2CL0X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gppnhp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide binding protein
total genus 65
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cl0X00
2GJSA 1NKTA 4DUGA 2ORIA 4M9ZA 4B34A 4M2LA 5HCIA 4RZ2A 3LFUA 1YE8A 3BE4A 3K0FB 2ZAOA 2XOKA 2QTVB 4AKGA 1BYIA 1E9AA 2QBYA 2CL7X 4RFVA 4IDOA 4H1VA 1Q20A 1D9ZA 1E2MA 5KYKA 1JPNA 2IS6A 2GHIA 2RMKA 2IYYA 4LPKA 2H92A 5JEDA 1DE0A 3HYTA 1FZQA 1UJ2A 1Z2CA 4PHGA 3VAAA 1U0HC 3VX3A 3QKRA 2IYWA 5DLQC 1NBMD 2HT6A 1LNZA 3RSLA 5IDVA 4Z1MD 2ODNA 1IXSB 4G3XA 4TQ9A 1CJUC 4WIAA 1SHZA 1S96A 4ZDJA 1ZM7A 1F6BA 4IW3B 2WOJA 5TV2A 4Q03A 3FVQA 4MGZR 3ZD6A 5KSYA 2FNAA 2P6NA 3VR3A 4C2UA 2WSSA 1U99A 3ADKA 3E1SA 3BGWA 3WNCA 3W5JA 2OFXA 4L5BA 4AYTA 3SR0A 3NBYC 3K0AA 5AUOB 3AVOA 4V0KA 3I61A 2FEOA 1NLZA 3DM5A 3SYKA 4C9BA 1A7JA 2IXGA 5DHAA 1KGDA 3AVPA 4GRAA 2VHQA 1Q3TA 4X8MA 1EFCA 2QE7A 1SXJD 1IOZA 1OSNA 3TRFA 2ZVPX 1OT3A 1YVDA 2IXEA 3OHMA 4IOJA 3RRMA 2ZETA 1XTIA 5HR5A 1GKYA 2YV5A 2AXPA 1CR0A 2WJHA 2HF8A 5TY0A 1H8HD 1Z07A 2OV2A 1JQJC 4NCIA 3SHFA 3WYAA 4HB0A 1GG2A 4JLMA 4JVNA 5BN5A 2RGBA 1E2DA 5DO9A 4ZDWA 2JLUA 3WRXC 2QRZA 3R7WB 2O0KA 2BJVA 3QJYA 3SQWA 3A6PC 4Q00A 1GL7A 3EIQA 4TMTA 1R7RA 5FPHA 2JLYA 5JEEA 4URZR 4PO8A 3WHLA 3DMNA 4AG6A 4P3YA 2NOAA 3QF4A 2GCPA 1CRPA 1TAGA 2QI9C 4XVQA 3PJRA 5D3MA 2W0MA 2QZ4A 4JLBA 1EX6A 2YYZA 3T06B 5JHHB 3KQHA 4V0OA 4HLQB 2DY1A 4BE7B 3RRZA 4JLOA 3FKSA 4NCKA 2H17A 1XZPA 4TLCA 4LC0A 4IHQA 4UNPA 1UBFA 3D31A 2YOHA 2ZJYA 1JXMA 2XJ4A 1LS6A 2OZEA 4NYJQ 2AKAB 4M53A 821PA 1M7BA 1US8B 4WZ6A 3QE0A 2R62A 3QXXA 3DPUA 5EE3A 4A8JC 4LPSA 2ZSEA 2CCJA 2WKQA 3GLIE 4TYYA 1KNXA 2XXAB 1BYUA 1L4YA 1KZGB 1W2GA 2B6HA 2R6AA 2QSYA 4QJ4A 4N1AA 5GJWC 1L4UA 1UBGA 1MABA 1QVRA 5FL3A 4DJTA 1SVLA 2HJVA 1TADA 3I92A 1OKKD 1P9WA 1KJZA 1X8JA 1SGWA 5AJZA 2ZE6A 2OBLA 5B30A 2YWGA 4CRWB 3I73A 3MJHA 1JR3D 3QXJA 2X19A 5G41A 1Z8FA 3W9YA 1MO4A 1BIFA 4LWZA 1XEXB 2DHRA 3LXRA 3RLFA 2V55B 2XNDA 5BQ5A 1ETUA 3AM1A 2WMOB 4WA7A 2Q9CA 2MSCB 1GL6A 1NN3A 5CIQA 1YZLA 1XNJA 1G7RA 1MO5A 1KNQA 5CK4A 4GI7A 4CEIA 2O8BA 1TQ2A 1E79D 2B8WA 3AUYA 4DCSA 5HE9A 3AVXA 1ONBA 4M1TA 3GJ8A 4CEHA 2RGXA 5M04A 1F60A 1KI8A 1IONA 2NGRA 3GJ0A 4AWXA 2ZR7A 1YR7A 4A2PA 4R2HA 3TUZC 2Q3MA 2WHXA 4PR0A 1QHXA 1R0WA 4A82A 3CW2A 4JL8A 1E9FA 2RGGA 2C96A 4EPVA 2WJGA 5FTKA 4M9QA 1G41A 1P2VA 3BB3A 4LJ7A 3PEVA 4NDZA 1A4RA 3TK1A 2ZS9A 3LNCA 2MSEB 3K1JA 5FBQB 3C8UA 3VMFA 2HV8A 4I99A 2GXAA 3DL0A 4JLVA 2X2FA 3J81k 5CJPA 1JALA 3NEYA 1E1QA 5EXXA 3GEHA 4PX9A 2QUZA 2B7CA 5CM8B 2W6JA 4DCVA 2WPDD 2BBTA 2W2TA 3U61B 3SJCA 8OHMA 2P5SA 4FIDA 3ZS9A 1RFLA 1F3OA 2N42A 3TE6A 4EQ6A 4MKFA 4QHTA 1P73A 3QXSA 2ZRHA 2R6CA 1OHHD 2JLSA 3AVQA 2XGJA 3PV0A 3BIFA 5FR2A 5EE0A 1RZ3A 4E03A 1XD2A 3B82A 3BRWD 3AQ4A 5A0FA 1N6PA 1AA9A 3IGFA 4WVFA 2D62A 4EPRA 3CRW1 4YDHB 4ZCLA 1KSFX 1XTRA 2OE2A 3SOPA 3PEUA 2E9SA 2QAGB 3A1WA 4ITRC 1XJ0A 3TR0A 2R6DA 4MRRA 1KI6B 4ERNA 3NG1A 1S2MA 1R5NA 2QRNA 4KFSA 3SE0A 4YQFA 2ZR0A 3GP8A 4KYIB 5JLJA 4UNRA 1K5GA 1KTVA 1S3SA 1G7CA 3HJNA 1XXHB 2ZTSA 2CNWA 2WWIA 3NEJA 4LYFA 4NPHA 5FTLA 3AKDA 1QZXA 1HA3A 3WYFA 1ZMXA 4K46A 1G8PA 3D6TB 1ZJ6A 1E2LA 2J87A 1UKEA 1Y3AA 2X2EA 4JKIA 1TMKA 3EARA 3TKLA 4URXR 1GWNA 4MRNA 4Q1DA 3U7GA 1PLLA 4D0LB 5TXGA 3KL4A 4PQYA 1Q1EA 1WA5A 4LZZA 4Q1EA 1YZUA 4LJ8A 4KSCA 3IDQA 2DB3A 4G0NA 4DDWA 2FPMA 3IEUA 1II0A 4Z8XA 2HYIC 3K9LA 2ZRNA 5SZJA 2I1VB 2GZDA 1IQPA 2IHYA 3AV0B 1X6VA 4QBHA 2P3SA 4US1R 4JVLA 2ZYWX 2NO1A 3AVYA 5AJYA 3A1VA 1QRAA 3RSOA 2D7CA 1KI7A 3CX6A 1NN1A 3EZ7A 2J9RA 2IWRA 1KI4A 1NY5A 5H1YA 3FHOA 1S3GA 1NVVR 2ASEA 5FOVA 3U4QB 3U3OA 5FR1A 2PBRA 3GLHB 1HE8B 3OFNA 4I1VA 5LB2A 3KX2A 2P67A 4FWIB 1CEEA 1SKYE 1Z29A 1NMXA 1RRPA 2JJ1A 3AVVA 3FMPB 4GDFA 3CH4B 2NPIA 2YWFA 2AX4A 2QM7A 3U7HB 3EW9A 4YMVA 3CWQA 4OHWA 1W36C 3H84A 4JBWA 4ARZA 3GFOA 2WMNB 2J46A 1KSJA 3CF6R 2KI5A 3CRMA 4B35A 3T61A 2CDNA 4UNQA 3NVAA 1IY0A 2HCBA 4ZKDA 2HT1A 1DO0A 4QGAA 4BEBA 3GLIA 4M9SA 4JKYA 2YZ2A 3VR1A 3EA0A 3O8DA 1ZBDA 1P9RA 5IHPA 2A2ZA 3JZMA 5HPYB 2Z4RA 5H68A 3IQXA 5KSPA 1AK2A 2J7PD 1SXJE 2IA5A 2RH5A 1W49A 4FMDF 4Q4JA 3QPUA 1X8LA 3L8ZA 3SHWA 5LPNA 5AJWA 3QG1A 5SZIA 1XMJA 2O8DA 2VTKA 4JLNA 3CWZA 1MRSA 2CLDX 5IK2D 1XEFA 4F4CA 3LD9A 2ZJ8A 4LGMA 3KQLA 2EW1A 4DKXA 4E09A 3NHBA 3B1ZA 2XJ9A 5JI2E 4G5RA 3LVQE 2O8EB 2XB2A 1L8QA 1SQ5A 1KMHA 3UANA 1CJKC 3TUJC 2JLXA 3VR2A 5EXSA 1D5CA 1NIPA 3LV8A 4EIWA 2FGJA 2E1RA 3CRRA 5LB4A 2DWOA 2VP5A 3SNHA 1NJGA 1SVKA 3BS4A 4AG5A 1TQDA 1JAHA 2ZJOA 2OT3B 3KKNA 1SULA 3KZ1E 4TLDA 4TYPA 4ZPXA 3RWOA 3AKEA 4RD3A 5FPYA 5EP4A 3QG5A 3SZRA 5KDOA 3GJ4A 4TT3A 5KSZA 1PZNA 1S4QA 2EYUA 4IVQA 2WAYA 3C4JA 2VQSA 3K70C 4TMZA 1L7VC 2C9YA 4EJSB 1NJFA 3CIOA 4JL5A 1KY3A 3KJGA 3MUFA 4LBYA 5EP2A 5L8VA 1OIVA 5FOUA 2YC4C 2LKCA 2QNRA 1QBKC 1GDDA 3WRYC 3U3MA 1S1MA 1DAIA 3I8XA 3KQKA 4OJKA 1T6NA 1E2NA 5JJKA 3U7FB 1ESMA 1G16A 1GKUB 1SKQA 2DR3A 3O8BA 2EU8A 1AZTA 3KJEA 1E9CA 3THOA 1HQYE 3KTAB 4D0NA 2PH1A 5HKKA 1Y63A 2IYQA 3AUXA 3MSXA 4BLPA 4Q7KA 4B32A 1EWRA 4DHEA 4QJ5A 1G9XA 1BH2A 5J4HA 1XD8A 2ZRBA 3QEOA 