2CL0X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with gppnhp
Total Genus 65
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
65
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide binding protein
total genus 65
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cl0X00
1E4YA 4DCNA 4PZLA 3PIRA 1ZAKA 5FL7D 3CUEF 2HV8A 3FKQA 1R7RA 4EFMA 3TW4A 4A0GA 4LYHA 2ZU6A 3OEED 4AKEA 3DPUA 2VHTA 2GDJA 1WA5A 2WZQA 2ZRCA 5SZIA 3LO5A 1WE2A 2VPPA 5JLJA 1KZ7B 1NIPA 3TW8B 4M4SA 2AD1A 3U44A 3TUZC 4ZIRA 1X3SA 3RWOA 1TF2A 3P32A 1GAJA 3AVQA 1K5GA 3BS4A 4F4CA 2VQSA 1XEXA 1Q22A 2AWNA 3OIYA 3EZ9A 3BIFA 2CJWB 4TMKA 1R5BA 1ZC4A 3WXMA 2G88A 1NMXA 4B35A 3C14C 4KLNA 2IC5A 2VP4A 4RKFA 4TN1A 4EPXA 5AK0A 2JLVA 2WSSD 4XVRA 2X1VA 3FFBA 3GQBA 5DH9A 4Q1CA 5B64A 1QF9A 2BOVA 1P75A 2IUSA 3A1SA 5AUPB 4TZ0A 2KBFA 1U0HC 5A5GA 5LD2B 2IEZA 5EXTA 2FNAA 1NVVR 3GP8A 2YVUA 1G19A 2P3SA 2J41A 3B2EA 5K8TA 1PVOA 2WIBA 3KTAB 3OIVA 1KO4A 5FFMA 4MGZR 1E79A 5HPYB 4CRWB 5E7MA 3AVWA 3VR1A 4OBEA 1OYWA 3OZXA 1BO6A 4AURA 2H92A 2QAGC 1DAFA 3CWZA 2A5YB 1LS1A 3W5IA 2IS1A 4E5UA 3FHOA 2XAUA 3ZJYA 3V4RA 3QJYA 3VR2A 2A9KA 2XNDA 3ZVLA 3RC3A 2VP5A 4MYHA 3KKMA 2W6JA 2G3YA 2R6AA 4GPTA 2GA8A 1R0YA 3CPEA 5GADl 4XJXA 2CCKA 1Z0KA 4MDFA 2REXB 4P4SB 4R71A 2J3EA 2QL6A 1KDOA 4NCNA 2QUZA 1XD8A 4RZ3A 4AI6A 4LYFA 1U0LA 1X8LA 3A58B 4KBFA 1VIAA 3C4JA 2B92A 4B48A 5IF9A 4Q9HA 1H8EA 3U3JA 2NMVA 5DN6D 2CBZA 4MRRA 3K0AA 1DAEA 5FBQB 1DVRA 4D80A 2P6RA 1Z07A 2X2EA 3ONWA 4TYNA 1KZGB 4MGKR 4WXPA 4B44A 3VR6A 1A7JA 1G18A 1V5WA 4DLZA 3DMDA 3SFZA 5D3MA 4B47A 5CYPA 3KL4A 2QROA 4GRAA 4JVNA 4HAUA 4XD7A 4GOKA 1I2DA 1Z0DA 2CK3D 1ZNZA 4BECA 1NKTA 3KDSE 5FBWB 2XXAA 3FKSA 3QF4B 4A8JA 3K8YA 3MMPA 1JJ7A 3CM0A 821PA 3U3KA 3VR3A 1SVSA 4BLTA 4D25A 3MRSA 1Z6TA 3UK6A 3IIKA 1IBRA 1IOZA 3IIJA 4LC0A 1PUIA 3VHLB 3NEYA 1Z6AA 4RVCA 1XD2B 2D4HA 2IS2A 3U4QA 3AVPA 2BBSA 2ZYUX 3U7GA 1YR6A 1G8GA 2G77B 3C5HA 3EASA 4IOLA 1XDBA 4WBSA 1NF3A 1R5NA 2QE7D 3A8TA 4KVAA 2O8EB 1IN4A 4PC3A 2Q9BA 4C7OA 2FGJA 4P3YA 2I1QA 1HQCA 3SJBA 1DO0A 1SXJB 2RGGA 1J70A 2GTPA 3SDZA 4DEXA 2QU8A 2H7VA 2EWVA 1HURA 3SNHA 1W36B 4Q9JA 1U94A 3K0SA 4TMTA 1ZYUA 2WWWA 4A2WA 2IYZA 3RYTC 5FL3A 3SBEA 4DSOA 4M1KA 1J7KA 4EQ6B 3GJXC 1JAIA 1TUIA 2GRJA 2ZI7A 3GFOA 1GRRA 1K8RA 1YZGA 4IOJA 4RSGA 4TYQA 4JJZA 1ZU4A 1XU4A 3B82A 4Q7JB 4XVQA 2WKRA 3ADKA 1CJKC 4BFYA 2YC2C 2QT1A 4UXJA 3U3MA 5JHHB 4BFUA 2GJ9A 2W0MA 5FUWA 3CRMA 3OF5A 5J40A 1N5KA 4Q4AA 1D5CA 2DCUA 2FGKA 1XTKA 1E9RA 1TMKA 2BMJA 3QQ5A 5KDDA 1Z8FA 5EXSA 4I1VA 2I1VB 1ZM9A 1GKYA 2XTMA 3TJZA 5TMPA 2FU5C 5TVKA 1VTKA 4B3GA 4CVNA 2CL0X 2Z4SA 1E9CA 4LOAA 3FMOB 1M1YE 1HT1E 4K8OA 3RRYA 3THYA 2C9OA 3R9WA 3ND8A 1ZNWA 2IUTA 2Q6TA 4C0BA 4IEEA 3IO3A 4MYTA 3RC8A 3JZMA 3FMFA 5HE8A 3U5ZB 3BD9A 2NO7A 4ACAA 1R0WA 3TR0A 4KBGA 2V54A 2V7QA 2FF7A 1ZW6A 3AVUA 2HT6A 2C9YA 1GSIA 1QRAA 3ADBA 3GLFE 4TSFD 1G7TA 1YZNA 4IDQA 1G20E 1XXHE 4JLNA 3KX2A 1X86B 1QHNA 2QAGA 4IXMA 4OQXA 1P2TA 4LPSA 2Z5FA 3SE0A 3GLHE 4LHWA 1E2DA 3PCRB 3CF6R 2JLRA 3I8XA 1IM2A 1U99A 2A5FA 1NLFA 4KLZA 1YZUA 3Q5EA 3FE2A 3LX5A 2ZAMA 1IJEA 1DEKA 1OIVA 3K9GA 2OUKA 3GJ7A 2FFQA 2XGJA 4ARZB 2EW1A 1Z22A 2CNWA 1H8HA 3UMFA 1SVIA 1GKIA 4PFSA 4PO8A 5CK4A 2GZHA 3OESA 1NJFA 4M9QA 4ZCMA 5BW8A 1E99A 1WMSA 2FPKA 3BXZA 3LY5A 5HCNA 5AWFC 3ICEA 1BMFA 1E94E 3U3RA 1JECA 4LC1A 5HZHA 3U44B 2F55A 3F3YA 1ZJ6A 2ZETA 4MRPA 2DFNA 3CX6A 1XTQA 4C30A 3GJ8A 3EWAA 1CEEA 4WAUA 1KKLA 2GHIA 4JVSB 5G3ZA 2Y8EA 3O8DA 1WCV1 2FN4A 4EJSC 3BFKA 5BN3A 5EJEA 1XEXB 4YDSA 2WOOA 1KI6B 5CDFA 4M1SA 1KOFA 1Q3TA 3I32A 4LJ5A 1I4LD 4I81A 4WZ6A 5KHOC 3GPLA 2SHKA 1F5NA 4DSUA 5F9HA 3BH7A 4JYBA 1AGPA 4C0HA 4ZDKA 2IBMA 3B85A 1COWD 4V0ME 3BGWA 5FOVA 3RVBA 2CHVA 2IYYA 2QM7A 3A36A 3S1AB 1QBKC 2W6ID 2R8RA 3L82B 3RS7A 5CB6A 2WM9B 2DYKA 1ETUA 2ZREA 3OHMA 4OK5A 3KFVA 4Z1MD 3CH4B 5L8VA 4BLPA 3CB4A 5DI3B 1FQJA 3PUYA 1KMHA 4OL0A 3LW7A 2CVHA 3QVUA 4LBYA 1P9WA 5JHGB 4XVUA 3ZDQA 3EZ6A 3K9LA 1ZUNB 1Z08A 1HTWA 3RDPA 4HYYA 3TSZA 2C8VA 2ZJAA 3EZFA 4C0AC 1OFIA 1KDRA 3MLEA 4PZZA 5FI1B 5FR2A 1IN8A 2QPOA 4LPKA 4QOSA 3GJ4A 4JVLA 3PXGA 1Y3AA 3VQTA 2G1JA 2ZR7A 2YNMA 3T5DA 3D6TB 3K0FA 4ERNA 1KY2A 3NHAA 1P6XA 1XWIA 3SR0A 3G0HA 3KKOA 3THXB 2C95A 1N2CE 3CZQA 1C1YA 2ZRPA 5BYJA 3OFNA 2IA5A 3NH6A 3JVVA 2ZEJA 5AJXA 2C5LA 3LXRA 4HAWA 1KO1A 2JA1A 2BWJA 2XB4A 3THOA 5DISB 4CEJA 3HPRA 4MKIA 5J4VA 4HUTA 5CM9C 4PC2A 2FSIA 1IY0A 3G5UA 5D3MB 4YMUA 1SXJC 1D9ZA 4G0NA 1TU3A 2J7KA 4P0TA 5JMTA 1P9NA 1CRQA 1UBGA 4A8JB 1SKQA 5DO9A 3ZS9A 3UXMA 1TQ2A 4CYMA 4R9UC 1KO8A 2WPDD 4V0MA 3B1WA 2P5SA 3Q7PA 1RW4A 1VKJA 4PX9A 1W1WA 5IRCD 3RRMA 2LKCA 4UQOA 1VCIA 4J0QA 2YWFA 