2CKIA

Structure of ulilysin, a member of the pappalysin family of metzincin metalloendopeptidases.
Total Genus 82
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
82
sequence length
262
structure length
262
Chain Sequence
RMEIVKIPVVVHVVWNEEEENISDAQIQSQIDILNKDFRKLNSDVSQVPSVWSNLIADLGIEFFLATKDPNGNQTTGITRTQTSVTFFTTSDEVKFASSGGEDAWPADRYLNIWVCHVLKSEIGQDILGYAQFPGGPAETDGVVIVDAAFGTTGTALPPFDKGRTATHEIGHWLNLYHIWGDELRFEDPCSRSDEVDDTPNQADPNFGAPSYPHVSCSNGPNGDMFMNYMDYVDDKCMVMFTQGQATRVNACLDGPRSSFLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ULILYSIN
publication title Molecular Analysis of Ulilysin, the Structural Prototype of a New Family of Metzincin Metalloproteases.
pubmed doi rcsb
source organism Methanosarcina acetivorans
molecule tags Hydrolase
total genus 82
structure length 262
sequence length 262
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-04-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05572 Peptidase_M43 Pregnancy-associated plasma protein-A
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.390.10 Alpha Beta 3-Layer(aba) Sandwich Collagenase (Catalytic Domain) Collagenase (Catalytic Domain) 2ckiA00
4L6TA 2V4BA 3LUNA 4GR8A 1S4BP 3OHOA 5B5PA 2YIGA 2JSDA 2OW0A 1I73A 4GR3A 2EROA 1EB6A 2MZHA 4G0DA 1QJIA 1OO9A 3UVCA 3USNA 2QPJA 4A7BA 3K7NA 4I03A 2X3AA 2WO8A 1GO8P 3NX7A 4PKVA 1FM1A 3LJGA 3U1RA 2OVXA 1WNIA 2E3XA 4PKSA 2JT6A 3LK8A 2D1OA 1QIAA 3WV1A 1ROSA 456CA 2MZIA 1JIWP 3N2VA 4XCTA 1Q3AA 1UTZA 1SMPA 4H30A 2L0RA 4FXYP 4WKEA 4GQLA 4HMAA 4AIGA 4XM6A 2J83A 2XS4A 3LGPA 3O2XA 1Y8JA 3F1AA 3F17A 1IAAA 4EFSA 2PJTA 4H84A 4HX3A 1IAGA 3RTSA 1IAEA 1SLMA 1ZTQA 2OW1A 3HY7A 1EUBA 2WO9A 1QICA 3F19A 1BUVM 1QJJA 2DW1A 3ZVSA 3LIKA 4WK7A 1CGEA 5D7WA 4ZR5A 5BPAA 1G05A 4ON1A 1QIBA 3DSLA 2D1NA 5I43A 1PWQA 1KAPP 2W14A 3EWJA 1ZP5A 5B5OA 3KEJA 2MLRA 3EDIA 4Q1LA 3G42A 1JAOA 4IUWA 4L19A 4GWMA 1AF0A 4GWNA 4PKUA 1FLSA 2K2GA 4WZVA 2X3CA 3WV2A 4PKTA 2OVZA 1GO7P 1PWUA 5LABA 1MMPA 1OMJA 4XBHA 5D3CA 1MMBA 1R1IA 1HFCA 2DDYA 5D1TA 1A85A 1HV5A 3KWVC 1GE5A 3I7IA 1J7NA 1R1JA 4JP4A 3L0VA 4JQGA 1BZSA 4IN9A 1MNCA 1XFYA 3Q2HA 1XFVA 1R1HA 3HBVP 1KUKA 2DW2A 2ERPA 4JPAA 5CZMA 3TS4A 2K9CA 2X3BA 3N2UA 1D7XA 3KECA 4R3VA 3KMEA 1K7GA 4ILWD 3HBUP 4PKRA 1YP1A 1HTDA 1B3DA 2OZRA 5I3MA 3HY9A 1UTTA 5I2ZA 1MMRA 1R54A 4GF1A 1KUHA 4IJOA 1RMZA 3EDHA 3KEKA 3LUMA 4L63A 966CA 1IABA 3ZXHA 2JT5A 1Y93A 3P1VA 1D5JA 1D8MA 2DW0A 3KMCA 1ZVXA 1JJ9A 1A86A 3LJTA 3HDBA 1IADA 1PWVA 1G4KA 2JIHA 2MZEA 3EDZA 5CUHA 4CTHA 3ZUKA 4GUYA 3EHXA 1JANA 1GKCA 1I1IP 3LMCA 5I4OA 1XUCA 1I76A 2OI0A 3F16A 2RJQA 3LEAA 3LQBA 3HYGA 2MLSA 1KUFA 1FBLA 2W13A 1KBCA 4DV8A 4J4MA 2X7MA 1QUAA 1ND1A 1HOVA 3LIRA 2FV9A 5I12A 2Y6CA 3TT4A 3K7LA 1EAKA 3LE9A 4H82A 3RTTA 3VTGA 2KRJA 1AYKA 1AKLA 2W15A 1CXVA 3VI1A 4H3XA 4AYKA 1UMTA 1YCMA 3BA0A 5D1UA 3TSKA 1KUGA 1HFSA 1ATLA 4PKQA 