4FMDB 1DTSA 2EFCB 2QG6A 3T5GA 3TSOA 1JNYA 1IXZA 1JR3E 2BV3A 3CUEF 3Q5EA 2IUSA 2PZFA 5EP1A 1Z22A 3UWKA 4RJLA 3X1ZA 4A6PA 1FTNA 1ZCAA 1N5IA 1HYQA 1TEXA 1VCNA 4NH0A 4URVR 1X3SA 2ZI4A 4LJYA 2GXSA 2Z43A 4Q4AB 5HE8A 3THWB 1J8YF 5EXTA 4PC6A 3RC8A 3VR5A 2QM8A 1F2UB 4M9XA 4BLQA 1PJRA 2WJYA 4TLAA 1BMFD 1F48A 5DHFA 4HAUA 4U00A 1G8HA 3PXGA 1FOEB 4O3MA 5FOWA 1E2HA 3EG5A 2EWVA 1JEEA 3MCAA 4RKFA 4A92A 3GD7A 2BEKA 4GT1A 1M34E 5BWMA 4L15A 2ORVA 5DI3B 4CVNA 4ZCMA 4Q01A 3RANA 3WP1B 3RNLA 1P9NA 1R8SA 4I81A 2H57A 4NYIQ 3P4XA 2CE2X 1E2EA 1EFHA 4NBSA 3KXIA 1YRBA 3OE7D 4GZMA 2O0HA 2JATA 3TAHA 4R7ZA 1Z0DA 4DLRA 3C15C 2IUTA 2F7SA 5AWFC 3EZ6A 3LY5A 2GJKA 3TAUA 2D74A 4DDTA 3NXSA 3B1WA 4Q4HB 2DBYA 2ZVQX 4FW9A 4XD7A 3ZVNA 3SJZA 2XEXA 2V1XA 4JJZA 1OLOA 3WY9A 4Q1FA 2JA1A 4EKDA 1NKSA 3OEEA 4BFZA 1KMQA 2J3EA 1G1MA 4AD8A 5KTYA 2Y8EA 4AC9A 2WAXA 4TTPA 4Q1AA 2HLDD 4AYWA 2BKUA 4F7WA 1WBBA 4RSGA 2ATXA 3K09C 3R8FA 1Q1BA 1VECA 2PX3A 1Q0UA 2IHBA 3SFVA 3OIWA 1Z2AA 2ZRKA 5B57C 3O8RA 3B60A 1AS3A 2Z0MA 4WAUA 3L8YA 3QIAA 3SJAA 1UADA 4YLGA 2K5UA 1A2BA 1W0JA 4B2LA 3VNUA 2AL7A 3V4FA 4L9SA 2NG1A 1K5DA 1O87A 4MRPA 4XIGS 2V1UA 2QP3A 2HF9A 1S0UA 3VKGA 2XNSA 2GCOA 1HURA 1DAEA 5GADl 1E0JA 2GAAA 3U3KA 1OB2A 4DB4A 2ZI7A 3K9HA 4RFSB 4DEYA 1W4CA 1JJ7A 3FMFA 2VF7A 4QBFA 2DCUA 5BN3A 4LY6A 1G64A 1Q57A 4RD0A 4B76A 1M74A 4QM7A 3U44A 1M2OB 5KHOC 4LBVA 4PQRA 1F2TB 1II8B 5BXQC 4QHYA 4HAZA 1GP2A 1CBUA 2WJIA 4HZUA 4QGGA 5AUNB 2FSFA 5BYKA 1HT2E 2V54A 1RC8A 2KJQA 4CZ2A 2C04A 3B5JA 4TSFD 2A9KA 4C0QC 5A5GA 2CK3A 2PZGA 3GEEA 5LD2B 4B71A 2YJTD 1N3BA 4BFTA 1QHYA 3QY0A 1MH1A 1NVWQ 1NVUQ 4RVCA 2P2LA 2GJ8A 4DSTA 3A37A 1NL3A 2J0VA 2BIFA 2NZ8A 3HR7A 2XSZD 3KJHA 1GNPA 2FDCA 3ONWA 1AGPA 4M21A 4DLVA 4OKSA 2CL6X 1J70A 1Z6XA 3AH8A 2CLCX 4KFRA 1I2DA 2FFBA 3BWDD 4ZI2A 1MO6A 4OK5A 1KO5A 4IVRA 2V9PA 2WKPA 2C99A 3B8HA 1OV4A 1U8AA 1P75A 1KKLA 4NYJR 1VCOA 2EFDB 3SYNA 1P61B 1ESNA 2BOVA 1FTSA 4Q47A 1L2TA 5H70A 1OYWA 2GTPA 3K0FA 4NU0A 4YDSA 5JBQA 4KODA 5CLQA 4ASUD 4EFNA 1J90A 4P32A 3GFTA 1MT0A 4OHXA 3RS7A 5CDFE 3NIBA 4DWJA 2J0UA 4DB2A 1G6HA 3N2EA 2VSXA 2ZJAA 1YRAA 2V8OA 1N5LA 1SXJB 5EP3A 5BW8A 4WXPA 2A3RA 4G5GA 3BB4A 4KSBA 1E98A 5DE3A 2GXUA 1JBKA 1CR4A 2JCSA 1W4AA 4Q9LA 5FH9A 3U3JA 1EGAA 2ONJA 4DLWA 5A4JA 1VCMA 3BFXA 3TVTA 1OJLA 5KNDA 5L3SA 3TQCA 3I5XA 1D8TA 3AF1A 1W0KA 3GLFB 3OESA 3CKLA 5GVSA 2R2AA 1E99A 3TMKA 2D2EA 3AP3A 1LVGA 4TWZA 4V0NA 3GEIA 2QMOA 1JR6A 4EFLA 4D81A 3FHTA 1KOFA 3I72A 3Q5DA 3CB4A 1N0WA 1XXHE 4OJQA 2FOLA 2NMVA 2WKRA 3WP0A 4B2IA 3A1SA 1JQLB 1T3SA 1W5SA 2F9MA 4U02A 2IYRA 5C1BA 3MWYW 1HUQA 1MRNA 3RYTC 3IO5A 3DO6A 3ZQJA 1HH4A 1KK2A 1XMSA 3QPVA 1KDTA 4JLAA 3JVUA 3REGA 2VSOA 1RW4A 5CB8A 4WOPA 1WBDA 3W3AA 4DC9A 1YHNA 4RZUA 1CXZA 3OIUA 2OCPA 5FPTA 5J47A 5FUYA 1I4DD 1LV7A 1QHIA 2HCJB 2WZQA 4HUTA 2Q9BA 1C9KA 4NTZA 4KBGA 1MKYA 1YKSA 2GF9A 5EUMA 2VYFA 1VDZA 4NCHA 4BLOA 1N6KA 4D4LA 4HDQB 5F2EA 5B64A 2OHFA 4JS0A 3I3SR 1GNRA 4RZ3A 2WVJA 3IIJA 5FI0B 3DOEA 1U8ZA 2QGZA 3ZIAD 4TTQA 2ZAMA 4MKGA 4TMKA 5D3QA 2ORWA 3SI7A 4B3BA 3EWSA 1C1YA 3K8YA 1PLKA 1YZQA 1FPMA 3G5UA 4QGFA 4HLUC 4OHYA 4QBIA 3NC0C 3Q7PA 3WMFA 1T5LA 2IC5A 4XTCS 3EXAA 3ZH9B 4B74A 2GK6A 5JI3E 4Q18A 3M1IA 2PT7A 4URYR 1G20E 2GDJA 3GLHE 4BFVA 1XEWY 3NDBB 2XAUA 4AKHA 3IBGA 3AP2A 3DHWC 5KDLA 2EFGA 2NTYC 1DPFA 2IEZA 2CXXA 3THYB 1OPXA 1US8A 4X8OA 5HTKA 1N5JA 3A1UA 2PEZA 1MR3F 4N0DA 4UJ5A 4IDQA 3TNFA 4A36A 1P2UA 2IYZA 3RRYA 2ZI6A 3ADDA 1E1RD 2W00A 1R5OA 4OI4A 1E69A 2XXAA 1XBTA 3CNOA 1QHSA 1N2CE 2QENA 3MWJA 3OAAD 4LDJA 2FSHA 1T9HA 3A8TA 3UKDA 4DSUA 4LV6A 4HAYA 4PQFA 1KKMA 1YZNA 4NONA 2QROA 1JJVA 1O3YA 4HDOB 3DEFA 2OBMA 2QSZA 4FXPA 5JCPA 421PA 3B2EA 3U7EB 1XCPA 1VYTA 2IUUA 1PVOA 2ZSDA 3PITA 3VHXA 4RD1A 4MKIA 3SFZA 1UDXA 3HDTA 5FL7A 1G8GA 2WM9B 4JIMA 1XEXA 1ZNZA 3B7GA 4BZPA 2BMFA 3CR8A 1XMVA 1Q44A 1T0HB 3X1YA 2A5DA 1GIAA 1D2MA 4BZXA 2OCAA 4KVGA 4M1MA 4EUNA 1VG8A 2GAOA 3QKTA 1T3HA 5CK5A 1DAMA 4DIDA 1IBRA 2WIAA 3TBKA 4F4IA 1X8KA 2QN6A 3IO3A 2C2HA 1R6BX 1QF9A 4WBSA 1NSTA 1UDWA 3RS0A 1G8FA 3S1AB 1R0ZA 3R20A 4GP7A 4O2LA 2WWFA 2V6IA 1D2EA 1X1SA 5KNCA 2O0JA 1IY2A 2W6IA 3B1YA 3OIYA 5K8LA 1KDPA 4LOAA 1Z6TA 3FKQA 3RVBA 2R9VA 1IAQA 1S9HA 1F5NA 1ZUNB 3I4LA 1XTQA 1HT1E 3KFXA 4Q66C 4R2IA 4XSHA 2BEJA 4HUQB 4NP6A 2G83A 2ZI9A 4AYXA 2ZPTX 2JDID 3W90A 4BUJA 1TTTA 1A82A 1N6NA 1XF9A 4KYUA 4HLCA 4M1SA 1KHTA 5HZHA 2IBMA 4KU4A 1P6XA 1QG2A 2GJ9A 4F4JA 4Q7MB 2GKSA 5CLLA 2JLRA 3HU1A 3ND8A 1Z6YA 5DNYB 3U3RA 2NO6A 5H8WA 4DLSA 2FGKA 2Q3HA 2W58A 3ZZUA 3U6KA 4JZKA 5GVRA 3QBTA 5CDFA 2BCJQ 5FI1B 3L0OA 3AVWA 1VYVA 1DEKA 3LX5A 5EQTA 1AN0A 1I4TD 2A5YB 2FF7A 2Q9AA 4DLXA 4IVPA 3IPXA 3EZFA 2ZRCA 4V03A 2IYVA 2F55A 2HJGA 1NN0A 4ZIRB 3CR7A 1ZNXA 2B8TA 1NMZA 4Q9IA 3K0CA 3HPQA 3G0HA 2ZI5A 3K09A 1W36D 1FX0B 5FUXA 3GLGB 1NI3A 3QKSB 3HYRA 4FCVA 4HEJA 4O2RA 2BC9A 1P7CA 2ECKA 3BC1A 4DUGD 1G21E 4D26A 4PFSA 4UJ3A 2O5VA 4U5XA 2GF0A 2WSMA 4B6FA 1KI6A 4DDVA 5E7JA 2XOKD 3L0SA 3VU9A 1ZD8A 2BKEA 3PUWA 4H1UA 2QPTA 4B48A 1W7AA 1FFHA 2IF0A 5LD2C 1I4LD 2ZS8A 3FE2A 2F1HA 4JLDA 3IKJA 4IEIA 5EE1A 4YMUA 