2F1JA 4EFNA 1JXOA 2FG5A 3QPWA 4GOJA 5DIFA 2DWQA 1L2TA 2HXSA 3I5YA 1PJRA 1P2VA 4IFBA 4R98A 1NIJA 2NZJA 3U4QB 3PUWA 4HATA 4F92B 4Q47A 3LDAA 4GDFA 1LTQA 1KAOA 1PLKA 2DFTA 4EKDA 3GLGE 1FL9A 1FMJA 2ZUDA 1G5PA 4KODA 4NDZA 2GK6A 4Q19A 1VPLA 3SJCA 4JBWA 3B9QA 4FCWA 3QXXA 4B32A 4HLCA 4NBSA 2IYXA 1MO3A 2WJVA 1GILA 1D2NA 5AUQA 4C9BA 1NP6A 1OF1A 3N2EA 4EPVA 4F7WA 1FNMA 2RGBA 4I1SA 3TSOA 2HUPA 4OJKA 1TX4B 4KCGA 1JALA 3V9PA 1FPMA 2J9RA 2ZSAA 2VYFA 5EE9A 2VP0A 5JEEA 5FTJA 2B7CA 5FOTA 2XTZA 4OKSA 1GDDA 1U8ZA 2JCSA 2PT5A 1QVAA 3PITA 3IBGA 3UKDA 2ECKA 4MITA 2OXRA 1ZM4A 1JR3E 2Z43A 1S3GA 4PSAA 3R20A 5JRZA 3A6PC 3ZD6A 1W47A 1Z29A 3Q5DA 1SGWA 1Z47A 3VX3A 3W8NA 4C0LA 1X8KA 1OXUA 1W4RA 1JEEA 4Q4AB 5TB5A 3DVLA 3BB4A 3R7WA 1MRSA 3AKDA 3RNLA 2WHXA 4HLUC 2QGNA 1ZCBA 1KSGA 4QGGA 2AKAB 3UANA 4EJSA 4TLDA 4AKHA 2N1BA 3LA6A 4BGDA 1I4DD 2AXPA 3VU9A 2QMUA 2IS6A 3THYB 3NTUA 5P21A 2J0QA 4M9ZA 1WXQA 4BZPA 2A2ZA 2GWHA 3LBNA 2ATVA 1ANKA 3ZVMA 2WAXA 1JPJA 2RMKA 4F91B 1R2QA 1G6OA 2VSFA 4DCUA 4N0DA 3CZPA 3F8TA 1QVRA 4PTLA 3C7KA 2A78A 4NE2A 1GITA 3NEJA 4ASUA 2CDNA 3O47A 1KDPA 2WV9A 3N70A 4KXFB 1OLOA 1YU9A 5EE5B 3T35A 4KVGA 5B57C 4AD8A 4JLJA 2QAGB 5G53C 2WWYA 2NQ2C 1TUEA 2P6UA 4I99A 4DLSA 1E2LA 1KK0A 3N5CA 4OHVA 3CNLA 1Z0IA 2GCOB 2QBYA 2R62A 1SVKA 5JCZA 1FOEB 3WP0A 1JQLB 2PX3A 2VP2A 1YQTA 5CK5A 4JL6A 3IO5A 3DKPA 2MSCB 5L3SA 1SVLA 5GJWC 4NZYA 1CR2A 2V1XA 4QGAA 1Q0UA 3CNOA 2C2HA 1G8PA 5ANRB 2OBMA 1S96A 3I3SR 4CZ2A 4RY2A 2CL7X 2FSFA 1RRPA 1R5OA 4LBVA 1D2EA 4HUQB 1S1MA 2Q3MA 2Q21A 5KDLA 4TTQA 1QHYA 2G1KA 1XMSA 3QI2A 4E03A 4DIDA 1W4AA 1U8YA 4DXAA 4OHXA 3LH5A 1OFTA 2BDTA 2V8OA 1EK0A 1NN0A 1P60A 621PA 1SXJA 4O0MA 3CX7A 1YRBA 3T1VA 2EFHB 4L15A 4B3CA 4HI0E 1GIAA 1PZNA 1CIPA 3P20A 5M04A 1T0JB 4FD2A 3CR8A 1KI8A 2IHBA 3AF0A 4KV9A 3LBIA 2J1LA 4NYJQ 3RS3A 1KNQA 2QRZA 3MWKA 4S2EA 1UADA 2J5XA 2GEDA 2H17A 3VMFA 3GFTA 4TMXA 3FDIA 3HU1A 1DG1G 3BBPA 2OCYC 3EARA 4EFLA 4QKQA 4MQBA 3D7MA 4D6PA 4IDPA 3NBZC 4OK6A 1XP8A 4YLGA 2XEXA 3IPYA 2ODWA 3UPUA 1FP6A 5FPTA 3GLFB 1KI3A 5TDHA 2JAQA 4US1R 3GJ3A 5KSPA 5FL7A 3BAFA 2D06A 1KMHB 3RAPR 1X6VA 4ZPXA 4D0GA 3OEEA 1T4GA 2OM2A 4TLBA 2CL6X 4LJ9A 2N46A 2O0KA 4Q1EA 3BH0A 2CCJA 2QP3A 4TTRA 3B6EA 3AVVA 1ZD9A 4EPTA 2XSZD 4FWIB 2F1IA 2BIFA 1E4VA 2WIAA 1JR3D 4N3NA 4R2HA 1VHTA 2BBOA 4LK2A 4NU0A 4A8JC 4O3MA 1Q1ZA 2PZFA 221PA 1J8YF 5LPNA 3K1JA 4NTZA 1U8AA 1ZM2A 2KBEA 3M4YA 1GOTA 1TPZA 1Z0AA 3TH5A 5JSZA 1RC8A 3QENA 1IONA 5FTNA 2ZVQX 4DCSA 1RIFA 2N42A 2NTYC 4Y0VA 4B73A 2PEYA 2WSSA 5KOYA 2WTUA 2ZYWX 3CLVA 3K9NA 3W8RA 1UDWA 1A5TA 1JB1A 1MKYA 2ZUCA 1FFHA 2HLDD 4H1VA 4RFVA 3SFVA 2WICA 4CEJB 2D3WA 4BASA 1M34E 4C0JA 1XEFA 4BFTA 5HE9A 4MRVA 3N2IA 1G41A 2B6HA 2QSYA 4NH0A 2WJJA 2OFXA 2GVZC 2ZYVX 3EZ7A 1OH8A 4HLUA 1OH5A 4WOPA 4MGIR 4QBHA 1U9IC 2UZIR 1G1MA 3GJ5A 4GSYA 4D26A 1J2JA 2WWXA 3O8BA 4L5BA 1A2BA 4POAA 3ZZTA 4D4LA 4MUAA 5KNBA 4FWTA 4PQYA 1W49A 3QEJA 1I2MA 2QG6A 2V3CC 1Q12A 2FZ4A 5LBIA 2PJZA 4ZKDA 4UNRA 4HAYA 4BFZA 4MKHA 4TL7A 1FTSA 3ZD7A 1ZRHA 1ESNA 3KKNA 3LFUA 1KSJA 2ZAOA 3KXLA 3FMPB 5JS8A 2Z6VA 1JPNA 5EUMA 5FR1A 1Q44A 2MMCA 1II0A 5LB4A 5TARA 3EA0A 2ZJ2A 4NCHA 3VR4A 3W90A 2XZPA 1FP7A 1CJVC 2C77A 3HR7A 5TV2A 1OHHD 1UF9A 1XEWX 3EPHA 2A5JA 1KK3A 2GNOA 1T3HA 3JVUA 4PO9A 4RZUA 4TTPA 3WMFA 2QPTA 4M53A 2DPXA 1G8HA 3KXKA 1LY1A 3A4LA 1KI6A 3LBHA 1VCMA 2NIPA 3NKVA 3DOEA 4HAZA 5H68A 2ZJOA 1GNRA 3MFYA 1XEWY 5IK2D 5UKDA 4B3DA 2QP9X 2ZRJA 2GK7A 2PCLA 4UNSA 3SHWA 2W00A 2OXCA 4B43A 4PHHA 5HTKA 2BBTA 1W4BA 2H57A 5IHPA 3F5FA 3ASZA 3J81k 5L3RA 1E0AA 3S1AA 3MGCA 3BRWD 3OAAD 2FSGA 4URYR 3NDBB 5DYIA 4LYJA 1II9A 1DOAA 3CRRA 3M1IA 1F2TA 1XMJA 3EIQA 1HH4A 4KSCA 2HEIA 2CCGA 1IN7A 3T06B 5DI3A 3HU2A 2R6DA 4JLOA 2ANBA 2NPIA 3WHKA 2ZPTX 3BE4A 1TEVA 3R7WB 1G7SA 1XRJA 2QE7A 4PPNA 3EPKA 5F2EA 3Q85A 1SVWA 1HY3A 2RGCA 1Q1QA 1XTSA 3RS5A 4DZZA 3FHTA 4KFSA 4U7DA 3DOFA 1E2IA 4EJSB 2GVDC 4XTRA 3WY9A 4RD1A 4CEIB 3VU9B 1VCNA 5EXPA 4BFXA 2ORWA 3AF2A 3H0KA 2ODNA 4PAQA 4ZV4A 5E3HA 2JIZA 2ZRKA 3SQWA 3NBFA 3ZH9B 4IOMA 2PJRA 1Z3IX 4W5WA 4AG6A 1AKYA 2RB4A 3FFAA 5SZHB 3QUSA 3RHFA 1VG8A 4E09A 1TAGA 3X1YA 1XX6A 1KAGA 2BKUA 4A1FA 5HR5A 3LRPA 1HT2E 1WF3A 4GOXA 3NHBA 1NVXQ 1TQ6A 3THXA 1T5LA 2EWWA 1P3JA 1CJMA 1X1RA 1ZM7A 2DWPA 3IUYA 5GVRA 1AA9A 4AKIA 1R0XA 2GAOA 2CE7A 2L0XA 3CO5A 4H1UA 2V6IA 4NYMR 2JATA 4V03A 2VL7A 3W6OA 2OG2A 3KJIA 3UIEA 5GVSA 2V1UA 3REFA 5B30A 2AFHE 3Q3JB 2VSXA 4PQFA 2ZI3A 4XWKA 1Z0JA 3GJ6A 1EFRD 1CF4A 2C03A 3V00A 1QHHB 1SHZA 1S0UA 4LJ4A 3X2SA 4NHOA 1XPRA 1XJQA 2QBYB 4MRSA 2G9NA 1G17A 2FA9A 2R44A 2H8KA 1W5TA 2H1LA 2VRWA 4HDQB 2FMXA 2OILA 4DJTA 4S35A 5EUQB 3RS2A 5L3SB 2XB2A 