2CL0X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gppnhp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide binding protein
molecule keywords GTPASE HRAS
total genus 65
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cl0X00
2J5XA 2IHBA 2VF8A 4JZKA 5JHHB 1VYTA 5CIQA 1NSFA 1G3IA 3I72A 4FINA 4CT5A 1BS1A 4ZO4A 6Q21A 3L43A 5KO2A 2JLYA 2OESA 1YZUA 4BE7B 4OI2A 3NIBA 2NO0A 3C14C 4BEBA 4XD7A 1U90A 5C18A 2QAGA 2GK7A 2VTKA 4JVMA 5HE8A 4HB3A 1OT3A 5LD2B 3KX2A 5FPYA 3A1SA 4RJLA 3DM9B 3HJNA 2X8AA 4TL9A 2OFXA 1N0WA 3K0AB 1IN8A 4YONB 5J47A 3VR1A 2QRZA 4JT4A 2O8EB 5D3QA 4JIMA 3WNDA 1XTIA 1KO1A 2K5UA 1FP7A 5LPNA 5JS8A 1OFTA 2F43B 2QG6A 4RKEA 3QI2A 1KYIA 1IBRA 2ZTSA 3CR7A 2GF9A 2OBMA 3GJ3A 3I73A 4LBZA 4FMDF 5EE3A 2NO9A 4C0KA 4M8NE 2IL1A 3A8TA 1Q21A 2P6UA 1P4SA 4DLXA 1NMYA 2FNAA 2IYTA 1VYVA 3AVPA 4DT1B 3B5JA 4DSNA 3HP1A 2A2ZA 2HXSA 2JLRA 3GLFE 2O8BB 2JLZA 2IUSA 2RGNC 3ND8A 2P5TB 1NLYA 1IJFA 2OXCA 4Q18A 4UNQA 1G21E 5DN6D 1E4YA 4DSTA 2PJRA 3AVYA 3BERA 2ZR9A 4AWXA 3A58B 3QEOA 1KJYA 3QXCA 3JZMA 3W5JA 1KHTA 3BH0A 2N42A 2W6IA 3OE7D 4KYIB 2OAP1 4V0OA 5SZIA 2W83A 3IIMA 5TXGA 5L3QB 2DBYA 1FNNA 2H5EA 2MSCB 3AP3A 3QQ5A 3MLEA 1DOAA 1UM8A 1SVWA 1FX0B 1JPJA 3VR5A 4NKRA 1Z6XA 3LX5A 4DDWA 2EWWA 2XB4A 3KL4A 4F7WA 2QE7A 3GP8A 5AJVB 1U81A 4KO8A 1R4AA 1E2MA 3B13B 4JYBA 4UQOA 4B34A 2Z5FA 2XZPA 4AKIA 1ZW6A 1WCV1 3H2YA 3MMPA 4QBIA 4M2LA 1G6OA 3K9NA 3PXGA 3FDIA 4PFSA 4IW3B 1VKJA 2G1JA 4O25A 4O2RA 3W9YA 1CJMA 2YNMA 4ILEA 2V3CC 4FD2A 3B60A 3CWZA 3IGFA 4P33A 2BBOA 1ZIPA 3THOA 3KKQA 1X3SA 1C1YA 4M53A 2MSEB 2DWPA 4A2QA 2H1LA 4GZMA 4OQNA 4BFVA 3HPQA 5EXPA 4U7DA 2JLWA 2WSSD 1WB9A 4CW7A 5M04A 2KJQA 4AKEA 5IT5A 4GI7A 1P3JA 1W36D 3KB2A 4TN1A 2OT3B 3W34A 1GOTA 1BH2A 3D6TB 1HTWA 1S9HA 2IYRA 4KVGA 1I4TD 2V9PA 4MRVA 4C3ZA 5TMPA 1ZNYA 4F4CA 1N0VC 2IT1A 3B7GA 4OHZA 1OH6A 1Z0DA 2XEXA 4C0BA 2P6NA 1L7VC 2ZXUA 3GLIA 1NBME 1RW4A 4ZDKA 3X1YA 3QXXA 2OCBA 4NYIQ 4YMTA 1E2LA 1XX6A 4NYJQ 4FIDA 2OCAA 4CT4B 4D26A 521PA 4GDFA 2RAPA 3K0AA 4IKEA 3AF0A 4IHQA 3CW2A 3GFTA 4MITA 3GQBA 3LH5A 2GCOA 2NG1A 4IFBA 1L8QA 1T3HA 3IEUA 4P31A 3CF2A 3RANA 5KNDA 2ZRKA 4KV9A 4C0LA 1B23P 2R6GA 3DKVA 3K53A 3W3ZB 5L3SB 3QEJA 3HDTA 4V0NA 1VG9B 1RJ9B 1FQJA 3BB3A 3QENA 1XEWY 5FL7D 4OI4A 5FOTA 4PC3A 1MRSA 2QMOA 1N5LA 4WZBE 1XJ0A 1TMKA 2ORWA 3C16C 2IBMA 3FHOA 3SS8A 2XXAA 2C98A 1II9A 4LV8B 1KOFA 3EWAA 3KQKA 4DWJA 1ZM3A 1FTNA 1XD8A 2VP9A 3CF6R 1E2FA 5BWMA 3PFIA 4WZ6A 3WYFA 3R9WA 2D62A 4A2PA 5UKDA 2J7KA 1II0A 4PO9A 2YV5A 4DJTA 1JBKA 2WSSA 3W6OA 1X8LA 4DIEA 5F3WB 1TQ6A 4IDOA 2QTHA 4QJ5A 3U6KA 1NN3A 2BIFA 2O0JA 3MWLA 4PSAA 3TGPA 1NIPA 3BBPA 4BASA 4R9UC 2WHXA 3PITA 3ZVMA 2GBLA 1KI6B 1SVLA 5TB5A 3TK1A 3QBTA 3PENA 5CLLA 3SJZA 2JLQA 5K8LA 1QF9A 3S1AB 3P27A 4KLZA 3RS4A 5EE5B 4Z54A 3A1WA 3CZPA 5KNBA 4HZUA 2ORVA 4D82A 4DEXA 3B85A 1Q3HA 4QGGA 1F6BA 2D3WA 1KMHA 2IF0A 4KVAA 3OFNA 3WY9A 4UNRA 2VH5R 3O47A 1NJGA 2BM1A 4M1YA 2LCFA 2F1RA 3N2IA 3LFUA 1IOZA 3E70C 4EUNA 1F2UA 1JALA 1LS1A 2PEZA 3KKPA 3IILA 1G3UA 1NLZA 4B74A 1DAHA 5DHAA 2H18A 2KB0A 2ZRLA 4LPKA 2NGRA 2NQ2C 2QI9C 2VSOA 4KHZA 2X2FA 5GVRA 4BFXA 5FUVA 1D2MA 1Z6GA 3T35A 3PUWA 1KK1A 4FCTA 4DLSA 2I1VB 3ZIAD 2ZI5A 3HPRA 2FN4A 3BFKA 1NMXA 1JJ7A 1YZGA 1NN0A 2J0UA 4N1AA 1P61B 1MO6A 2CJWB 5LB2A 2CBZA 4XSGA 2XGJA 2JJ8A 4EFLA 1GTVA 4KBFA 3EA0A 4JL6A 4BZPA 1Z83A 4H9GA 1HH4A 1S8FA 2QEQA 4GP7A 4NMMA 5EE9A 1SULA 3T61A 2ZJBA 3OHMA 4XWKA 1A1VA 1XTQA 4QM6A 2QMEA 1E1QA 2IUUA 1Z0IA 1G3MA 2C04A 3HR7A 2RGBA 2ZRIA 1SQ5A 1YJ5A 4V0ME 1GNRA 5E7MA 4Q1BA 4P4TA 2ZUDA 2J46A 3U2QA 1Z6TA 1N6HA 1GILA 1XWIA 2AN9A 1F48A 5TARA 4US1R 1XTSA 5L3SA 2WKQA 1E2KA 2WWWA 4U5XA 4EJSA 3FKSA 1XTKA 2GCOB 5J4KA 1VYUA 3IIKA 1I4DD 2J41A 4QBHA 2R8RA 3K0FA 4BFWA 3OEED 1GDDA 2FE4A 2FG5A 4QOSA 1NY6A 4D0GA 3QKRA 1JECA 4N3NA 2QORA 1OFUX 5DI3B 4NCHA 3VR3A 4L5BA 5B2ZA 5CITA 4OHYA 4EKDA 3MAAC 3E5HA 5IHPA 3IEVA 3CRRA 5CK4A 2PX0A 1E9EA 4DDTA 3A36A 1U8AA 1E6CA 3AB3A 1XCGB 1L4UA 3MWKA 3UG7A 3G82C 2ZPTX 4ZIRB 3RAPR 4IXNA 1E99A 4URXR 4FMDB 2X19A 1RC8A 4MYTA 3F8TA 1D9ZA 1AGPA 2Z4RA 2OCPA 4PC1A 3NDBB 2F9MA 1AZTA 1VIYA 2SHKA 4LDJA 3U7GA 2VP0A 1E98A 2LKDA 3LWNA 3HYRA 3U5ZB 5AJZA 4TMWA 3OEHA 3LRPA 4TT3D 3RVBA 2GCNA 1H65A 4W5JA 2CDNA 4LWZA 4A8JB 1XCPA 3K0EA 2O8DB 5EZ5A 3T06B 1DARA 2REBA 2ZITA 5C4MA 2VSFA 1KKLA 2CE2X 3CB4A 3NHAA 1Z63A 1S1MA 3IPXA 2H17A 1W2GA 1D9XA 1UKYA 2JLXA 1XXHE 3EW9A 2R6FA 2OAQ1 4JLJA 3L0IB 3NBZC 2QENA 3QBVA 2HCJB 3GLFB 4I1UA 4HLCA 4R7ZA 2FU5C 3PUXA 3WHLA 3WP0A 2ZIAA 5DHFA 1R10A 4AD8A 4QM7A 2EVWX 3NBXX 1AQYA 4NYMQ 4JVLA 1XPUA 5AK0A 4M1WA 3VHXA 1CBUA 1N6PA 4KITB 5H1YA 1QVRA 5L3QA 1N5JA 2RGNA 5C1BA 5H8WA 4YMVA 1TUEA 3BC1A 4A15A 4AURA 3DEFA 2VSXA 1E2GA 1T0JB 1K5GA 3TSZA 4YXWD 5EE0A 1XEXB 4V0MA 2ZRHA 1Q12A 5P21A 2WIBA 1Z0AA 2FMXA 3EIHA 2V55B 5JMTA 1SHZA 2XXAB 4RZ2A 2BC9A 1RRGA 3GFOA 1Z8FA 2Z4SA 3GLFA 4OI0A 2AWNA 3KB1A 1ZC4A 3LAWA 1CJVC 2V54A 4TLCA 2VRWA 3EC1A 1J7KA 4XJXA 1KI3A 3LBIA 3DOEA 2B6HA 2WBLC 1E79A 4O2LA 2GETA 4ASUA 2GEUA 4MYUA 4IDPA 3WBKA 5F9FA 1PZNA 4EQ6A 3O8DA 2ORIA 3LLUA 1AK2A 3CR8A 