4TZ0A 4PPNA 1FP6A 4MGIR 3B9PA 1IJFA 2FV8A 3B6EA 4P4SB 4Q48A 2NIPA 5KOYA 4OQMA 1ZM3A 1Z08A 2IYSA 4B6EA 4PC7A 3WMEA 4B43A 4ZDKA 1E9DA 1U0JA 1G7TA 3A4LA 3ICEA 4GMXA 2QEQA 1G4UR 1RJ9B 1OH7A 1ZUIA 5CB6A 3LWNA 3QPWA 3D3QA 3QQ5A 2WSSD 3BK7A 4HAVA 5CYOA 5FFMA 3PFIA 1RYFA 2G0TA 2WV9A 3QOFA 4GBMA 2H18A 4TMVA 1GRRA 3B1VA 1WE2A 3RS2A 2XX3A 4JLKA 2PEYA 4G01B 1G5TA 3UXMA 3DM9B 2NZJA 2OUKA 4PSKA 1SXJC 4RD4A 2H1LA 3K70D 2AN9A 2QA5A 3P32A 1DVRA 5JMTA 4RCZA 1E9BA 2CE7A 2QE7D 3P4YA 2QPAA 1WP9A 2DPXA 4PAQA 1TPZA 2ZUCA 3GFPA 3LX8A 5ANRB 5JSZB 1ZU4A 3U4QA 4QG7A 2F1RA 1COWA 1OFUX 3X2SA 4OHVA 2D4HA 2RHDA 3CH5A 4QXAA 4CEHB 4PSVA 2J45A 2VHUA 3RHFA 2VP6A 3UMFA 1KO1A 4DZZA 1CR2A 3FHCB 1OH8A 1EFUA 4URWR 2QP9X 1H65A 3QXCA 4PANA 3SJBA 4KAXA 4A0GA 1LFDB 4A1FA 3OIVA 1QVAA 2FWRA 2UVQA 4WW0A 2G9NA 3NBFA 1G7SA 1WF3A 3G82C 2J0SA 3KFVA 1GRNA 4FMBB 5C4MA 1AM4D 2F3TA 1UAAA 1E2FA 1R0YA 3FKSD 2D2FA 2O8FB 1GTVA 1E0KA 1NG1A 1XFAA 2ZITA 3K9GA 4NE2A 3RS4A 1EFRA 3NBZC 4LYHA 1P5ZB 2QMUA 5DI9A 3ASZA 3BERA 3W3ZB 1ZM4A 2I4IA 6Q21A 5F9FA 4IDHA 1R10A 4HZIA 2C9OA 4GOXA 5AJXA 1FMLA 1NF3A 5DGXA 2IXFA 3GJ3A 1G8YA 2IK8A 3DZDA 3QEJA 5DYIA 3T1QA 2O8EA 3P27A 3C16C 2GZAA 1W47A 2BM1A 1G3QA 2W6ID 4TYQA 1NBME 1TF7A 3EZ9A 2R65A 5EJEA 4C7OB 2FEMA 4M1WA 4KXFB 4G5OA 2BJWA 2JJ2A 2CL0X 2QMHA 4JVSB 4FINA 1S8FA 5GJCA 2WJJA 4JL6A 2Z6VA 2VL7A 3H0KA 4PHTA 5IF9A 2W0SA 4P31A 4MGYR 3B13B 3L82B 2BMEA 4LCBA 2ZYUX 1XTKA 4TMXA 2WBLC 1U2RA 1CTQA 1GVNB 2OILA 4LUCA 1OH6A 2IEYA 2QGNA 5J4KA 1Z0AA 1TU3A 2HXSA 2XNDD 1DG3A 2VP9A 3IPYA 4QJ3A 1P62B 2BDTA 4E22A 3C7KA 4DRZA 1EX7A 3H4MA 5C46F 4KFTA 2C98A 1YR8A 1FUKA 2QTFA 4QBGB 1DADA 3THXB 3D8BA 2WWYA 3EPLA 3ADBA 1BKDR 1H8EA 2C77A 3BXZA 1U90A 1E4VA 3GJ6A 4HLUA 4B3CA 3KTAA 4W7SA 2E87A 3BH7A 1FP7A 3ZVRA 1NIJA 1CKEA 1W4BA 2QMEA 4NKRA 2GA8A 2VP4A 3GLFE 1ZYUA 1SVSA 2O8CB 1R2QA 3LA6A 4KHZA 5BYJA 5E3HA 1U81A 1LS1A 4US0R 1D2NA 3ZLJA 4TYWA 4CIDA 3FWYA 4QHSA 1XEWX 2AKYA 4A0HA 2ODWA 3AF4A 2HDNB 2ZEJA 3CRVA 1LTQA 4EAQA 3SU8A 4Q4AA 3THWA 3WYGA 1E1QD 3E2IA 3RS3A 4HAWA 3QVVA 2W6JD 3LQQA 2TMKA 4V0ME 5P21A 3KUCA 1F2UA 3KKPA 4IDPA 4IXNA 1T8UA 1NVXQ 3B78A 4LJ9A 5JWRA 3LAWA 3MWKA 5AK0A 5FTMA 2EQBA 3DVLA 4I1OA 2IYXA 3A4MA 5DIFA 4A2QA 1N6HA 5DI3A 5KU1A 3KXLA 4I1UA 4M1KA 1FQKA 3UIEA 4PZYA 1WQ1R 2V3CC 2WOOA 2FFHA 2P6RA 3SDZA 2ZRIA 1GZSA 2VO1A 5DSZA 1JB1A 3VX4A 3L2OB 3ZS8A 4DLTA 1OXSC 1KJWA 2WWHA 4PZZA 2GJAA 4G5SA 4UNSA 5KNBA 3T35A 2FJUA 4LHXA 1E6CA 4LHYA 3ZJYA 4FCWA 2BVNA 1WB9A 2UZIR 3MD0A 4UXJA 2GESA 5L3VA 1XJQA 2IL1A 2ATVA 2QP4A 3I8SA 4YXWA 4EPYA 2WWWA 3TGPA 3RAPR 3TUIC 4BFXA 3CZQA 4Q4HA 3MWLA 2GETA 4A0FA 2I3BA 2C9CA 2REOA 3UG7A 2V6JA 2R8RA 3TJZA 2CNWD 1ZNYA 1J7KA 1R0XA 5DN6A 4X8LA 3FFBA 1KK3A 2HXYA 4XTRA 3NWJA 2B92A 4EPXA 4Z54A 1KMHB 2KBFA 2J1LA 4LHZA 2XTZA 4PAMA 2A78A 1NG9A 3I5YA 2YC2C 2W83A 4JSYA 3CRQA 2KE5A 1E3MA 121PA 4L16A 2IWHA 4CEJB 3LO5A 4L9WA 2WWGA 4FMCF 3KKMA 2BBOA 1M7HA 5EZ5A 3Q7QA 3CPEA 1S9DA 5FUWA 5SZHB 4EDHA 4BPBA 2F43B 1Z6AA 4V02A 2ZUDA 2ANCA 2IS2A 1EFRD 3U5ZB 3NH6A 3CX7A 1JEDA 4RFSA 4D2IA 1BS1A 1VIYA 1IM2A 4OK3A 2W2XA 1YQTA 4Q1BA 2AR7A 4D4KA 2ZU0C 2C03A 2ZRJA 2RGAA 2MSDB 2YKGA 4QC2A 2ZJBA 3UATA 1AQYA 1E0SA 1KAGA 3W6NA 1XCGB 4NHOA 1E2PA 2GVZC 4WZBE 3OFND 1AKYA 1XWIA 4MGKR 1N6OA 1F2TA 1II8A 1MO3A 2O52A 1WDTA 2JJ1D 2J7KA 1E96A 5L3QB 3X1DA 1U94A 1Z0IA 3ZQ6A 4DEXA 2ZYVX 1CJMA 1A2KC 2BMDA 1XD9A 3K0CC 4AKIA 1NVVQ 1E2KA 1T91A 4NYMQ 2C78A 4D6PA 2FU5C 4KFUA 1HTWA 5CIWA 1CRQA 2CVFA 4P4TA 1V43A 2VSFA 3I32A 4ZV4A 1CF4A 2QAGC 3GJ7A 4KV9A 3W6PA 4OBEA 4ZKEA 3N70A 2AD1A 1KIMA 4Z1MA 4QOSA 4A8JB 2L0XA 3P1JA 2GEDA 4MUAA 4KCGA 1SVIA 4DDUA 4MYUA 1YZTA 1Z0JA 4BECA 3CF0A 3TSWA 4DLYA 3W34A 3CLVA 2EFHB 2XZLA 4B3XA 2CJWA 1FUUA 4C4PA 1WXQA 1KDOA 2PMDA 1U9IC 3AP1A 4P4UA 4FN5A 4D25A 1HQCA 4MQBA 4W5HA 2GK7A 3QXHA 4WZAE 1RIFA 1GL9B 1YZGA 2Q21A 3C5HA 3CPHA 4Q7JB 1SXJA 5CYPA 4EPWA 5IRCD 3AEZA 2REXB 2RGEA 4IFBA 4C0HA 5C18A 1GSIA 2YOFA 1U0LA 1QHHA 3W8RA 1H8HA 1EWQA 1CLUA 3GLGE 3DKVA 1ZRHA 1GOTA 1GKIA 4K81B 1HE1C 3OZXA 2G3YA 4TT3D 2CLSA 2KB0A 4H9GA 3FYHA 3HU3A 3CNNA 3GLFA 2X77A 3GMTA 2Q0HA 1I2MA 4PPQA 3FDIA 5FTNA 2GVDC 721PA 4B3FX 1NNEA 2PJRA 2QORA 5GJBA 4JYBA 2G1JA 4TL9A 1EK0A 2ZI3A 1GRQA 3PUZA 4OYHA 3B1XA 2NPFA 4F92B 2HEIA 3ICQB 4PC2A 5J40A 5FPSA 2ZR9A 4E5UA 4LSGA 1HEIA 3FB4A 5HKKD 2QQEA 4V0MA 4OK6A 2F3RA 2Q6TA 4ON9A 1NRJB 1CJVC 3FTQA 3W6OA 2QT1A 4GSYA 4NCJA 1E2IA 1SVWA 3KXKA 3AB3A 4DVGA 4JYCA 3WBKA 3ASYA 1FQJA 1LB1B 2RHMA 4QNMA 4PO9A 5KSOA 1VG0B 3SC3A 4A6XA 1N6IA 3RC3A 5E7IA 1OXTA 4YMSA 3BFKA 4IEEA 1VG1A 4PO1A 3EASA 5JRJA 1YR9A 5AR1A 2QAJA 5L3RA 2ZE8A 4LHVA 1E0AA 1GILA 2BBWA 3U2QA 3V4RA 5G3ZA 2PLRA 3UMRA 4JVMA 2H8KA 3MRSA 2P5TB 2LWIA 1JI0A 4Q1CA 4TTRA 3BBPA 1NY6A 1GM5A 2FSGA 1OKKA 3CZPA 3PEYA 5CITA 2ODEA 4BWYA 1E2GA 3K53A 1JPJA 1JR3A 1FNNA 1CR1A 3K0SA 1PUJA 4BLRA 2R6GA 4Q5IA 2FX3A 1T3LA 4O0MA 1UKYA 1GAJA 1Z83A 2KBEA 3CF2A 3PUXA 2FZLA 2ZQ5A 4EFMA 3THYA 1ZW6A 5JWHA 4C0JA 4HB4A 4BQSA 4TYNA 2YWHA 4N3NA 1OB5A 1VPLA 4IJMA 2RGDA 3WNBA 3WBJA 4HSEA 1T5IA 2IF2A 2JLZA 5G3YA 1C4OA 