3R8FA 4D82A 3T34A 4PHTA 2XITA 4JKIA 5EP4A 1ZP6A 1DS6A 4TYWA 4PPQA 5DLQC 2ZE5A 1D6JA 4M1YA 1G291 1TQDA 4LHZA 3LV8A 4KJZA 4LV8B 5CLQA 2PBRA 2R6GA 3B1ZA 1F3OA 1T9HA 1QDEA 2JJ2D 1S3SA 2J0UB 4TSFA 4CEHA 1OKKD 5FTMA 1EFTA 3ZS8A 1SHKA 4YC7A 4BZXA 4L9WA 5DGXA 1AS2A 2FPLA 5EP2A 4JSYA 1U9IA 4ZDJA 2CE2X 2QPAA 1NKSA 3KXIA 3AKCA 4MKGA 4TWZA 1QZXA 2OFOA 3AV0B 3A4MA 2NG1A 2BEKA 4TT3D 3JZAA 4QGHA 1GM5A 1G4UR 4KI0A 2YV5A 1KY3A 1ZNYA 2BEJA 3IIMA 3HPQA 2UVQA 3GEIA 4FMBB 5DI9A 3PJRA 4CF7A 4BUJA 4DUGD 2ORVA 3ADCA 3T61A 2A5DA 4DLTA 4QGFA 1OIXA 4IFEA 1E9AA 1K5DA 4DB4A 1J99A 1N6LA 5CYOA 4D81A 1CU1A 2HCBA 2J59A 1U2RA 5FUXA 3Q7QA 5AJVB 2OCBA 3A1WA 1BYIA 2MMGA 4TQ9A 2HYDA 3QXCA 1OB2A 5BWMA 1QHGA 1DG3A 3TIFA 1K6MA 2PMKA 3UWKA 2ZRNA 4KYIB 2JLQA 4WZBE 1R8SA 2X2FA 1TQ4A 3AGPA 1Z6YA 1BKDR 4QNMA 4PXAA 4A36A 4HZUA 4Z8XA 5GJCA 4RD2A 4JMPA 3LLUA 1E9SA 5K8LA 5JSZB 1KTVA 3CBQA 3RSOA 5HKKD 3WNCA 5C4GB 3DL0A 3CKLA 2J45A 3MWLA 1XPOA 3DHWC 1KGDA 1UAAA 1RRGA 3TNFA 1G4AE 3CONA 4B33A 5IT5A 2ZU0C 1COWA 4Q7KA 4W7SA 4RCZA 4ZI2A 2D62A 1X8JA 3H86A 4U02A 2NZ8A 4C4PA 2W6IA 1KHTA 2MSEB 1SZPA 3A1UA 4Z1MA 4FMCB 2MSDB 3RS4A 3TUIC 4HLDA 4D2IA 1P4SA 1FUKA 1W4CA 2GKSA 4IOKA 2ZI4A 3L8YA 4CT5A 4QM7A 5FOUA 1W0KD 3QVVA 3SC3A 4RJLA 3VFDA 5DHAA 1R4AA 1L4UA 2JJ1D 3I73A 3PUXA 3EPJA 1OXTA 3RRZA 2YOGA 2HF9A 3U6KA 2GCOA 2Q3FA 4W9MC 1NVUQ 4A15A 4TYYA 4URWR 2BM1A 1E3MA 1DARA 1G3IA 4A6XA 3W6NA 1D2MA 2EU8A 3OIUA 4YXWD 4QBIA 1OFHA 4M1MA 4LHVA 2NPFA 5C18A 2EFGA 5AR1A 1T91A 2ZYTX 4KITB 2XZLA 4R2IA 2Z4RA 1GRQA 2F1HA 4AK9A 2P0EA 3DEFA 4HUQA 1W0JD 4H9GA 1F6BA 1DADA 4JLPA 4N0EA 1AN0A 2WJIA 3KFXA 5DNYB 2ZRBA 2WJGA 5K8IA 1HV8A 2QI9C 3EC2A 3LXXA 1UEJA 4GP6A 4LCBA 4X8OA 3WBKA 1UBEA 1XTJA 5KO2A 4GT1A 1JBKA 3K0EA 4AC9A 4ILEA 2CLDX 2OZEA 2FEOA 2YWGA 4OI0A 5CB8A 3IKJA 1UPTA 3FB4A 2VF8A 4TMZA 5JWHA 3M6AA 2WPDA 2JEOA 4EDHA 1YJ5A 2YINC 4DHEA 4Y0AA 2RGNC 2RGEA 3GEEA 4LJ6A 3QKSA 4LY6A 4OYHA 3GLFA 1F2TB 2FX3A 1XXHA 3QSYA 1ESMA 2ZE8A 2GILA 4EPYA 1NN5A 1QHXA 1S2MA 5GJBA 1A82A 1R8QA 3VX4A 1G3RA 2W58A 1VCOA 5KNCA 3GLHA 2HT1A 3AUXA 1KJYA 3KUDA 4GMXA 3ZVRA 2B7BA 4NCJA 4QL3A 4Z54A 4ZDWA 4I4LA 2ZRGA 2KB0A 4G01B 1ZD8A 2PLFA 1A4RA 2Q0HA 1XZPA 3C41J 3GJ0A 4P33A 1UBCA 3KJHA 5E7JA 5CITA 1KI2A 3ND9A 4OHWA 1G64A 1JQJC 2BC9A 2OO7A 1E1QA 4GMDA 5G40A 3FTQA 3ZIAD 1W44A 2DFLA 4A2QA 3QKRB 1GNPA 1ZIPA 2IT1A 1YRAA 4DEYA 1Z0FA 1XCPA 2JLSA 4WW0A 3BB1A 3RLFA 1XCGB 5FUVA 2P2LA 2NOAA 1G7CA 2BHRA 121PA 4BFWA 1CS4C 1SKYE 4C3ZA 3LQQA 1AK2A 1OPXA 4QBGB 5AJWA 3KB2A 4AKGA 3VNUA 1LS6A 4LBWA 1E9FA 3A1VA 2CNWD 1E1RD 3OEHD 4O2LA 3F0TA 5J4LA 4XOIA 4DSTA 3CRQA 2RHDA 5JI3E 1XCMA 4PC1A 2HCJB 5CLLA 1P2SA 3SN6A 2OAQ1 1OYYA 4TL8A 2A3RA 2HJVA 1DTSA 2BM0A 2FH5B 3VAAA 4DT1B 4QHYA 2EFCB 4PHGA 5J4HA 2IXGA 2ZJZA 1DPFA 2F1RA 3VHXA 4C2TA 4OI1A 1YE8A 2IEYA 4DCVA 3GFPA 4EUNA 1ZD1A 2ZTSA 3NVAA 2VP6A 4JYCA 4C2UA 4DC9A 3AVOA 1M74A 4JL8A 4YMWA 2F6RA 2IX3A 1NMZA 3MWJA 2ONKA 4LRWA 1E2PA 3GLIE 4PC7A 1VHLA 3TVTA 5DSZA 3L0IB 3RWMB 4FI3C 2XX3A 3BFXA 4CT4B 1MR3F 1M7BA 3A37A 4G5RA 4B3BA 3QXHA 4CEHB 2WKQA 1A2KC 1IHUA 3GEHA 1EWRA 4GFDA 5LB2A 3KQUA 4PSVA 4G3XA 1A1VA 1MRNA 2V6JA 4RCYA 1AQUA 2QORA 3I61A 2VSOA 2ZJ5A 3TAUA 4U00A 4UXIA 3HYRA 4KFTA 1Z2AA 4JLMA 2J46A 3LNCA 1P7CA 1Z6GA 5FBVB 3K70D 5DE3A 4OI4A 1R6BX 2YWEA 1XJ0A 2QMHA 1SQ5A 3KQLA 1NBME 2GESA 3WRXC 1MO4A 4KFRA 421PA 3Q9LA 1EGAA 4GI7A 3ECCA 2ZRLA 2LCFA 3SS8A 3L0PA 4M9XA 3ZZ0A 1ZCAA 1VG1A 5FBRB 4YMVA 3BERA 1W5SA 3AP3A 4PQRA 1RJ9A 3LWNA 3H1TA 3WHLA 1WQ1R 5EZ6B 2RKOA 3EC1A 3MCAA 3QY0A 4OHZA 1XFAA 4IVQA 1N5IA 2OCAA 3TBKA 2ZRMA 4PC6A 4CEIA 1E0KA 4G5QA 4TLEA 3KUCA 4UNQA 1HYQA 4JVMA 4M1TA 1AS3A 2ZR9A 4HZUB 4C0KA 5KU1A 3UMRA 4D4MA 5A4JA 2DFKB 3H4MA 1M2OB 3DZDA 4RZ2A 3RANA 3E1SA 4V0NA 2EVWX 3GLIA 2RGNA 4NPHA 4A9AA 5KDOA 2J87A 1II8A 3GLGA 3DDCA 1TTTA 1E96A 2C96A 1E2NA 2C99A 1BIFA 2WJYA 4JT2A 4E22A 1U98A 1T8UA 1RE0A 1UKZA 1G5TA 3PVSA 3VKGA 1M7GA 3HJNA 3RRNA 2QEQA 2C78A 4RFSB 3AF4A 2QP4A 1MO6A 2BMEA 2CHGA 4JBYA 4JKYA 4M9SA 2ODEA 4P4UA 4BRWA 1QHHA 4PHFA 1RPZA 1HQYE 1N6HA 1XPUA 2XSZA 3NBXX 4RKEA 1SULA 2BVNA 3AP2A 3TGPA 4NYIQ 4DDWA 4QJ4A 1GVNB 2JLUA 5JS7A 2GEVA 2X77A 1JR3A 3OE7D 4ON9A 1NY6A 2IF0A 3MJHA 2BBWA 1F2UB 3LVRE 4IKEA 1T6NA 2OBLA 4A0RA 3RSLA 3TAHA 3B60A 2QMOA 5BQ5A 2B8TA 3R8CA 4QJ3A 4DDTA 2C04A 2ZIAA 1E2GA 3EIEA 2O0HA 3BOSA 3NC0C 3L43A 5DYGA 3EW9A 2NO0A 1E98A 4HZIA 1VMAA 1G3QA 2J0UA 2PZEA 4HB3A 1KNXA 2TMKA 2GXQA 1DAKA 1WDTA 1WRBA 2R65A 2W0SA 2O8DA 2IYRA 4RD4A 4F4JA 3FPAA 2NO1A 3SI7A 1OFUX 3VNVA 1CRPA 4OQFA 1Q3HA 3KKPA 1L8QA 1AM4D 3T1TA 2GXAA 2WBLC 1CKEA 2I4IA 2QGZA 2CXXA 3M0EA 3TLXA 3TSWA 5E95A 4Q4JB 5B58C 