2CKUA

Solution structure of 2f13f1 from human fibronectin
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
89
structure length
89
Chain Sequence
EETCFDKYTGNTYRVGDTYERPKDSMIWDCTCIGAGRGRISCTIANRCHEGGQSYKIGDTWRRPHETGGYMLECVCLGNGKGEWTCKPI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FIBRONECTIN
publication title The Solution and Crystal Structures of a Module Pair from the Staphylococcus Aureus-Binding Site of Human Fibronectin-A Tale with a Twist.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 6
structure length 89
sequence length 89
ec nomenclature
pdb deposition date 2006-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00039 fn1 Fibronectin type I domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2ckuA01
2.10.70.10 Mainly Beta Ribbon Complement Module; domain 1 Complement Module, domain 1 2ckuA02
1H03P 1CKLA 1OK3A 4LOSA 4WJG2 1E88A 2CKUA 4AYIA 1E5GA 1UOTP 2B5ID 4IGDA 2G7IA 1HFIA 1TPMA 2V8EA 3GXEA 3ZD2A 3R62A 4J38B 3EJHA 3INBC 5HYUB 4PZ5A 3IX0A 2MCYA 1GHQB 1MD7A 2KRIA 3CALA 3M7PA 1Q3XA 1GKGA 1G4FA 2IZ4A 1VVDA 3KZJA 1OK9A 3SW0X 2XWBF 1OK1A 3L89M 5HYTB 5I0QB 2RKYA 2A55A 1ELVA 3ZRZA 1H2PP 3RJ3D 1QGBA 1SS2A 4DJZA 5HYPA 2MCZA 3T5OA 1G4GA 2RKZA 2XRBA 2YRAA 4LOTA 4YNXA 2IZ3A 2UWNA 2CG6A 1ZJKA 3IU3I 4JHSA 4ONTD 4AYDA 4AYMA 2RLPA 4C16A 1OJWA 4MUCA 4B2RA 1VVCA 3ZD1A 3MQLA 2BZMA 2W81A 3KXVA 2RL0A 2W80A 2XQWC 2YBYA 3GOVA 1OJYA 2LOJA 1TPGA 1GPZA 1FBRA 1GKNA 3OP8A 1NWVA 2ERJA 4ZH1D 1TPNA 2XWJI 3O8EB 4K12A 5JPMG 1LY2A 5FO8C 1HCCA 1E8BA 1MD8A 2RLQA 1PPQA 3ERBA 2JRAA 1U5MA 2JGXA 2O39C 1QO6A 1H04P 4F4OC 3OXUD 4KKDA 3OEDC 1Z92B 1H2QP 4A5WB 1C1ZA 1O9AA 1OJVA 1QUBA 2KMSA 4FXGG 2QY0A 2WIIC 4B2SA 4CSYA 2CG7A 2EHFA 3TVJA 3NFPI 2EC3A 2JGWA 1HFHA 5HZPB 4AYEA 1SRZA 2XRDA 1OK2A
chains in the Genus database with same CATH superfamily