3ONWA 4Y0VA 3PUYA 2ECKA 3WRXC 2KSQA 1AS0A 4G1UC 1E9DA 3A1VA 2GF0A 2PEYA 4PSVA 1PV4A 3QF4B 1TUIA 1OKKD 3FB4A 3CH4B 5DGXA 5EP1A 621PA 1Z2CA 4PZZA 2FSGA 3T1TA 4POAA 4FWTA 1G8FA 1OIWA 4B43A 4M1KA 3LQQA 5BW8A 2PZEA 4C9BA 3H0KA 3I62A 4EDHA 1JXOA 2PLRA 2CEAA 2H7VA 3QXHA 4A1FA 2FV8A 4TLAA 1FW6A 2BCGY 2B21A 1N6RA 1SVSA 2FSFA 5AJWA 2YC4C 1G3RA 4LJYA 1VCIA 4ABYA 5DI3A 2WPDD 3SJBA 4TYQA 4B3DA 3B82A 4LUCA 1ZNWA 4HB4A 3DKPA 4JVNA 3IUYA 2ODEA 3SU8A 1A2KC 3FHCB 5F2EA 3MCAA 2GJ9A 2KWIA 3EIQA 2DFLA 1ZMXA 4TQAA 4XSHA 3LDAA 1NVWQ 2QL6A 1IY2A 3GJ7A 3NBFA 4PQRA 5FOSA 5B58C 5C46F 5HCIA 4K46A 4HAVA 1U8ZA 4BWYA 1GIAA 1XD9A 4BECA 3SBEA 2C78A 4B3CA 2XNDD 1K6MA 5JHGB 3OE7A 1W47A 3NG1A 4LHVA 1E9RA 3ZD7A 4WBSA 1X6VA 1Z47A 4C4PA 1Q1EA 3EASA 3MUFA 2ZE6A 2QP9X 4MRNA 4BFYA 3SZRA 1OXSC 3GLIE 1KZGB 2JJ2A 4JKIA 1TAGA 4EIWA 2EWVA 3L0PA 4ARZB 1R6BX 3RS3A 4IOJA 1G8HA 4RSGA 2X1VA 2ZJYA 4JLPA 2CNWA 1C4OA 1HUQA 1SZPA 721PA 4LJAA 3OESA 2QQEA 4YDHB 1AKEA 3LY5A 1QHIA 5E7JA 1P9RA 2WJYA 1AGRA 4DIDA 2REXB 3NDPA 3EZ2A 3L2OB 4PPQA 4Q9JA 2XJ9A 3DHWC 2WJVA 1Q20A 3C8UA 1HT1E 1WXQA 2J3EA 1G4AE 3DZDA 3WYGA 1DBSA 1KSGA 1RFLA 1DAIA 2YWFA 1H8EA 4C7OB 1F2UB 3A37A 1GKIA 4DC9A 3TVTA 2BMJA 1NBMD 1BKDR 2NTYC 3EX7C 3D7MA 3LD9A 3C15C 3HR8A 4V0KA 4EFNA 1N2CE 4QG7A 4KI0A 1P72A 3C4JA 4TSFD 3ICQB 3NH9A 4XIGS 2IYLD 1KSJA 1LTQA 4V0LA 2ATXA 4TMZA 4DUGA 2C99A 3D3QA 4G5GA 1G8GA 1ZM9A 3M6AA 4P4UA 2ZAOA 1W0KA 5KPJA 3WMEA 1XMIA 1KI6A 1T9HA 3SFVA 1XNJA 1Z07A 2D2EA 1TQ2A 1KO8A 3BFVA 2F1HA 4IFEA 4XTRA 4MUBA 2IYYA 5HE9A 1R8SA 2WMNB 2R62A 4BFZA 1JPNA 1YR7A 4B3XA 4DDVA 3KUDA 3OAAD 4EPTA 4Z1MA 3AF3A 5IK2A 3CM0A 3NC0C 2PBRA 5JEDA 3RS2A 2ZRAA 4LC0A 4IRUB 4W5HA 4AI6A 1P2TA 2G0TA 2GJAA 1ZUNB 2ZSDA 3LVQE 4M0LA 1NJFA 4L9SA 2EYUA 4DLVA 1XMJA 2J7PD 4HYYA 1TF5A 1BOFA 3KKNA 3A4LA 4MGYR 3O8BA 1TU4A 1OF1A 1T4GA 3NVAA 2G1KA 3LV8A 4WIAA 2PZGA 4WW0A 3FPAA 3WHKA 5AUNB 4PHGA 1AQUA 4S2EA 3M4YA 1JNYA 1EFRA 5FBLB 5LBIA 2JA1A 1KNQA 1MKYA 3ZLJA 1AKYA 5CB8A 5IDVA 3GPLA 2AD1A 3H84A 1CR0A 4C30A 4HLQB 1V5WA 2BEJA 3CPJB 5FL3A 821PA 5LD2C 2FFQA 2P3SA 2IS6A 2O8DA 2V1XA 3T34A 4HDCA 2DFKB 5H68A 4LK2A 3VKHA 3TR0A 1N6LA 2DR3A 4QGHA 1FTSA 1TQDA 1M34E 2VIIA 3KQHA 2GTPA 5FTKA 2GXAA 3J81k 5CJ2A 5GJWC 3LXRA 1DEKA 1GAJA 2ZI6A 4B76A 3TLXA 3P26A 4TTPA 1Q44A 5J4LA 4R71A 1XFAA 1F3OA 3EPKA 1YR9A 4II7A 3U4QB 2A5GA 4OHXA 4HUQA 4HI0E 3VX3A 5GJBA 4ZKDA 4HUTA 3DZ8A 2GAAA 2QP4A 3QVVA 4LBWA 4E09A 2JIZD 3MWJA 5JS7A 1R5BA 3W6PA 4GP6A 3HWSA 2BMDA 2KI5A 3T15A 4DSOA 3SFZA 4DVGA 3BB4A 4CGZA 4EAQA 3X1ZA 1S2MA 2BKEA 2XSZA 1YZQA 2OFWA 3GJ4A 2WSMA 3RRNA 4PC6A 4I4LA 4GL2A 3U7HB 3PG5A 1P9WA 1KO5A 4PQYA 3RLFA 3RS0A 5B30A 3AVOA 4JSYA 5KYKA 1J8MF 4EQ6B 4MRSA 1N6KA 5EZ6B 4D81A 3SYLA 3IIJA 5FFMA 3OIYA 3K0SA 3MSXA 4OK5A 2C9OA 2NO7A 2C03A 2YOGA 3CF0A 2ZYWX 3F3YA 4KFTA 3FTQA 5AR1A 3TSWA 5HR5A 2PL3A 2ZYVX 3TNFA 1KTVA 2WM9B 1KK2A 2C5LA 4R2IA 3TQFA 2OLJA 3KFXA 4B47A 3GCGA 2DHRA 1N6IA 4YDSA 1FL9A 1M7HA 2IYQA 4TYPA 3EPJA 4MDFA 2GDJA 2JDIA 3Q72A 1MR3F 4ZDIA 3DDCA 4LJ9A 4QNMA 1OHHD 4QNRA 4RFVA 1X86B 5FI1B 3EZFA 1KY2A 4PO1A 5E4FA 3H86A 2G9NA 4UKDA 3U3KA 2DPXA 4E07A 1HA3A 3R20A 1T5LA 1R7RA 1IM2A 1EFHA 2AWOA 1UEJA 4Q4JB 3LW7A 1WP9A 3EXAA 3AGQA 2ZU0C 4MQBA 1Q57A 4DB2A 1BO6A 4U02A 4K81B 3ZQ6A 2Y8EA 2J0SA 2Q9BA 3UWKA 5IRCD 4D4JA 1J8YF 1LVGA 3K8YA 2DWQA 4Q48A 3AVVA 1D5CA 1SVMA 1ZBDA 2FFAA 2YWEA 3RNLA 1JI0A 2BCJQ 1IXRC 5DI9A 5FBQB 4XOIA 1XF9A 1XMVA 2RHDA 2VYFA 3M1IA 1RPZA 2GNOA 1P2SA 1ZVQA 4KFSA 1OXTA 4TT3A 3W8RA 2MSDB 1X1SA 5KTYA 4Q00A 1G20E 3P4YA 2R44A 5BN3A 3TSOA 1VHLA 2JJ1D 3BOSA 4B6FA 5LDDC 3GEHA 5EP2A 4NBSA 4TL6A 1X8JA 1U0JA 4TLBA 1DPFA 1VG1A 2C9YA 5KSOA 3IKJA 1NLFA 2JGNA 1NIJA 3WNBA 4OYHA 1Q1BA 4AYTA 5FR1A 2XZLA 4XTCS 2A7QA 2OBNA 2FPKA 2Z43A 4HLUC 4MA4A 4D0LB 2VP5A 4FMBB 1XJCA 4HLUA 1E2JA 2HF8A 2OM2A 5G3YA 1OH8A 1W5TA 4UJ5A 4RCZA 4TMVA 3CRW1 4MGIR 3KJHA 3SOPA 1C9KA 3U3JA 3PIRA 5FH9A 2ANCA 3TAUA 3ZVNA 5JWHA 1AA9A 5AUOB 5CYOA 4KODA 1P5ZB 4AY2A 2CK3A 3B9QA 4L9WA 4PZYA 2HJVA 2GEDA 2XOKA 4KYUA 3UKDA 3QXSA 3E1SA 4RD1A 2G3YA 4LYAA 2O8CA 4NYJR 4F4JA 1NSTA 3EPHA 2IWHA 3RSLA 1ZJ6A 4H1VA 1E2PA 4JBWA 1W5SA 1II8A 4NCIA 5JCPA 2F6RA 4BFTA 3AF4A 4ITRC 4NYIR 3ADCA 2AFIE 2FPMA 4B6EA 3PVSA 1CTQA 3R9IA 4LJ4A 3ETLA 4DZZA 4ZI3A 2BOVA 1GKYA 8OHMA 1FFHA 3CWQA 4TLDA 1YR6A 3BK7A 1P2VA 1R0XA 4E5UA 1RYFA 2ZRPA 4DKXA 1Q1QA 4A4DA 1MV5A 2JJ1A 1KI9A 2LWIA 4UJ3A 4OI1A 4HAWA 3JVUA 3VU9B 4UNNA 3AV0B 1JEEA 1GNQA 5CJPA 4C0HA 2C8VA 4QHYA 3ECCA 4D4MA 4DCTA 3FKQA 4JL8A 4Q9LA 2YKGA 1L4YA 2QGZA 4ESVA 3UG6A 3B1VA 5DYGA 1TX4B 2P0EA 1WF3A 4D4LA 2AK3A 5JZVA 2EYQA 4PX9A 1U94A 2WJJA 5FOVA 4JL5A 1IAQA 4OKSA 2IW3A 3ZGXA 4JLKA 3SN6A 4CEHA 1COWD 1NKTA 1U0HC 3FFAA 2FSIA 3Q5EA 1F60A 1M6NA 3Q8XB 2Q6TA 2PCLA 4OJQA 2PLFA 4AYXA 4FN5A 2O5VA 4GPTA 2IYXA 1CR1A 2W2XA 4A6PA 1T6NA 1XDBA 4BLSA 3UPUA 2FDCA 1FOEB 1XEWX 2LKCA 2ZSEA 4LBYA 4IVQA 1YZNA 1Z3IX 4PPNA 1SXJC 1GSIA 2NZJA 3KTAA 5K8IA 5JI2E 1CU1A 2VEDA 4CIDA 4KSCA 4Q1CA 1IXSB 3ZZUA 1ZM7A 2RGEA 3NC1C 4Q1EA 3AQ4A 2JDID 3IHLA 4JS0A 1G4UR 1AZSC 3QOFA 5JJKA 1XEXA 3VAAA 