2ATXA 4Q9KA 2J7PD 1XZQA 5TXGA 1KSHA 1OIWA 4HB2A 2WMOB 4QHSA 4PAMA 3QKSB 1EXMA 1AIPA 1XXHB 1ZUHA 1JAHA 3FYHA 2AL7A 1OT3A 1UEIA 2G6BA 4US0R 3RS0A 3GLHB 3IDQA 3L0OA 1VYTA 3PFIA 3QEOA 3TQCA 3I92A 3TE6A 1NVVQ 1J8MF 1PV4A 2IYQA 4UJ3A 2UZ3A 4C0QC 1E6CA 1OH7A 5JJIA 1OHHA 2GETA 3AF3A 1ONBA 3DKVA 4A82A 1NBMD 3QPVA 2X8AA 5CIQA 4BEBA 3CW2A 4Q03A 1S9HA 3QF7A 2PH1A 2QTVB 2DY1A 4Q4HB 1P2UA 5IK2A 1U81A 4BFVA 5FTLA 1D8TA 3WNBA 2HXYA 3K70B 4N1AA 2PZGA 4DDUA 2FFBA 3LVQE 3ZVNA 4L16A 4JL5A 2D2EA 3A4NA 3QOFA 5BYKA 3OAAA 3U61B 4MRNA 3EZ2A 3U7HB 1E0SA 2ZRAA 1KK2A 2JDID 3REGA 1H65A 1KK1A 2O8BA 3EIHA 3I5XA 1E9EA 2WMNB 4MDEA 3VTKA 2JLYA 1GL9B 2F43A 1WBDA 3H84A 3NC1C 4JLVA 2QENA 2VF7A 3PQCA 5KSYA 3T1OA 1JJVA 1LF0A 1T0HB 1LNZA 3QG5A 3LLMA 2PEZA 1QHIA 2WWFA 1NLZA 4FIDA 4MYCA 3ZQ6A 4XWAA 1E0JA 3EA5A 2VLIA 3I62A 4L8GA 2R6CA 1YKSA 3TKLA 3K09A 3NWJA 1G8FA 2CMKA 3C15C 4MYUA 3FGNA 2VO1A 2F7SA 2P65A 3ZZUA 3K0CC 4X8LA 5J47A 1CJUC 3U3OA 1PLJA 3AGQA 3MD0A 5H1YA 1N6PA 4V0KA 3B8HA 1W36D 1IXSB 5H70A 1P61B 4M22A 1N6KA 4TL9A 2ZVPX 4FW9A 4EPWA 5JWOA 5FOXA 4CGZA 2ODBA 1OSNA 4YDHB 5DN6A 2EQBA 4EAQA 2VTKA 4ZKEA 1HE1C 4DLUA 5SZKB 4CW7A 1G21E 1KJWA 1BYUA 1M8PA 3C8UA 4QJ5A 4DLVA 4IEIA 2NGRA 1U0JA 1G6HA 1EFRA 3U7EB 1FQKA 2QA5A 5K8UA 2CK3A 2ORIA 1GUAA 1IY1A 2W83A 1Z28A 2Z0MA 4NMMA 2BMFA 4JIMA 1EFUA 3CH5A 3U7FB 5A0FA 3X1WA 4W5HA 5C4MA 4QNRA 3TQFA 2ZANA 3TRFA 5KSZA 3O8CA 2VHQA 1VG9B 2O0JA 1Q20A 3W5JA 1SKYB 4NYJR 1YZTA 4PO1A 1X1SA 2CLSA 4DVGA 1DAHA 5EP1A 1N0WA 3P4YA 1MH1A 5FUYA 3QIAA 4NONA 2GCNA 4DWJA 4DSNA 3KQNA 5ELXA 2B8WA 3DM5A 3T5GA 3X1XA 1EWQA 3TVDA 4O25A 3R9XA 1RJ9B 3QG1A 4URUR 2FFHA 2IWHA 5AUOB 4OQLA 1UM8A 1EG7A 2OHFA 1OH6A 2DB3A 1NVWQ 4ITRC 1RFLA 2ERXA 2JJ2A 3PV0A 1KDTA 1CLUA 1ZU5A 2DBYA 2FDCA 1ZMXA 1E2QA 1OKKA 4TQUS 1KJZA 2ZROA 1IN5A 4P31A 4V0LA 2VIIA 2XOKD 4Q7LA 2QN6A 3AVTA 3AKYA 4DIEA 5C2JB 2P67A 2ANCA 1RZ3A 3K53A 1EFCA 3SQXA 3QKRA 2VH5R 4LSGA 4II7A 2GCPA 4G5SA 4Q00A 4TT3A 3BC1A 3NXSA 2LWIA 2REOA 4P32A 3GLIB 1UFQA 4I1UA 2AXNA 2FPMA 3PEUA 4HLQB 4DDVA 3OIWA 1II8B 3GLGB 3NDPA 4A4DA 3GCGA 4DUGA 3B1XA 1G3MA 1NG1A 1G16A 1XF9A 1ZM3A 3L2OB 4NCKA 4PPGA 1XMIA 2EFDB 3I4LA 4G5OA 3ICQB 4OHYA 4WZAE 4B2IA 4I1OA 5GJVC 5L3VA 4GZMA 1FX0B 3G82C 2YJTD 1OB5A 1B23P 4ESVA 2KSQA 1KKMA 1UJ2A 3UATA 3PENA 4LHXA 3IBYA 4G5GA 1AZTA 4UJ5A 3B7GA 1MOZA 4XWOA 2PMDA 3IHLA 3ZYCA 1Z83A 3LW8A 2D74A 2G0NA 3BORA 3PEVA 3UMSA 1N5LA 2ZSDA 3WBJA 4YQFA 1VYVA 3L0SA 5JECA 2D7DA 4KSBA 4Q1BA 2C98A 2QTFA 4DT1A 3SU8A 3AF1A 2OESA 2WWHA 5CM8B 2YC4C 5C46F 2XTNA 1DELA 2F3TA 1TF5A 2ZRIA 2GF9A 1LB1B 1T3SA 1SVMA 4Q66C 3R9IA 2ZXUA 4LDJA 5HKKA 4YONB 4EPRA 4MA4A 2QY9A 4R7ZA 4PPFA 4ZCLA 1W2GA 4AIIA 2FE4A 3AP1A 1OXVA 2VBCA 3GD7A 5KPDA 1NI3A 3SZRA 2QTHA 2QM8A 4DLWA 4UNPA 3I1FA 3MG9A 4BFSA 2ZJBA 1YR8A 3B1YA 3B5JA 5G3YA 4XSGA 4IVPA 3D3QA 4Q48A 5SZJA 1F48A 3AKEA 2GAAA 4WA7A 2O8DB 4BE7B 3NG1A 1W0KA 2IYTA 4HAXA 1ELOA 2JJ1A 2O5VA 3P27A 4ZCIA 5KTYA 3E70C 5LDDC 1E79D 2IYUA 1ZNXA 5EE3A 1G9XA 2R6FA 2JJ8A 2P6NA 4QFMA 5JCPA 1CXZA 1YVDA 6Q21A 1EX6A 2YZ2A 2AN9A 4TL6A 4BLRA 1NRJB 4JLKA 3QBTA 3QKUA 1CULC 2OLKA 2ZM5A 3QXJA 1CTQA 3K0CA 4PZYA 3K70C 2WAYA 5FPHA 1UKVY 5F9FA 1CBUA 2XNDD 3DZ8A 5EE1A 4YXWA 5TY0A 4V0OA 4Z51A 2EFEB 1NMYA 2IW3A 2JIZD 5AJZA 4LI0A 3SOPA 2W6JD 2C9CA 2OV2A 2ZI9A 1WBBA 2H5EA 1F60A 1R10A 4URVR 1W0JA 3IEUA 4L9SA 2GEUA 1HE8B 4KHZA 1IXZA 1YZKA 4Q7MB 5AJYA 5CJ2A 1TL7C 3KJEA 4M1OA 2X19A 4BLOA 2PLRA 2QQEA 1H8ED 4B3XA 5JBQA 4JT4A 2ZRDA 1VECA 2ZRFA 3E5HA 3MSXA 3ETLA 5FTKA 2RAPA 1E69A 2AWOA 3CF2A 2RGXA 1E2KA 4HEJA 4Q1FA 4WIAA 1NN3A 2AKYA 2FFAA 1E32A 3SHFA 1VG0B 4OK3A 1GRNA 3BK7A 1W46A 1KI4A 4LGMA 4JLBA 4Q1AA 1LVGA 3CPJB 4XD7D 2FSHA 3HU3A 3KKQA 3VKWA 2CHQA 1C9KA 3UG6A 3LAWA 3FKSD 1TF7A 3EAQA 4LV5B 2ZE6A 5CJPA 2EYUA 2HYIC 1N25A 1IQPA 4ZO4A 2RHMA 1NJGA 3C16C 4FMDB 4TLAA 3H2YA 1E2EA 3W9YA 2O8BB 2OBNA 3TUJC 4B75A 4MUBA 4Q18A 1PUJA 1N0UA 5C1BA 1HEIA 1KI1A 5CDFE 4M2LA 2AD5A 2F43B 3IPXA 4FXPA 3ZLJA 4RFSA 5KPJA 2ZJ8A 1OW3B 3HWSA 4XSHA 4E07A 2QT0A 3UWOA 2OT3B 4JS0A 1MABB 4CIDA 3T12A 3ADDA 2F3RA 1AKEA 4UKDA 2ZITA 4AYTA 3CRVA 2K5UA 2GF0A 3KJGA 2IWRA 2B21A 3FHCB 1ZC3A 1KMQA 3FVQA 5AUNB 1DBSA 3SJZA 1F2UA 1KSFX 3ZIAA 1J90A 1IJFA 2WVJA 5FPYA 2PX0A 5J4YA 2KE5A 3LQRA 1TU4A 3VR5A 2D7CA 1N0VC 3U6BA 1GWNA 3PUZA 4MGYR 2ERYA 2GBLC 4LHYA 3KQKA 2BMDA 1YZLA 2O8FB 3FOZA 3B1VA 3DMNA 2IXFA 4PR0A 1TADA 3K9HA 2IHYA 2OAP1 3RABA 2HF8A 4QHTA 2BJVA 4BRUA 1OXXK 4X8MA 4A0HA 4TZ6A 5FI0B 2GJAA 4BZQA 2QMEA 1IN6A 1NSFA 1O87A 1M6NA 1DE0A 4HB4A 4LWZA 3OEHA 1E1RA 2NO6A 4DLRA 2WSMA 4DBLC 4KAXA 4Z8YA 3CIOA 3MJRA 4KYUA 3I72A 5JEDA 3BH6A 3CWQA 5LD2C 1UKEA 