1H03P 1CKLA 2Y8TA 1OK3A 4LOSA 4WJG2 1E88A 2CKUA 4AYIA 3NJAA 1E5GA 1UOTP 2B5ID 4IGDA 2G7IA 1HFIA 1TPMA 2V8EA 3GXEA 3ZD2A 3K3TA 3R62A 4J38B 3EJHA 3INBC 5HYUB 4PO7A 4PZ5A 3IX0A 2MCYA 1GHQB 1MD7A 2KRIA 3CALA 3M7PA 1Q3XA 1GKGA 1G4FA 2IZ4A 1VVDA 4BWCA 3KZJA 1OK9A 3SW0X 2XWBF 1OK1A 3L89M 5HYTB 5I0QB 2RKYA 2Y8SA 2ZYCA 2A55A 1ELVA 3ZRZA 4YIZA 1H2PP 3RJ3D 1QGBA 1SS2A 4DJZA 5HYPA 2MCZA 3T5OA 2Y8RA 1G4GA 2RKZA 2XRBA 2YRAA 4LOTA 4YNXA 2IZ3A 2UWNA 2CG6A 1ZJKA 3IU3I 4JHSA 4ONTD 4AYDA 4AYMA 2RLPA 4C16A 1OJWA 4MUCA 4B2RA 1VVCA 3ZD1A 3MQLA 2BZMA 2W81A 3KXVA 2RL0A 2W80A 2XQWC 2YBYA 3GOVA 5DN4A 1OJYA 2LOJA 1TPGA 1GPZA 1FBRA 1GKNA 3OP8A 1NWVA 2ERJA 4ZH1D 1TPNA 2XWJI 3O8EB 4K12A 2I2LA 5JPMG 3WSYA 1LY2A 5FO8C 1HCCA 1E8BA 1MD8A 2RLQA 1PPQA 3ERBA 2JRAA 1U5MA 2JGXA 3CI0J 2O39C 4N7EA 1QO6A 1H04P 4F4OC 3OXUD 4KKDA 4MSLA 3OEDC 1Z92B 3F6KA 1H2QP 4A5WB 1C1ZA 1O9AA 1OJVA 1QUBA 2KMSA 4FXGG 2QY0A 2WIIC 4B2SA 4CSYA 2CG7A 3FGTA 2EHFA 5DN5A 3TVJA 3ZLEA 2X2ZA 3NFPI 2EC3A 3WSXA 2JGWA 1HFHA 5HZPB 4AYEA 1SRZA 2XRDA 1OK2A 1RLHA 3ZLDA 3FGRA 4APLA 3VWOA
chains in the Genus database with same CATH topology
1H03P 1CKLA 1OK3A 4LOSA 4WJG2 1E88A 2CKUA 4AYIA 1E5GA 1UOTP 2B5ID 4IGDA 2G7IA 1HFIA 1TPMA 2V8EA 3GXEA 3ZD2A 3R62A 4J38B 3EJHA 3INBC 5HYUB 4PZ5A 3IX0A 2MCYA 1GHQB 1MD7A 2KRIA 3CALA 3M7PA 1Q3XA 1GKGA 1G4FA 2IZ4A 1VVDA 3KZJA 1OK9A 3SW0X 2XWBF 1OK1A 3L89M 5HYTB 5I0QB 2RKYA 2A55A 1ELVA 3ZRZA 1H2PP 3RJ3D 1QGBA 1SS2A 4DJZA 5HYPA 2MCZA 3T5OA 1G4GA 2RKZA 2XRBA 2YRAA 4LOTA 4YNXA 2IZ3A 2UWNA 2CG6A 1ZJKA 3IU3I 4JHSA 4ONTD 4AYDA 4AYMA 2RLPA 4C16A 1OJWA 4MUCA 4B2RA 1VVCA 3ZD1A 3MQLA 2BZMA 2W81A 3KXVA 2RL0A 2W80A 2XQWC 2YBYA 3GOVA 1OJYA 2LOJA 1TPGA 1GPZA 1FBRA 1GKNA 3OP8A 1NWVA 2ERJA 4ZH1D 1TPNA 2XWJI 3O8EB 4K12A 5JPMG 1LY2A 5FO8C 1HCCA 1E8BA 1MD8A 2RLQA 1PPQA 3ERBA 2JRAA 1U5MA 2JGXA 2O39C 1QO6A 1H04P 4F4OC 3OXUD 4KKDA 3OEDC 1Z92B 1H2QP 4A5WB 1C1ZA 1O9AA 1OJVA 1QUBA 2KMSA 4FXGG 2QY0A 2WIIC 4B2SA 4CSYA 2CG7A 2EHFA 3TVJA 3NFPI 2EC3A 2JGWA 1HFHA 5HZPB 4AYEA 1SRZA 2XRDA 1OK2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1H03 P;  1CKL A;  1OK3 A;  4LOS A;  4WJG 2;  1E88 A;  2CKU A;  4AYI A;  1E5G A;  1UOT P;  2B5I D;  4IGD A;  2G7I A;  1HFI A;  1TPM A;  2V8E A;  3GXE A;  3ZD2 A;  3R62 A;  4J38 B;  3EJH A;  3INB C;  5HYU B;  4PZ5 A;  3IX0 A;  2MCY A;  1GHQ B;  1MD7 A;  2KRI A;  3CAL A;  3M7P