2OXUA 2OXWA 3SHIA 3WV3A 3LILA 1D8FA 2HU6A 3DWBA 1USNA 1SATA 1OM8A 3B8ZA 1BSWA 1GE7A 1CGLA 5CXAA 1JAQA 1XUDA 4I35A 2WOAA 1XFUA 2Z2DA 1RM8A 2I47A 1OM6A 1O0QA 3GBOA 5H8XA 5D2BA 1GKDA 1BUDA 1JAPA 3I7GA 5L7FA 2OW2A 3ELMA 3AIGA 5JMYA 2YB9A 1JKYA 2OY2A 2E2DA 2OY4A 3G5CA 3LJZA 1YOUA 3O64A 2AIGP 1BM6A 2OXZA 3EDGA 3AYKA 4H49A 3MA2A 2USNA 2OW9A 1DTHA 3KHIA 1GXDA 1CGFA 1SU3A 2A8HA 2O36A 4WKIA 3F15A 1IACA 1CK7A 1Y0VA 1XFWA 1Z3JA 5I0LA 1R55A 2RJPA 3OHLA 1CAQA 3HDAP 3CKIA 1BKCA 4JA1A 4H1QA 1L6JA 1UMSA 1H71P 1ZXCA 1PWWA 3V96B 1ZS0A 5D1SA 1UEAA 1ASTA 1K7IA 1XFZA 4H76A 3KRYA 4FXQA 1HY7A 1CQRA 1ZXVA 1G9KA 1C8TA 3LQ0A 1B8YA 4PKWA 4QKZA 2FV5A 2Y6DA 2ERQA 5L79A 3HB2P 1BKCE 4H2EA 4XM7A 4DPEA 1BQQM 3LKAA 2SRTA 3TVCA 4WF6A 2O3EA 1OS2A 1OS9A 3B92A 2W12A 3B2ZA 1JIZA 1JK3A 2JNPA 2CLTA 3AYUA 2W0DA 1CIZA 1SLNA 2TCLA 3DPFA 1G49A 4JIJA 3DPEA 4AXQA 4XM8A 1G12A 1OM7A 1YQYA 3F18A 2N8RA 2DDFA 3Q2GA 1C3IA 4A3WA 1K7QA 3DL1A 3DNGA 3L0TA 4FU4A 1JH1A 1BQOA 1MMQA 1BIWA 1O0TA 1XURA 4DD8A 1C7KA 5BOYA 4FVLA 5BOTA 4GR0A 1SRPA 1BKCI 4AUOA 2CKIA 4G9LA 3E8RA 1DMTA 1PWPA 2POJA 1GE6A 2AYKA 830CA 3EHYA 1KUIA 2J0TA 3P24A 1XFXA 4DF9A 2XS3A
chains in the Genus database with same CATH superfamily
4L6TA 2V4BA 3LUNA 4GR8A 1S4BP 3OHOA 5B5PA 2YIGA 2JSDA 2OW0A 3DTKA 1I73A 4GR3A 2EROA 1EB6A 2MZHA 4G0DA 1QJIA 1OO9A 3UVCA 3USNA 2QPJA 4A7BA 3K7NA 4I03A 2X3AA 2WO8A 1GO8P 3NX7A 4PKVA 1FM1A 3LJGA 3U1RA 2OVXA 1WNIA 2E3XA 4PKSA 2JT6A 3LK8A 2D1OA 1QIAA 3WV1A 1ROSA 456CA 2MZIA 1JIWP 3N2VA 4XCTA 1Q3AA 1UTZA 1SMPA 4H30A 2L0RA 4FXYP 4WKEA 4GQLA 4HMAA 4AIGA 4XM6A 2J83A 2XS4A 3LGPA 3O2XA 1Y8JA 3F1AA 3F17A 1IAAA 4EFSA 2PJTA 4H84A 4HX3A 1IAGA 3RTSA 1IAEA 1SLMA 1ZTQA 2OW1A 3HY7A 1EUBA 2WO9A 1QICA 3F19A 1BUVM 1QJJA 2DW1A 3ZVSA 3LIKA 4WK7A 1CGEA 5D7WA 4ZR5A 5BPAA 1G05A 4ON1A 1QIBA 3DSLA 2D1NA 5I43A 1XAXA 1PWQA 1KAPP 2W14A 3EWJA 1ZP5A 5B5OA 3KEJA 2MLRA 3EDIA 4Q1LA 3G42A 1JAOA 4IUWA 4L19A 4GWMA 1AF0A 4GWNA 4PKUA 1FLSA 2K2GA 4WZVA 2X3CA 3WV2A 4PKTA 2OVZA 1GO7P 1PWUA 5LABA 1MMPA 1OMJA 4XBHA 5D3CA 1MMBA 1R1IA 1HFCA 2DDYA 5D1TA 1A85A 1HV5A 3KWVC 1GE5A 3I7IA 1J7NA 1R1JA 4JP4A 3L0VA 4JQGA 1BZSA 4IN9A 1MNCA 1XFYA 3Q2HA 1XFVA 1R1HA 3HBVP 1KUKA 2DW2A 2ERPA 4JPAA 5CZMA 3TS4A 2K9CA 2X3BA 3N2UA 1D7XA 3KECA 4R3VA 3KMEA 1K7GA 4ILWD 3HBUP 4PKRA 1YP1A 1HTDA 1B3DA 2OZRA 5I3MA 3HY9A 1UTTA 5I2ZA 1MMRA 1R54A 4GF1A 1KUHA 4IJOA 1RMZA 3EDHA 3KEKA 3LUMA 4L63A 966CA 1IABA 3ZXHA 2JT5A 1Y93A 3P1VA 1D5JA 1OZ9A 1D8MA 2DW0A 3KMCA 1ZVXA 1JJ9A 1A86A 3LJTA 3HDBA 1IADA 1PWVA 1G4KA 2JIHA 2MZEA 3EDZA 5CUHA 4CTHA 3ZUKA 4GUYA 3EHXA 1JANA 1GKCA 1I1IP 3LMCA 5I4OA 1XUCA 1I76A 2OI0A 3F16A 2RJQA 3LEAA 3LQBA 3HYGA 2MLSA 1KUFA 1FBLA 2W13A 1KBCA 4DV8A 4J4MA 2X7MA 1QUAA 1ND1A 1HOVA 3LIRA 2FV9A 5I12A 2Y6CA 3TT4A 3K7LA 1EAKA 3LE9A 4H82A 3RTTA 3VTGA 2KRJA 1AYKA 1AKLA 2W15A 1CXVA 3VI1A 4H3XA 3DTIA 4AYKA 1UMTA 1YCMA 3BA0A 