4UXHA 2V4ZA 3IQWA 2DHRA 4Q4JA 3T1QA 5KUTA 5B2ZA 4MH0R 2VHJA 2JGNA 4BLSA 4B2PA 4MKFA 2XZOA 721PA 1CR4A 1JEDA 2ZS9A 1FMLA 2A7QA 3AQ4A 4JSTA 3A1TA 4JLAA 1KI7A 5G41A 4ZIRB 4XH9B 4K46A 2FWRA 1OE0A 1GL6A 3BFVA 3B9PA 4GP7A 1R0ZA 4B3FX 2F9LA 3BB3A 4IDHA 4HB0A 4TMVA 2YYZA 2IL1A 1KO5A 1NLYA 3SEAA 4CDGA 2ONJA 3NH9A 1FTNA 1O3YA 3UG7A 1B0UA 4FCVA 4LYAA 2E1RA 4LJAA 2ZSFA 2IF2A 5E7IA 2V7QD 4YMTA 5KSOA 1S9DA 2I3BA 1US8A 4BPBA 4NL4H 1P72A 3EX7C 4ESHA 2WWIA 3X1ZA 2CEAA 2YOFA 4LV6A 4M21A 3SBDA 2O8CB 4TQAA 4A6PA 4Q4HA 2A5GA 4BQSA 4HDOB 4XTCS 2OFWA 1N6RA 4DB2A 5KNDA 3AB3A 1Y63A 4US2R 1E9DA 1G7RA 5JJLA 1RYFA 3WYGA 4BWYA 1MV5A 1NG9A 3W3AA 2GJKA 3BJIC 4GNKA 2J0SA 3C5CA 2WOJA 2VP9A 3PEYA 1D9XA 3EPLA 1NY5A 1XBTA 4RD3A 2HDNB 2ZS7A 2ZS8A 2G83A 1DAMA 3ZGXA 1H8HD 3CF0A 3Q8XB 1V43A 2AFIE 2H16A 3THWA 4FINA 1CP2A 4BLQA 3HYTA 2FJUA 1NNEA 5L3QA 4Q21A 1N6OA 3SYNA 1G3UA 3AM1A 2O8CA 2VA8A 4JBXA 1TNDA 1BMFD 1ZIOA 4GBMA 1LFDB 3K0AB 4IHQA 2WWGA 2W2VA 4OQNA 1OJLA 5JZVA 1L7VC 1GL7A 2E87A 2PCJA 2ZSEA 4JJKA 4LJ7A 3SJAA 2KWIA 1QHSA 2RCNA 3QXSA 1I4TD 2XJ9A 4JLDA 4QG7A 1RKBA 2Z83A 3MAAC 1W48A 1EX7A 1T3LA 3E2IA 3WYAA 4Q9IA 1G8YA 2XXAB 4G1UC 2GJSA 4QC2A 3CRW1 1W36C 4M8NE 4K81B 2WKPA 3CNNA 2GZAA 2ZQ5A 4LUCA 2J0VA 1OXSC 2P5TB 2G0TA 1NN1A 1E2MA 4IJMA 3SYKA 1EFHA 4TLCA 5CIWA 3KZ1E 5FH9A 1GTVA 1N6IA 2AK2A 2ZRHA 3TK1A 4IRUB 4UNNA 1LV7A 5D3QA 1BS1A 3W3ZB 1XB2A 2YKGA 1FNNA 2JLWA 2XNSA 1E2FA 3OE7A 2QZ4A 1Z63A 2QSZA 2YWHA 1WB9A 1RVDA 1UBFA 4C7OB 4QM6A 4PANA 5FOSA 3HDTA 5JWRA 5FOWA 3WP1B 1QG2A 1Q1EA 2GBLA 1DAGA 3B13B 1G5RA 2IYVA 4DRZA 3P26A 4ZDIA 1E1QD 4AG5A 4JZKA 4DLXA 1KI9A 5JJKA 1AJEA 1RYHA 2QNRA 2CJWA 1Z06A 1IAQA 3QPUA 2RGDA 3VKHA 4Q02A 2W2TA 4URZR 3NBYC 3OFND 1YR9A 2O52A 3FMIA 1Z6XA 4B76A 2FEMA 3IQXA 4YMSA 1DO2A 4KO8A 1XTRA 4RZXA 2IYSA 3KQHA 3WYFA 4RD0A 4C0SA 1FW6A 3P1JA 2AX4A 2NO9A 4FN5A 3PG5A 1Q21A 3KTAA 3B78A 3X1DA 3EG5A 2JLXA 5JFGA 3K09C 1PLLA 5FPKA 1GNQA 4D0NA 4B71A 2UKDA 2J7PA 1IY2A 3CPHA 4AYXA 5HZKA 2A30A 1JI0A 2D2FA 1CR0A 4LX0A 1XNJA 2WJHA 2ZR0A 1W2HA 3PEWA 1SXJE 4HAVA 1T8TA 3CX8A 2Q3HA 1ODFA 4Q1DA 4PSKA 1C4OA 2GXUA 3WRYC 1FX0A 4IW3B 5HCIA 1Z5ZA 4OJQA 4WVFA 1XD9A 4Q01A 3WMEA 4A92A 4ZI3A 5JI2E 4P4SA 4M1WA 1VIYA 1ZBDA 1IXRC 2AHOA 4XIGS 1LW7A 4F38A 5H8WA 1UKYA 1RRCA 2VHCA 4DCTA 1NL3A 4KFUA 3U2QA 4TYPA 1NBMA 1JXMA 1BOFA 2BKEA 1AS0A 2R9VA 4F4IA 1P5ZB 1KIMA 2FOLA 4B2LA 1MT0A 2OCPA 5FBLB 3U60B 2ZUBA 4B6FA 1VDZA 5EP3A 1XMVA 2EYQA 3AH8A 1W7AA 2IYWA 3HP1A 1CR1A 2CVFA 2Q9CA 2IUUA 3KB1A 4Q5IA 2RH5A 3QKTA 2R2AA 2ZJYA 1OV4A 4PAOA 4ABYA 4B6EA 3QF4A 2BV3A 4X8HA 5J5CA 2HLDA 1GG2A 3TMKA 2JDIA 2ZI6A 3D31A 8OHMA 1XTIA 4D0LB 4QRHA 3AUYA 5EZ5A 4URXR 2ZI5A 1AQYA 1N6NA 2H18A 4F93B 2LKDA 3AVXA 2AK3A 1FUUA 3D8BA 3FWYA 1YHNA 1HA3A 1S8FA 5JRJA 1XD2A 1GP2A 1TEXA 3DO6A 1ZVQA 1CJTC 4GL2A 1M7HA 1MO5A 5KYKA 2DWOA 4EIWA 2PL3A 2REBA 4B74A 2CLCX 4BEJA 3SYLA 2O8EA 4LJ8A 1QG4A 2IK8A 5EXXA 4LZZA 2V55B 5BN4A 3DM9B 4WXRA 4W5JA 3GMTA 2Q9AA 4IVRA 2ASEA 2OSBA 1JNYA 1U90A 1LF5A 1YR7A 1AZSC 2QRNA 5J4KA 5EQTA 4V02A 4HSEA 2GJ8A 4LBZA 4IDOA 4D4JA 2QAJA 3IILA 4HDCA 5F3WB 4NKRA 3T15A 2BCJQ 4EQ6A 2JASA 1ZUIA 3NIBA 4NP6A 1GZSA 1Q1BA 1Z2CA 3EXAA 4D4KA 4QXAA 1WP9A 3AVYA 3TR5A 4ASUD 1US8B 1JR6A 4AYWA 1SVOA 2IYLD 4P4TA 2JLZA 3IGFA 3CR7A 4QBFA 1XJCA 3ZQJA 3IEVA 5IDVA 5DHFA 1T5IA 1YZQA 1N5JA 2E9SA 2GZDA 1KO7A 3WNDA 2BJWA 1DAIA 1P73A 4M0LA 3O8RA 2YHSA 4KU4A 1BH2A 3PUVA 2BCGY 2AR7A 2FZLA 3L8ZA 3P4XA 2VHUA 4OQMA 2OE2A 3K0FB 1GKUB 4IDNA 2F9MA 2HJGA 4LJYA 4ACBA 4TMWA 4O2RA 3THWB 2OLJA 3I8SA 521PA 4NYMQ 1S4QA 1N3BA 1AGRA 3MUFA 1S1CA 1UDXA 5L3QB 3LX8A 1EESA 5FPSA 1MABA 2XJ4A 1FZQA 3LD9A 3WMGA 3PR1A 2XOKA 1Q57A 2GXSA 1P9RA 4FMDF 4IXNA 4FMCF 2IS4A 4Q4LA 1E9BA 5EE0A 2DR3A 4A2PA 3MWYW 2IXEA 2ZSBA 3ASYA 4RD6A 4OI2A 3BWDD 4A0FA 4NCIA 1SXJD 2VEDA 4AWXA 1P62B 4DLYA 5E4FA 4B34A 1KYIA 1L4YA 2YOHA 2KJQA 2QQ0A 2W2XA 4NYIR 3W6PA 4Q9LA 3QE0A 3V4FA 2ZE7A 1E2JA 5BXQC 2O8FA 4GZLA 4DKXA 3Q72A 1RRFA 2PT7A 4U5XA 3IHWA 3HR8A 5F98A 3QBVA 3AEZA 5BN5A 2OEPA 3QNUA 2FV8A 3EWSA 1ZINA 4FCTA 1E2HA 2RGAA 2KI5A 4L4UA 3W34A 1GFIA 4AY2A 1HUQA 4ARZA 1VYUA 1NSTA 2V9PA
chains in the Genus database with same CATH superfamily