A;  1Q3X A;  1GKG A;  1G4F A;  2IZ4 A;  1VVD A;  3KZJ A;  1OK9 A;  3SW0 X;  2XWB F;  1OK1 A;  3L89 M;  5HYT B;  5I0Q B;  2RKY A;  2A55 A;  1ELV A;  3ZRZ A;  1H2P P;  3RJ3 D;  1QGB A;  1SS2 A;  4DJZ A;  5HYP A;  2MCZ A;  3T5O A;  1G4G A;  2RKZ A;  2XRB A;  2YRA A;  4LOT A;  4YNX A;  2IZ3 A;  2UWN A;  2CG6 A;  1ZJK A;  3IU3 I;  4JHS A;  4ONT D;  4AYD A;  4AYM A;  2RLP A;  4C16 A;  1OJW A;  4MUC A;  4B2R A;  1VVC A;  3ZD1 A;  3MQL A;  2BZM A;  2W81 A;  3KXV A;  2RL0 A;  2W80 A;  2XQW C;  2YBY A;  3GOV A;  1OJY A;  2LOJ A;  1TPG A;  1GPZ A;  1FBR A;  1GKN A;  3OP8 A;  1NWV A;  2ERJ A;  4ZH1 D;  1TPN A;  2XWJ I;  3O8E B;  4K12 A;  5JPM G;  1LY2 A;  5FO8 C;  1HCC A;  1E8B A;  1MD8 A;  2RLQ A;  1PPQ A;  3ERB A;  2JRA A;  1U5M A;  2JGX A;  2O39 C;  1QO6 A;  1H04 P;  4F4O C;  3OXU D;  4KKD A;  3OED C;  1Z92 B;  1H2Q P;  4A5W B;  1C1Z A;  1O9A A;  1OJV A;  1QUB A;  2KMS A;  4FXG G;  2QY0 A;  2WII C;  4B2S A;  4CSY A;  2CG7 A;  2EHF A;  3TVJ A;  3NFP I;  2EC3 A;  2JGW A;  1HFH A;  5HZP B;  4AYE A;  1SRZ A;  2XRD A;  1OK2 A; 
#chains in the Genus database with same CATH topology
 1H03 P;  1CKL A;  2Y8T A;  1OK3 A;  4LOS A;  4WJG 2;  1E88 A;  2CKU A;  4AYI A;  3NJA A;  1E5G A;  1UOT P;  2B5I D;  4IGD A;  2G7I A;  1HFI A;  1TPM A;  2V8E A;  3GXE A;  3ZD2 A;  3K3T A;  3R62 A;  4J38 B;  3EJH A;  3INB C;  5HYU B;  4PO7 A;  4PZ5 A;  3IX0 A;  2MCY A;  1GHQ B;  1MD7 A;  2KRI A;  3CAL A;  3M7P A;  1Q3X A;  1GKG A;  1G4F A;  2IZ4 A;  1VVD A;  4BWC A;  3KZJ A;  1OK9 A;  3SW0 X;  2XWB F;  1OK1 A;  3L89 M;  5HYT B;  5I0Q B;  2RKY A;  2Y8S A;  2ZYC A;  2A55 A;  1ELV A;  3ZRZ A;  4YIZ A;  1H2P P;  3RJ3 D;  1QGB A;  1SS2 A;  4DJZ A;  5HYP A;  2MCZ A;  3T5O A;  2Y8R A;  1G4G A;  2RKZ A;  2XRB A;  2YRA A;  4LOT A;  4YNX A;  2IZ3 A;  2UWN A;  2CG6 A;  1ZJK A;  3IU3 I;  4JHS A;  4ONT D;  4AYD A;  4AYM A;  2RLP A;  4C16 A;  1OJW A;  4MUC A;  4B2R A;  1VVC A;  3ZD1 A;  3MQL A;  2BZM A;  2W81 A;  3KXV A;  2RL0 A;  2W80 A;  2XQW C;  2YBY A;  3GOV A;  5DN4 A;  1OJY A;  2LOJ A;  1TPG A;  1GPZ A;  1FBR A;  1GKN A;  3OP8 