5D1UA 3TSKA 1KUGA 1HFSA 1ATLA 4PKQA 2OXUA 2OXWA 3SHIA 3WV3A 3LILA 1D8FA 2HU6A 3DWBA 1USNA 1SATA 1OM8A 3B8ZA 1BSWA 1GE7A 1CGLA 1TVIA 1JAQA 1XUDA 4I35A 5CXAA 2WOAA 1XFUA 2Z2DA 1RM8A 2I47A 1OM6A 1O0QA 3GBOA 5H8XA 5D2BA 1GKDA 1BUDA 1JAPA 3I7GA 5L7FA 2OW2A 3ELMA 3AIGA 5JMYA 2YB9A 1JKYA 2OY2A 2E2DA 2OY4A 3G5CA 3LJZA 1YOUA 3O64A 2AIGP 1BM6A 2OXZA 3EDGA 3AYKA 4H49A 3MA2A 2USNA 2OW9A 1DTHA 3KHIA 4L7AA 1GXDA 1CGFA 1SU3A 2A8HA 2O36A 4WKIA 3F15A 1IACA 1CK7A 1Y0VA 1XFWA 1Z3JA 5I0LA 1R55A 2RJPA 3OHLA 1CAQA 3HDAP 3CKIA 1BKCA 4JA1A 4H1QA 1L6JA 1UMSA 1H71P 1ZXCA 1PWWA 3V96B 1ZS0A 5D1SA 1UEAA 1ASTA 1K7IA 1XFZA 4H76A 3KRYA 4FXQA 1HY7A 1CQRA 1ZXVA 1G9KA 1C8TA 3LQ0A 1B8YA 4PKWA 4QKZA 2FV5A 2Y6DA 2ERQA 5L79A 3HB2P 1BKCE 4H2EA 4XM7A 4DPEA 1BQQM 3LKAA 2SRTA 3TVCA 4WF6A 2O3EA 1OS2A 1OS9A 3B92A 3DTEA 2W12A 3B2ZA 1JIZA 1JK3A 2JNPA 2CLTA 3AYUA 2W0DA 1CIZA 1SLNA 2TCLA 3DPFA 1G49A 4JIJA 3DPEA 4AXQA 4XM8A 1G12A 1OM7A 1YQYA 3F18A 2N8RA 2DDFA 3Q2GA 1C3IA 4A3WA 1K7QA 3DL1A 3DNGA 3L0TA 4FU4A 1JH1A 1BQOA 1MMQA 2YUFA 1BIWA 1XM5A 1O0TA 1XURA 4DD8A 1C7KA 5BOYA 4FVLA 5BOTA 4GR0A 1SRPA 1BKCI 4AUOA 2CKIA 4G9LA 3E8RA 1DMTA 1PWPA 2POJA 1GE6A 2AYKA 830CA 3EHYA 1KUIA 2J0TA 3P24A 1XFXA 4DF9A 2XS3A
chains in the Genus database with same CATH topology
4L6TA 2V4BA 3LUNA 4GR8A 1S4BP 3OHOA 5B5PA 2YIGA 2JSDA 2OW0A 3DTKA 1I73A 4GR3A 2EROA 1EB6A 2MZHA 4G0DA 1QJIA 1OO9A 3UVCA 3USNA 2QPJA 4A7BA 3K7NA 4I03A 2X3AA 2WO8A 1GO8P 3NX7A 4PKVA 1FM1A 3LJGA 3U1RA 2OVXA 1WNIA 2E3XA 4PKSA 2JT6A 3LK8A 2D1OA 1QIAA 3WV1A 1ROSA 456CA 2MZIA 1JIWP 3N2VA 4XCTA 1Q3AA 1UTZA 1SMPA 4H30A 2L0RA 4FXYP 4WKEA 4GQLA 4HMAA 4AIGA 4XM6A 2J83A 2XS4A 3LGPA 3O2XA 1Y8JA 3F1AA 3F17A 1IAAA 4EFSA 2PJTA 4H84A 4HX3A 1IAGA 3RTSA 1IAEA 1SLMA 1ZTQA 2OW1A 3HY7A 1EUBA 2WO9A 1QICA 3F19A 1BUVM 1QJJA 2DW1A 3ZVSA 3LIKA 4WK7A 1CGEA 5D7WA 4ZR5A 5BPAA 1G05A 4ON1A 1QIBA 3DSLA 2D1NA 5I43A 1PWQA 1KAPP 2W14A 3EWJA 1ZP5A 5B5OA 3KEJA 2MLRA 3EDIA 4Q1LA 3G42A 1JAOA 4IUWA 4L19A 4GWMA 1AF0A 4GWNA 4PKUA 1FLSA 2K2GA 4WZVA 2X3CA 3WV2A 4PKTA 2OVZA 1GO7P 1PWUA 5LABA 1MMPA 1OMJA 4XBHA 5D3CA 1MMBA 1R1IA 1HFCA 2DDYA 5D1TA 1A85A 1HV5A 3KWVC 1GE5A 3I7IA 1J7NA 1R1JA 4JP4A 3L0VA 4JQGA 1BZSA 4IN9A 1MNCA 1XFYA 3Q2HA 1XFVA 1R1HA 3HBVP 1KUKA 2DW2A 2ERPA 4JPAA 5CZMA 3TS4A 2K9CA 2X3BA 3N2UA 1D7XA 3KECA 4R3VA 3KMEA 1K7GA 4ILWD 3HBUP 4PKRA 1YP1A 1HTDA 1B3DA 2OZRA 5I3MA 3HY9A 1UTTA 5I2ZA 1MMRA 1R54A 4GF1A 1KUHA 4IJOA 1RMZA 3EDHA 3KEKA 3LUMA 4L63A 966CA 1IABA 3ZXHA 2JT5A 1Y93A 3P1VA 1D5JA 1D8MA 2DW0A 3KMCA 1ZVXA 1JJ9A 1A86A 3LJTA 3HDBA 1IADA 1PWVA 1G4KA 2JIHA 2MZEA 3EDZA 5CUHA 4CTHA 3ZUKA 4GUYA 3EHXA 1JANA 1GKCA 1I1IP 3LMCA 5I4OA 1XUCA 1I76A 2OI0A 3F16A 2RJQA 3LEAA 3LQBA 3HYGA 2MLSA 1KUFA 1FBLA 2W13A 1KBCA 4DV8A 4J4MA 2X7MA 1QUAA 1ND1A 1HOVA 3LIRA 2FV9A 5I12A 2Y6CA 3TT4A 3K7LA 1EAKA 3LE9A 4H82A 3RTTA 3VTGA 2KRJA 1AYKA 1AKLA 