3EPLA 3THYA 5KPDA 1UEIA 2ZJ5A 4BLOA 1MH1A 2B92A 4IEIA 4EPVA 3M0EA 2WWGA 2G83A 3EZ6A 4Q4AB 4ERNA 1DG1G 3AEZA 5BYJA 2C96A 1IY1A 2E9SA 5EUMA 1GRQA 1FP6A 1P7CA 4KXFB 1KO4A 3QKSB 4Q9KA 1Q0UA 1G5RA 3SBDA 1E2HA 3U3MA 2GKSA 1D2EA 2Q3HA 5EP4A 3SYKA 3I5XA 4I99A 4RVCA 1PUJA 2PJZA 2QMHA 4A0FA 3AF2A 2EQBA 4AKHA 3VMFA 3AVTA 1U8YA 1VPLA 5EP3A 5FTMA 1UADA 1IHUA 2P5SA 4LRWA 4CEIA 2IX3A 2FFHA 1JR6A 2IK8A 1M7BA 2D4HA 4X8HA 5HKKD 3W90A 3RWOA 4LJ5A 5JWRA 1G9XA 3PV0A 2G77B 3WBJA 1DO2A 1W4AA 1DG3A 3RYTC 4DUGD 4EJSC 2CHQA 3R8FA 2FOLA 1Q3TA 4CEJA 1MO3A 5LB4A 4YXWA 4US0R 1GWNA 4TSFA 4LHXA 1UAAA 1X1RA 1EFUA 2IF2A 4L4UA 1NBMA 3K70D 2GBLC 2GZHA 1LV7A 4IOMA 2C95A 3CONA 3A6PC 1KJZA 3I32A 4YC7A 4WAUA 1Z0JA 2ODBA 3LLMA 2CHGA 2R2AA 5EJEA 2VP2A 3KZ1E 4A36A 5SZHB 4RKFA 1VG8A 3VKGA 2BDTA 1Z29A 3WNCA 2O8EA 4L8GA 1KSHA 3SE0A 4PTLA 2QTVB 3R7WA 2HT1A 5FBVB 4A0GA 2V8OA 1OIVA 2QMUA 3AUXA 3BORA 3V00A 4GNKA 2ZI3A 3I61A 5GJVC 1RVDA 2V6IA 5JJIA 1EGAA 4MKHA 4XWOA 1B0UA 3PEUA 1Q1ZA 2ZVPX 1WRBA 1AM4D 1QHSA 1RRPA 2REOA 5DLQC 1GNPA 1RZ3A 3K0FB 4YMUA 4U00A 2W2VA 3C5HA 3PUVA 4RFSB 3K70C 3QIAA 4DXAA 3B78A 2F1IA 4FCVA 1EWRA 3B8HA 4BRUA 3CPEA 1U9IC 2GXSA 2HYDA 3TW8B 5KOYA 3OIVA 4BUJA 1E0JA 4P4SA 1XEFA 2E1RA 3EWSA 4PC2A 4TWZA 1IQPA 4M9ZA 1HQYE 1IN4A 1SKYB 4MKGA 1P6XA 3QNUA 4DLRA 1XMSA 5CDFE 1CXZA 2WICA 4MYHA 3QKSA 2XAUA 4Q66C 3SEAA 2JLSA 3LBHA 1N6NA 2B8TA 4F38A 3BE4A 3RDPA 1TQ4A 3AKYA 4PR0A 1YR8A 4KFRA 2F3RA 2XJ4A 2B7CA 2WKPA 5GADl 4B32A 5JEEA 1CJUC 2VA8A 2YYZA 3KFVA 3F0TA 4FMCF 2O52A 4FW9A 4OHVA 4BLRA 4K8OA 4BEJA 2ONJA 5KDLA 2BHRA 1OFIA 2J1LA 1ZD1A 4P3YA 1E69A 1XJQA 3CPHA 2AX4A 3KTAB 2GXQA 1M8PA 1V43A 4HB0A 1NRJB 3DMDA 1S3SA 2J87A 1R0WA 3U44A 1E9BA 5CDFA 4Q1DA 5FOWA 1JEDA 3CRVA 4BLPA 1XXHA 1W36C 1DELA 1KI1A 1Z22A 3IPYA 2ASEA 4JLDA 4Q4HA 5JSZA 4LX0A 4KCGA 4Z8YA 1NN5A 3GD7A 3MD0A 1IN5A 3MRSA 4QRHA 4UXJA 3VX4A 4RCYA 1S9DA 1G64A 3SHWA 3TR5A 2VPPA 3P20A 3TW4A 4Q01A 1I4LD 2RGDA 1VTKA 1ZCAA 5AWFC 2G0NA 2Q0HA 1VIAA 2QT0A 3X1WA 1UJ2A 2VHTA 3F5FA 1UDWA 2ZSFA 4JJKA 5ANRB 1HQCA 4GMDA 3ZIAA 3S1AA 4IOLA 1R2QA 4N0EA 3CRMA 4QBFA 2AR7A 1QZXA 2JJ2D 2XNSA 1TEVA 1HE1C 2ZRDA 4ACAA 2Z6VA 2QROA 4X8OA 1LFDB 2QAJA 2WAYA 5JWOA 2ZS8A 4D2IA 3RRMA 1Z06A 3EARA 4CDGA 2RB4A 1A7JA 4Q19A 1IY0A 1W4BA 4G5RA 3RSOA 3U3RA 2DYKA 4OQLA 4AG6A 1JQJC 2XTNA 2QAGB 4M1TA 4LYHA 1II8B 2FWRA 1PLLA 5F98A 1K8RA 3QF7A 5AUQA 2W00A 3UIEA 5DYIA 3TH5A 3TUIC 4ZCMA 1ODFA 1RRFA 3KXIA 1E0KA 2W6JA 2AKYA 1ZUIA 4HSEA 1Y3AA 1G7RA 4I81A 1T3LA 1IN6A 1UBEA 1VCOA 1EG7A 2WWHA 4PANA 2ZUCA 1KSFX 4ZDWA 1T5IA 2ZANA 3MWYW 4NU0A 1LNZA 3L8YA 4KAXA 3L8ZA 1JR3E 4JJZA 1CLUA 2O8FA 5EXXA 1WA5A 3GLGE 5CLQA 4M22A 1CF4A 4DDUA 4ON9A 3IO3A 4HZIA 3W5IA 3A1TA 1RRCA 2EFEB 4B3BA 1KY3A 2KBFA 2WWYA 1Z28A 3PEVA 4GMXA 5SZJA 4A9AA 4Q1AA 4B71A 3QF4A 4JLMA 4TLEA 2C77A 4LBVA 3V9PA 2QBYB 1S0UA 1ZYUA 2CLSA 5FBWB 2OSBA 2W0MA 4LJ8A 4B3GA 3QKTA 3UMSA 1KMHB 4LJ7A 1G18A 4O0MA 4C0JA 2GA8A 5EXSA 1ANKA 2ODWA 2QZ4A 4F93B 1PLKA 4HZUB 1QG2A 2ZE5A 4AK9A 1PLJA 3WXMA 1R5OA 3QXJA 2AL7A 1KJWA 3CH5A 3G0HA 4B73A 5JSZB 3I4LA 5JCZA 1KI8A 1R8QA 5EXTA 4DLUA 4Q9HA 4B2IA 4B75A 2ZJAA 2GWHA 3TIFA 2DFTA 4OQMA 4NYMR 5C4GB 1SXJE 1WDTA 2MMGA 4ZKEA 2VHQA 5CYPA 3GEIA 1WBDA 2ZRNA 1ZP6A 4RD6A 2ZRBA 3BAFA 3EG5A 4C2TA 121PA 1ONBA 3T5GA 2IA5A 4IEEA 5FUXA 1SXJB 2RGXA 2ANBA 4BRWA 2GK6A 2H8KA 1YKSA 3ADDA 4BLQA 2QSYA 4Q4AA 5DN6A 3AVQA 1ESNA 1KZ7B 1XPRA 3WMFA 1E1QD 2VHCA 4B2PA 4XH9B 4PSKA 2RH5A 3RC8A 1CP2A 1FUUA 4ZDJA 3AP1A 1OSNA 1YRBA 4PHTA 4PC7A 3ADBA 5KDOA 3PEYA 1BIFA 4A2WA 3THXA 1LY1A 2D74A 1G19A 1W1WA 2BMEA 4QHTA 3RHFA 1S4QA 3DPUA 4TMTA 1RIFA 2CXXA 2F3TA 3CBQA 3DM5A 1E0AA 2HV8A 2VP4A 1GKUB 1K5DA 1TU3A 1OXUA 1OJLA 2ZI9A 1UKVY 3AVXA 2FFBA 3JVVA 4OJKA 3RWMB 2BM0A 2E87A 4Q7LA 3KXKA 4RFSA 2PMDA 1KAGA 2QE7D 5DH9A 2W2TA 2CHVA 1YQTA 2WJGA 3FGNA 3DOFA 3P1JA 4R98A 3KKOA 3WP1B 1LW7A 3ZJYA 2OZEA 5DISB 2Z0MA 1N5KA 4G01B 3UANA 3THWB 2GVZC 3PUZA 2WMOB 4JKYA 1GRRA 3HU1A 2BMFA 2NO1A 1GZSA 2Z83A 3KDSE 3B1YA 4ZIRA 3PJRA 1N3BA 3CNNA 4URZR 1O87A 4EFMA 3L82B 4ZI2A 2H16A 3U4QA 2ZJZA 2ZS7A 3ZDQA 2F7SA 5TVKA 4OHWA 2XB2A 2P67A 1EWQA 2IXEA 1ESMA 2CLDX 4LJ6A 4URYR 4CYMA 2IXGA 2QNRA 1E0SA 5D3MA 5FBRB 3OEEA 3SJAA 1EX7A 2ZROA 3MJRA 4WZAE 1U2RA 4M9XA 1BMFA 3BJIC 5DE3A 3Q3JB 4Q7KA 2DWOA 5BN4A 2IS4A 1NP6A 4X8LA 4QHSA 1JJVA 4E22A 1XXHB 1W2HA 2VQSA 3DMNA 3BGWA 2QY9A 2RMKA 3U44B 2RCNA 2FPLA 3QKUA 4F91B 4FCWA 2CL6X 3HU2A 4PPGA 4DLWA 5HKKA 1JR3D 3THXB 1W49A 4A82A 1SKYE 5G3ZA 1YE8A 2AHOA 2JCSA 1UKEA 2ZRFA 3KQLA 4Q4LA 2ZM5A 1KDPA 1W46A 3TE6A 1PVOA 1ZD9A 1CJTC 5DNYB 2EFHB 2H92A 2IEYA 2JASA 2WVJA 3QVUA 3GFPA 4NHOA 3ZZ0A 4UNPA 2Q3MA 1WQ1R 2I3BA 3CLVA 2FA9A 2GHIA 3AKEA 3GLHE 3LXXA 5FL7A 2GEVA 4MKIA 1KDRA 2ERXA 4HATA 2PMKA 2VL7A 5FR2A 3BWDD 1WMSA 1AIPA 3AM1A 1G5PA 3EIEA 2UZ3A 1E9AA 3PR1A 2RHMA 5DSZA 1Z0KA 4RD3A 5FPKA 2BBWA 4ZPXA 3SR0A 2IWRA 4ZV4A 1EESA 3BFXA 3LBNA 5ELXA 5AJXA 1F2TA 3K70B 4Q02A 2WKRA 5E95A 4XVRA 1BYIA 1JXMA 4LHZA 4QFMA 1E2NA 2ZSBA 2HEIA 4V02A 1AS3A 4GOJA 2X2EA 4G5OA 1NG1A 2ZJOA 2ZRMA 4UNSA 1FNMA 3A4NA 1DADA 1Z08A 