4OQFA 2DYKA 1E79A 2YNMA 5AJVB 3RDPA 3UK6A 4S2EA 1K6MA 4F91B 1G19A 4DXAA 4EJSC 1DARA 1YU9A 2FFAA 1FNMA 2JASA 3E70C 3ADCA 3R7WA 1AIPA 2JJ8A 4TQAA 4XD7D 4GOJA 2OBNA 1OXUA 1XB2A 5CJ2A 2FPKA 3PUYA 1ZIPA 2BM0A 2OCBA 3OEED 4NZYA 2YINC 3SN6A 2BMJA 4JSTA 2AWNA 2NO9A 5JZVA 2NO7A 3QF7A 2IYLD 2J0UB 4QRHA 1RPZA 3VTKA 4G5QA 3V9PA 4GP6A 1OXXK 4ACBA 4MRSA 2DFKB 3SEAA 1UKZA 1ANKA 3LDAA 3U60B 1W46A 2FPLA 2V4ZA 3LQRA 4ZCIA 1E4YA 4Q19A 3ETLA 1ZM2A 1XPUA 1KY2A 2FN4A 4ABYA 2WPDA 1W0JD 1IJEA 2A5GA 2B21A 2EYQA 3IHLA 3KKQA 4GPTA 4LJ6A 4Y0AA 5EZ6B 4DCUA 4QKQA 3ZGXA 5L3SB 3TW8B 1P3JA 2P65A 3FMIA 1LY1A 4K8OA 4ZO4A 3PENA 1OHHA 4D80A 3ZDQA 3S1AA 1RRCA 2ZROA 2KWIA 4Q21A 3T1TA 2A5JA 4BRWA 4TLBA 4DT1B 3EA5A 5TVKA 1N6LA 1E94E 4PZLA 1VYUA 1G5PA 1W36B 4HB2A 4UNNA 4B3DA 2J59A 4HUQA 3BD9A 4C2TA 2CMKA 1AKEA 2RGCA 3TLXA 4PPGA 2AK2A 2VRWA 3B9QA 4RD2A 5F98A 5DH9A 3HPRA 3P20A 1E9RA 3SQXA 3V00A 4CDGA 2QBYB 4LJAA 4KJZA 3REFA 4BFSA 5HZKA 2NQ2C 1KI2A 1OIWA 4IDNA 4J0QA 3LBIA 2ZM5A 1AJEA 3HU2A 5FOXA 1WMSA 2F6RA 1KSGA 1GFIA 2CK3D 3AKYA 4HDCA 2AWOA 2ERYA 3O47A 1WCV1 1XTJA 1OXVA 1G3IA 3T1OA 5J4VA 1ZU5A 2D3WA 1JECA 4I4LA 1NLYA 3QKRB 3SBDA 1G18A 3MJRA 1NSFA 4N0EA 1CIPA 2OCYC 5ELXA 4CYMA 4ILEA 1P2TA 2SHKA 4ZIRA 5AUPB 3FMOB 1J99A 3CPJB 1E9SA 3JZAA 3KQUA 2OXRA 3KQNA 1FX0A 1VCIA 2VP0A 2CVHA 3M4YA 3LVRE 2PJZA 3GLGA 3QKSA 4UXIA 2CCKA 4LHWA 1NP6A 3IQWA 4L8GA 2JEOA 4ZI3A 1UF9A 2OSBA 1DS6A 2ZU6A 2AK3A 1M8PA 1SHKA 3K0AB 4B73A 1TUEA 1UBEA 3L0IB 2XTMA 2OXCA 3K70B 1T0JB 3ECCA 4AI6A 1Z6GA 2GNOA 4GL2A 1QHGA 2PL3A 4B47A 4LJ5A 3TH5A 4MUBA 4G1UC 4BRUA 1J8MF 4ZDIA 3ZD7A 2DWPA 1IN6A 3DMDA 3RABA 4ESVA 4P4SA 4JBYA 1M7GA 1ZAKA 4LRWA 2CCGA 1B23P 1G3MA 2RAPA 4EPTA 2QT0A 1IN7A 3AF0A 4HYYA 1EG7A 1TX4B 2AFHE 4XH9B 5TMPA 3QKUA 1RJ9A 1ZIOA 2XITA 5IT5A 4Q02A 1W0KD 4LJ4A 4TLEA 4KITB 3UPUA 3CM0A 1M6NA 1VHTA 2OG2A 2VHJA 4URUR 3UG6A 4NL4H 3WMGA 3QF4B 4JLPA 2IT1A 2F1JA 1FMJA 3AKCA 4D0GA 1G291 1R5BA 2C5LA 2FA9A 2ZUBA 5D3MB 1BOFA 5BN4A 1V5WA 2GZHA 2QAGA 3NC1C 4NMMA 3T34A 3CX8A 1IN8A 3KJIA 2J7PA 1QG4A 2Z4SA 1GUAA 2WIBA 2CHQA 4TL7A 2BWJA 4IFEA 4F38A 5JSZA 1YZKA 3F3YA 1KO7A 5K8TA 2WJVA 1XXHA 1KO8A 3Q85A 3LW7A 5IK2A 1KI9A 5FOTA 2WWXA 1TF2A 1Q21A 4M8NE 3FPAA 4QFMA 1UPTA 3VHLB 2ZREA 2JLWA 2GRJA 2AFIE 2OM2A 4YMTA 2EFEB 3CONA 1U9IA 2OESA 1TU4A 3N5CA 4B3GA 2ZRAA 3PG5A 2ZRDA 3QSYA 1NN5A 2A7QA 4CGZA 1DAGA 1TQ4A 1Z47A 2AD5A 3Q9LA 1MABB 1P2SA 3QI2A 2GXQA 2V7QA 3TQFA 2VHCA 1FW6A 1DAKA 2IW3A 4QNRA 4HB3A 221PA 1G3UA 4JT2A 1Z0KA 1OIXA 2O8FA 2XTNA 5F3WB 2MMCA 3R9IA 3U6BA 1XU4A 4MYHA 5J5CA 3TR5A 4B44A 1AQUA 2GBLC 3ZVMA 3I62A 4MA4A 4OQXA 2GEUA 4LBWA 1N5KA 4RY2A 1ODFA 4A4DA 2R44A 4CEIB 1RRFA 3NKVA 3RWMB 2O8BB 1KO4A 4LYJA 5DISB 3GLHA 4C7OA 3W8NA 4IXMA 3LLUA 5JRZA 4HATA 3P26A 4Z51A 1CU1A 4I1SA 5HCNA 4TZ6A 4QGHA 1OW3B 3EC2A 4DBLC 4DCNA 521PA 4A15A 3AF3A 4HI0E 1OFHA 3KB1A 4UQOA 1ZP6A 3A36A 3OF5A 4OL0A 3TVDA 3VU9B 1Q1ZA 1WRBA 3GQBA 1FL9A 1VMAA 2CEAA 2GEVA 3DDCA 1GNQA 3CBQA 3H86A 3HWSA 3LXXA 1B0UA 5FL7D 4BZQA 2J0QA 5JJLA 3K0EA 5F9HA 1E32A 3LW8A 1D6JA 2YOGA 1QDEA 2GWHA 3TSZA 1OFTA 5JECA 3R9XA 3QBVA 1UBCA 1XX6A 1G4AE 1W2HA 5UKDA 3R8CA 5B58C 3H2YA 1DOAA 1CS4C 3FOZA 3H1TA 4B75A 5G40A 1IN4A 4D4JA 3THXA 5KPDA 2J41A 3SBEA 1BMFA 1T8TA 4EQ6B 2ZS7A 4KVAA 1X86B 4W9MC 5TARA 4NYIR 2JGNA 3A1TA 4R9UC 2XZOA 1OFIA 2OLKA 4E07A 1A1VA 2WICA 1XMIA 3EIEA 4C0SA 1SVOA 4LV8B 1GITA 2RCNA 2O8CA 1KSHA 2RGNC 4X8HA 1XD2B 5FBWB 1S1CA 1ZVQA 2C8VA 4BFYA 4DSOA 2VH5R 3VNVA 1ZD9A 3LLMA 4BFUA 2HUPA 2XZPA 1ZINA 1G5RA 2ANBA 2OEPA 4F93B 3B85A 2Z83A 3KUDA 1DAFA 4LYAA 3EPKA 1G6OA 3OE7A 1XP8A 5FOSA 2DFTA 2G0NA 3JVVA 4M1OA 4GZLA 3NHAA 1Q3HA 1KAOA 4FI3C 4C0AC 2ZJ2A 2PLFA 1Z5ZA 4O25A 2D06A 2GCNA 3X1XA 2PMKA 5FUVA 5SZKB 4U7DA 1W1WA 3IEVA 4EJSA 5EE9A 4NYMR 5JWOA 2DFNA 2DFLA 3W5IA 2VA8A 4IKEA 4Q9KA 2CHGA 1P60A 3CO5A 1KI1A 4XWAA 4XOIA 2HLDA 1XRJA 1UFQA 5TB5A 4FWTA 4KLNA 4RKEA 1VIAA 3AGPA 1N0UA 3I1FA 4RD6A 3Q8XB 2JIZA 1AS0A 4MH0R 1IN5A 4KO8A 4B2PA 3BH6A 4YC7A 3UWOA 3BFVA 2GILA 3PQCA 3Q3JB 2BHRA 1UKVY 2EWWA 4GOKA 1KZ7B 4M22A 5E95A 4FD2A 4JJKA 1DELA 3EPHA 1TUIA 3O8CA 1NLFA 4PC1A 2QQ0A 3C5CA 1Z63A 2RB4A 5EUQB 3QNUA 4BASA 4CW7A 2VIIA 2PCLA 2ZE7A 1KK0A 3OEHA 2X1VA 4KI0A 4A9AA 1VHLA 1HY3A 3EAQA 4DLUA 1ELOA 3MFYA 4XVRA 3AVTA 4LV5B 2UKDA 4AK9A 5GJVC 4AY2A 3NTUA 2A5FA 2H16A 2VEDA 4NCNA 4MDFA 4MRVA 2ZYTX 4CEJA 2JAQA 2IS4A 1TL7C 2H5EA 1DG1G 1YJ5A 4MITA 3T15A 1ZNWA 4UKDA 1PLJA 2V7QD 3GJXC 4TSFA 1SZPA 2F43A 2ZSFA 4GMDA 4ARZB 4Q9HA 1T4GA 4YONB 3X1WA 1ZC3A 1KK1A 4C0BA 4UXHA 3DKPA 2QPOA 3LBNA 3GLIB 3EPJA 2C95A 2XSZA 4OQLA 3VKWA 4PTLA 4XJXA 2VP2A 1U8YA 2OAP1 2YHSA 2BCGY 4PAOA 4PPFA 1CP2A 1KDRA 4Z8YA 1LF5A 4TMWA 3T12A 4LK2A 1AS2A 1R4AA 2IYUA 1ZM9A 4DCTA 1E9EA 4C30A 2QY9A 2LCFA 4Q4JB 4HLDA 5KDDA 3VFDA 3KB2A 2KSQA 2O8DB 2FZ4A 4OI2A 4YMWA 1COWD 5K8IA 3RRNA 1UEIA 2B7BA 2VLIA 5FBRB 1UEJA 3R9WA 2G1KA 4ASUA 1KYIA 1OF1A 5L3QA 3T1VA 1ZD1A 1TF5A 1AZSC 1MV5A 2QTHA 1W4RA 4HAXA 4Q4LA 4GFDA 4TL8A 5KPJA 1DBSA 2ZE5A 2WTUA 4PC3A 3BORA 1LF0A 1CULC 2F1IA 1ZUHA 4LC1A 1R8QA 3IBYA 4PSAA 3PCRB 