2P11A 4G0XA 4KPUB 5IFKA 4R2MA 4DCNA 3PIRA 3WGNA 3VUEA 1EVYA 1ZJ5A 3NNSA 2HV8A 1ZX1A 3GT7A 1FX1A 4GYJA 2C92A 1ZOPA 4LQCA 1DLIA 1NT4A 4RQBA 3TW4A 1B0ZA 1VJ0A 3AK4A 3W8DA 1JKIA 1VMIA 3DPUA 2PRSA 3EAFA 5CMLA 4F71A 1NURA 3PFGA 3QLEA 4QLOA 1U2TA 1UP6A 4O5OA 3SD7A 2O57A 1JNXX 3HNRA 5EKDA 3TQIA 3RU2A 4AN1A 4NOKA 1NIPA 3TW8B 5LOVA 2IH2A 5K1ZA 3QELA 4R2JA 3SX0A 4B6GA 4N3BA 4LRXA 3OSUA 5B1EA 1J4AA 1TF2A 1PR3A 2Z1DA 3P32A 3QV2A 1K5GA 1GGJA 3L18A 2I7CA 2JFQA 2NSLA 1M2EA 2VQSA 3UMJA 1XEXA 4CUZA 1TUGA 4F4CA 1B42A 1F8GA 1R50A 2WD7A 3CINA 4F2DA 5K3SA 3BUSA 2CJWB 1XDUA 4OTZA 3SPXA 3VPAA 4HBGA 5HUJA 1E4OA 4B35A 4MQ4A 3N76A 3ABZA 3HH8A 4OHPA 3SLKA 4DR1B 3FOCA 2VP4A 1PYDA 4RZHA 4YI5A 4RKFA 1HZJA 4PHCA 5FWXB 1E1CB 2CNKA 4TXJA 3ZK7A 5BW4A 3TWOA 3FUTA 4Q1CA 1A9RA 1JHPA 2BOVA 3ZE2B 3A1SA 2IUSA 4YAIA 5FO0A 3G1UA 4TZ0A 2V5VA 3H7IA 1CJBA 3WFZA 1TZKA 2DKNA 4GZ3A 3GP8A 2P3SA 3OLZA 2FEPA 2J41A 4Q3DA 4BP1A 4C2AA 5JNUA 5K8TA 5ENZA 3IJEB 3OIVA 3I9NA 2ENWA 1LWNA 4CRWB 1FTGA 5TQ2A 3VR1A 4EGJA 2GN8A 3OZXA 1DRKA 4AURA 4CF6A 2XW6A 4MOWA 3JARA 1GPJA 3RJ9A 2A5YB 4LMRA 1E7MA 4HQOA 2W6NA 2FSUA 1GA4A 3W5IA 2IS1A 2AUNA 3ELWA 3R76A 4LXIA 3ZJYA 4MHOA 3S68A 3V4RA 4RPCA 5BVHB 1U5CA 3QJYA 5KNBD 3RC3A 1G21A 1UBHS 2J9XB 2VP5A 4G8JA 2UUAB 5AIAA 2QAIA 3KKMA 1ULBA 2W6JA 2H7YA 2R6AA 2QTZA 4GPTA 3CF4A 2BF4A 2JB9A 5K0NA 4JP2A 2XMSA 2C1ZA 3LGAA 2CCKA 3GEMA 4LCJA 2OHOA 3TE7A 4MDFA 3RF7A 1UXJA 5TGZA 2EJCA 4MVCA 5HIMA 3ENNA 3DYIA 1BHO1 3PD1A 3OPYI 4R2WA 4RZ3A 4DYVA 1SB9A 4YRQA 4ND6A 5LDGA 1XOIA 3T4XA 1U0LA 1CZNA 3C4JA 2DQSA 5AI9A 3S2YA 2CBZA 4MRRA 3FVRA 3K0AA 1DAEA 3NRJA 4MUXA 5FBQB 5GQSA 4C04A 1J8VA 1POXA 3A9TA 1KZGB 4I1YA 4MGKR 4U5QA 3VR6A 1DBRA 2XGMA 5KJFA 2BFAA 3P8ZA 1PL7A 4CKEA 5HM6A 1ZJWA 3SFZA 4EA7A 2ZBPA 3KT3A 5CYPA 4GRAA 4XD7A 5HTOA 4HAUA 3QWAA 5K0CA 2HA4A 2VH1A 3JQGA 2CK3D 3WNVA 3QA9A 1NKTA 3SVTA 2WYHA 2V7XA 5AW6A 2ZIFA 4JOBA 3QF4B 4EA6A 3K8YA 3HBFA 3ZHYA 1J9ZA 4PGGA 1PR2A 2A4KA 4KYTA 1JG7A 4H7PA 3H8JA 3JWHA 3SQWA 4OLAA 1R64A 5D01A 5BV2P 3KIPA 3I9KA 3UK6A 2WF9A 1IBRA 2QLMA 5DHPA 1WDLA 3CCFA 3L5KA 4YRSA 1HXHA 3NEYA 3TGWA 3BRQA 2ERCA 3IPRA 3MTAA 3PPYA 3BTOA 3QTLA 1G0OA 5T3UA 4S05A 3CS3A 5GM1A 3VPXA 1YRWA 2AJ8A 1FRVA 3ZIUA 5JQGF 1NF3A 1ADJA 4BMOB 4KVAA 2NO4A 3VZBA 2O8EB 1IN4A 3M34A 2BPOA 4M3NA 3SNKA 2VH2A 5F4ZA 1SUCA 1TKRA 2I1QA 3PCXA 4MW2A 2OQVA 1OFGA 4AF8A 2RGGA 2BY4A 3FMVA 3BIJA 1QANA 1UK9A 2GTPA 4QE3A 5K3AA 1RPTA 3EFEA 2PD6A 1WW8A 3W5VA 5DRYA 1HURA 3X2EA 1FFYA 4ROSA 2CD7A 1PL0A 4M8LA 4OXQA 4RJTA 1ZYUA 1BE8A 1E8MA 3A28A 4KB5A 3RYTC 1AMNA 2UXBB 3F47A 2YNMC 3C7TA 4DSOA 1PQWA 5H80A 1Z74A 4F1JA 1UL1X 2G40A 2MSNA 3GJXC 3SXUB 5CVCA 4JI1B 1BHSA 3GFOA 1GRRA 4IH1A 2VBGA 3P9XA 3D7RA 4UBNA 3BULA 5C3MA 1CDZA 1Y80A 1SK9A 2WKRA 3ADKA 4X44A 5HDBB 3UPTA 2YC2C 3U3MA 1O4WA 1DCFA 2GJ9A 2AUMA 2LBPA 2ZTMA 3BWYA 3FYSA 3HCBA 4EOGA 5ITVA 1U2QA 1PS8A 5KC8A 1BKYA 1DUSA 1ADFA 1V1JA 2HK7A 3DKIA 4Q4AA 1QRTA 4ZC1A 4INOA 1XYVA 5L6MB 1TMKA 1TK2A 3PHGA 2BMJA 1I5RA 2AQKA 4BJHB 5KDDA 2I4LA 2VNSA 1XVLA 4I1VA 2WFAA 4Y7DA 1GNLA 2O2EA 2I1VB 3TJZA 2ZJ3A 4TKUA 4LZNA 3OO1A 5TVKA 4B3GA 3DWFA 2J3DA 3AR4A 4LOAA 3HRIA 3RRYA 3IESA 2H1SA 3THYA 4O4JB 3ZLUA 4ETNA 2NYRA 4RPIA 2Y93A 4C0BA 1E6MA 4EVSA 2MSKA 4HYQA 5F3DA 3EZYA 3JVEA 2Y27A 4Y6RA 2FMTA 4UFPA 1SUEA 4O4HB 1SA0B 3O95A 3AYZB 5C1PA 5HE8A 2VTVA 1EJ0A 2X8WA 3KP1A 5KNCH 1LK7A 1AKMA 2R1TB 3ZCVA 2V54A 2VQDA 5A3JA 4FUTA 5HXAA 4G07A 4P08A 4OLFA 3DLCA 1QRAA 1YAHA 3ETDA 1SQ6A 4S2UA 4TSFD 3QE9Y 3NVMB 1YZNA 2OBXA 3L04A 4KR9A 4KTTE 4D9NA 3KX2A 3KJNA 4P2BA 4S1TA 3TNDA 4E14A 1X86B 3R7NA 1QHNA 3K30A 5CW1A 3LWBA 3GLHE 1RD4A 3BGOS 3G5LA 1E2DA 2CMHA 2G9ZA 3ZHCA 2INGX 3L1JA 1TM2A 2JLRA 3GC6A 1IM2A 1JLKA 3H19A 3CGWA 4YASA 2A5FA 1NLFA 2FWPA 1K88A 3CBGA 4GR5A 2ZAGA 1E3LA 3AJDA 4HS4A 3OTQA 4JC8A 3FE2A 4XCXA 5FLXA 2D59A 3UWPA 2ZZMA 3AMVA 4KZPA 4BVLA 1N2HA 4HDKA 1IJEA 2HMTA 2LDXA 3DQQA 3K9GA 3NRCA 2FFQA 5AI8A 5ITZB 2QY6A 4JOQA 4BCCA 3RBAA 3PQ5A 2DZDA 3A1FA 3DFZA 5B55A 4L75A 1IUNA 2KX7A 3GN2A 3D7LA 5GM2A 3AWDA 3HSKA 1SUAA 3BWMA 4DMUB 2B8EA 2IU6A 3IVGA 2DETA 4EGAA 4X7MA 1P1RA 1NJFA 3WGOA 4F3KA 4MVXA 4ZCMA 2FTKE 1E99A 4C07A 3TTVA 2NT3A 4LGYA 3WGZA 2EFYA 3BXZA 2Y71A 3IKMB 3IP1A 3LY5A 4XVCA 3EDCA 3ICEA 1T4CA 4LQDA 2PYIA 1BMFA 1E94E 4YRLA 3ZV5A 3W06A 1JECA 1K5PA 4B87A 4EP1A 5IBRA 2FWJA 4G41A 2HMVA 4H7HA 1LLFA 4YRNA 2DFNA 3CX6A 3NBAA 4C30A 1MQ9A 3LP8A 3GROA 3DDNA 3UK0A 4JVSB 5G3ZA 3SM3A 3R0QA 4HDAA 2Y8EA 5BN3A 3O8LA 1Y3CE 2VDRB 3BWVA 5CDFA 1BS9A 1KI6B 3LL4A 2PNJA 5U9CA 2G17A 4MJXA 4WZ6A 5KHOC 2BGTA 3EB9A 1WM1A 4TSRA 4TWBA 4PW0A 3R6LA 1F5NA 3VO1A 4DSUA 1E77A 3UENA 2FK7A 1AGPA 3E8MA 2D8MA 2BF7A 5KX5A 4UUQA 1NPYA 2C8LA 4UTZA 2C5EA 1XZMA 4WI1A 4W1PA 3WJ7A 5CTJA 5BNWA 1COWD 4V0ME 2HU8A 3BGWA 3CGGA 3ORQA 2CHVA 2IE0A 3PX3A 3U4GA 3UYKA 2IPAB 4O08A 1QBKC 1SCNE 1Y3HA 1ZH6A 2XMCA 2FCRA 2HNAA 2A1UB 2PGDA 1ISFA 2W6ID 3I0NA 4XB6B 5ICEA 2WM9B 1ETUA 3G2LA 3KFVA 5HKLA 2QRKA 4BLPA 4JI7B 4MXDA 5DI3B 3AFNA 3RVKA 1FQJA 3DCJA 4OL0A 4YROA 5K5EA 2WHPA 4TV8A 2IBTA 4E08A 1TVKB 4YT4A 3HCEA 3CUUA 5K6AC 4JR0A 3DONA 