2W6JD 5FTNA 1OH7A 1DAKA 2QSZA 2GJSA 3N5CA 1F5NA 4Q03A 3R9XA 1QHHB 5FOUA 1J99A 3U7EB 1W36B 1DAEA 1S3GA 1M2OB 2PCJA 4MRPA 2FF7A 4NDZA 2XTZA 4OL0A 4C7OA 5B57C 2R6AA 3NTUA 3ZH9B 2D7CA 2AK2A 2WWFA 4DB4A 5D3MB 5FTLA 3Q9LA 4JMPA 3A1UA 1MABB 1E2EA 1VMAA 2CCKA 1I2MA 2F43A 2OV2A 3A4MA 4J0QA 1E2IA 2G6BA 4WVFA 4M1OA 1QG4A 1YZKA 4GBMA 5J4YA 2J0VA 1E2QA 4AKGA 4GT1A 3U60B 4FWIB 1TEXA 3WMGA 1NVUQ 5FOXA 2ZE8A 4G3XA 2H57A 2IEZA 4GSYA 4W5WA 1U99A 4Q4JA 5CK5A 3THWA 2ZSAA 3IQXA 3SC3A 4ARZA 1Q22A 1KK0A 1KAOA 1VDZA 1D6JA 1G7TA 2FSHA 4JT2A 2MMCA 4DBLC 1XBTA 2JLUA 3AP2A 2GVDC 3GJ8A 2QM7A 1G8PA 4DCUA 2A3RA 5CB6A 4M4SA 1GUAA 4BPBA 1OYWA 2IYUA 1NY5A 1J2JA 4QJ3A 4MRRA 4JBXA 5CM8B 2ZI7A 4KFUA 1ZM4A 1CIPA 3AGPA 3TQCA 3OIWA 3GJXC 2QT1A 1E1RA 4LOAA 3D8BA 3U6BA 2W6ID 5A4JA 1JQLB 3GLHA 1VCMA 5KSPA 4CVNA 5G53C 1N5IA 3NBYC 4QBGB 2ZQ5A 4R2HA 4URVR 3E2IA 5FI0B 2VBCA 2V7QA 1GL9B 1HV8A 1OV4A 2WWXA 2YZ2A 3SNHA 2VLIA 1ELOA 1G17A 2YINC 3QPUA 1Z6AA 4QGAA 421PA 1G41A 2IYSA 1FMJA 4A8JC 5AJYA 1SXJA 3TMKA 1ZRHA 5E7IA 5JLJA 2Q9CA 3T12A 1YZTA 2CCGA 4HAYA 2IXFA 3FYHA 4DCNA 4W7SA 2QQ0A 1UDXA 4H1UA 2R65A 1NKSA 3I3SR 4PZLA 1KIMA 1NVXQ 3K09C 3UK6A 3GLGB 1HURA 3ZYCA 2YWGA 1KKMA 2QM8A 1R0ZA 2D06A 2GILA 3T1VA 4YLGA 1FPMA 3O8RA 1NG9A 2FGKA 1KK3A 4PO8A 2WOOA 3SHFA 3W6NA 1ZU4A 4GOKA 1TL7C 2A5YB 2GXUA 4HB2A 5FPTA 3NHBA 5FUWA 4N0DA 3KJGA 4RD2A 4BGDA 3K0CC 3AF1A 2Q9AA 3ZQJA 3RABA 3SDZA 4V03A 4Q21A 2HCBA 1DO0A 2R9VA 3P4XA 2XOKD 2JATA 5JJLA 4HAZA 3KKMA 2V4ZA 3I5YA 1I2DA 2CK3D 4XD7D 4B48A 4CRWB 4GRAA 4TZ0A 2VO1A 1W4CA 1A4RA 2WTUA 3REFA 4D4KA 2QN6A 4FMCB 3BIFA 1QRAA 2RKOA 2A9KA 3IDQA 5JFGA 2WAXA 3TUJC 3FWYA 4MYCA 1ZC3A 2ATVA 2C9CA 1M1YE 3IBYA 4M1SA 2QRNA 4QJ4A 1G5TA 2F55A 1P62B 5EQTA 4IDHA 1XB2A 4RD0A 4BFUA 2NPIA 2WV9A 4HEJA 1LS6A 1TPZA 3UWOA 4LGMA 2XZOA 3B1ZA 2UKDA 1ZM2A 4LPSA 4AYWA 3FE2A 1G3QA 2OCYC 2RGCA 3VFDA 1US8B 2IS1A 4IDQA 5K8UA 1E96A 1N0UA 1UBCA 3EZ7A 2O8CB 1GVNB 1KI2A 4P4SB 4A6XA 3LX8A 4LHYA 1NF3A 1UBFA 1S1CA 1E94E 5J40A 4WXPA 2BJVA 4YMSA 3TUZC 5FUYA 1YVDA 1DS6A 1NMZA 4IOKA 2BKUA 4UXHA 2OILA 4Q9IA 4D25A 5IK2D 1IXZA 4L16A 4DT1A 2KBEA 2P6RA 2BWJA 4MH0R 2EU8A 4DLTA 3SQXA 5CIWA 1Z2AA 2IS2A 1ZNXA 1T8UA 3L0SA 4KLNA 3QG5A 1X8KA 1RE0A 3VNVA 4TQUS 4KBGA 1LF0A 4QGFA 1OXVA 4LHWA 4LV6A 4JLVA 2AFHE 4AC9A 4ZCIA 1HYQA 3R8CA 4TTQA 2NMVA 1O3YA 3GLGA 1IONA 3REGA 3FMOB 1HEIA 2AXPA 5JECA 2VHJA 4RY2A 4C0QC 1TNDA 2HLDD 5HZKA 5JRZA 2GJKA 4NH0A 2OHFA 4HUQB 2FX3A 5KSYA 4CEJB 2R6CA 1U0LA 4NPHA 3W8NA 2G88A 5C2JB 1RKBA 4HLDA 2A78A 3UXMA 3O8CA 4DCVA 4RZXA 5BQ5A 2UZIR 3QKRB 1QBKC 5TY0A 1DVRA 1W4RA 4CEIB 2BVNA 5KHOC 4P0TA 2WIAA 4TL8A 1KI7A 4LY6A 5KU1A 4A0HA 4PAMA 2NOAA 2QPOA 1XTJA 4E03A 1KDTA 2ZRGA 4NZYA 4EPYA 2HJGA 4NP6A 5EE1A 3CNLA 4C0SA 4B3FX 4Y0AA 2XITA 3CKLA 2J45A 4MGZR 4Q47A 2L0XA 5CM9C 4IVRA 4B33A 1H8HD 2O0KA 5A5GA 1UPTA 4Q1FA 1KI4A 1G6HA 3EZ9A 1P73A 3KUCA 1CULC 2N1BA 1W0JD 1DE0A 4JSTA 1QHYA 2FJUA 2J7PA 5A0FA 3ZZTA 3AKCA 4D80A 1KO7A 1P9NA 2QU8A 1NI3A 3SYNA 2GRJA 1OXXK 5HZHA 3EC2A 4Q5IA 3BS4A 5J5CA 1GP2A 2JLVA 3HYTA 1LF5A 2ZJ2A 2DB3A 1XU4A 2CJWA 1JAIA 5DIFA 1LB1B 2I4IA 4MKFA 4TL7A 1XPOA 2WZQA 2ZREA 4HAXA 3IQWA 1YHNA 2F9LA 4OBEA 2BBTA 4DCSA 4US2R 1MO4A 221PA 1UKZA 3D31A 3PCRB 5F9HA 3PEWA 4F4IA 1FZQA 2PX3A 2DY1A 1GL6A 1W44A 3ASYA 5G41A 1N6OA 4NE2A 3VKWA 1R5NA 1DAGA 1E9SA 3AUYA 2WPDA 3K9GA 2D7DA 3OIUA 4GOXA 1CJKC 3LQRA 4NCNA 4NONA 3CIOA 3IBGA 1WBBA 1FUKA 2FEMA 1KDOA 3T1QA 2IUTA 3IHWA 4LZZA 3RS7A 1NL3A 4PAOA 2YOHA 3W3AA 4KSBA 2QBYA 1M7GA 3R7WB 3GJ0A 2HYIC 1D2NA 2Q21A 3FMIA 4MDEA 2ZRJA 3TBKA 2B7BA 4TYNA 3NEJA 1E9CA 2J9RA 4BFSA 1XRJA 2ZVQX 5HTKA 4TMKA 3ZD6A 4C2UA 2XTMA 1H8HA 3BH7A 1T3SA 2ZR7A 4M9SA 1Z0FA 3FVQA 3HU3A 4G5SA 4PAQA 5GJCA 4UXIA 1HY3A 3AVWA 2HXYA 2W0SA 3V4FA 1E2DA 2YC2C 2PT5A 1CEEA 1VCNA 1ZNZA 2HDNB 3BH6A 3CZQA 2R6DA 5BYKA 1U98A 3RS5A 3SQWA 1G7CA 1E79D 1CKEA 3B6EA 2P2LA 1SXJD 1OLOA 5G40A 1G291 1AJEA 3OZXA 4HAUA 3GJ5A 1DAFA 3MGCA 4L15A 3V4RA 1RYHA 4LSGA 3NKVA 1CRQA 4M21A 1JAHA 3B1WA 1N25A 1XZQA 4HDOB 1XD2B 1W48A 4MUAA 5L3RA 4B35A 4EPWA 2CE7A 2BJWA 1SVOA 1G1MA 1FMLA 4JVSB 2IC5A 1XP8A 4B44A 3RRYA 1CR2A 2WJHA 1SKQA 1UFQA 2ZYUX 1TF7A 4DSUA 2UVQA 1GG2A 2ODNA 4JBYA 2HF9A 1SVKA 2GCPA 1OPXA 3QSYA 1QHNA 3LO5A 1DAMA 1T8TA 1G16A 4A8JA 1ZINA 2EFDB 2OEPA 4G5QA 3FFBA 1EFRD 4URWR 1GFIA 1Z6YA 1OH5A 3C41J 1COWA 1ETUA 2WJIA 3I92A 4DLZA 3QE0A 1QDEA 1QHXA 2FH5B 3FMPB 4KU4A 2BEKA 2CMKA 4NCKA 3ICEA 2ZUBA 2YVUA 4F92B 1NNEA 2N46A 3SI7A 1W7AA 1YU9A 4Z51A 3WRYC 1UBGA 2YJTD 4LYFA 5KUTA 2IYZA 1Z5ZA 3X2SA 4IJMA 2BBSA 3GJ6A 2EW1A 2O0HA 3C5CA 1G8YA 2AD5A 4NCJA 5FPHA 2ZYTX 1AN0A 3U3OA 3B9PA 3FMFA 1NVVR 1GL7A 2A5JA 4YMWA 3LVRE 4C0AC 2QA5A 4TYWA 3I1FA 4M9QA 3CO5A 2ZETA 5BXQC 2CL0X 1ZIOA 2I1QA 2XSZD 2ZAMA 3QJYA 4Q4HB 4BLTA 3L0OA 1SHKA 2XNDA 4RZ3A 4A92A 4QC2A 1PUIA 2ERYA 3OAAA 4FXPA 4JLAA 4LCBA 1A5TA 5DO9A 2KE5A 2ONKA 3ZVRA 2NPFA 3UMRA 3FOZA 4LC1A 3EA5A 4DHEA 2JIZA 1CR4A 4OK3A 5EUQB 3LNCA 4ACBA 2WOJA 1TTTA 3KQNA 2W58A 2DFNA 3CUEF 3QG1A 4JLOA 1JB1A 1ZD8A 4IXMA 3ASZA 2OXRA 3ADKA 3QY0A 3ZS9A 4D0NA 2V7QD 2QUZA 