2W15A 1CXVA 3VI1A 4H3XA 3DTIA 4AYKA 1UMTA 1YCMA 3BA0A 5D1UA 3TSKA 1KUGA 1HFSA 1ATLA 4PKQA 2OXUA 2OXWA 3SHIA 3WV3A 3LILA 1D8FA 2HU6A 3DWBA 1USNA 1SATA 1OM8A 3B8ZA 1BSWA 1GE7A 1CGLA 5CXAA 1JAQA 1XUDA 4I35A 2WOAA 1XFUA 2Z2DA 1RM8A 2I47A 1OM6A 1O0QA 3GBOA 5H8XA 5D2BA 1GKDA 1BUDA 1JAPA 3I7GA 5L7FA 2OW2A 3ELMA 3AIGA 5JMYA 2YB9A 1JKYA 2OY2A 2E2DA 2OY4A 3G5CA 3LJZA 1YOUA 3O64A 2AIGP 1BM6A 2OXZA 3EDGA 3AYKA 4H49A 3MA2A 2USNA 2OW9A 1DTHA 3KHIA 4L7AA 1GXDA 1CGFA 1SU3A 2A8HA 2O36A 4WKIA 3F15A 1IACA 1CK7A 1Y0VA 1XFWA 1Z3JA 5I0LA 1R55A 2RJPA 3OHLA 1CAQA 3HDAP 3CKIA 1BKCA 4JA1A 4H1QA 1L6JA 1UMSA 1H71P 1ZXCA 1PWWA 3V96B 1ZS0A 5D1SA 1UEAA 1ASTA 1K7IA 1XFZA 4H76A 3KRYA 4FXQA 1HY7A 1CQRA 1ZXVA 1G9KA 1C8TA 3LQ0A 1B8YA 4PKWA 4QKZA 2FV5A 2Y6DA 2ERQA 5L79A 3HB2P 1BKCE 4H2EA 4XM7A 4DPEA 1BQQM 3LKAA 2SRTA 3TVCA 4WF6A 2O3EA 1OS2A 1OS9A 3B92A 3DTEA 2W12A 3B2ZA 1JIZA 1JK3A 2JNPA 2CLTA 3AYUA 2W0DA 1CIZA 1SLNA 2TCLA 3DPFA 1G49A 4JIJA 3DPEA 4AXQA 4XM8A 1G12A 1OM7A 1YQYA 3F18A 2N8RA 2DDFA 3Q2GA 1C3IA 4A3WA 1K7QA 3DL1A 3DNGA 3L0TA 4FU4A 1JH1A 1BQOA 1MMQA 2YUFA 1BIWA 1O0TA 1XURA 4DD8A 1C7KA 5BOYA 4FVLA 5BOTA 4GR0A 1SRPA 1BKCI 4AUOA 2CKIA 4G9LA 3E8RA 1DMTA 1PWPA 2POJA 1GE6A 2AYKA 830CA 3EHYA 1KUIA 2J0TA 3P24A 1XFXA 4DF9A 2XS3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4L6T A;  2V4B A;  3LUN A;  4GR8 A;  1S4B P;  3OHO A;  5B5P A;  2YIG A;  2JSD A;  2OW0 A;  1I73 A;  4GR3 A;  2ERO A;  1EB6 A;  2MZH A;  4G0D A;  1QJI A;  1OO9 A;  3UVC A;  3USN A;  2QPJ A;  4A7B A;  3K7N A;  4I03 A;  2X3A A;  2WO8 A;  1GO8 P;  3NX7 A;  4PKV A;  1FM1 A;  3LJG A;  3U1R A;  2OVX A;  1WNI A;  2E3X A;  4PKS A;  2JT6 A;  3LK8 A;  2D1O A;  1QIA A;  3WV1 A;  1ROS A;  456C A;  2MZI A;  1JIW P;  3N2V A;  4XCT A;  1Q3A A;  1UTZ A;  1SMP A;  4H30 A;  2L0R A;  4FXY P;  4WKE A;  4GQL A;  4HMA A;  4AIG A;  4XM6 A;  2J83 A;  2XS4 A;  3LGP A;  3O2X A;  1Y8J A;  3F1A A;  3F17 A;  1IAA A;  4EFS A;  2PJT A;  4H84 A;  4HX3 A;  1IAG A;  3RTS A;  1IAE A;  1SLM A;  1ZTQ A;  2OW1 A;  3HY7 A;  1EUB A;  2WO9 A;  1QIC A;  3F19 A;  1BUV M;  1QJJ A;  2DW1 A;  3ZVS A;  3LIK A;  4WK7 A;  1CGE A;  5D7W A;  4ZR5 A;  5BPA A;  1G05 A;  4ON1 A;  1QIB A;  3DSL A;  2D1N A;  5I43 A;  1PWQ A;  1KAP P;  2W14 A;  3EWJ A;  1ZP5 A;  5B5O A;  3KEJ A;  2MLR A;  3EDI A;  4Q1L A;  3G42 A;  1JAO A;  4IUW A;  4L19 A;  4GWM A;  1AF0 A;  4GWN A;  4PKU A;  1FLS A;  2K2G A;  4WZV A;  2X3C A;  3WV2 A;  4PKT A;  2OVZ A;  1GO7 P;  1PWU A;  5LAB A;  1MMP A;  1OMJ A;  4XBH A;  5D3C A;  1MMB A;  1R1I A;  1HFC A;  2DDY A;  5D1T A;  1A85 A;  1HV5 A;  3KWV C;  1GE5 A;  3I7I A;  1J7N A;  1R1J A;  4JP4 A;  3L0V A;  4JQG A;  1BZS A;  4IN9 A;  1MNC A;  1XFY A;  3Q2H A;  1XFV A;  1R1H A;  3HBV P;  1KUK A;  2DW2 A;  2ERP A;  4JPA A;  5CZM A;  3TS4 A;  2K9C A;  2X3B A;  3N2U A;  1D7X A;  3KEC A;  4R3V