2ODBA 1SVMA 2EVWX 2P6UA 3C14C 5LBIA 2QL6A 4OQNA 1BO6A 2N46A 3DOFA 4A8JA 1YR6A 3WNDA 2N1BA 1XDBA 2F9LA 2FSIA 3M0EA 2ZRGA 3ZZ0A 3BB1A 3RS5A 3AGQA 2VPPA 4IOLA 1N0VC 1JAIA 3SYLA 2RKOA 4BLTA 1P4SA 1Q12A 1Z06A 1ZCBA 3GPLA 4ESHA 1RRGA 2REBA 1N6RA 4LBZA 5FBLB 2IX3A 5FBVB 2ZRPA 2OAQ1 5K8UA 3ZZTA 1II9A 2D7DA 4JLJA 2JLVA 2ZJ5A 3PUVA 4BFWA 4US2R 1DAHA 2CHVA 4C3ZA 4D82A 3PR1A 5KO2A 1TNDA 3K9NA 2X8AA 2AHOA 2JJ2D 5FPKA 3L43A 1RE0A 1VTKA 3M6AA 3EZ2A 3E5HA 3LRPA 1OH5A 1W48A 3IILA 3L0PA 4AKEA 4FCTA 3PVSA 2VF8A 4A2WA 1UM8A 2AXNA 5TDHA 4CF7A 3AVUA 3CNLA 2IS1A 4B33A 4CT4B 2OFWA 3Q72A 4W5JA 3IIKA 3FGNA 1NBMA 1TQ6A 3PEWA 621PA 2VBCA 1XPRA 1KI3A 4BLSA 4RZXA 4M0LA 1KJYA 1Q22A 3VQTA 5CM9C 3ZIAA 2OO7A 4Q7LA 4XSGA 2FG5A 5E4FA 3NDPA 1EXMA 3IUYA 4OHZA 4BEJA 2P0EA 5EXPA 2HYDA 1IY1A 5JS8A 1EESA 1X1RA 4DLZA 4FMCB 1N25A 1H8ED 3MG9A 3EC1A 1Z3IX 2ZJZA 2G6BA 4M1YA 2JIZD 1M1YE 1OE0A 4C0KA 3VR4A 4XWKA 2ZXUA 5JFGA 2ZRLA 4KBFA 3WXMA 5LDDC 2H7VA 1XJCA 4DSNA 4LI0A 3FFAA 4CT5A 2Q3FA 4IOKA 2ZSBA 5J4LA 2ZRFA 2GBLA 4DIEA 1DO2A 1OYYA 2VHTA 1XZQA 1E1RA 2YVUA 3WHKA 4S35A 2BBSA 4OI0A 1A5TA 5E7MA 3AF2A 1MOZA 5EE5B 3OEHD 3PIRA 1ZC4A 3D7MA 2A30A 2G77B 3LBHA 3OAAA 4RCYA 3EIHA 4Q9JA 4XVUA 4TL6A 3TW4A 3MLEA 3ND9A 4M4SA 1QHNA 3KKOA 2NO0A 1RKBA 1Q1QA 3ZVLA 4OI1A 3N2IA 4D4MA 4QL3A 1G17A 1D9XA 4JT4A 4PHHA 4W5WA 3BH0A 5C4GB 4A0RA 2YWEA 2JLQA 2ZSAA 3DZ8A 4XWOA 2MMGA 2PCJA 3GCGA 1RVDA 1RYHA 4R98A 5JHGB 1XPOA 2Z5FA 3TIFA 5AUQA 4ACAA 3HP1A 2FFQA 1XTSA 4P33A 3GJ5A 3BOSA 3SS8A 1AGRA 4AIIA 1K8RA 5G53C 1PUIA 2PZEA 3EWAA 2FE4A 3F0TA 4MYTA 2W2VA 1SKYB 2XB4A 4TQUS 1EFTA 3NBXX 3QENA 5B2ZA 4C0LA 4BGDA 4QM6A 2QU8A 4MYCA 3F8TA 4YXWD 1G3RA 2GCOB 3QUSA 1NMYA 4IRUB 4JBXA 5FTJA 4MDEA 2IYTA 2ONKA 1Z0FA 3HR8A 1Z28A 4JMPA 3QVUA 2ZIAA 5DYGA 1E2QA 4PHFA 1CJTC 3MAAC 2J5XA 2CJWB 5DN6D 5J4YA 2RGNA 1IXRC 3C41J 3LH5A 3VKHA 3MGCA 4PXAA 1E2JA 1VKJA 2OLJA 1XCMA 4POAA 2CBZA 3BAFA 2JDIA 1J2JA 2PT5A 3UMSA 1W44A 2G88A 4R71A 3U44B 3MMPA 1HV8A 4LX0A 5JS7A 4GNKA 4AURA 3A4NA 1W5TA 1P72A 4V0LA 1TEVA 5KUTA 4HZUB 3A58B 1IHUA 3F5FA 1QHHB 3KDSE 1PV4A 4WXRA 4P0TA 4II7A 5JCZA 2OFOA 3EX7C 2ERXA 4KLZA 2UZ3A 3T5DA 2FMXA 5JJIA 2LKDA 2ZANA 4L4UA 1LW7A 2R6FA 4TN1A 4IOMA 4Y0VA 5C2JB 3BJIC 3IHWA 4MKHA 3VR6A 2I1QA 4DT1A 2DWQA 1U98A 3NH9A 1JXOA 3ZYCA 3IIMA 1VG9B 2ZRMA 2FH5B 2PX0A
chains in the Genus database with same CATH superfamily
1C3EA 2FFRA 5TT0A 4CGYA 3MGAA 2ORIA 5FYQA 1J0DA 2OQRA 4RZ2A 3LLCA 5JG7A 2HF2A 2GN6A 3NNNA 3W06A 4BU0A 3RC7A 4JH0A 3ZTYA 1BYIA 1E9AA 1KWKA 4H60A 4Z0TA 3KQMA 2ZB4A 4DABA 4JBGA 2ECFA 3FAKA 4RFVA 3NKLA 4UDXX 1Q20A 1NXTA 1U9YA 2IS6A 4G4SO 4LRYA 1GDTA 3AXTA 3WGJA 4M8LA 5WRFA 2HEGA 2VK4A 1T9BA 1KP3A 4UBOA 3R5SA 1UJ2A 3EDMA 4B7CA 2EL9A 3ICCA 5DULA 5A4FS 3F6SA 4TZ6A 3HFGA 1L5WA 1NQOA 4YA6A 2O2IA 2O8VA 4Z1MD 3VZCA 2ODNA 3Q1KA 1IXSB 4G3XA 4OXNA 4PX3A 2PKCA 1CJUC 1DJNA 4WIAA 1SHZA 1S96A 4JOBA 3ZOZA 3DZFA 4YP7A 5BWLA 2O19A 2WIKA 1HLGA 4C4OA 5BW5A 2CKMA 3QLVA 1KE2A 2WOJA 4BE9A 4COKA 5IWCA 3FVQA 4MGZR 4K0RA 3O3OB 5KSYA 4ER5A 5C9ZA 3C8MA 3E1SA 3IB3A 1C30A 3BGWA 4R41A 3WNCA 4RDXA 5J1SB 2OFXA 3N76A 4GSLA 3NWBA 3E81A 5IEBA 3OCWA 5M2QA 2D1YA 3NBYC 3K0AA 1JFFB 5JIBA 5KTTA 3N87A 4JUBA 4D8WA 3KYBA 1A7JA 5CNMA 3GIWA 3WTCA 4KIWA 1ZVKA 4OATA 2F9FA 3FM9A 3KYCA 3IUJA 4HDRB 3UJ6A 1IOZA 1OSNA 4JI3B 1EPUA 2A9FA 1OT3A 4UAJA 3NCTA 4X6UA 3DE7X 3WFIA 2YV5A 4IIHA 4NE9A 4E4TA 5HR5A 4D9EA 4HG2A 1CR0A 5TY0A 4LF7B 3A3PA 1QYDA 1Z07A 2OV2A 5I9BA 3T5CA 1Q74A 3WYAA 3F3KA 4ZRDA 2DR2A 2MSLA 2HMWA 2JBAB 1U5BA 2BUBA 1E2DA 2RGBA 4UUPA 5DO9A 5T4EA 3VC1A 1X7WA 5I6DA 4FBMA 1QYVA 1T1IA 2JLUA 2QRZA 3TTWA 3TGWA 5AM2A 2TYSB 1Z73A 1GL7A 1E3IA 2BP7B 3EIQA 4IJKA 4Z9YA 3SQDA 5JEEA 4URZR 2VRCA 1QMGA 2EKPA 2X1HA 4GC9A 4ZVSA 3WHLA 4EHDA 5HW0A 3V32A 4F12A 1NRWA 4IY1A 1E7MA 4B6OA 3I2HA 4B17A 4Q6WA 4QUEA 1TAGA 4Z9FA 4BP3A 3DKKA 3C7TA 3PJRA 3NR2A 1QAQA 3O31A 2QZ4A 4QT4A 1VRVA 1SEVA 2VYNA 1F8YA 2YYZA 4IIYA 4HLQB 5K6AC 1VSTA 3HO6A 3TRKA 4TV9B 1JQDA 1T10A 1XZPA 5G0WA 2V98A 5E4YA 3WRVA 4LC0A 4C4ZA 4IHQA 1UBFA 2YOHA 1JDBB 1Y1TA 1JXMA 4LJRA 3PGJA 821PA 4M53A 1NJ1A 3TQTA 4EUHA 1UIMA 5CFNA 2QYTA 1TVKA 1M7BA 4WZ6A 4P4NA 3QX7A 2H5LA 2HSGA 3G5LA 5AW8A 4KXQA 1EEXB 4KRFA 4R8LA 3MGKA 1PFGA 1PJLA 4LPSA 2E4XA 4YH1A 3RVSA 3TLEA 4YRZA 3B53X 5IVHA 3GLIE 5DT9A 3ITDA 4TYYA 1KNXA 1UODA 4M37A 2OZLA 4H7PA 3D0KA 1YRYE 1TC1A 3A2LA 3GEPA 1BYUA 2FEKA 1L4YA 3AOEC 4K28A 5KQLA 5CD1A 2MSNA 3G9TA 4EKEA 3EGCA 3OUTA 5GJWC 1L4UA 3A0RB 3LZCA 1UBGA 1XEAA 1MABA 1QVRA 2AXQA 2DT8A 2FWIA 3IELA 1G8AA 2G1UA 5D5HA 1HYGA 3GPCA 4ANFA 2XWSA 3I92A 1KJZA 4F86A 1SGWA 3VUEA 2RI6A 4CRWB 5E0OA 2BHTA 3MJHA 1C7RA 4GF5A 4JFAA 4BEVA 4OB6A 4RK5A 4U7TB 5AICA 3W9YA 5FUMA 3G59A 4IF6A 4O8CA 4WJKB 2KPOA 1XEXB 4LWZA 2OA0A 1JJBA 3LXRA 2MYPA 3HDHA 4NR0A 3RLFA 5BQ5A 3TB6A 3RUCA 4GMHA 5IAJA 4NOMA 4WA7A 4N5LA 3RVPA 3H5RA 2MSCB 3QW4B 4Q3NA 3EUAA 5B1EA 3NBQA 3EBOA 5CIQA 1XYGA 3DDWA 1G7RA 1FU8A 1YDMA 3QPCA 1XP5A 4CEIA 4EA6A 2E4WA 1MDBA 1GGHA 1TQ2A 3AVXA 5HE9A 2DP4E 1HZJA 2Y4NA 4RDCA 3UV7A 2JKVA 1RYNA 3VXKA 5C8VA 3B5EA 