1H8ED 1P2UA 4Q7JB 5JBQA 1FX0A 3N70A 3TJZA 3AH8A 4RZUA 2Q3FA 1SVIA 1UF9A 2AXNA 4GZLA 3PQCA 1GM5A 4M1MA 1US8A 5L3VA 1OB2A 3MG9A 3NXSA 2OBLA 2OG2A 3K09A 5J4VA 2ZI4A 2QPTA 2FZ4A 2CVFA 4LV5B 2J0UB 2J59A 1AS2A 1HT2E 2PH1A 1XCMA 3U7FB 3G5UA 3AVUA 4OQXA 3X1DA 5B64A 2P65A 5IF9A 2YOFA 3K0CA 4QKQA 3CRQA 3TRFA 3VQTA 2CVHA 3BB1A 5SZKB 4DRZA 1KGDA 3DL0A 2QPAA 3MFYA 3K9LA 2GAOA 1NVVQ 3ZS8A 2O8BA 4D6PA 1E3MA 3AKDA 5HPYB 3CNOA 4IDNA 2AKAB 3GMTA 1D8TA 3TVDA 1ZUHA 3I8SA 3B1XA 4TTRA 1YZLA 1HE8B 2EFCB 2JAQA 2VHUA 1WE2A 1CS4C 4Z1MD 4OK6A 5KSZA 2A5FA 3KQUA 4YQFA 4NL4H 4PXAA 2TMKA 3C7KA 4BZQA 4KJZA 2GZDA 2HT6A 4AG5A 2FZLA 1PJRA 2QTFA 3NEYA 2V6JA 1G7SA 3BXZA 2YWHA 4Q7MB 1TF2A 1S96A 4X8MA 2FEOA 4PPFA 3SJCA 1MT0A 3WYAA 1E1RD 2ZRCA 3IO5A 4CZ2A 4TZ6A 4LI0A 3VR4A 1TADA 4Z8XA 3OFND 4EPRA 3KXLA 2ZE7A 2ZU6A 4WOPA 1NN1A 2IHYA 3VHLB 3ND9A 5JI3E 4I1SA 1EFTA 3VR6A 2QGNA 3OF5A 1OE0A 2HLDA 3CX6A 5HCNA 1KMQA 2OUKA 3QPVA 1R0YA 3P32A 4P32A 1SGWA 3CX7A 1OHHA 4A0RA 2ZJ8A 4RD4A 5JRJA 1VECA 2ZS9A 3FKSD 2F1JA 3GEEA 1MOZA 4I1VA 2YHSA 1OKKA 1ZAKA 3GLHB 5L8VA 1BYUA 3TAHA 4BQSA 2PT7A 1EK0A 4XVUA 3I8XA 1GITA 4WXRA 2OFOA 1OYYA 1RJ9A 1M74A 5FPSA 3UATA 4JLNA 2GESA 2CLCX 3ZVLA 1IJEA 2BV3A 1T91A 2NIPA 2OO7A 4HDQB 3THYB 4NTZA 3RRZA 1OB5A 1QHGA 3JZAA 1EX6A 1VHTA 2QP3A 3B2EA 3U61B 2XX3A 5GVSA 4XVQA 1EXMA 3K1JA 4ZCLA 4GFDA 1QVAA 5J4HA 1W0KD 4G0NA 2WWIA 2A30A 1L2TA 2CCJA 3VR2A 2GZAA 3MJHA 3GLIB 2A5DA 1MO5A 1A2BA 3H1TA 3QUSA 1MRNA 4OQFA 4ASUD 4WA7A 2PZFA 4CF7A 5TDHA 4DEYA 4FI3C 3N2EA 3LA6A 2OE2A 2RGAA 4IVPA 1BMFD 3BD9A 2RGGA 4QL3A 3Q5DA 1FQKA 4QXAA 2IYVA 2GJ8A 4BZXA 3X1XA 1MABA 1P60A 1IN7A 3NH6A 1J90A 1OFHA 3RC3A 4S35A 2NO6A 4URUR 2X77A 4CEHB 3Q7PA 1VG0B 2C2HA 4LYJA 1XTRA 3NWJA 2OLKA 3LW8A 5H70A 3H4MA 3BRWD 3UMFA 3CX8A 3T1OA 1CRPA 2NZ8A 4PHFA 1J70A 2J0QA 3Q7QA 2HUPA 2VP6A 3QPWA 1GRNA 5FTJA 1QHHA 4B2LA 3VU9A 4TYYA 4I1OA 4MGKR 5TV2A 1ZCBA 4EPXA 2CNWD 1P75A 3EAQA 4TQ9A 3TKLA 3KJEA 3Q85A 3DVLA 2B8WA 4ESHA 5AUPB 1KNXA 4TMXA 3T5DA 3OEHD 1F2TB 3VNUA 1JR3A 4JYCA 2IYWA 1YRAA 1A82A 4W9MC 1W0JA 2CL7X 2V1UA 3FHTA 1E4VA 3DO6A 4JLBA 4EJSB 1U9IA 1EFCA 4PHHA 1OW3B 4AIIA 1OIXA 1T0HB 4DLYA 2O8FB 2DCUA 1Y63A 1DTSA 3VTKA 1E9FA 5KDDA 2JEOA 1XZPA 3K9HA 4PQFA 2VF7A 2ZR0A 5BN5A 2ZEJA 5K8TA 5KNCA 4XWAA 2FGJA 4O3MA 2EFGA 3KJIA 5E3HA 1E32A 2D2FA 1XD2A 1ZU5A 2QAGC
chains in the Genus database with same CATH superfamily
1S3FA 3KHSA 4R1PA 3UFXA 1JYSA 2IHBA 2JGFA 2VF8A 3PA8A 3EF3A 4KO2S 4TWJA 4BMXA 1NW4A 1WSAA 3PWTA 4ZCSA 2X1HA 3K92A 4ZO4A 3C39A 1FMCA 4KE9A 1SR8A 3U1BA 3CSSA 5C9ZA 2NO0A 2H48A 4LFAB 4NNPA 1YVRA 2VTKA 1T1JA 3IAS1 1JTVA 3SKVA 1QB7A 4GKJB 4HB3A 2IYOA 3UH1A 1AA6A 5JASA 4ZD6A 3ZG6A 3FOFC 1WMAA 5FLYA 3SM9A 1UP6A 1EWVA 4KMSA 3SJ7A 3GCWA 3OE5A 1XELA 4TL9A 1FY2A 4CTJA 2HJ9A 4CN8A 2QRZA 4JIMA 2AE2A 4LG1A 1XTIA 2NT4A 2K5UA 3QVSA 4ECEA 3WDMA 1KEWA 2XIJA 4EENA 5JS8A 4RKEA 1IBRA 3QPAA 3PS9A 2JGEA 3CR7A 2RDMA 2NUAA 3I73A 3LCUA 5HF6A 2PUJA 4GEKA 4RYDA 5EE3A 5EWMA 2JL1A 2NO9A 2WTXA 4OXQA 5ALNA 4M8NE 3KTOA 4C0KA 1GADO 1HE3A 3A7EA 2IHKA 3U7JA 3KXPA 1YIOA 4XDYA 3UMJA 1H0KA 5HM6A 4UBLA 4NFLA 4DT1B 5JFTA 1VYVA 1PHPA 4MI1A 3B5JA 3ZLVA 4KR7A 4JB3A 1VFNA 3G9QA 1N36B 4BQEA 2JCGA 2Y1CA 5JXHA 2A2ZA 4YRNA 2QTZA 2JLRA 1Z74A 1D0IA 2O8BB 4J0IA 4G63A 2RGNC 2QUIA 5LWQA 4UASA 1IJFA 2W11A 4AUNA 3ETNA 2PJRA 1P5RA 5JZBA 3QYFA 1CFZA 4KWEA 4AWXA 3EEOA 1KJYA 3W5JA 4M36A 1KHTA 5JDIA 3BH0A 4WJKB 3LP6A 2NU8B 3L92A 5HFJA 4EG8A 3W78A 2OAP1 3G0OA 4V0OA 5SZIA 4MYDA 4YECA 1GQQA 2AC4A 4PSDA 4Q3EA 3RJTA 1QQ5A 1OTXA 3AP3A 2MSCB 2I62A 1UIMA 1H2XA 3TTUA 4EF6A 1EVJA 2BGIA 3MLEA 1A7AA 1HNNA 1J9EA 1TIKA 1S4MA 1XLUA 3HV2A 4IX1A 2GAFA 3A3YA 4P92A 4MP8A 1RT9A 4K5QA 1IQUA 2ZB7A 5I6DA 2G9ZA 1IZZA 3KCNA 2YX1A 3VJKA 1E5XA 1Z73A 4GGMX 5CMLA 1VBKA 4RA9A 3GRKA 3TPFA 4B7XA 1PU2A 1JIJA 2BKLA 3VTFA 4AJPA 4COKA 4ANFA 2HXGA 4B34A 2IHVA 1CIJA 3RHSA 1T3GA 4GQBA 4KRGA 1ZW6A 3VSEA 1NR7A 3I0NA 4DOMA 4GWKA 3NAGA 4KUGA 1G6OA 5AVSA 1MV8A 1WW2A 3H9JA 4HR7A 1QX3A 3DR3A 3GUYA 2FK8A 1K68A 4O2RA 2QMQA 1CJMA 4KUHA 2YHBA 4O25A 5IAGA 4C4XA 2BE9A 4ND7A 2CYAA 4JGGA 2BBOA 2Q2WA 1X3SA 3JTEA 1W34A 2WD7A 4JV5B 3WK8A 1Z4IA 4OQNA 2JIBA 4YY3B 1LFAA 4C05A 3HSSA 3O31A 4CV3A 4U7DA 2LBPA 2VBGA 3A9CA 4KR2A 2JLWA 3DEYX 4E4TA 3OU2A 4OFXA 1I0IA 5ARDA 5M04A 2KJQA 3WIDA 4RPKA 3RFUA 3KB2A 3IXQA 4Z4IA 2PFSA 3GNLA 1NJ2A 4TN1A 3RVKA 1GOTA 3JQAA 1GHTA 3C98A 1BH2A 1FRFS 2HGSA 3OF3A 3QX7A 1IWPB 5CNMA 1I4TD 4ZXFA 3RFVA 2V9PA 2QYOA 1N2CA 3CT4A 1AGNA 1ZNYA 3HS3A 2IT1A 3WLHA 2XDAA 2ZB3A 5KNDD 1UOQA 2OGZA 3M49A 4OXRA 2DUWA 4O08A 1WV0A 3VZPA 4PWYA 3STTA 1NVTA 4CUZA 4JY7A 3BA6A 4G5XA 4RSRA 3QXXA 1AUQA 1PV2A 3P9QA 4NYIQ 5K6TA 2AEMA 1XX6A 3BDVA 2AFVA 4CT4B 4D26A 5B53A 1Q2XA 2Y2UA 4QOHA 2O0LA 4DRYA 1RQGA 4TTTS 4U2CA 2J3DA 3HO6A 4Q39A 1ZUWA 1X9GA 1ZZGA 2WYOA 3CVJA 5HX7A 2MR5A 3S5JA 5I4IA 5B3JA 1GA6A 2P9JA 4JDUA 3IVAA 5CDGA 5JNVA 4C0LA 3N8GA 5ESRA 2ZKIA 3K53A 1SG0A 5L3SB 3PGLA 3OWXA 2H08A 4K6HA 4ZOLB 3T6KA 3QBJA 4AT1A 2C4WA 3RBVA 3SHQA 1VG9B 1RJ9B 3D81A 4GSLA 1RKVA 4HGPA 4HMOA 4DN6A 3DVRX 4EY6A 