1JLMA 2QVYX 4S3MA 5JHGB 4Z4EA 1WDWB 3WV4A 3EBPA 3PWSA 4MQ6A 2ZSHA 2ASVA 2FEXA 2VYCA 3V1MA 1ZUNB 3OETA 4KXWA 3G0OA 5FD8A 2CMFA 3FCSB 3FVTA 1Z08A 4QYMA 3J7AC 1A8UA 5E38A 2H8GA 4O5AA 1P45A 2KM1A 5L7WA 2QPOA 1A95A 3BJMA 3HM9A 3PL5A 5AVXA 4LFCB 2B8NA 3T5DA 1LDMA 1I80A 1PO7A 1RMYA 3DKRA 4RMGA 4ERNA 1J97A 2CYBA 5LZ8A 3RHZA 3NHAA 1P6XA 1QVWA 2HJHA 3QTBA 2R7KA 3SR0A 3WB9A 3KKOA 2C95A 3CZQA 1W36C 1O5TA 1GA1A 3JYNA 4FFWA 1PSZA 3D4LA 2ORYA 3GRKA 3OFNA 5BYJA 5HQ3A 1QTRA 5LC1A 3EF0A 2R25B 1U3UA 1M5TA 2P40A 2J3JA 2ZEJA 2UYYA 3W9SA 1IVSA 3CIFA 1FFCA 4PGMA 4AZTA 3KVYA 2XB4A 3QE4A 3QU9A 2VDWB 3G9ZA 1TIBA 5CM9C 3AIOA 1AGNA 3JXEA 3OIFA 4RIFA 4FSXA 4D3DA 3BL8A 2FW9A 1H2ZA 1SXJC 5EWJA 3IT0A 4JXZA 1S7CA 3LUGA 4UM9D 1T6ZA 4P0TA 1C9YA 1JP7A 1UBGA 5JCOA 4CL8A 3STYA 1AUPA 1LQ2A 1SKQA 2J33A 4TVKA 3PA6A 1TQ2A 3KOYA 2JKVA 2OHHA 3GBPA 3TZCA 3V8EA 1N8KA 3B1WA 3Q7PA 3VOTA 5A2GA 3RC2A 5DNYB 1WDKA 1W1WA 2N1MA 5EJ8A 4UQOA 2HIHA 4R69A 4HTFA 2BRUA 2I8CA 4J0QA 4YP1A 3U4DA 5A0TA 4M1EA 1W88A 2J08A 2F1JA 4EFNA 4PQEA 1QZUA 5JTUA 1XNQB 1T9KA 2DWQA 2HXSA 2V7PA 4JXJA 4KPUA 4LMPA 3PNVA 1PJRA 4LTMA 5JTTA 1XALA 3U4QB 3ZR4B 3PUWA 4K6CA 4HATA 3RVRA 1PR1A 3VDNB 4F92B 5FA5A 3W5CA 1G6KA 5I8PA 2RAUA 5I7WA 1SM4A 3ZOKA 2ZUDA 3N2KB 4Q19A 4XWYA 3SJCA 1IIRA 1VPEA 2X0JA 4X24A 5A1TA 5C7LO 4YY3B 5COAA 1TRHA 2PGAA 3TW8A 2C2MA 1BNCA 3QXXA 3U1VA 2VA9A 2IYXA 5AYVA 1D2NA 1OF1A 2CL5A 4NX2A 3I28A 4OX9B 3D3KA 4F7WA 2RGBA 3GPIA 3K1AB 3BMCB 2V98A 2YYYA 3PWZA 3ZCXA 3DS8A 4AZWA 1JALA 5EIHA 4UNIA 3V9PA 2YUTA 2FN9A 5CP8A 2J9RA 2AFIA 3FAZA 4PYQA 4ESOA 1OASA 1PT8A 1SIWA 4DIOA 2RHWA 4ZHQB 1MOPA 2XTZA 2OBYA 3SX2A 4OA5A 4YBZA 3GEBA 4ROTA 2JCSA 3L6DA 2HM7A 3IBGA 4R54A 3KTFA 3DOJA 3RG8A 4MITA 4FZJA 5FWXA 2OXRA 3G0BA 1JR3E 3OLQA 1S3GA 2BGUA 2R11A 4LXHA 4Y9UA 1E1CA 5H83A 1W47A 2OXFA 4OY3A 1CY4A 3A70A 3D4IA 1D1TA 1E6WA 4HPXB 1DKUA 3VX3A 3WWOA 3DMTC 2QV0A 4NH4A 4PM4A 3GFSA 4E1BA 5BUQA 4V1CI 1DQRA 1RHMA 2FPGA 3SCZA 2P6MA 2IEAA 1X8KA 5E1OA 4H6WA 4Q9NA 1DBQA 2I2FA 3BB4A 4UTXA 4KGVA 4GE3A 5K4AA 1XU7A 3TPZA 4HXYA 4X91A 4IJ6A 3ZUPA 4HLUC 2IZ1A 4FOLA 4KK4A 5EL0A 2E0IA 4QGGA 5K3OA 1GPNA 1XR3A 1XLVA 3IA7A 4EJSA 5BSUA 5I3CA 5BVHA 1RWPA 2I1WA 2QMUA 3M3HA 4X7PA 3MJSA 4EB6B 4D3FA 5CDGA 5I6DA 1UBUS 5T4EA 4H31A 4BZPA 1UMBB 2A2ZA 3LBNA 3TJMA 3UBTA 2ATVA 3AZOA 1E4EB 4RTQA 3ZVMA 4BX9A 4MS1B 4R81A 3EDQA 1KQNA 2COEA 2H1RA 1ZXLA 1ULSA 2D13A 1Z5NA 4N0DA 3LCRA 3F8TA 3UK2A 4AKTA 4KQMA 1Q84A 1C4WA 3C7KA 5JD3A 4CM9D 3NEJA 2GF2A 1KDPA 4HQ6A 3ELUA 1PZGA 1OLOA 1YU9A 3OURA 1BVYF 3HJGA 1XLWA 4MWDA 5B57C 4AD8A 2CGEA 2P9BA 2RBKA 4YIHA 3FDJA 5KTOA 3Q2IA 2ADOA 4G23A 2YXEA 4KE8A 1W5EA 4P81A 4RDCA 4ZAYA 5D7NA 4UTVA 2C9BA 1LRKA 2AXEA 2PL9A 2PZ8A 1J8DA 4ZCTA 2VWHA 2ZZKA 4PYJA 1E2LA 2IJGX 2NM0A 1YGPA 4ENSA 1SVKA 1ZI8A 3BXPA 1XTVA 3DXZA 5AOCA 4C03A 1OWPA 5IVDA 4UBMA 1IEVA 1WPGA 1EM6A 3BMQB 3DMGA 5ALRA 3HXLA 3H05A 5CK5A 3R6TA 4JL6A 3IO5A 4O1IA 3WLPA 1IBLB 1XEAA 4GGMX 3ILVA 3LLVA 1EAYA 1T2VA 5GJWC 2G5PA 3RJMA 1KGSA 3CW9A 4QGAA 1VBFA 1WS6A 1YO6A 1G8PA 2C2HA 2CFRA 1SEVA 2CHEA 1YB1A 4X61A 1S96A 3I45A 5ANRB 1CPYA 4HHEA 4I50F 1UQUA 4ZVMA 3ANSA 1BWRA 4LBVA 4IHJB 1D2EA 1QYCA 3O9ZA 1A96A 1ZXBA 4ZOAA 4Z9FA 2Q3MA 3VZDA 4EGQA 5KDLA 1RYEA 3DLBA 1QU3A 1RXVA 3PHJA 3VTZA 4IZHA 3ZGLA 3MCTA 3KEFA 4EY4A 5A5EA 4L95C 3JQAA 3LH5A 1OFTA 3RJZA 4NMXB 2X23A 1JXAA 4O8CA 1NN0A 5IN4A 1JHQA 4QOFA 3V7YA 5JDCA 1CUYA 1DFGA 1M1YB 1P5RA 3CX7A 4GPBA 1YRBA 4B3CA 3IEIA 3PPXA 4MB2A 1PGOA 4MI3A 1F4LA 3KTDA 3CR8A 4EG7A 4II3A 2MU1A 1KP2A 3JYOA 1EVIA 1QO0D 1ZSYA 2XF8A 3RS3A 4DUYB 2QRZA 3PLRA 4S2EA 4K2AA 4H17A 2H17A 1C3JA 4DQDA 4M0PA 4EFLA 1SC3A 2DWCA 2VBIA 3HN6A 3SXUA 2A1TS 4R9VA 3VZPA 1U7UA 3NBZC 5C4IA 4LJLA 1XP8A 4GVPA 2XEXA 1SEPA 2ODWA 4C05A 3UPUA 1DXOA 2C7GA 3D43A 2X0IA 3NM4A 5LUAA 5IKOA 1SU8A 2JAQA 1HO3A 4US1R 2HC9A 1TM5E 2Z2JA 4R1MA 3GJ3A 1U65A 5KSPA 3BAFA 4J1TA 3GPDG 2XLBA 1X6VA 5I51A 1PFUA 2WYWA 5DEIA 3CEPB 3HCCA 4LQLA 4X1IB 4DIFA 1E6EA 4QBKA 4TLBA 4D4IA 1L8OA 3TBHA 4JR1A 3VVCA 3DWEX 1KC1A 2XBUA 4EWLA 5FWAA 1WXEA 4KQ1A 1GCOA 4JYZA 1ATIA 1H4SA 3TVYA 1E4VA 9MHTA 2Y4NA 1RLMA 4N3NA 3EGVA 1VHTA 4CDMA 4LK2A 3P5BA 1Y48E 1APBA 4O4JA 4O3MA 1TOAA 4WK0B 1X77A 3GEPA 3MEQA 5K3DA 1Y7TA 1YRQA 3UBMA 3ZNQA 1U8AA 2E4XA 2FW6A 4U7TB 2Q4BA 1MJGA 2PRZA 3H8VA 4MRMB 3M4YA 1VSQA 1KJ8A 4D9HA 2QTCA 1IONA 4DCSA 1MXFA 1B14A 1R9GA 1RIFA 1SG0A 2XIQA 4MWEA 1SQFA 1A9TA 3BIXA 4DMMA 4MIEA 1EP9A 2PEYA 3W4IA 4B73A 2CLFB 2ZYWX 2F8SA 3K9NA 5FIUA 2P4UA 4QD3A 1UDWA 1A5TA 4G1VA 4PYKA 3LGSA 3SFVA 4FLEA 4IJWA 2XXBA 4RHXA 1HC7A 4NATA 1CEYA 2GQ0A 3F49S 4JU8A 2DM6A 2M1ZA 4XB1A 4B46A 1OH8A 2FZKA 3JS5A 