2CKXA

Crystal structure of ngtrf1, double-stranded telomeric repeat binding factor from nicotiana tabacum.
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
83
structure length
83
Chain Sequence
RPFSVAEVEALVEAVEHLGTGRWRDVKMRAFDNADHRTYVDLKDKWKTLVHTASIAPQQRRGEPVPQDLLDRVLAAHAYWSQQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TELOMERE BINDING PROTEIN TBP1
publication title Structure of the DNA-Binding Domain of Ngtrf1 Reveals Unique Features of Plant Telomere-Binding Proteins.
pubmed doi rcsb
source organism Nicotiana tabacum
molecule tags Nuclear protein
total genus 29
structure length 83
sequence length 83
ec nomenclature
pdb deposition date 2006-04-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.246.220 Mainly Alpha Orthogonal Bundle Serum Albumin; Chain A, Domain 1 Serum Albumin; Chain A, Domain 1 2ckxA00
2QHBA 2CKXA 2ROHA 2AJEA 2JUHA
chains in the Genus database with same CATH superfamily
2BXBA 1KXPD 1LNSA 2E0YA 3FWBC 1GNIA 4FJCB 4F5UA 5B5TA 3KJLA 5GHKA 2ROHA 3MHHB 5IIHA 4ZBRA 3ECPA 3GQXA 2BXMA 2Z8JA 1BKEA 3B9LA 4DHXB 3VQIA 2OT3A 3WHSA 3NVIA 5ID7A 4LB2A 2DBUA 1HK5A 2LQHA 2BXGA 3BPJA 3WHQA 4F5SA 3JRYA 4I9OA 3UIVA 2OZBB 3NVKA 2NNWA 2CKXA 3A75A 2KBZA 3PLAA 4M70B 2NQOA 4TQ1A 4J2VA 5DQFA 1BJ5A 2QM6A 1UORA 1TXUA 4N0UD 2DYOA 2Z8KA 4ZBQA 2E0XA 1HK2A 3H3AA 2XVWA 1E78A 2BXOA 1MIVA 1E7EA 1E7BA 3W1SA 1KW2A 4N0FD 4L9QA 2BXIA 2BXDA 4WA6B 3A73A 2BXKA 5IJFA 2XVUA 3GA9L 4PO0A 4S1YA 4F5VA 2DBWA 3SQJA 1NT2B 2KWFA 4Z69A 5FUOA 2XW0A 3SIVB 1HK4A 1TF0A 3CX9A 1E7HA 2YDFA 4BY9C 4G03A 3LU6A 1MA9A 2BXQA 2DBXA 4LUHA 4L9KA 4C31B 5IIXA 2DYMA 2LOQA 3LU8A 5IIUA 1HK3A 1E7GA 3NVMA 1N5UA 3B9MA 4ZC6A 4G01A 5HOZA 2XVVA 1IJGA 2DG5A 4IW2A 4HGMB 1H9ZA 2BX8A 2EFEA 4EMXA 5DBYA 5IFOA 1FOUA 3MHSB 1MUSA 2BXCA 1KDXA 2EFDA 3FNMA 1J7EA 2AJEA 3ICXA 2I30A 4OTUA 4W4UB 3V03A 2BXLA 2BXAA 2XVQA 3NMUA 1J78A 2V36A 1E7CA 4Z9OA 4G04A 2EFCA 4GG2A 4K2CA 1E7AA 2XW1A 4OTTA 2LXTA 3WHRA 4BKEA 5BPKA 4DM0A 3G9KD 1MIWA 3JQZA 4GDLB 2I2ZA 4JK4A 3M99C 1HA2A 4ZUXV 4LUFA 5ID9A 4ZBKA 3KIKA 1HK1A 2Z8IA 4GDXA 2XSIA 1BM0A 1E7FA 4LB9A 4N3ZA 3TDLA 1MUHA 4E99A 3H37A 2QMCA 4FIPB 1LOTA 4LA0A 1JNBA 4GDKB 