4MJXA 1RLIA 2B2NA 3N7TA 2POCA 3FY4A 4OI4A 4YR7A 4PC3A 1MRSA 1OLUA 1U31A 3S2UA 2IKSA 4YUZA 1QK5A 3OCJA 1K0FA 1M2WA 4WDQA 2IBMA 3FHOA 3FNRA 5E0KB 4KEAA 5AVKA 3S5UA 4AJNA 1XL0A 3LPAA 2DKOA 1KOFA 4DQUA 4W6QA 3F46A 2PRIA 4MUMA 1EXNA 1ZM3A 1HZJA 3R6GA 1RCUA 3IAFA 4RPJA 4ALKA 5BWMA 2FRXA 2J85A 4WZ6A 2DUJA 1YDGA 5AW6A 5MN4A 3ZCRA 5D7NA 3ZDBA 5UKDA 3R9WA 1V7CA 3R5KA 5DEIA 4DJTA 4EMSA 3WAKA 2UZ1A 2WSSA 3W6OA 1X8LA 1Y8QB 4DIEA 4WK2B 5AW2A 1TQ6A 3QUQA 4IDOA 1U2ZA 4OH7A 2G80A 5KZMB 3MWLA 2BIFA 5KTSA 1QIMA 1BEZA 4TXHA 3BBPA 4BASA 3MBKA 2WHXA 3PITA 2FPGB 2DUUA 3CEMA 1KI6B 2B36A 1V6SA 4D9HA 3PENA 3PHJA 2JLQA 3ECAA 1OLSA 1GNTA 2FPUA 3P0RA 2B2CA 1WXFA 2B4TO 5KVQA 5EHZA 3U9LA 2HU5A 4BY9E 1RHMA 1WUTA 4Z54A 1AUPA 5KNBA 3SS7X 1N2CB 2HLNA 2H1RA 1HGXA 3GIWA 4C14A 2X9QA 4J6EA 2D3WA 3DAPA 2QG4A 4PWZA 3PXAA 5HK9A 4CM4A 1WZ2A 3WY9A 3CUVA 1NJGA 3KXDA 3BRWA 4HRXA 2H2WA 4KQJA 2WQ6A 2NADA 1EMDA 2JA2A 2ZB8A 3CLHA 3LDHA 4ZQIA 3RAEC 3FZGA 4JITA 3QX3A 1F2UA 4DMLA 1QWSA 3IILA 4WPGA 4QOFA 2A86A 4RORA 2IPXA 2FW1A 3X1JA 2J4CA 2VVTA 5DHAA 3QLUC 3QPBA 5EUCA 1Z9BA 2ZRLA 3D5TA 2NGRA 2NQ2C 2PT9A 3A70A 3R5TA 2R5FA 1EBBA 1W59A 4IO0A 5GVRA 5AW4A 1D2MA 1XAIA 2Q8PA 3PUWA 1KK1A 3N87A 3ZWQA 4UBOA 3ZIAD 2ZI5A 1WB6A 2FN4A 2FWJA 1NMXA 2X0DA 1YZGA 4N1AA 1DQPA 1WUHS 5LB2A 3O82A 1OXMA 4XSGA 2XGJA 2V9CA 4H3VA 4EFLA 2AUTA 2EJCA 3EPRA 3NPMA 5GM1A 4BL5A 4E2WA 4ZQCB 2Q3JA 2R8PA 3GQVA 4NBUA 1HH4A 2JFFA 1S8FA 2E4UA 2UYOA 3D8UA 5GQSA 2EZ8A 1N92A 4WOJA 2XE6A 3FYUC 1SULA 5EE9A 2ZBVA 3T61A 2ZJBA 3E9MA 3ZKAA 1EA7A 4L2IA 1V41E 1BW9B 3EISA 3I3OA 2YZGA 2NACA 4QTTB 1RRKA 4KO4S 2B37A 4MUKA 2BM8A 1Z0IA 5K2MA 2IUUA 2C04A 5LM3A 1VLQA 2OV4A 2B5VA 4H31A 3V32A 1SQ5A 5U4XA 2VRNA 1T4BA 3EUAA 3MTEA 3HC7A 4JOQA 4CQJA 1JTEA 2ZUDA 2OXFA 1A9XA 1UFKA 2G4CA 1P5JA 1Z6TA 3WLEA 4BGIA 3V8RA 2Q4DA 4U39A 1JQDA 2AN9A 3T54A 3OHSX 4U2GA 5TARA 3O7MA 3PYXA 5H4HA 1T2CA 3K73O 3VC3A 1E2KA 4YRJA 4BN4A 2V7UA 3CF4G 3RAFC 3LFHA 1QF7A 4N49A 1CQIA 1JLMA 1GTZA 2GCOB 4M0MA 3IIKA 4P7JA 3G1TA 1V26A 5EVJA 1XKLA 5FXMA 3T5BA 4E2ZA 1JSCA 4QOSA 5DNCA 4JUDX 3OSUA 4D0GA 5KSWB 4RS4A 4Z3OA 3QKRA 1JECA 1DXOA 2C97A 1PQUA 2JC3A 4Z99A 5DXAA 1OFUX 3DW3X 3VR3A 1RI2A 4OXYA 1XIVA 1GKKA 5CITA 4OHYA 2LV8A 3EQZA 3MAAC 3IEVA 1Y0BA 4BRSA 2X7XA 1JQBA 2PX0A 4KQGA 1FZTA 1CY7A 3A36A 3HGQA 3DDZX 4CCYB 2PHZA 2GM3A 2X4LA 2GO1A 1L4UA 1UKCA 2GJ4A 4UHEA 2WG0A 3RUAA 1M1NB 3ISJA 3M6FA 4IXNA 3NHKA 1E99A 2OHIA 4URXR 1F5SA 1SCKA 2X19A 2JAPA 4ZYWA 1E3IA 1DLIA 3BJRA 2OENG 5TR9A 4QASA 1NLUA 3E4DA 3OT1B 4W8GA 5EHNA 4P53A 3T3HA 1O8BA 3I9V6 1Z38A 4RQTA 1XSEA 1VIYA 4XDGA 4Z0PA 2VQ6A 1XZDA 3TMAA 4B4KA 2OA0A 2IHZA 1O95D 1FP1D 5DDIP 3O74A 3SZMA 3KKEA 4V38A 1E6MA 3HCWA 5AJZA 5KVCA 4MV4A 1A2OA 1UMDB 2PX5A 2COUA 3FUTA 3LRPA 3M82A 1HDCA 2GCNA 2W4QA 3P9NA 3IX7A 3SIXA 4A5OA 4A8JB 3UKOA 2PV7A 5FA8A 2O8DB 1Z4NA 4JUAA 2GS9A 1DARA 3K2IA 3OI7A 2REBA 5DTRA 4NSNA 2VSFA 1KKLA 2CE2X 4M76B 4D43A 1S1MA 4YYEA 1N0HA 4R6WA 4ZQEA 3S68A 2NVUB 1H66A 3ENNA 2R6FA 1L5KA 2OCGA 1NXPA 2X2PA 2OAQ1 2ZAGA 5BR1A 1PBNA 5GINE 3VR5H 2QENA 2VT6A 1M75A 2KPOA 3TCNA 3ED1A 5BSMA 4AJJA 2ZBFA 3IR7A 4RLFA 2WF5A 1MAVA 3AL3A 3QHQA 3RH0A 3W77A 2R48A 2A7XA 1R10A 4GVPA 4QVKA 4ZOAA 1QV7A 1AQYA 2XUFA 3NBXX 4HCJA 1ADYA 4JVLA 5H3CA 2I91A 4M1WA 1WXIA 1N6PA 3F4BA 3H9GA 3MRTA 2OMKA 1QVRA 3L7BA 3TS1A 4F5YA 4KITB 1N5JA 5CU7A 5C1BA 4MB2A 1OJ7A 1PDVA 2J9FA 3OZAA 4HC4A 4GEGA 3C3YA 2H2IA 4WTOA 3ORRA 1YFKA 2CJYA 2GEKA 3KK0A 1U6KA 2GZRA 3T5CA 3TSZA 4PN3A 3NTOA 5IVIA 2DETA 4MMZB 5ERGB 1R15A 5P21A 2VATA 4LTDA 4JJ7A 5KC9A 2L2QA 1G9SA 4O4JF 3PKIA 5A2QA 3LDUA 3EIHA 2BFEA 2V55B 4N4AA 3U40A 5JMTA 1CUXA 5SYNA 1NW8A 3GFOA 4YXFA 1Z8FA 2Z4SA 3GLFA 3CC8A 3GRPA 4IUDS 1AF4A 3PQDA 1WXGA 3LAWA 4OHKA 2V54A 3HY3A 3ZDDA 3IAAA 1ZEJA 4FJ2A 4NJMA 2WBLC 1E79A 1PJQA 2GETA 4O2LA 3FCEA 5GGYA 2GEFA 4MYUA 3NVDA 3PA6A 3GN1A 4IDPA 3WBKA 4CHGA 3PXEA 4HDRA 5G02A 5F9FA 3O8DA 1JBQA 1YZ3A 1QB8A 4PLCA 3ONWA 2ECKA 3K6RA 4N65A 5DXFA 3IRVA 1AS0A 3UCEA 1BD3A 1NASA 1A8SA 1R8XA 1DCFA 1U9ZA 2OHOA 1E9DA 2PMFA 2GF0A 2PU5A 2VYNA 4P38A 5IASA 4I7EA 1X7ZA 4LQDA 1M2FA 3IVRA 4BNWA 5IT0A 1TUIA 3GP3A 4CNBA 2LIVA 5EP1A 4E08A 2OV1A 4PZZA 2FSGA 3T1TA 2H6EA 1MP0A 1Y1KE 2YRWA 4MPDA 3NHLA 1G8FA 4POAA 3VDQA 2H1OA 1YMVA 1J22A 3BF7A 4RELA 5LYYA 1OLXA 3LQQA 4LAFA 5D87A 2PZEA 2PUWA 1DFIA 3MXOA 3LXUX 4E11A 4EDHA 1Q92A 3OQVA 2PLRA 2ZUVA 2IYEA 1Q1GA 1L5SA 3B6JA 3QXHA 4D98A 3NHZA 1FW6A 2BCGY 1QNLA 3I76A 4CTKA 1M67A 3A6JA 3LJKA 1G3RA 3K0HA 1VCIA 2PGJA 4BAUA 3ZNNA 3UOGA 3CG4A 4TYQA 4N03A 1VDMA 3B82A 3OTQA 1J07A 2AMVA 4E31A 3NRJA 1UH5A 4ENQA 5ALJA 3DKPA 4C6RA 1QWOA 5AVQA 3GNTA 4JVNA 2A1TS 1TAQA 4NOMA 2QY6A 5IVKA 2ODEA 4EECA 3FHCB 4KUEA 5F2EA 4DIFA 1PEYA 2KWIA 1KGSA 4JFAA 2QTTA 3TAXA 1JGTA 1WX1A 2I03A 3WGLA 3ZWYA 4MHTA 4LMPA 4XSHA 2FP4B 3RW9A 3HO1A 3JVIA 1EU1A 3GA0A 1IY2A 3WHIA 3PK0A 1QRUA 4ZOCA 4O02B 2P9HA 4K46A 1U8ZA 4X44A 1RHUA 1G63A 1SU4A 1NNUA 4JUFA 4BECA 5IXYA 3SBEA 4UATA 2CB0A 1K6MA 4OA8A 1XDZA 1PV1A 4EI9A 3ZDFA 2Q5HA 4MSUA 1DKNA 1XA4A 2VP3A 4P7KA 3HGTA 1E9RA 2XMPA 2AOTA 3G59A 