A;  3KME A;  1K7G A;  4ILW D;  3HBU P;  4PKR A;  1YP1 A;  1HTD A;  1B3D A;  2OZR A;  5I3M A;  3HY9 A;  1UTT A;  5I2Z A;  1MMR A;  1R54 A;  4GF1 A;  1KUH A;  4IJO A;  1RMZ A;  3EDH A;  3KEK A;  3LUM A;  4L63 A;  966C A;  1IAB A;  3ZXH A;  2JT5 A;  1Y93 A;  3P1V A;  1D5J A;  1D8M A;  2DW0 A;  3KMC A;  1ZVX A;  1JJ9 A;  1A86 A;  3LJT A;  3HDB A;  1IAD A;  1PWV A;  1G4K A;  2JIH A;  2MZE A;  3EDZ A;  5CUH A;  4CTH A;  3ZUK A;  4GUY A;  3EHX A;  1JAN A;  1GKC A;  1I1I P;  3LMC A;  5I4O A;  1XUC A;  1I76 A;  2OI0 A;  3F16 A;  2RJQ A;  3LEA A;  3LQB A;  3HYG A;  2MLS A;  1KUF A;  1FBL A;  2W13 A;  1KBC A;  4DV8 A;  4J4M A;  2X7M A;  1QUA A;  1ND1 A;  1HOV A;  3LIR A;  2FV9 A;  5I12 A;  2Y6C A;  3TT4 A;  3K7L A;  1EAK A;  3LE9 A;  4H82 A;  3RTT A;  3VTG A;  2KRJ A;  1AYK A;  1AKL A;  2W15 A;  1CXV A;  3VI1 A;  4H3X A;  4AYK A;  1UMT A;  1YCM A;  3BA0 A;  5D1U A;  3TSK A;  1KUG A;  1HFS A;  1ATL A;  4PKQ A;  2OXU A;  2OXW A;  3SHI A;  3WV3 A;  3LIL A;  1D8F A;  2HU6 A;  3DWB A;  1USN A;  1SAT A;  1OM8 A;  3B8Z A;  1BSW A;  1GE7 A;  1CGL A;  5CXA A;  1JAQ A;  1XUD A;  4I35 A;  2WOA A;  1XFU A;  2Z2D A;  1RM8 A;  2I47 A;  1OM6 A;  1O0Q A;  3GBO A;  5H8X A;  5D2B A;  1GKD A;  1BUD A;  1JAP A;  3I7G A;  5L7F A;  2OW2 A;  3ELM A;  3AIG A;  5JMY A;  2YB9 A;  1JKY A;  2OY2 A;  2E2D A;  2OY4 A;  3G5C A;  3LJZ A;  1YOU A;  3O64 A;  2AIG P;  1BM6 A;  2OXZ A;  3EDG A;  3AYK A;  4H49 A;  3MA2 A;  2USN A;  2OW9 A;  1DTH A;  3KHI A;  1GXD A;  1CGF A;  1SU3 A;  2A8H A;  2O36 A;  4WKI A;  3F15 A;  1IAC A;  1CK7 A;  1Y0V A;  1XFW A;  1Z3J A;  5I0L A;  1R55 A;  2RJP A;  3OHL A;  1CAQ A;  3HDA P;  3CKI A;  1BKC A;  4JA1 A;  4H1Q A;  1L6J A;  1UMS A;  1H71 P;  1ZXC A;  1PWW A;  3V96 B;  1ZS0 A;  5D1S A;  1UEA A;  1AST A;  1K7I A;  1XFZ A;  4H76 A;  3KRY A;  4FXQ A;  1HY7 A;  1CQR A;  1ZXV A;  1G9K A;  1C8T A;  3LQ0 A;  1B8Y A;  4PKW A;  4QKZ A;  2FV5 A;  2Y6D A;  2ERQ A;  5L79 A;  3HB2 P;  1BKC E;  4H2E A;  4XM7 A;  4DPE A;  1BQQ M;  3LKA A;  2SRT A;  3TVC A;  4WF6 A;  2O3E A;  1OS2 A;  1OS9 A;  3B92 A;  2W12 A;  3B2Z A;  1JIZ A;  1JK3 A;  2JNP A;  2CLT A;  3AYU A;  2W0D A;  1CIZ A;  1SLN A;  2TCL A;  3DPF A;  1G49 A;  4JIJ A;  3DPE A;  4AXQ A;  4XM8 A;  1G12 A;  1OM7 A;  1YQY A;  3F18 A;  2N8R A;  2DDF A;  3Q2G A;  1C3I A;  4A3W A;  1K7Q A;  3DL1 A;  3DNG A;  3L0T A;  4FU4 A;  1JH1 A;  1BQO A;  1MMQ A;  1BIW A;  1O0T A;  1XUR A;  4DD8 A;  1C7K A;  5BOY A;  4FVL A;  5BOT A;  4GR0 A;  1SRP A;  1BKC I;  4AUO A;  2CKI A;  4G9L A;  3E8R A;  1DMT A;  1PWP A;  2POJ A;  1GE6 A;  2AYK A;  830C A;  3EHY A;  1KUI A;  2J0T A;  3P24 A;  1XFX A;  4DF9 A;  2XS3 A; 
#chains in the Genus database with same CATH topology