1F60A 1IONA 3U9LA 3HGMA 2AF4C 2FRDA 1YR7A 4A2PA 5LQSA 2QE6A 1KS2A 2E4YA 2WHXA 4A82A 1QHXA 4NULA 3CW2A 3G5TA 5E2AA 1ODSA 1C9EA 1TZKA 4G1CA 4RVNA 5CG2A 2Q5FA 4P9NA 1ZL0A 3TRJA 2DUNA 1GSAA 1PGQA 4M9QA 1SUAA 3DVQX 3CZMA 2BLNA 1C1DA 1B8NA 4PRLA 3HKCA 1A4RA 4FVTA 4NDZA 2BTQA 4AJ2A 2ZS9A 1VXRA 5B4UA 4AN1A 3BIJA 1Z2DA 5BSHA 2HV8A 2X9GA 2GXAA 1X19A 4FEEA 2LUOA 1PR4A 2GPYA 3P9PA 5CJPA 1JALA 2FPXA 3B9RA 1E1QA 2VEOA 2V7EA 2QUZA 3IJRA 4HQRA 5A2QA 1OREA 1RD4A 4RHUA 5ALXA 2O20A 2BBTA 4KXWA 4NS4A 1KR5A 1GRVA 1LX7A 1Y1SA 2P5SA 3G02A 4PICA 1F3OA 1O5OA 1SUPA 5TGDA 5DVZA 3T3HA 4WNYA 3B6ZA 1KZ9A 2DG2A 2OXEA 5JAHA 1Y98A 1EUDA 5FEUA 1V5EA 3ZCSA 1EDDA 1K3TA 1PDOA 2RB5A 4ZALA 5IH3A 3SZOA 4KK4A 3M70A 2OZPA 2A14A 4RVHA 3PV0A 2YZMA 5FR2A 4YROA 1OWNA 3UENA 1RQ2A 4JNCA 1T3ZA 1I3NA 1J49A 4EUEA 2XCRB 4LYDA 1AA9A 5AM5A 3IGFA 5IAEA 3TD6A 3SM3A 1XWWA 4ZCLA 1LFAA 4BJHB 3HCCA 1FNBA 4IDGA 5FWNA 4IDCA 3OQOA 1N4AA 1RXUA 4KQ9A 3NHFA 1V8DA 1VL1A 3DDNA 2QAGB 3OCJA 5ELLA 3HB1A 2GMWA 3IV6A 4NJMA 4RVGA 2VDNB 1AQIA 3TR0A 5EIBD 1OXBB 1YCFA 3KQSA 1XAIA 3JD1A 4ERNA 3DE5X 5KWSA 3QX3A 1S2MA 2DC1A 5DHUA 3SE0A 5JLJA 3E0QA 5DCWA 1OWLA 3DB2A 4J2OA 5H7XA 3U26A 4UNRA 2O7VA 1XXHB 3NAQA 2W71A 1N3LA 3CKKA 5LU8A 1V9LA 4U2KA 4JI8B 4ZEMA 1D2HA 4C5AA 2DEUA 2VSNA 2FI1A 4NPHA 3BL6A 5H3HA 3SX4A 4KKVA 5ED0A 2EG9A 3WYFA 4AUNA 1XL1A 4XCQA 1Y5MA 1Y8QA 1HQKA 4ZAFA 2A33A 3D6TB 1NGSA 2J87A 3I1IA 1LSJA 3IOEA 3NW9A 1HOTA 1NDUA 4M9CA 1TMKA 3TKLA 5A3QA 2BI8A 1RE1A 1JJIA 2PFSA 5IARA 3T3IA 3SXUA 4HKTA 3U7GA 1H2EA 4D0LB 4MVJF 4PQYA 4CIBA 1RXVA 2NAFA 1XN1A 2J33A 4AO8A 1MHPA 5CP8A 3L77A 4UEOA 1YZUA 1IZ9A 1QV6A 2NNWB 3FHLA 4LJ8A 2P91A 3U62A 5BOSB 3IEUA 4WXYB 2DB3A 4Z8XA 4PBSA 1XSEA 4BQQA 2ZRNA 4DQ0A 5SZJA 3ACBA 2GZDA 2XCOA 4KWCA 3S2ZA 4DPMA 1J97A 3WLKX 5KB3A 2P3SA 1XDGA 2VLBA 4US1R 3BICA 4YFYA 3HTXA 4MP3A 2NO1A 3AVYA 4MRMA 1CZKA 1P4AA 2FLVA 4OQEA 1PR3A 3A1VA 1UMCA 4ML3A 1VLZA 4DM3A 3RSOA 1KI7A 2FUEA 4I1IA 5G0VA 5B3LA 1T34A 2F00A 3L8MA 2GWRA 3IA2A 1GSHA 1WL8A 3FHOA 3LUCA 4U7PB 1NVVR 2ASEA 3AJRA 1AQNA 5CJJA 2NWQA 1CEQA 4LS3A 1JIVA 3SD7A 1G20B 2NTJA 1QH8A 4I1VA 5LUAA 2P67A 2WHQA 5FLYA 4HNTA 1CQJA 4FWIB 2C9ZA 1GPAA 1U65A 1Z29A 5IW8A 3AVVA 5HILA 1Z5OA 3GVCA 3TZBA 1I4EB 2QN9A 2ZSIA 3G0CA 4PBTA 5E6SB 4B3HA 1T5HX 3PZBA 3Q10A 5LJIA 5A7GA 2KLHA 1TMGE 3SR3A 3GXOA 3GFOA 2WMNB 4DLBA 4UTVA 1KR2A 2X9LA 1CDZA 2CDNA 4IMPA 4R2JA 3QU9A 4UNQA 2IPXA 4ZKDA 1DO0A 4BMNA 1JDNA 4QGAA 4CWAA 3RSHA 3DVRX 2B4AA 4UAUA 4RK6A 4EA9A 3SXJA 1NYLA 3O8DA 1PG0A 3DC2A 3ODPA 4MW6A 3JZMA 4WERA 3BWMA 2Z4RA 4WKPA 1IHXA 3AR5A 5H68A 4E4YA 3IQXA 5CCEA 2WHYA 1AK2A 3LQ1A 1V16A 4WI1A 5A5FA 3WO0A 5ADWA 1RM3A 2X23A 2QL7A 3L8ZA 4LNAA 5LPNA 2XMSA 1JYFA 1BJTA 1XMJA 2ZGVA 4HGZA 1E66A 3CWZA 3OZTA 3OQIA 4E2ZA 4NX2A 2QN7A 1N5OX 4GOND 5C1OA 1WU7A 1MUUA 2X6TA 4MS4A 2CKDA 3GRYA 4EYGA 3WLRA 3U09A 1XDZA 1AXEA 2I62A 1YZFA 2XJ9A 1WKCA 2XKAA 1ZD4A 2O8EB 4B0PA 3R3UA 1L8QA 1DQNA 3K4HA 4WNAB 3OJOA 3Q6NA 2BGJA 2C0PA 5ES4B 1F8UA 2FCAA 1B2RA 1I2AA 2GBPA 2NUAA 1D5CA 2UXCB 2ROQA 2A94A 1I01A 2QUJA 2NN3C 1SVKA 5IZCC 2BH2A 3BS4A 2VPXA 1XZIA 4HVTA 5BQFA 1ABBA 1JAHA 5EFOA 2HXGA 2OT3B 3KZ1E 4FE4A 4OLHA 4S1NA 4TLDA 1UJMA 1GCUA 4UM7A 5KTOA 3MZ0A 5FYDA 1PJCA 3OJEA 1A69A 3ESRA 1Y7LA 5CMLA 3GJ4A 3LLVA 1M0TA 1VMDA 1CUHA 3IEPA 3WDSA 4GHWA 3GRCA 3P5SA 1WR8A 3KZKA 3K70C 3VR6H 3PNYA 2YL2A 1JR2A 1ZVMA 3CQ9A 4EJSB 1QGUA 2FK7A 5AKXA 4JL5A 4N3GA 2BFWA 4UUAA 5FPPA 4BAUA 4DREA 1B0AA 5FOUA 2QNRA 3TZKA 1CP3A 4L27A 1F17A 4RANA 1DAIA 1YCDA 4RY0A 1LDBA 5GY7A 2GD2A 3KQKA 4JC8A 1T6NA 2VWHA 3U9TA 5FWAA 3WQBA 5JJKA 1ESMA 1ZXXA 4MQMA 5EWLA 4UD2A 2C84A 3O8BA 4YX9A 1AZTA 2NXCA 1WU8A 3KJEA 1RQXA 3II6X 3TYXA 4DL9A 1PFQA 2IYQA 4G0QA 3AUXA 4OBXA 3MSXA 4Q7KA 1XJ5A 4B32A 1FYWA 2ZIWB 1NXOA 1WULS 1QM5A 3LYUA 5K1ZA 3WDKA 1WJGA 4FMDB 2H6EA 2EFCB 4FLEA 1CY4A 4G4SP 3T5GA 4MWCA 4B46A 2NU8B 4YAIA 2YV3A 3AG5A 5JXGA 3ZW8A 2AUMA 1UUFA 3UWKA 1U9ZA 3X1ZA 4A6PA 2XTAA 1FTNA 1ZCAA 1FLNA 2PX5A 4URVR 1TEXA 4R9SA 3HDVA 2GN0A 5THQA 3DOUA 4RL6A 3TDKA 3ZNOA 3OX2A 5HE8A 1HL3A 2Z43A 4Q4AB 4GIBA 2CMDA 2WWRA 1J2TA 1YE3A 4GKKB 3RC8A 3QEBZ 1FJ2A 4AJ4A 2H5IA 4MNTA 3DF7A 4DRXA 5DHFA 2NYAA 3HKBA 4U00A 1PV1A 4NNJA 1LZLA 5FTWA 3ZV6A 3S1LA 4KMRA 1E2HA 2CXTA 4F04A 1DWOA 1VPVA 2EWVA 4BN5A 5LQNA 3I04M 2NSYA 4EWLA 2DHDA 2ORVA 4YPFA 4WSOA 5TNXA 2ZBFA 3IEXA 5BNFA 2ISCA 1Z34A 2CNLA 3RAJA 1QVZA 4R2WA 2D8AA 2HK8A 4GR5A 3G1WA 1YA4A 3RNLA 2V03A 1P9NA 1AURA 3V4SA 2HL6A 3NB0A 2H57A 2EZTA 3P4XA 4HDAA 3D1JA 2FWPA 4NBSA 4R4JA 2BY4A 2GBCA 3G68A 4DZTA 4IHKA 2ES4A 1RJEA 4TUYA 1IDN1 3C15C 2WMDA 1P7YA 3EZ6A 3PQ4A 1X70A 3LY5A 2Z57A 3R7DA 4HGYA 4TSRA 4CKZA 1ESEA 2D74A 1D1PA 5EWMB 2BR3A 4DDTA 2D0OB 3B1WA 4XD7A 5H02A 4KO3S 1NWHA 4B6JA 4CR6A 5HOQA 2BZSA 2XMGA 2V7BA 2D13A 1OLOA 3E27A 1RSZA 1UOEA 3WSTA 4TKLA 4AD8A 2J3EA 1D3AA 5JJBA 3A3OA 9ABPA 4EO4A 1EINA 4W9RA 4AC9A 5M3BA 1SOWA 3GUCA 3JV7A 2YIVX 4RSGA 3SIXA 1HSOA 1FSZA 1YAHA 4ROSA 4UFOA 1I10A 5DYYA 1Y42X 5I7OA 2HO4A 3TKYA 4DC0A 3L4SO 2HIGA 3SFVA 3WQRA 1Z4JA 1ABEA 5B57C 4YV1A 1XK6A 1AS3A 2Z0MA 