1K75A 2RFLA 4J0JA 4P0QB 2WSIA 4EFKA 2MDTA 3EEIA 1X6VA 2SKCA 5KQRA 1Q1EA 2A0WA 1P3DA 3A05A 4IFTA 5LR6A 1OU4A 3AEUB 4MRNA 1PWHA 1PD1A 1V37A 3I6BA 5AXCA 1OXSC 3SZRA 3E9YA 1R6DA 3W9BA 2EWVA 3RS3A 4RSGA 1G8HA 3UHJA 4Q7EA 2QTCA 4PHCA 4R54A 4J07A 3O93A 3FGZA 4GX5A 1BDIA 2C82A 2ZW9A 4QJIA 4PLZA 1OZFA 3H65A 2V5AA 2Q7OE 4ND8A 5F64A 5JPCA 1TJPB 3A9VA 5CHEA 4YO8A 5C1IA 4CU5A 2NZUG 1YMUA 1AGRA 2ISSD 3CNQS 2REXB 4DIDA 1T5TA 5JXIA 4PPQA 4R4JA 2XJ9A 2AA3A 4CG1A 2VQFB 1B7GO 1T5SA 2WJVA 2Z6QA 3AWDA 2PWBA 4HDNA 3SQOA 5TQVA 3CVWA 3CKMA 1ZUD1 4QUAA 1DBSA 5DGHA 1KSGA 2IIBA 1DAIA 5JYBA 3SXUA 2G9UA 1H9BA 1GKIA 5K8CA 3TVTA 4OB8A 3S40A 1NBMD 1LTHR 3IAXA 2IP1A 3JAWA 2PGIA 4Q4DA 3DQQA 1KYVA 3EX7C 1MEEA 2G0AA 4KI0A 1HDEA 2YJGA 3C4JA 3G17A 3LA8A 2DMRA 3FSRA 4HPXB 2NUAB 1ISRA 2IYLD 3VVMA 1KSJA 3ICQB 4JEMA 2F1KA 4M9RA 4TMZA 4LGYA 2QW8A 4REOA 4DUGA 5A9RA 4P4UA 3M6AA 3N76A 1R3UA 2Q3BA 1DKUA 1KA9H 5J9FA 5C8XA 4JI2B 5KPJA 3WMEA 1DKRA 4F2WA 1T9HA 4AZ0B 3SFVA 3OUUA 1Z07A 2D2EA 4H7EA 3Q5GA 1TM3E 1OWMA 1S3IA 4MUBA 3NNSA 3IAEA 3K3PA 3CUKA 5HE9A 3LL7A 1AMUA 4XGQA 3A9WA 3F98A 4FFVA 1JHUA 1XMXA 5AHKA 4BFZA 5K0NA 3T4PA 4BXOA 1BDJA 3PWSA 3KUDA 4DDVA 1OVMA 3OAAD 3R7LA 4ALMA 3DZGA 4OLJA 4HH1A 4EHIA 1PR3A 3IUEA 3AF3A 5KNCH 1R9MA 1L3CA 2BY4A 3KWLA 3LT4A 5JEDA 3RS2A 2ZRAA 2BUAA 1ZMRA 1ZUNB 5ALHA 3BXGA 2OHVA 5CH5A 1U2SA 4PYIA 2I6FA 2W7TA 4L9SA 2OAGA 4BN0A 2ZZNA 1Q0TA 1NVEA 3EEQA 2PSFA 3G5TA 1NR1A 3O1HB 1NATA 3A4LA 4MGYR 4YROA 13PKA 4RY8A 4PG8A 4PN7A 1OF1A 1P9LA 1I6KA 3NFRA 4FS8A 4K03A 3LV8A 4IJ5A 1FJXA 2PZGA 4WW0A 5AUNB 4OBXA 1HL3A 4PHGA 4URFA 2GN8A 4S2EA 3G23A 5EN4A 5D3KA 1G0NA 4KXXA 1EFRA 4H6XA 2JA1A 4Q6BA 4J7CA 3L4EA 1KNQA 1WXWA 1AKYA 4RETA 5BV0A 1CK4A 2WWVD 4JC4A 1YJ8A 3RVSA 3FPGA 3D4OA 2EBUA 4R2WA 3ZHVA 3E7XA 3DTVD 1XUOA 5AOVA 1V5WA 3NV7A 3K6JA 2P2NA 2FFQA 2WIKA 1XFDA 1NW6A 2FKNA 3OKCA 1AKVA 4AB1A 1I80A 2PRKA 4JR0A 4C4OA 3LO8A 5AVWA 2WUGA 3MT9A 1FFDA 1N6LA 1QQ6A 4ZRMA 1FTSA 3TR0A 1P1KA 2VIIA 3RD5A 1POWA 3GQBB 1THTA 2PX2A 3AI3A 3LC0A 5DBEX 3J81k 5CJ2A 2HDHA 2IRWA 4HQKA 1GAJA 2ZI6A 5BMOA 1MAAA 5ERXA 1KU0A 3P26A 4LXQA 3FETA 1A76A 2VI5A 3MTJA 4K88A 4LI3X 3ICOA 4C22A 4BLVA 3LIPA 3DBRB 2P1RA 1CHNA 4OHFA 5EVCA 2IDJA 2RHCA 3ODPA 2PGNA 3Q4GA 5D7BA 3N28A 2QP4A 3E9QA 3QVVA 1UJMA 4E09A 3EGEA 3MWJA 3SMQA 3ZBUA 4J2HA 5JNSA 1U8XX 4FD3A 2XQFA 4GP6A 3HI6A 5AW8A 3HWSA 3CZCA 4DSOA 3I2YX 1OBCA 2W43A 2JB9A 4JYPA 5AQ1A 2I9PA 4EAQA 3X1ZA 2PPVA 4UM9D 1I6WA 3GJ4A 3QOXA 2EBWA 4HTAA 4ZU3A 2C5HA 4PC6A 3MVEA 3H2ZA 1L9XA 5IJ0A 4GL2A 5JSYA 3PG5A 4PQYA 3L8GA 1GTG1 1MZVA 4JSYA 2HIAA 4PYOA 1GCAA 5EZ6B 1NU6A 3WGNA 1SG6A 3SYLA 2CYBA 2PSJA 4JEUA 1M1YB 2IY7A 2FDRA 4TRJA 5ALZA 4PLFA 3E27A 2RB5A 2X1MA 1KK2A 3CX4A 2IKQA 5JQGB 4RULA 2H31A 4ONEA 3TQFA 5CVCA 4D3FA 4BGUA 7MDHA 4C3VA 4LISA 3U3ZA 1N6IA 3BD7A 1FL9A 1M7HA 1WY5A 4MJLA 3MJFA 3T9AA 1U7DA 3EPJA 3RT7A 1BN6A 2JDIA 1FFWA 3Q72A 3HJBA 3R7BA 1CDOA 3RSCA 1JKXA 3P9XA 4LJ9A 5B1EA 3GG9A 1X86B 3MTQA 3LS2A 4IWYA 4PO1A 3UUFA 2B5WA 4A91A 5T6MA 3HEBA 4X62B 2DPXA 4K9PA 4TPKA 3H4IA 1UQRA 4E07A 1RWQA 4XUGB 1MOPA 1TZJA 4Q4JB 1UEJA 4KQ1A 4P8RA 1E1CB 2Z2ZA 4PQEA 4YV7A 2AI3A 2UYCA 3G8YA 4C88A 4X1YA 4K2AA 4WFJA 1BO6A 4J29A 4DE5A 1SU8A 1F12A 1RXIA 3EVBA 5H81A 2Q9BA 2K87A 1EQ2A 1D1PA 3UHFA 5I7SA 3FSGD 1YBHA 4F86A 2ZIUB 4BNYA 4DR5B 4X20B 4Q48A 4R2JA 4WOKA 5A4DA 1PZHA 3STHA 1SVMA 2AUMA 4DJAA 3BQNB 1ECGA 3QW2A 5JAZA 2FFAA 3B1JA 4H1HA 1TW2A 1GTSA 3A06A 1UP7A 3ZWPA 2A9JA 2LW7A 3TXAA 3GRYA 3UA3A 2G1PA 1KJJA 4G1EB 4NZOA 1I51A 4A1OA 1SM4A 4X91A 4EHJA 1BG6A 1BEUB 3HFSA 2GNOA 1R50A 2P6OA 4LDPA 3W8FA 4C5AA 5T41A 5BN1A 4JBNA 4CMJA 4TT3A 4D5GA 4NR0A 5LVAA 1A9PA 5LXTA 3WDKA 1G20E 2V59A 3P0HA 1AC5A 2NX2A 4IAOA 5BN3A 1ZN7A 3MWEB 5ALEA 5JD6A 3SHTA 3GA7A 4TS1A 2W90A 4LZNA 5JMPA 2JJ1D 3RKRA 3OJOA 4RL6A 4B6FA 4M98A 5D85A 4ZJYA 2ZB4A 4NBSA 1X8JA 1U0JA 1XT6A 2VYND 1DHTA 2VEOA 1DPFA 2Z58A 4TLBA 1VG1A 4MB6A 4D8TA 2W2LA 5KSOA 3ETEA 3IKJA 2ET6A 1NLFA 3JD2A 3VC2A 3BL6A 3AIKA 2JIOA 4FKZA 5E9JA 1Q1BA 4PONA 3U80A 3E9EA 4INZA 4D0LB 1RZUA 4UUQA 2V3WA 1WZIA 2O4CA 4P93A 5A1JA 1M73E 5JY6A 1QRRA 2BMVA 4MGIR 3QV1A 5J2TB 1C9KA 4U7HA 5CM2Z 3K6SA 4P2GA 1KWGA 4EY3A 3NM5A 2R2GA 2RI1A 3P0FA 4FFLA 3TAUA 3BK2A 2B9VA 2Y9MB 1AA9A 3ZVNA 5AUOB 5CYOA 4B17A 1U0GA 4KODA 2ZGVA 4PGHA 2H3HA 1P5ZB 2I7DA 2XBLA 4HXGA 4WKOA 4O4IF 4BJ5A 2HRZA 4HN4B 3BSFA 2EOAA 1AURA 1WMFA 3UKDA 5IN5A 4MPTA 3QXSA 3LCRA 3QEMB 3E1SA 2G3YA 2BRUA 4F4JA 4DY4A 5JOQA 4DM3A 3EPHA 1JDZA 1OFVA 3FNBA 3RSLA 4JBWA 3HLYA 5ER6A 4EWLA 2PSHA 1QFYA 2HMSA 4NCIA 5JCPA 2F6RA 4BFTA 3ADCA 1GT91 4R84A 4ARBA 2FPMA 1WCXA 3ETGA 3PVSA 4B6EA 1F0PA 4RJTA 1JE0A 1Z39A 5A4FS 2Q0SA 3R9IA 2BELA 2WUDA 3ETLA 4HXFB 4DZZA 2BOVA 4WMLA 5C34B 2OORA 4LF7B 1YR6A 3V8BA 1T2AA 4KDEA 3FNIA 1F1BA 1XV5A 4IXWA 4R9VA 3EXIA 3UJ6A 3QX8A 1P19A 3C3CA 3COVA 2CFRA 2ZT8A 3PNPA 4HAIA 4MVJD 3STVA 1I6MA 5ICMA 1N77A 1SRQA 1QQTA 1QVZA 1ZIYA 2CNLA 4PQGA 4UNNA 2QLMA 4REMA 2IOQA 1JEOA 3VU9B 3PFNA 1GNQA 4QQKA 5CJPA 1ESEA 3DKIA 1CY8A 1L5YA 1TW3A 1W88A 1R9GA 3IEKA 5BRNA 4DCTA 1UJ4A 3FKQA 3OZ7A 