 4L6T A;  2V4B A;  3LUN A;  4GR8 A;  1S4B P;  3OHO A;  5B5P A;  2YIG A;  2JSD A;  2OW0 A;  3DTK A;  1I73 A;  4GR3 A;  2ERO A;  1EB6 A;  2MZH A;  4G0D A;  1QJI A;  1OO9 A;  3UVC A;  3USN A;  2QPJ A;  4A7B A;  3K7N A;  4I03 A;  2X3A A;  2WO8 A;  1GO8 P;  3NX7 A;  4PKV A;  1FM1 A;  3LJG A;  3U1R A;  2OVX A;  1WNI A;  2E3X A;  4PKS A;  2JT6 A;  3LK8 A;  2D1O A;  1QIA A;  3WV1 A;  1ROS A;  456C A;  2MZI A;  1JIW P;  3N2V A;  4XCT A;  1Q3A A;  1UTZ A;  1SMP A;  4H30 A;  2L0R A;  4FXY P;  4WKE A;  4GQL A;  4HMA A;  4AIG A;  4XM6 A;  2J83 A;  2XS4 A;  3LGP A;  3O2X A;  1Y8J A;  3F1A A;  3F17 A;  1IAA A;  4EFS A;  2PJT A;  4H84 A;  4HX3 A;  1IAG A;  3RTS A;  1IAE A;  1SLM A;  1ZTQ A;  2OW1 A;  3HY7 A;  1EUB A;  2WO9 A;  1QIC A;  3F19 A;  1BUV M;  1QJJ A;  2DW1 A;  3ZVS A;  3LIK A;  4WK7 A;  1CGE A;  5D7W A;  4ZR5 A;  5BPA A;  1G05 A;  4ON1 A;  1QIB A;  3DSL A;  2D1N A;  5I43 A;  1XAX A;  1PWQ A;  1KAP P;  2W14 A;  3EWJ A;  1ZP5 A;  5B5O A;  3KEJ A;  2MLR A;  3EDI A;  4Q1L A;  3G42 A;  1JAO A;  4IUW A;  4L19 A;  4GWM A;  1AF0 A;  4GWN A;  4PKU A;  1FLS A;  2K2G A;  4WZV A;  2X3C A;  3WV2 A;  4PKT A;  2OVZ A;  1GO7 P;  1PWU A;  5LAB A;  1MMP A;  1OMJ A;  4XBH A;  5D3C A;  1MMB A;  1R1I A;  1HFC A;  2DDY A;  5D1T A;  1A85 A;  1HV5 A;  3KWV C;  1GE5 A;  3I7I A;  1J7N A;  1R1J A;  4JP4 A;  3L0V A;  4JQG A;  1BZS A;  4IN9 A;  1MNC A;  1XFY A;  3Q2H A;  1XFV A;  1R1H A;  3HBV P;  1KUK A;  2DW2 A;  2ERP A;  4JPA A;  5CZM A;  3TS4 A;  2K9C A;  2X3B A;  3N2U A;  1D7X A;  3KEC A;  4R3V A;  3KME A;  1K7G A;  4ILW D;  3HBU P;  4PKR A;  1YP1 A;  1HTD A;  1B3D A;  2OZR A;  5I3M A;  3HY9 A;  1UTT A;  5I2Z A;  1MMR A;  1R54 A;  4GF1 A;  1KUH A;  4IJO A;  1RMZ A;  3EDH A;  3KEK A;  3LUM A;  4L63 A;  966C A;  1IAB A;  3ZXH A;  2JT5 A;  1Y93 A;  3P1V A;  1D5J A;  1OZ9 A;  1D8M A;  2DW0 A;  3KMC A;  1ZVX A;  1JJ9 A;  1A86 A;  3LJT A;  3HDB A;  1IAD A;  1PWV A;  1G4K A;  2JIH A;  2MZE A;  3EDZ A;  5CUH A;  4CTH A;  3ZUK A;  4GUY A;  3EHX A;  1JAN A;  1GKC A;  1I1I P;  3LMC A;  5I4O A;  1XUC A;  1I76 A;  2OI0 A;  3F16 A;  2RJQ A;  3LEA A;  3LQB A;  3HYG A;  2MLS A;  1KUF A;  1FBL A;  2W13 A;  1KBC A;  4DV8 A;  4J4M A;  2X7M A;  1QUA A;  1ND1 A;  1HOV A;  3LIR A;  2FV9 A;  5I12 A;  2Y6C A;  3TT4 A;  3K7L A;  1EAK A;  3LE9 A;  4H82 A;  3RTT A;  3VTG A;  2KRJ A;  1AYK A;  1AKL A;  2W15 A;  1CXV A;  3VI1 A;  4H3X A;  3DTI A;  4AYK A;  1UMT A;  1YCM A;  3BA0 A;  5D1U A;  3TSK A;  1KUG A;  1HFS A;  1ATL A;  4PKQ A;  2OXU A;  2OXW A;  3SHI A;  3WV3 A;  3LIL A;  1D8F A;  2HU6 A;  3DWB A;  1USN A;  1SAT A;  1OM8 A;  3B8Z A;  1BSW A;  1GE7 A;  1CGL A;  1TVI A;  1JAQ A;  1XUD A;  4I35 A;  5CXA A;  2WOA A;  1XFU A;  2Z2D A;  1RM8 A;  2I47 A;  1OM6 A;  1O0Q A;  3GBO A;  5H8X A;  5D2B A;  1GKD A;  1BUD A;  1JAP A;  3I7G A;  5L7F A;  2OW2 A;  3ELM A;  3AIG A;  5JMY A;  2YB9 A;  1JKY A;  2OY2 A;  2E2D A;  2OY4 A;  3G5C A;  3LJZ A;  1YOU A;  