1AO6A 2BXEA 3FWCC 4IW1A 1SB0A 3V08A 4K71A 2QHBA 2XMOA 3V09A 4L8UA 4OR0A 2EFHA 4FK5B 4OT2A 3LU7A 3SIUB 1VZSA 1E7IA 1GNJA 1O9XA 4D7XA 2VUFA 4F5TA 5D7GA 5IJEA 4ZCGA 2BXHA 2LQIA 1VFIA 2BXFA 5GINA 2K0NA 2GUTA 3GQUA 1MIYA 4MBEC 4NAWB 4TQ0A 2BXPA 5IJ5A 5GIOA 2AGHB 2LXSA 2VDBA 5GIPA 2BXNA 1MM8A 2VUEA 1H5WA 2JUHA 4HGKA
chains in the Genus database with same CATH topology
2BXBA 1KXPD 1LNSA 2E0YA 3FWBC 1GNIA 4FJCB 4F5UA 5B5TA 3KJLA 5GHKA 2ROHA 3MHHB 5IIHA 4ZBRA 3GQXA 2BXMA 2Z8JA 1BKEA 3B9LA 4DHXB 3VQIA 2OT3A 3WHSA 3NVIA 5ID7A 4LB2A 2DBUA 1HK5A 2BXGA 3WHQA 4F5SA 3JRYA 3UIVA 2OZBB 3NVKA 2NNWA 2CKXA 3A75A 2KBZA 3PLAA 4M70B 2NQOA 4TQ1A 4J2VA 5DQFA 1BJ5A 2QM6A 1UORA 1TXUA 4N0UD 2DYOA 2Z8KA 4ZBQA 2E0XA 1HK2A 3H3AA 2XVWA 1E78A 2BXOA 1MIVA 1E7EA 1E7BA 3W1SA 1KW2A 4N0FD 4L9QA 2BXIA 2BXDA 4WA6B 3A73A 2BXKA 5IJFA 2XVUA 3GA9L 4PO0A 4S1YA 4F5VA 2DBWA 3SQJA 1NT2B 4Z69A 5FUOA 3SIVB 2XW0A 1HK4A 1TF0A 3CX9A 1E7HA 2YDFA 4BY9C 4G03A 3LU6A 1MA9A 2BXQA 2DBXA 4LUHA 4L9KA 4C31B 5IIXA 2DYMA 2LOQA 3LU8A 5IIUA 1HK3A 1E7GA 3NVMA 1N5UA 3B9MA 4ZC6A 4G01A 5HOZA 2XVVA 1IJGA 2DG5A 4IW2A 4HGMB 1H9ZA 2BX8A 2EFEA 4EMXA 5DBYA 5IFOA 1FOUA 3MHSB 2BXCA 2EFDA 3FNMA 1J7EA 2AJEA 3ICXA 2I30A 4OTUA 4W4UB 3V03A 2BXLA 2BXAA 2XVQA 3NMUA 1J78A 2V36A 1E7CA 4Z9OA 4G04A 2EFCA 4GG2A 4K2CA 1E7AA 2XW1A 4OTTA 3WHRA 4BKEA 5BPKA 3G9KD 1MIWA 3JQZA 4GDLB 2I2ZA 4JK4A 3M99C 1HA2A 4ZUXV 4LUFA 5ID9A 4ZBKA 3KIKA 1HK1A 2Z8IA 4GDXA 2XSIA 1BM0A 1E7FA 4LB9A 4N3ZA 3TDLA 4E99A 3H37A 2QMCA 4FIPB 1LOTA 4LA0A 1JNBA 4GDKB 1AO6A 2BXEA 3FWCC 4IW1A 3V08A 4K71A 2QHBA 2XMOA 3V09A 4L8UA 4OR0A 2EFHA 4FK5B 4OT2A 3LU7A 3SIUB 1VZSA 1E7IA 1GNJA 1O9XA 2VUFA 4F5TA 5D7GA 5IJEA 4ZCGA 2BXHA 1VFIA 2BXFA 5GINA 4TQ0A 3GQUA 1MIYA 4MBEC 4NAWB 2BXPA 5IJ5A 5GIOA 2VDBA 5GIPA 2BXNA 2VUEA 1H5WA 2JUHA 4HGKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QHB A;  2CKX A;  2ROH A;  2AJE A;  2JUH A; 
#chains in the Genus database with same CATH topology