3B60A 2AE2A 1ORHA 2ZXFA 3QIAA 1FQWA 5B5SA 3R09A 3C3AA 3RJMA 3W2GA 5JISA 3TQRA 1XRPA 5FV7A 1FVFA 1K5DA 4J7UA 4HXGA 2FSVA 3PX7A 4XIGS 3DAYA 2QP3A 1M6VA 2HF9A 3DVAA 4GC5A 1QKIA 3RHSA 2XNSA 2GCOA 4F2GA 5U4XA 2YJ3A 2A0YA 1OB2A 2CFSA 3GP5A 3QELB 3QFTA 5T4BA 5JZSA 1JGTA 2ZI7A 3K9HA 3A9TA 5L4NA 4CV1A 4DB4A 4HTAA 2IU6A 4MUEA 4EY6A 1PQYA 1NPYA 4FFBB 2DCUA 3NBMA 3UF0A 4BXOA 2O07A 3EH1A 1Q57A 3PVCA 4MULA 3JQFA 4RD0A 4I19A 3IERA 4ZXFA 4B7ZA 1OZFA 2E2WA 2ZYSA 3KQWA 1U2ZA 4AZSA 2VHEA 4M36A 1ST2A 2MU1A 4JN6B 2NTVA 4I4TF 3C3PA 5KHOC 3AFMA 2IZ5A 4LBVA 2PMBA 5BXQC 2JFQA 5LKRA 1KEZA 2OGUA 2WD9A 3JQGA 1YFZA 4G9EA 3ZQUA 5AUNB 4OHOA 8GPBA 5BYKA 2V54A 1UXGA 1O6FA 1NVBA 2Q6KA 3SK0A 4GEKA 3WKCA 4WDQA 1XQWA 4IGFA 4QXRA 1R8JA 2ADOA 2CK3A 2XUAA 4X41A 2Z3VA 3M5DA 2V45A 1FUIA 4UFNA 4Z7NB 3JALB 1TZ2A 1BX0A 1QHYA 2PLAA 2WIFA 4WZZA 1EWYA 1NVWQ 1Y7HA 3RTGA 2XCSB 5IYZB 5K8JB 1NL3A 5JPIA 1A9XB 1C0EA 2BIFA 2NZ8A 3BMQA 3KJHA 4HQOA 3V2HA 1AGPA 3F4BA 4M21A 4ISCA 2ZWMA 2VDPB 3TOXA 1FXWF 4NJEB 1KJJA 1UBMS 2CLCX 3IAXA 2FFBA 1DJMA 4YJ3B 2YUIA 2XA1A 2VJDA 4E2FA 1KO5A 3LQFA 3ZKWA 3HCPA 1OV4A 1SY7A 1U8AA 2CV1A 4GEGA 3ZWNA 1VCOA 2N9UA 3L02A 3SYNA 3KVRA 3RV3A 4K2AA 4M7PA 1FTSA 2QL9A 4Q47A 4IS3A 4C7XA 1JFSA 1ODIA 1ZD5A 3NFYA 1L2TA 4OA8A 1NC3A 4RETA 1UANA 1P74A 5H70A 3KVNA 4YDSA 2X7XA 4EFNA 1ZO8A 2PM8A 1NU6A 3QBDA 2W4IA 1ZOLA 2JGKA 3JVEA 3MMNA 1BE1A 2ZJAA 3N59A 1YRAA 2DXIA 1N5LA 2WEKA 3V3TA 4N0MA 1BGWA 2A3RA 1L5FA 1A98A 3I6IA 4XXHA 3BSWA 3WGNA 5ADUS 1DV2A 1CR4A 1OYVA 1J9EA 4MI6A 4XM2A 1KMMA 2O3UA 3G49A 4Q9LA 5FWDA 3U3JA 3GGOA 5CIYA 1SD5A 4KQFA 2C2BA 1EGAA 2X76A 4JU8A 1GD1O 1VCMA 5FA5A 4FI3F 4MWDA 1KETA 5EJFA 3VTZA 3ZNQA 1OJLA 3WIBA 5KNDA 5L3SA 1IWOA 1GNVA 2HSDA 1W0KA 3H16A 4H15A 1SO8A 2QTTA 2BYTA 1YVPA 3CKLA 4RLFA 2ILTA 2R2AA 3MNFA 3S81A 3NHSA 1LVGA 3HLKA 3EF0A 2OHGA 2QM3A 2QMOA 3GEIA 4CMIA 2K6GA 1E7QA 2C7OA 5FEMA 1P1IA 3HS3A 1V1JA 4IIJA 4ZD6A 4EG0A 1FFCA 4G0MA 3O74A 1EAYA 2IYRA 1J23A 3IIIA 5EZQA 4R6WA 3A14A 4YDQA 3R4VA 5DOVA 3L6CA 3ZQJA 4C08A 1P81A 3JVUA 5KOJA 2M6SA 1RW4A 5CB8A 3C1TA 5EIAA 3ZUPA 2XF8A 1WBDA 4DC9A 2XE8A 4L9RA 1U7OA 2NM0A 3AF5A 5I4IA 4U7FA 3RTDA 1M33A 1KYZA 3KOMA 5J47A 3S8YA 4F2HA 2Q4RA 2H2GA 4Y6QA 3CVXA 1VL0A 1LV7A 1AHNA 1QHIA 2HCJB 4F9GA 3BHIA 1C9KA 4NTZA 1MKYA 1VDZA 1M34A 2NSJA 2TMDA 5JNVA 4J3FA 1IZ0A 2AQ8A 1W9HA 4YJFA 3QMWA 4EF4A 4F2WA 2QTRA 4OAOA 1EBUA 2Q5IA 3GVXA 1GNRA 3D4NA 1NMSA 3WLJA 4R9VA 3DOEA 4K6HA 2G1AA 2PU5A 3KOOA 2H08A 4ZOQI 1V4NA 3HVHA 1NXQA 3F73A 2GK4A 3IC5A 1YR3A 2PQ2A 2IUYA 1I5EA 3OLQA 5KYGA 3E4CA 2WILA 1C7JA 1T2EA 4S1VA 2IC5A 1TJYA 4AUKA 3EXAA 1X0XA 4OLBA 4NQZA 4Q18A 1X8XA 4KUHA 3M1IA 4GKAA 4URYR 3CKMA 1DIOB 2VK2A 3GLHE 3VR4D 1ZEMA 2GOYA 2UVPB 2XMPA 1E60A 1SB9A 2JZCA 5HRAA 1XEWY 4HNQA 4KPUA 2VJQA 1P0CA 4RCVA 4K9QA 5CAEA 5HK9A 1URPA 5JC1A 1OC2A 2GSWA 1JDJA 3ISTA 1NLUA 4L5CA 4P53A 3CX3A 4CE6A 4EMTA 1US8A 1CZUA 1WSDA 3NM5A 1W85B 5ERXA 4E21A 1BEEA 4EUFA 3DHYA 1IZYA 1MR3F 3ZCRA 3DLBA 1NUSA 1J9ZA 4LMBA 4L8FA 1CLEA 3WRYA 5HJ2A 3HCAA 3ADDA 1TC2A 2YH2A 4L2IA 3UJ3X 2G4VA 4BWFB 2YHIB 4M0KA 4AJKA 1E69A 3LHDA 3CNOA 1A96A 1N2CE 2YVLA 3TG2A 1AQ6A 1YJBA 3AX6A 1T9HA 1NTRA 2HSZA 3A8TA 1OZ0A 1W6UA 4YYEA 4PYJA 1IATA 2IIQA 5T41A 2ZK7A 2R5WA 3EVGA 4Y1EA 1YZNA 4P3PA 5DK4A 1KVTA 3FJOA 4XFDA 4OMFG 2QROA 4P2BA 3DEFA 4ZI7B 2Q5HA 3A6ZA 4IBOA 2I6GA 4IINA 2W2MA 3H1BA 421PA 3K16A 1AHIA 1P6UA 2IUUA 4ND3A 4NBWA 3A05A 3PITA 1NW5A 2QZSA 3I28A 5LP6A 5FL7A 4CN8A 2WM9B 2AOXA 4UMFA 4BZPA 5A04A 1Z7BA 2BMFA 4OHRA 1ZIYA 3OJWA 1XMVA 1Z7GA 4AY3A 3QVGB 4YRDA 1AKMA 2VQDA 3KVVA 3KJNA 5FAXA 2OCAA 3PD1A 3P52A 4DANA 5JH7A 2YBDA 4QZVA 4EUNA 4RGQA 1NFRA 1M2HA 2ZP1A 3DZCA 2GAOA 1UK8A 1KVQA 2CZCA 3SZUA 1EJ6A 3NUGA 4TTIA 5FWXB 3FIJA 4FFOA 5MN4A 1JA0A 2WIAA 3TBKA 4MQUA 2C2HA 2HU8A 4L0DA 4MXDA 5D87A 2PUHA 2JIMA 2GN1A 3H2IA 4DA4A 4O2LA 4C43A 1JEQA 2Q4TA 1SIOA 3DVSX 1CUXA 1S4MA 4JT8A 5HYVA 3B1YA 3WNQA 4B82A 1KMIY 1YMVA 3RVBA 2KW5A 2H29A 2DPMA 3LP6A 1S9HA 5A7FA 4Q66C 1RRVA 3I4LA 5FI3A 5C35A 1AQJA 3K6KA 1H9CA 2ZI9A 2PRJA 2ZPTX 1FLVA 2RHOA 3DR5A 5CVUA 3W90A 1JIQA 3W4KA 1PS0A 1A82A 1RC1A 1XF9A 5EPEA 1GO2A 5TR9A 5IU6A 4GPAA 4HLCA 2HA7A 2NXWA 4Q34A 2IBMA 2W11A 1ILWA 3AJ9A 1BDIA 3EFBA 1SC3A 3FTCA 4IWYA 4D57A 3E6AA 3A9WA 5BNZA 5TPZA 3AU8A 1RBMA 3OWXA 2QR3A 4GG1A 5ERGB 3KV1A 2MWMA 2FGKA 1OBOA 3IVMA 4JZKA 4OF4A 5JT1A 3PQ7A 5CDFA 1L8LA 2BCJQ 5FI1B 3AVWA 3EGDB 3HNOA 2FZKA 2H1OA 1SD1A 3DEJA 2FF7A 2Q9AA 4H18A 4NV1A 4LCEA 4GPD1 1N1DA 2CHFA 3THSA 1H94A 4ZJUA 5DBGA 3H8WA 4ZIRB 3CR7A 3AUAA 3AFNA 4IYRA 5HKLA 3K0CA 2A67A 2FSSA 2JIDA 2Q4EA 3K09A 3LUBA 3D6UA 5KNLA 2BUCA 4ARUA 1JEYB 1VJRA 4JX9A 3INGA 4DIFA 3IQHX 3OCZA 3M1LA 1RYBA 1NI3A 4FCVA 5F1OA 2NXNA 1ULTA 2BC9A 2ECKA 2GCGA 5JUWA 2HA6A 3ACCA 3M83A 3TOVA 4PFSA 4U5XA 1OUMA 3P71T 4N9QA 3UMVA 2BHLA 2CL5A 4DWWA 1UPAA 4CDNA 2Y1WA 2JFZA 3L0SA 2JGDA 1ZD8A 4B48A 1BH6A 3ON5A 5F2OA 1GARA 4MI1A 1W7AA 3UB4A 3L0BA 1ULSA 5SYMA 5LD2C 1I4LD 3WQSB 3ZCUA 3FE2A 3RARA 4JLDA 4K7JA 5EE1A 3S2GA 2A0XA 1SJ9A 3VR5H 4WY8A 1GGKA 1KQNA 1GU7A 4BMPB 1IJFA 3QX8A 