A;  1NWV A;  2ERJ A;  4ZH1 D;  1TPN A;  2XWJ I;  3O8E B;  4K12 A;  2I2L A;  5JPM G;  3WSY A;  1LY2 A;  5FO8 C;  1HCC A;  1E8B A;  1MD8 A;  2RLQ A;  1PPQ A;  3ERB A;  2JRA A;  1U5M A;  2JGX A;  3CI0 J;  2O39 C;  4N7E A;  1QO6 A;  1H04 P;  4F4O C;  3OXU D;  4KKD A;  4MSL A;  3OED C;  1Z92 B;  3F6K A;  1H2Q P;  4A5W B;  1C1Z A;  1O9A A;  1OJV A;  1QUB A;  2KMS A;  4FXG G;  2QY0 A;  2WII C;  4B2S A;  4CSY A;  2CG7 A;  3FGT A;  2EHF A;  5DN5 A;  3TVJ A;  3ZLE A;  2X2Z A;  3NFP I;  2EC3 A;  3WSX A;  2JGW A;  1HFH A;  5HZP B;  4AYE A;  1SRZ A;  2XRD A;  1OK2 A;  1RLH A;  3ZLD A;  3FGR A;  4APL A;  3VWO A; 
#chains in the Genus database with same CATH homology
 1H03 P;  1CKL A;  1OK3 A;  4LOS A;  4WJG 2;  1E88 A;  2CKU A;  4AYI A;  1E5G A;  1UOT P;  2B5I D;  4IGD A;  2G7I A;  1HFI A;  1TPM A;  2V8E A;  3GXE A;  3ZD2 A;  3R62 A;  4J38 B;  3EJH A;  3INB C;  5HYU B;  4PZ5 A;  3IX0 A;  2MCY A;  1GHQ B;  1MD7 A;  2KRI A;  3CAL A;  3M7P A;  1Q3X A;  1GKG A;  1G4F A;  2IZ4 A;  1VVD A;  3KZJ A;  1OK9 A;  3SW0 X;  2XWB F;  1OK1 A;  3L89 M;  5HYT B;  5I0Q B;  2RKY A;  2A55 A;  1ELV A;  3ZRZ A;  1H2P P;  3RJ3 D;  1QGB A;  1SS2 A;  4DJZ A;  5HYP A;  2MCZ A;  3T5O A;  1G4G A;  2RKZ A;  2XRB A;  2YRA A;  4LOT A;  4YNX A;  2IZ3 A;  2UWN A;  2CG6 A;  1ZJK A;  3IU3 I;  4JHS A;  4ONT D;  4AYD A;  4AYM A;  2RLP A;  4C16 A;  1OJW A;  4MUC A;  4B2R A;  1VVC A;  3ZD1 A;  3MQL A;  2BZM A;  2W81 A;  3KXV A;  2RL0 A;  2W80 A;  2XQW C;  2YBY A;  3GOV A;  1OJY A;  2LOJ A;  1TPG A;  1GPZ A;  1FBR A;  1GKN A;  3OP8 A;  1NWV A;  2ERJ A;  4ZH1 D;  1TPN A;  2XWJ I;  3O8E B;  4K12 A;  5JPM G;  1LY2 A;  5FO8 C;  1HCC A;  1E8B A;  1MD8 A;  2RLQ A;  1PPQ A;  3ERB A;  2JRA A;  1U5M A;  2JGX A;  2O39 C;  1QO6 A;  1H04 P;  4F4O C;  3OXU D;  4KKD A;  3OED C;  1Z92 B;  1H2Q P;  4A5W B;  1C1Z A;  1O9A A;  1OJV A;  1QUB A;  2KMS A;  4FXG G;  2QY0 A;  2WII C;  4B2S A;  4CSY A;  2CG7 A;  2EHF A;  3TVJ A;  3NFP I;  2EC3 A;  2JGW A;  1HFH A;  5HZP B;  4AYE A;  1SRZ A;  2XRD A;  1OK2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...