3O64 A;  2AIG P;  1BM6 A;  2OXZ A;  3EDG A;  3AYK A;  4H49 A;  3MA2 A;  2USN A;  2OW9 A;  1DTH A;  3KHI A;  4L7A A;  1GXD A;  1CGF A;  1SU3 A;  2A8H A;  2O36 A;  4WKI A;  3F15 A;  1IAC A;  1CK7 A;  1Y0V A;  1XFW A;  1Z3J A;  5I0L A;  1R55 A;  2RJP A;  3OHL A;  1CAQ A;  3HDA P;  3CKI A;  1BKC A;  4JA1 A;  4H1Q A;  1L6J A;  1UMS A;  1H71 P;  1ZXC A;  1PWW A;  3V96 B;  1ZS0 A;  5D1S A;  1UEA A;  1AST A;  1K7I A;  1XFZ A;  4H76 A;  3KRY A;  4FXQ A;  1HY7 A;  1CQR A;  1ZXV A;  1G9K A;  1C8T A;  3LQ0 A;  1B8Y A;  4PKW A;  4QKZ A;  2FV5 A;  2Y6D A;  2ERQ A;  5L79 A;  3HB2 P;  1BKC E;  4H2E A;  4XM7 A;  4DPE A;  1BQQ M;  3LKA A;  2SRT A;  3TVC A;  4WF6 A;  2O3E A;  1OS2 A;  1OS9 A;  3B92 A;  3DTE A;  2W12 A;  3B2Z A;  1JIZ A;  1JK3 A;  2JNP A;  2CLT A;  3AYU A;  2W0D A;  1CIZ A;  1SLN A;  2TCL A;  3DPF A;  1G49 A;  4JIJ A;  3DPE A;  4AXQ A;  4XM8 A;  1G12 A;  1OM7 A;  1YQY A;  3F18 A;  2N8R A;  2DDF A;  3Q2G A;  1C3I A;  4A3W A;  1K7Q A;  3DL1 A;  3DNG A;  3L0T A;  4FU4 A;  1JH1 A;  1BQO A;  1MMQ A;  2YUF A;  1BIW A;  1XM5 A;  1O0T A;  1XUR A;  4DD8 A;  1C7K A;  5BOY A;  4FVL A;  5BOT A;  4GR0 A;  1SRP A;  1BKC I;  4AUO A;  2CKI A;  4G9L A;  3E8R A;  1DMT A;  1PWP A;  2POJ A;  1GE6 A;  2AYK A;  830C A;  3EHY A;  1KUI A;  2J0T A;  3P24 A;  1XFX A;  4DF9 A;  2XS3 A; 
#chains in the Genus database with same CATH homology
 4L6T A;  2V4B A;  3LUN A;  4GR8 A;  1S4B P;  3OHO A;  5B5P A;  2YIG A;  2JSD A;  2OW0 A;  3DTK A;  1I73 A;  4GR3 A;  2ERO A;  1EB6 A;  2MZH A;  4G0D A;  1QJI A;  1OO9 A;  3UVC A;  3USN A;  2QPJ A;  4A7B A;  3K7N A;  4I03 A;  2X3A A;  2WO8 A;  1GO8 P;  3NX7 A;  4PKV A;  1FM1 A;  3LJG A;  3U1R A;  2OVX A;  1WNI A;  2E3X A;  4PKS A;  2JT6 A;  3LK8 A;  2D1O A;  1QIA A;  3WV1 A;  1ROS A;  456C A;  2MZI A;  1JIW P;  3N2V A;  4XCT A;  1Q3A A;  1UTZ A;  1SMP A;  4H30 A;  2L0R A;  4FXY P;  4WKE A;  4GQL A;  4HMA A;  4AIG A;  4XM6 A;  2J83 A;  2XS4 A;  3LGP A;  3O2X A;  1Y8J A;  3F1A A;  3F17 A;  1IAA A;  4EFS A;  2PJT A;  4H84 A;  4HX3 A;  1IAG A;  3RTS A;  1IAE A;  1SLM A;  1ZTQ A;  2OW1 A;  3HY7 A;  1EUB A;  2WO9 A;  1QIC A;  3F19 A;  1BUV M;  1QJJ A;  2DW1 A;  3ZVS A;  3LIK A;  4WK7 A;  1CGE A;  5D7W A;  4ZR5 A;  5BPA A;  1G05 A;  4ON1 A;  1QIB A;  3DSL A;  2D1N A;  5I43 A;  1PWQ A;  1KAP P;  2W14 A;  3EWJ A;  1ZP5 A;  5B5O A;  3KEJ A;  2MLR A;  3EDI A;  4Q1L A;  3G42 A;  1JAO A;  4IUW A;  4L19 A;  4GWM A;  1AF0 A;  4GWN A;  4PKU A;  1FLS A;  2K2G A;  4WZV A;  2X3C A;  3WV2 A;  4PKT A;  2OVZ A;  1GO7 P;  1PWU A;  5LAB A;  1MMP A;  1OMJ A;  4XBH A;  5D3C A;  1MMB A;  1R1I A;  1HFC A;  2DDY A;  5D1T A;  1A85 A;  1HV5 A;  3KWV C;  1GE5 A;  3I7I A;  1J7N A;  1R1J A;  4JP4 A;  3L0V A;  4JQG A;  1BZS A;  4IN9 A;  1MNC A;  1XFY A;  3Q2H A;  1XFV A;  1R1H A;  3HBV P;  1KUK A;  2DW2 A;  2ERP