3B6EA 4P4SB 4DRXB 3OA2A 3KC2A 3H87A 4Y30A 3KVYA 1VFPA 2C57A 4FW8A 4PYKA 2HNBA 1Z08A 4TXHA 2Q7XA 2OPHA 5IT9A 2WIDA 5JNTA 1H2XA 1PEYA 2H7CA 2BGKA 7ADHA 4FMPA 3H9CA 2Q6IA 4OIFA 4RKYA 3DE2X 1G4UR 3TEFA 1E5TA 5DGIA 4NY1A 2XUFA 3PC2A 2GYVA 3QPWA 2RE8A 4MB6A 2Q8PA 1LDMA 2QG4A 3AFHA 3QQ5A 2YUTA 3GO4A 5FWYA 5E6UB 3PFIA 1GTSA 2G0TA 4LF9B 1J8FA 1E3MA 2DQYA 2APJA 1NUUA 1TM1E 4MQ5A 2JF0A 4PG7A 3RS2A 3GEGA 4JLKA 1ZMBA 2PEYA 3IPRA 5DYWA 3DM9B 1LLCA 2NZJA 3DKRA 1BEUB 4YRFA 1H1LB 3K70D 2QA5A 1QGYA 3U13A 1KTIA 1GQFA 1KBQA 1YXMA 2LP4Y 5KQGA 3CB2A 3P4YA 4D9NA 4JI1B 2JGMA 5KTSA 1J2UA 2DPXA 3TM5A 1SXPA 2AMYA 3ZXXA 5LLDA 3HXOA 1TPZA 4ZVUA 5AXBA 5ANRB 2VYCA 4IKPA 1RQNA 1ZU4A 2VF2A 4DC1A 2OGSA 3OQ6A 4UHJA 5K0GA 1AGNA 2G4LA 4OHVA 3VYVA 2IY8A 5GV7A 1DX9A 1A8HA 1XT6A 1DQPA 3ND7A 4G89A 4HRVA 4ZVQA 5TEWA 1WZ2A 3GDWA 3JSXA 1DC6A 2O48X 2LRHA 4JUIA 4MCHA 1KO1A 3UWMA 3SNKA 1P7PA 3FHCB 1JW9B 4PX2A 2G09A 1MJGM 4EY5A 1H65A 2YVQA 4M83A 4CETA 2VRCD 4A1FA 4UTOA 2AZTA 7GPBA 1GAEO 4Q82A 1WF3A 1L3BA 1Y34E 3PC4A 3G82C 3KFVA 1GRNA 3RKRA 2LIPA 5CFPA 3HMKA 1M1NB 2OTCA 1YQGA 5CD9A 2J9FB 3DLIA 3JYPA 2F3TA 2VYND 4LWPA 4KWHA 4XRGA 2IU3A 4MRAA 4NE2A 1TVCA 1U4SA 3ZHTA 3DE4X 3RS4A 1GQQA 2VUTA 3D2AA 4HRAA 3SBXA 2FY8A 1E2UA 4WNCA 4MVJA 3BERA 4HDNA 2AT1A 4KH0A 2OYCA 2I4IA 3IFSA 3RO7A 4BMZA 1JKJA 1I1HA 5E3JA 3ZZNA 2O3RA 1E18A 1USUA 1LJ8A 2AQKA 5DGXA 1W5AA 5I7UA 2JGEA 3KWFA 2QVZX 2HB6A 2V8BA 4FYYA 2VF5X 4KGZA 3GAFA 3P27A 5DYIA 3T1QA 5A6SA 4TWIA 5ADVA 5A4DA 3D0QA 4M0MA 3C16C 1FA9A 2GZAA 3SEQA 4TYQA 4MWOA 4ZO8A 4OH1A 3T9BA 2Z6UA 3OICA 2DAPA 2PHZA 1E6LA 1WVGA 1XNGA 1ZK2A 2FEMA 3DMRA 3N0TA 1ZA2A 1EBBA 2A0WA 4G5OA 4X1IB 2V7TA 3EY4A 4L78A 2BJWA 3QA3E 3FZGA 4PZ0A 1TGYA 3JPYA 1T6ZA 3A10A 3PXDA 5EIOA 4UBNA 1MV8A 1S8FA 3DMTA 4C76A 4CG1A 2WJJA 4N0QA 4JL6A 4DY6A 2X6RA 4TRMA 5IF9A 2RJOA 3NTXA 4P31A 3ZX5A 4E1AA 4DNPA 1ZI8A 3L82B 1VIDA 4X1YB 5HMMA 2WBLC 1WUJS 1JFTA 2IIPA 2IXDA 2IEYA 4EKNB 5B6IA 1PWXA 3VH4A 5J4KA 4KG7A 1TU3A 1UBHS 2HXSA 3G0BA 5KBYA 3T1YB 4QJ3A 3DG9A 1M67A 3I2KA 2Q0QA 4ZRMA 2L2QA 3M3HA 5LA6F 3HCRA 4PG5A 1KZ1A 1RCTE 3B70A 4H7IA 2VTVA 3WG9A 3RT7A 1OZAA 4JJ4A 4BQNA 5LXTB 4PXYA 3O82A 5IWAB 2AC4A 1WV0A 1AK1A 3GH1A 3UCEA 1N5RA 5KSWB 5HZGA 3TGLA 2GM4A 2ZIEA 3EPLA 1MB2A 9MHTA 1BKDR 3Q9NA 3HY4A 1RLMA 3FOWA 4DQVA 3NGMA 3KTAA 4JBLA 1Y9DA 1N4DA 3KQOA 4D9BA 4YAKA 1KP9A 2HCTA 3A4TA 3NWPA 2QMEA 3PP8A 4IXDA 4KE6A 3FF4A 4NFSA 2GA8A 3CY6A 4MR7B 4QVGA 3R23A 3ZCQA 1AA6A 1YOBA 1R2QA 4R2KA 4XLTA 5I7FA 3E3MA 2A58A 5BYJA 1OU4A 1U81A 5GINE 2RD2A 1LS1A 4US0R 4DBLE 2D6FA 1D2NA 1Z6PA 1KMNA 1I7SB 1V0JA 1M9NA 2XADA 3NAZA 4IHJF 1ARZA 2AKYA 4Y1RB 1PT8A 4F1JA 2PRZA 1ISRA 4EAQA 1CZRA 4ZVPA 5CXUA 2FZVA 3GNLA 5HUJA 4K6CA 1CDEA 4D46A 4XWGA 4EHLA 4ABTA 4LXHA 1E1QD 3RS3A 3WYGA 3WC4A 5GPBA 4BVJA 1WZEA 3L92A 1PAUA 1XVUA 1Y3HA 2TMKA 3OQMA 1QCZA 1F2UA 1T8UA 1TRHA 1E1KA 3PUKA 1SZDA 3H5AA 5ALGA 4BIMA 4DG9A 1XTBA 2GGSA 3LAWA 4O4LB 5TMEA 2EQBA 2QJFA 2PWPA 4Y0NA 4I1OA 1ZW1A 2RARA 3HVIA 3A4MA 2CFCA 1KOLA 4X0EA 1V5GA 5EJ9A 2XLBA 5DI3A 1DKOA 2IIVA 1H3FA 3W3AH 4L8YA 4B87A 3J7TA 1WQ1R 1U0BB 1Z7EA 5IM4F 2FFHA 2B61A 3RIGA 3SDZA 2VO1A 2QR5A 4U4AA 3ZS8A 1ADCA 1KJWA 2WWHA 4UNSA 5CA0B 3ZDRA 2OLEA 2QI9F 3T35A 5BPHA 4Z4QA 3JPWA 5BVGB 1T5DX 1NBHA 4FCWA 1NNI1 2J6BA 3GLTA 3VVBA 2C3YA 3OFVA 1UKAA 2UZIR 4UXJA 2E3JA 2Z1NA 5HM6A 2BKVA 3PI6A 4W6QA 2P9ZA 3TAXA 2EEZA 1SZCA 1J8VA 4KQGA 4EPYA 2WWWA 4KWEA 1YGPA 3RODA 4CM4B 1H42A 3LWDA 3T3NA 3IAS6 4L57A 4ZAWA 1N2JA 5CDUA 4GBGA 4IZHA 1YQ9A 1ZNYA 4ZVVA 4YIHA 5HOEA 4RADA 4WE3A 1GJRA 5EY5B 3QX9A 3FFBA 3Q11A 2B92A 1IUKA 1DOZA 5FBKA 1Y6JA 1YSCA 4M0PA 4QA9A 2YX1A 3GPDG 3QM1A 5IC6A 3BULA 3W2FA 2J1LA 1TM2A 5KYWA 4RTMA 2PY6A 3GJSA 2YC2C 1NBOA 1JT2A 1KBOA 1RJGA 3D7RA 4JSYA 5DLDA 4DJJA 5C8XA 4U2GA 2H31A 2I7DA 2QRVA 1P4GA 2ZYGA 3LO5A 3OPXA 3A1FA 4K1LA 4NMXB 3FPCA 3KKMA 1CJCA 2BBOA 4M8KA 2HHLA 4OUKX 5JMWA 3Q12A 3CPEA 3GX1A 5FUWA 2NACA 2XMRA 1EH5A 3O8OB 2D5AA 4NCXA 1T4BA 3U3XA 5LQRA 1RAAA 3ZHYA 1Z6AA 3E5RA 2FEPA 2CNKA 2ZUDA 4BNZA 3QVOA 5EIWA 4WMLA 4MMXB 3WLOA 1EFRD 5AK3A 3NH6A 4URHA 3FVTA 3VC7A 2HSEA 3UW1A 3PHBE 2AFIB 1SWWA 1ZGHA 4B3JA 5TLSA 4GWKA 4RFSA 1BS1A 1SXGA 1IU9A 1YQTA 2C03A 2ZRJA 4I46A 5F2NA 3ZLUA 4MV0A 2ZJBA 1KU6A 1ZHHA 1DX4A 1AQYA 4U9HS 1E0SA 4I50F 3RH0A 4ENSA 2ZUSA 5L6LB 2C1XA 4DR7B 1E2PA 2GVZC 1QGOA 1IUPA 3F5MA 1XZDA 2JANA 1DFGA 4GBJA 1M2OA 3K9QO 3KKEA 4HMPA 1H2ZA 1MO3A 1QYXA 4IJQA 1LBTA 1PQPA 4R7TA 4IX1A 5AKZA 1BXRA 4TS4A 1DWQA 1Z4LA 4DEXA 3KYJB 2ZYVX 3QFSA 4GBED 4JBIA 1PJ8A 3AERA 1T2FA 1Z6ZA 3PXXA 2BMDA 1GHTA 3HA2A 3K0CC 3L49A 4DARA 5ITVA 3NGXA 4D3SA 4AKIA 2C78A 4KE8A 2MINB 4KFUA 1LQ2A 3LECA 1HTWA 1KDZA 4KQ1A 3WE7A 4TRNA 4MLPA 1RI3A 4LKOA 4P4TA 4JI2B 5E6RB 1V43A 4Y6LA 3BFJA 4B79A 3A31A 4QU9A 3W6PA 1KYTA 3D02A 1IHOA 1UDRA 3AI2A 3TDNA 3EPRA 4QQFA 3PQDA 3SX2A 4BCBA 2GUGA 2PA0A 2L0XA 2GEDA 1NOKA 1DJLA 3BG5A 2X0EA 1IB6A 2ET6A 5FA8A 4WLFA 1N92A 4AMUA 3WXBA 2A88A 4GSKA 1Y4SA 3LZDA 4PFKA 1X9HA 1Z0JA 4ALMA 1L6IA 3IHTA 4BECA 1KIAA 4FM9A 2G25A 1NI4A 3CLVA 3WLPA 4LRQA 4I6GA 5IFLA 1QYWA