 2BXB A;  1KXP D;  1LNS A;  2E0Y A;  3FWB C;  1GNI A;  4FJC B;  4F5U A;  5B5T A;  3KJL A;  5GHK A;  2ROH A;  3MHH B;  5IIH A;  4ZBR A;  3ECP A;  3GQX A;  2BXM A;  2Z8J A;  1BKE A;  3B9L A;  4DHX B;  3VQI A;  2OT3 A;  3WHS A;  3NVI A;  5ID7 A;  4LB2 A;  2DBU A;  1HK5 A;  2LQH A;  2BXG A;  3BPJ A;  3WHQ A;  4F5S A;  3JRY A;  4I9O A;  3UIV A;  2OZB B;  3NVK A;  2NNW A;  2CKX A;  3A75 A;  2KBZ A;  3PLA A;  4M70 B;  2NQO A;  4TQ1 A;  4J2V A;  5DQF A;  1BJ5 A;  2QM6 A;  1UOR A;  1TXU A;  4N0U D;  2DYO A;  2Z8K A;  4ZBQ A;  2E0X A;  1HK2 A;  3H3A A;  2XVW A;  1E78 A;  2BXO A;  1MIV A;  1E7E A;  1E7B A;  3W1S A;  1KW2 A;  4N0F D;  4L9Q A;  2BXI A;  2BXD A;  4WA6 B;  3A73 A;  2BXK A;  5IJF A;  2XVU A;  3GA9 L;  4PO0 A;  4S1Y A;  4F5V A;  2DBW A;  3SQJ A;  1NT2 B;  2KWF A;  4Z69 A;  5FUO A;  2XW0 A;  3SIV B;  1HK4 A;  1TF0 A;  3CX9 A;  1E7H A;  2YDF A;  4BY9 C;  4G03 A;  3LU6 A;  1MA9 A;  2BXQ A;  2DBX A;  4LUH A;  4L9K A;  4C31 B;  5IIX A;  2DYM A;  2LOQ A;  3LU8 A;  5IIU A;  1HK3 A;  1E7G A;  3NVM A;  1N5U A;  3B9M A;  4ZC6 A;  4G01 A;  5HOZ A;  2XVV A;  1IJG A;  2DG5 A;  4IW2 A;  4HGM B;  1H9Z A;  2BX8 A;  2EFE A;  4EMX A;  5DBY A;  5IFO A;  1FOU A;  3MHS B;  1MUS A;  2BXC A;  1KDX A;  2EFD A;  3FNM A;  1J7E A;  2AJE A;  3ICX A;  2I30 A;  4OTU A;  4W4U B;  3V03 A;  2BXL A;  2BXA A;  2XVQ A;  3NMU A;  1J78 A;  2V36 A;  1E7C A;  4Z9O A;  4G04 A;  2EFC A;  4GG2 A;  4K2C A;  1E7A A;  2XW1 A;  4OTT A;  2LXT A;  3WHR A;  4BKE A;  5BPK A;  4DM0 A;  3G9K D;  1MIW A;  3JQZ A;  4GDL B;  2I2Z A;  4JK4 A;  3M99 C;  1HA2 A;  4ZUX V;  4LUF A;  5ID9 A;  4ZBK A;  3KIK A;  1HK1 A;  2Z8I A;  4GDX A;  2XSI A;  1BM0 A;  1E7F A;  4LB9 A;  4N3Z A;  3TDL A;  1MUH A;  4E99 A;  3H37 A;  2QMC A;  4FIP B;  1LOT A;  4LA0 A;  1JNB A;  4GDK B;  1AO6 A;  2BXE A;  3FWC C;  4IW1 A;  1SB0 A;  3V08 A;  4K71 A;  2QHB A;  2XMO A;  3V09 A;  4L8U A;  4OR0 A;  2EFH A;  4FK5 B;  4OT2 A;  3LU7 A;  3SIU B;  1VZS A;  1E7I A;  1GNJ A;  1O9X A;  4D7X A;  2VUF A;  4F5T A;  5D7G A;  5IJE A;  4ZCG A;  2BXH A;  2LQI A;  1VFI A;  2BXF A;  5GIN A;  2K0N A;  2GUT A;  3GQU A;  1MIY A;  4MBE C;  4NAW B;  4TQ0 A;  2BXP A;  5IJ5 A;  5GIO A;  2AGH B;  2LXS A;  2VDB A;  5GIP A;  2BXN A;  1MM8 A;  2VUE A;  1H5W A;  2JUH A;  4HGK A; 
#chains in the Genus database with same CATH homology