A;  4JPA A;  5CZM A;  3TS4 A;  2K9C A;  2X3B A;  3N2U A;  1D7X A;  3KEC A;  4R3V A;  3KME A;  1K7G A;  4ILW D;  3HBU P;  4PKR A;  1YP1 A;  1HTD A;  1B3D A;  2OZR A;  5I3M A;  3HY9 A;  1UTT A;  5I2Z A;  1MMR A;  1R54 A;  4GF1 A;  1KUH A;  4IJO A;  1RMZ A;  3EDH A;  3KEK A;  3LUM A;  4L63 A;  966C A;  1IAB A;  3ZXH A;  2JT5 A;  1Y93 A;  3P1V A;  1D5J A;  1D8M A;  2DW0 A;  3KMC A;  1ZVX A;  1JJ9 A;  1A86 A;  3LJT A;  3HDB A;  1IAD A;  1PWV A;  1G4K A;  2JIH A;  2MZE A;  3EDZ A;  5CUH A;  4CTH A;  3ZUK A;  4GUY A;  3EHX A;  1JAN A;  1GKC A;  1I1I P;  3LMC A;  5I4O A;  1XUC A;  1I76 A;  2OI0 A;  3F16 A;  2RJQ A;  3LEA A;  3LQB A;  3HYG A;  2MLS A;  1KUF A;  1FBL A;  2W13 A;  1KBC A;  4DV8 A;  4J4M A;  2X7M A;  1QUA A;  1ND1 A;  1HOV A;  3LIR A;  2FV9 A;  5I12 A;  2Y6C A;  3TT4 A;  3K7L A;  1EAK A;  3LE9 A;  4H82 A;  3RTT A;  3VTG A;  2KRJ A;  1AYK A;  1AKL A;  2W15 A;  1CXV A;  3VI1 A;  4H3X A;  3DTI A;  4AYK A;  1UMT A;  1YCM A;  3BA0 A;  5D1U A;  3TSK A;  1KUG A;  1HFS A;  1ATL A;  4PKQ A;  2OXU A;  2OXW A;  3SHI A;  3WV3 A;  3LIL A;  1D8F A;  2HU6 A;  3DWB A;  1USN A;  1SAT A;  1OM8 A;  3B8Z A;  1BSW A;  1GE7 A;  1CGL A;  5CXA A;  1JAQ A;  1XUD A;  4I35 A;  2WOA A;  1XFU A;  2Z2D A;  1RM8 A;  2I47 A;  1OM6 A;  1O0Q A;  3GBO A;  5H8X A;  5D2B A;  1GKD A;  1BUD A;  1JAP A;  3I7G A;  5L7F A;  2OW2 A;  3ELM A;  3AIG A;  5JMY A;  2YB9 A;  1JKY A;  2OY2 A;  2E2D A;  2OY4 A;  3G5C A;  3LJZ A;  1YOU A;  3O64 A;  2AIG P;  1BM6 A;  2OXZ A;  3EDG A;  3AYK A;  4H49 A;  3MA2 A;  2USN A;  2OW9 A;  1DTH A;  3KHI A;  4L7A A;  1GXD A;  1CGF A;  1SU3 A;  2A8H A;  2O36 A;  4WKI A;  3F15 A;  1IAC A;  1CK7 A;  1Y0V A;  1XFW A;  1Z3J A;  5I0L A;  1R55 A;  2RJP A;  3OHL A;  1CAQ A;  3HDA P;  3CKI A;  1BKC A;  4JA1 A;  4H1Q A;  1L6J A;  1UMS A;  1H71 P;  1ZXC A;  1PWW A;  3V96 B;  1ZS0 A;  5D1S A;  1UEA A;  1AST A;  1K7I A;  1XFZ A;  4H76 A;  3KRY A;  4FXQ A;  1HY7 A;  1CQR A;  1ZXV A;  1G9K A;  1C8T A;  3LQ0 A;  1B8Y A;  4PKW A;  4QKZ A;  2FV5 A;  2Y6D A;  2ERQ A;  5L79 A;  3HB2 P;  1BKC E;  4H2E A;  4XM7 A;  4DPE A;  1BQQ M;  3LKA A;  2SRT A;  3TVC A;  4WF6 A;  2O3E A;  1OS2 A;  1OS9 A;  3B92 A;  3DTE A;  2W12 A;  3B2Z A;  1JIZ A;  1JK3 A;  2JNP A;  2CLT A;  3AYU A;  2W0D A;  1CIZ A;  1SLN A;  2TCL A;  3DPF A;  1G49 A;  4JIJ A;  3DPE A;  4AXQ A;  4XM8 A;  1G12 A;  1OM7 A;  1YQY A;  3F18 A;  2N8R A;  2DDF A;  3Q2G A;  1C3I A;  4A3W A;  1K7Q A;  3DL1 A;  3DNG A;  3L0T A;  4FU4 A;  1JH1 A;  1BQO A;  1MMQ A;  2YUF A;  1BIW A;  1O0T A;  1XUR A;  4DD8 A;  1C7K A;  5BOY A;  4FVL A;  5BOT A;  4GR0 A;  1SRP A;  1BKC I;  4AUO A;  2CKI A;  4G9L A;  3E8R A;  1DMT A;  1PWP A;  2POJ A;  1GE6 A;  2AYK A;  830C A;  3EHY A;  1KUI A;  2J0T A;  3P24 A;  1XFX A;  4DF9 A;  2XS3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...