3VRHA 4DQDA 5JATA 1L4YA 4CCWA 3FDZA 5KWEA 3KFLA 5K09A 2F67A 3UY4A 3IL2A 2UAGA 2QZJA 3O2NA 1NBEA 4PM4A 1WF3A 4D4LA 3PB3A 4JI5B 1F2VA 1NNLA 1U94A 2WJJA 3F9RA 2PWPA 4JL5A 4OKSA 5FOVA 1I9GA 4ZC8A 3ZGXA 1CRZA 1I5OA 3A04A 4JLKA 4RA6A 1SBQA 2ID9A 1K9SA 3SN6A 3SZ3A 2SECE 2ZJ7A 3FFAA 3O4JA 3LSYA 1N3LA 1SKAA 3Q8XB 4II3A 4MOWA 1M1ZA 3KYDB 3OEWA 2R8BA 1H05A 2ZZKA 3R5SA 4TS9A 4ZT3A 4WJLA 5AESA 4DV2B 5IBQA 2W2XA 1XU9A 1AHNA 2JIPA 2Q0XA 2RK3A 2XUPA 3QFHA 1YA8A 1JL3A 4MS3B 4TZTA 4XB6B 3UAYA 3LP5A 4BLSA 5GTDA 4HT3B 3T52A 4GKAA 1XEWX 5K9ZA 5K99A 4A0SA 4DV0B 4J1NA 2ZSEA 4KXMA 1NQAO 1HT3A 4BJHB 2H11A 1DDGA 1NQVA 1YOVA 1N2EA 3HXKA 1JDBB 4TWAA 4CIDA 4YUWA 3TRDA 3ZZUA 1ZM7A 2O7VA 3VDRA 4JJ6A 3DAHA 3C6QA 4JKOA 1NOIA 2NTNA 1U6IA 4L08A 4GX0A 3NVKI 3AQ4A 1VGRA 4QUDA 2Q7DA 3WQBA 1ZCFA 5LC1A 4EB3A 1V48A 1MJHA 3G0CA 1JDSA 3UV3A 3HJCA 4IG9A 2IYPA 4DYDA 1UEIA 1NXWA 1V3TA 2FR1A 1DBPA 5F1YA 3RRBA 5TE9A 5KPDA 3TLKA 5HBRA 3KZVA 3LKZA 3NGXA 2WWGA 5GOTA 3BGIA 1K08A 2JGMA 1HQDA 3AEZA 5BYJA 2QTMA 4A10A 5EUMA 4D1YA 4CR7A 1KO4A 2HMAA 4KX5A 1Q0UA 3SBDA 4N5LA 4BDTA 4UBKA 4M9UA 4A23A 3O1LA 2Q3HA 2DKFA 4YRCA 4NG5A 4RHFA 2QMHA 1O1YA 4C06A 3GRVA 3VVCA 2XY4A 3VMFA 2YMLA 4FOOA 4I8IA 4PNZA 4HFMA 4QUBA 5EP3A 3SLKA 5LN1A 2OP1A 1PR2A 4C0XA 4LRWA 4CEIA 1JR6A 1JWBB 2D4HA 2BDUA 5EIEA 4ZOEA 4X65B 1BVRA 4I5DA 4IHKA 3RWOA 4ZI7F 2XWJI 3IJRA 1CUGA 1I9CA 3PE6A 1W4AA 1ICIA 4LKRA 1L5QA 2E4VA 1GNVA 3OPYB 4RS3A 1M8KA 5LB4A 3COSA 3BHJA 1CE8B 2GBGA 2XVXA 2N1MA 2PLAA 3FOAA 3KWJA 3MJTA 4YAIA 2P2GA 2IF2A 3M6XA 1TVCA 4LDNA 3IS3A 4L4UA 4RAQA 2YRFA 4JR1A 2D5CA 5HYVA 4YJGB 1I4WA 4YWJA 4IOMA 1PT7A 1VZ2A 2C95A 3WZMA 4EMBA 2QK4A 4WAUA 5JY1A 5EJEA 4OP2A 3KZ1E 1BEEA 4YJGA 3ZWMA 1Q17A 3QVTA 5FQOA 2ZUWA 4XW2A 3D2AA 1DG9A 3K32A 3WNCA 4L8GA 4XRGA 3ORQA 1TTPB 1TI7A 4NBTA 2EJVA 3A7DA 3R7WA 1GZ6A 3Q7SA 4JR2A 4C3OB 4X1OA 5IM4A 2CFCA 1FSGA 4JB0A 4XM2A 3BM5A 4KDRA 3AUXA 3V00A 3OCUA 1RVDA 1VPVA 2V6IA 1H6CA 4MKZA 2O5CA 4OMUA 5JJIA 3PPWA 3VISA 1PJLA 1V3UA 4UFNA 3I01A 3UJ8A 4J94A 3AONB 4XWOA 1DRUA 2DG2A 5EJ8A 5REQB 4BE4A 7ADHA 4NV1A 5MFZA 1WRBA 4NFSA 3EGWA 2AFHA 2IVZA 4HDSB 5K0JA 1G8SA 5DLQC 1MCZA 4CQNA 4JENA 4UMDA 3RO7A 2W2VA 8MHTA 3PUVA 1CY2A 4H17A 3UICA 1FNSA 3K70C 1FX1A 3KE9A 4O5AA 3QNMA 1EWRA 3CW8X 5FULA 3CPEA 4ZVMA 3VUEA 1DRKA 4PIMA 3TW8B 3GJTA 3OIVA 2J3MA 3EWSA 2E1RA 3K5WA 3DEJA 4TWZA 3V34A 5B2FA 3NNNA 2E2WA 1N78A 5K3FB 5JDCC 2IUEA 4MKGA 1MF7A 2J32A 5A5VA 2J9FB 2WICA 1XKTA 3EVFA 3R09A 4MYHA 4HNSA 4J4TA 1I32A 5DNWA 1MGOA 3TB6A 3LBHA 1USGA 2Q6VA 2B8TA 2RHGB 3GCZA 4PZAA 4RK5A 4BP8A 4F38A 1EWYA 1O97D 5IUNC 4IXTA 4O4HB 4ZCPA 5BYBA 4EY8A 3SVLA 3UAVA 4QRIA 3NONA 4YB8A 2QXYA 3R1IA 1WIWA 4EH1A 2ID4A 4FW9A 4OHVA 4K8OA 3RVJA 4BEJA 5ED4A 4OHCA 1NI5A 5KDLA 2VXOA 1V8BA 2QD2A 3SR3A 2AXEA 2CT8A 1INLA 5CVDA 1LWNA 1WU8A 1Q6ZA 1SOUA 4F21A 1N33B 1M8PA 4FS3A 4GBED 1V43A 1NRJB 3RS9A 2GHQA 1R0WA 1D1QA 2ZYRA 3QUBA 3C5WP 5CDFA 3ZYZA 3ACBA 1PYDA 4P83A 2BFCA 3CRVA 4BO4A 4KACA 3IJEB 3RSZA 2C4NA 3TL2A 3TEFA 4Z3KA 3O94A 4KIWA 1YULA 2DX7A 4L8FA 1RWPA 1ZN8A 2PL5A 4KQXA 4L22A 5CVJA 2VSQA 4E5VA 3IDAA 1C9JA 1NVFA 4Q4HA 1UMDA 2C7OA 4CQMD 3HWWA 5JNWA 2DC1A 1V7ZA 1IN5A 1Y34E 2WYIA 3ZQ4A 4F5EA 4RCYA 4ED9A 3HKEA 3NHYA 5FF9A 3UXYA 6LDHA 1GFZA 1ZCJA 2DFPA 4G1VA 3RU3A 1DINA 1IC6A 2AUNA 2VPPA 1PJSA 3RARA 2DAPA 3TW4A 3O4FA 5C8ZA 2PR2A 2RGDA 5JFOA 4KFCA 1EVEA 1RWOA 4FYJA 2IBSA 2AR9A 1SRRA 3LT1A 5AWFC 1YZFA 3AEKB 5IVDA 1UOOA 1A4XA 1Y1PA 4YCMA 3O8OA 4IHJF 4GMDA 2X0IA 4RCVA 4AMBA 3LKBA 4K05A 5G2OA 1PNRA 1EUDB 1L4KA 4R5HA 4IOLA 3V1UA 4XUEA 1JAYA 3IP8A 4N0EA 4OYRA 5CW2A 4JI1B 4V24A 3N3AC 2AR7A 2JJ2D 3KQOA 3L7KA 2C94A 1HX7A 1JJIA 1HE1C 1PIWA 1W29A 2PUEA 1A3CA 2BL4A 1FA9A 3HVKA 2RIRA 2ZRDA 3C24A 3ISTA 4YQZA 1OAKA 1X80A 1YDHA 1LFDB 3UGKA 3UT5A 2WAYA 1FDSA 1XTUA 4B80A 4D2IA 1ADGA 2FMIA 3JQ9A 5TQ2A 1ZJJA 3B1FA 3MB8A 1FCJA 1A7JA 1IY0A 3PC2A 4X45A 1W4BA 3WDLA 2VDPB 1OZGA 3R23A 3RSOA 3U3RA 1CZKA 4CIBA 1LPBB 2QVXX 3ZDZB 2QAGB 4M1TA 1CDEA 4AF6A 2FWRA 2OZLA 4MTCA 1PLLA 5F98A 5HRCA 1MGPA 2AMYA 2I54A 1AF7A 1K8RA 2YCLA 3LHFA 2BFDB 3CLUD 1UMBA 1QS0A 3EDOA 3HL4A 4FR0A 1J2UA 1POXA 5FBZA 4XD2A 3TH5A 4N41A 3RJ9A 1ODFA 1YZYA 3KXIA 3M5WA 1M0SA 3U3DA 5A5FA 1GPJA 5DB4A 2WTNA 3QU5A 4I81A 2QL9A 4BNDA 4G81A 3QKIA 4O4IA 1IN6A 1XHLA 2ZXEA 3K6SB 2Y6UA 4UZSA 1YNSA 2DVMA 3WB2A 3M70A 3PXDA 2AOXA 3IMFA 1KSFX 2KYRA 2Y93A 2ZANA 3HUTA 4R2XA 4BB6A 1QF6A 4NU0A 3EMDA 3TPCA 5CCBA 2VJKA 4FZJA 1YCDA 2W71A 3CT6A 1JR3E 1NV8A 3DYBA 2E4ZA 4XQGA 1CF4A 1R0LA 2PK3A 3CRNA 3NBUA 5F33A 4B4OA 2FUKA 4GRIA 2G72A 4GPZA 4ON9A 1JIUA 1PK8A 2ECFA 3A1TA 2FYTA 2XGMA 4TKMA 3W5IA 1OI2A 3D6UA 1UBRS 3EH2A 3LNTA 3M6WA 4MUEA 2I8LA 1KY3A 3IC5A 4I50A 5BPHA 5IYZF 2O20A 1NPDA 2R8YA 2VHZA 2P1DA 3O4RA 2Q3EA 1HWYA 3PEVA 4GMXA 4TXMA 4BVGA 4TKLA 5GONF 2N75A 3WQHA 3HEAA 3CLKA 3KD2A 1VHJA 1VRCA 1R0CA 2C77A 2IU3A 3BF8A 1EK1A 3V9PA 4HRAA 4OL9A 1RSZA 1S0UA 4YJFA 5JTUA 1ST3A 3O8OB 3GW8A 4WA8A 1Y7PA 4KGXA 4B3GA 5IANA 4PSUA 5IMSA 4LJ7A 1IIBA 4C0JA 3ZKWA 1NXSA 1ZIDA 2XRZA 2ODWA 1G20A 3CS3A 2QPLA 1MTOA 1QG2A 2QRPA