 2BXB A;  1KXP D;  1LNS A;  2E0Y A;  3FWB C;  1GNI A;  4FJC B;  4F5U A;  5B5T A;  3KJL A;  5GHK A;  2ROH A;  3MHH B;  5IIH A;  4ZBR A;  3GQX A;  2BXM A;  2Z8J A;  1BKE A;  3B9L A;  4DHX B;  3VQI A;  2OT3 A;  3WHS A;  3NVI A;  5ID7 A;  4LB2 A;  2DBU A;  1HK5 A;  2BXG A;  3WHQ A;  4F5S A;  3JRY A;  3UIV A;  2OZB B;  3NVK A;  2NNW A;  2CKX A;  3A75 A;  2KBZ A;  3PLA A;  4M70 B;  2NQO A;  4TQ1 A;  4J2V A;  5DQF A;  1BJ5 A;  2QM6 A;  1UOR A;  1TXU A;  4N0U D;  2DYO A;  2Z8K A;  4ZBQ A;  2E0X A;  1HK2 A;  3H3A A;  2XVW A;  1E78 A;  2BXO A;  1MIV A;  1E7E A;  1E7B A;  3W1S A;  1KW2 A;  4N0F D;  4L9Q A;  2BXI A;  2BXD A;  4WA6 B;  3A73 A;  2BXK A;  5IJF A;  2XVU A;  3GA9 L;  4PO0 A;  4S1Y A;  4F5V A;  2DBW A;  3SQJ A;  1NT2 B;  4Z69 A;  5FUO A;  3SIV B;  2XW0 A;  1HK4 A;  1TF0 A;  3CX9 A;  1E7H A;  2YDF A;  4BY9 C;  4G03 A;  3LU6 A;  1MA9 A;  2BXQ A;  2DBX A;  4LUH A;  4L9K A;  4C31 B;  5IIX A;  2DYM A;  2LOQ A;  3LU8 A;  5IIU A;  1HK3 A;  1E7G A;  3NVM A;  1N5U A;  3B9M A;  4ZC6 A;  4G01 A;  5HOZ A;  2XVV A;  1IJG A;  2DG5 A;  4IW2 A;  4HGM B;  1H9Z A;  2BX8 A;  2EFE A;  4EMX A;  5DBY A;  5IFO A;  1FOU A;  3MHS B;  2BXC A;  2EFD A;  3FNM A;  1J7E A;  2AJE A;  3ICX A;  2I30 A;  4OTU A;  4W4U B;  3V03 A;  2BXL A;  2BXA A;  2XVQ A;  3NMU A;  1J78 A;  2V36 A;  1E7C A;  4Z9O A;  4G04 A;  2EFC A;  4GG2 A;  4K2C A;  1E7A A;  2XW1 A;  4OTT A;  3WHR A;  4BKE A;  5BPK A;  3G9K D;  1MIW A;  3JQZ A;  4GDL B;  2I2Z A;  4JK4 A;  3M99 C;  1HA2 A;  4ZUX V;  4LUF A;  5ID9 A;  4ZBK A;  3KIK A;  1HK1 A;  2Z8I A;  4GDX A;  2XSI A;  1BM0 A;  1E7F A;  4LB9 A;  4N3Z A;  3TDL A;  4E99 A;  3H37 A;  2QMC A;  4FIP B;  1LOT A;  4LA0 A;  1JNB A;  4GDK B;  1AO6 A;  2BXE A;  3FWC C;  4IW1 A;  3V08 A;  4K71 A;  2QHB A;  2XMO A;  3V09 A;  4L8U A;  4OR0 A;  2EFH A;  4FK5 B;  4OT2 A;  3LU7 A;  3SIU B;  1VZS A;  1E7I A;  1GNJ A;  1O9X A;  2VUF A;  4F5T A;  5D7G A;  5IJE A;  4ZCG A;  2BXH A;  1VFI A;  2BXF A;  5GIN A;  4TQ0 A;  3GQU A;  1MIY A;  4MBE C;  4NAW B;  2BXP A;  5IJ5 A;  5GIO A;  2VDB A;  5GIP A;  2BXN A;  2VUE A;  1H5W A;  2JUH A;  4HGK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...