3QPCA 4XAQA 1XWWA 2BSQA 3EIUA 5ALQA 1AY0A 1OBFO 2PH3A 1U9IC 2UZIR 3HCOA 3P71T 4IDBA 4PSDA 4EITA 3EVNA 2O2SA 2WWXA 3REQB 4E5MA 1DJQA 1A2BA 1FU8A 1THZA 1KXZA 3PC8A 5LKAA 3R7AA 1ZESA 4ZU6X 4POAA 3DTNA 2Y1XA 3K31A 3UUGA 2WQ7A 2OCKA 4MUAA 1V8FA 1ZIDA 4G9BA 1RQXA 4PQYA 1F6WA 3T0FA 2DKFA 1T2DA 2QG6A 2VUIB 3HU5A 2X2OA 3G3EA 3BDVA 4LZLA 3KJQA 4MS3B 3BE6A 5HJEA 3BL5A 1N0IA 4NXMB 2DX7A 2FZ4A 4QU5A 4XRRA 3MMSA 2DF8A 3TNJA 1S7GA 2C29D 3AI2A 3ZNPA 4HNUA 4ZKDA 4HO1X 1OWLA 3FN4A 3OFJA 2ZWIA 1CUZA 4HAYA 4RV5A 1MZPA 4IZIA 1GQYA 1NJ6A 3DEAA 4TL7A 4TKVA 4D7AA 5JC1A 4C6HA 3IXLA 3GJZA 3KKNA 3K71B 4FCCA 1JT9A 1Z82A 3FMPB 5EUMA 3EVFA 4E2ZA 1G59A 1XZGA 1YQEA 5LB4A 1T2UA 2IHVA 5JDIA 5ISMA 3L4JA 4BNNA 2A8YA 1GZHB 2XDYA 5CCDA 2V6BA 3PGXA 2AC2A 4RVSA 2IHUA 2OXTA 3UJ7A 1RHUA 5I4KA 1KK3A 2VF2A 3DAYA 1ODJA 3JVUA 2ZBGA 3T5TA 2QPTA 3EQ2A 1O89A 2AW3A 3A4LA 2IPOA 1KI6A 2BHTA 1VCMA 1P4HA 4Q39A 3DOEA 3O4FA 3H13A 3Q15C 2BGNA 3IT2A 4U7HA 3G2IA 1QWOA 4UFOA 4MPTA 3ITKA 2FE1A 4DC1A 2EF1A 3PDIA 2IP1A 3U0BA 1N2CB 2W00A 1EVQA 3FNRA 4ILKA 5AM3A 3ZD8A 6LDHA 1W4BA 2H7XA 3PNKA 4KW7A 1RTTA 4D45A 3LPLA 5LOVF 1RJDA 1E0AA 4ZOBA 1XKXA 1JBQA 5EJ2A 1JJAA 1HFWA 2C9ZA 2FSGA 3M83A 3AR6A 1R6UA 3N6XA 4OYRA 3O73A 4UATA 3F8SA 3UCFA 1II9A 4UBOA 1DOAA 1ZY2A 1F2TA 3TQQA 1SO8A 1JLSA 1HH4A 1OX4A 2HEIA 2XWQA 4OH1A 3LY8A 1E60A 1IN7A 4O1MA 3CZ5A 5DI3A 3PX2A 4JLOA 5FNZA 1B8VA 2NPIA 4Q6WA 4OHKA 1TEVA 1XVTA 2HB6A 2VOEA 3OP1A 3R7WB 3OWXA 1G7SA 1XRJA 3E3NA 4H27A 4RK0A 2C07A 3EPKA 1KZ9A 1ZUNA 2GTHA 1VMKA 3RS5A 2X2PA 5IASA 2H4FA 1YZ3A 4OGFA 3FHTA 4DV0B 1E2IA 1QVVA 1JKJB 2GRAA 1SQ0A 4NSNA 2FMUA 2ORWA 3CKMA 5T8KC 4OUDA 3K4PA 2JIZA 2ZRKA 5AI0A 3T3MB 5E3HA 5KYYA 3ZGNA 1B7GO 3BA6A 4FFOA 1PR4A 1TA9A 2Q28A 2J5RA 3UNXA 5HYVA 2PJRA 1Q7TA 1GPDG 3FFAA 3QUSA 3FSRA 1KVQA 3G9TA 5SZHB 3VOBA 3HXOA 1JI3A 3GNSA 5BYBA 1MX3A 3X1YA 2BKUA 5KTKA 1HMYA 2LCIA 2MTBA 4A1FA 2PS3A 3F97A 3ND7A 2JIQA 3FBTA 4FDUA 1ZM7A 2DWPA 4PCLA 3I9V6 1Y5LA 3TTYA 3DZJA 1QE3A 4TTSA 1YKGA 1QORA 3H5TA 2EJWA 1TYAE 1A9PA 2RHBA 4NYMR 4V03A 3TPCA 4N7RA 4N3CA 4UFNA 4INJA 4YT5A 4D9BA 2XKBA 3UWMA 2ZI3A 4GWKA 1N34B 1WTAA 5CXUA 1SG9A 2H4WA 1NULA 1RWVA 4HQRA 1SHZA 1S0UA 2C1EA 4LJ4A 4UUOA 4D9KA 4WJKB 5ESXA 2QBYB 1JUDA 4YRMA 2XYGA 3FNFA 1WX1A 4S12A 1NTRA 5GZ1A 5JZBA 3GPBA 2H8KA 4NEQA 3PGA1 4DJTA 3AEQB 5TEWA 5EUQB 1TT5B 5BSRA 1K7YA 3AFGA 5A3RA 1OAKA 3LCCA 4D82A 3NP9A 5AM2A 5KYUB 2CVOA 4FEEA 3ZDCA 2ZYHA 3OPQA 4GE0A 1ZP6A 5C53B 3QVKA 4TYWA 4WUVA 1BMDA 2OHGA 1RYNA 2C59A 3II6X 3BT7A 5KWJA 1EKXA 3RE1A 3IQDB 1AF4A 4LV8B 3SJ7A 3H0CA 1VL2A 3T52A 1F3OA 1T9HA 1QDEA 2JJ2D 1S3SA 4IMRA 4ZEXA 4HFNA 4FJ2A 1SKBA 1OKKD 1B16A 1SHKA 3O92A 4BZXA 3RQIA 1PQYA 2J3IA 1WABA 3FI9A 3FY4A 3O2SB 3BGVA 3OKPA 1WY7A 2PUHA 4ZDJA 5HRCA 16PKA 1NRXA 2Y2UA 2C5HA 3T0GA 3PNQA 1DDIA 2XCOA 3BMCA 4PXYA 5A5FA 2A94A 1D1PA 4HQKA 4MKGA 4V24A 5CH3A 5B5SA 2PQ0A 4H16A 1I3OA 2JAOA 1V9LA 2II6A 4K6GA 4BGIA 2NG1A 4TT3D 4UCXA 3ULKA 1QK3A 4ZHQA 2XQIA 4QGHA 1GM5A 2DPGA 1G4UR 4ZV7A 4YJ2B 1QRUA 3IVXA 2YV5A 4MA5A 1ZNYA 2P7HA 3DBOB 3DT9A 3IIMA 2UVQA 3PDHA 1SWVA 4IY1A 3I6ZA 2HA2A 4RQUA 4MX8A 4MI6A 3WR5A 3T61A 3L77A 4DLTA 4DB4A 1K5DA 3EBOA 5EMNA 1N6LA 1GA6A 2WJ3A 2X9NA 2OBBA 3K72B 4D81A 3WLKX 4URFA 3IJRA 1GDTA 4Y6GB 4HNVA 1Z4OA 2MMGA 1OB2A 4IIVA 3GP3A 1H2YA 5ECWA 3BDAA 4Y2RA 3PR3A 4ER0A 2PMKA 1ECCA 1NQXA 3FTCA 2Y0CA 2ZRNA 3NPAA 4L0DA 4X20A 4KYIB 2OFFA 4YNBA 1VIVA 2B4YA 2JLQA 2RJ3A 3I6IA 4OPMA 3ZI4A 2PUBA 3MHTA 2Q6IA 3O1IC 3X1MA 2XBMA 1NAIA 3AUSA 4EHDA 3L6EA 1TQ4A 1Q1GA 1YS7A 2ZDHA 1BKDR 4QNMA 4AJ1A 3P2OA 4RD2A 4PVCA 4KG7A 3AXSA 1J0EA 1O5OA 5K8LA 1UMBA 1K0FA 2YZGA 4QVGA 3OCVA 2AH5A 2W8ZA 2Y1LA 5C4GB 4GWLA 4MS1A 5BMVF 1RRGA 3QUBA 2X6TA 2MINB 1UKAA 2C3UA 1XWFA 3PJDA 1C0PA 4Q7KA 4W7SA 4H15A 4RCZA 5I9NA 1RPNA 1UIRA 1QP7A 3OFSA 2IP2A 1RI1A 2NZ8A 1CG6A 4TWRA 1JZTA 4ZAXA 1D5WA 1KHTA 1KS2A 2FAXA 2MSEB 3A1UA 2Y0EA 4LECA 1TKAA 4P7FA 5FKJA 3RS4A 3A3NA 2NU6B 4HPWA 6AT1A 1FUKA 1JRLA 4IOKA 4BNGA 3L8YA 1RQPA 4OH7A 3N58A 3ZPXA 1X39A 5FOUA 5B3JA 2QTTA 4RJLA 4ZWNA 1JSXA 1MX1A 5J43A 2G4VA 3PUXA 4PS1A 5I7FA 2GM9A 3JRNA 5IANA 2G04A 2Y92A 4E2FA 2HF9A 3U6KA 1W73A 2CUTA 4MP6A 5CRIA 2C1XA 2G70A 2MT9A 2Q3FA 3NBKA 2XNJA 3NZEA 5IC6A 4UD6A 4P3XA 1ML4A 5KNDH 1L7QA 3DR5A 2FK8A 4TYYA 2OZKA 2VHZA 1U1FA 2YH2A 3D59A 2JEYA 4PIVA 2OMEA 1DARA 4MI1A 2WE8A 4ENWA 3W6NA 1D2MA 3L0BA 5LA6B 1EP2B 3RIHA 4YXWD 1OFHA 5IJ0B 1EK5A 3OPVA 2EFGA 2XZLA 5K05A 1RHQA 1YJ8A 5JVDB 4F6RA 4IHJA 1B4DA 2C5FA 3QFCA 3GVXA 2RGRA 2XF2A 4H9GA 1DADA 1OU0A 4JLPA 2ZB8A 1AN0A 1Y6JA 1FTWA 2GBCA 1HDIA 3E58A 3JWGA 1F51E 1WY5A 4QJBA 3DBLB 1FYWA 3E81A 4JELA 4YP6A 1HV8A 4FLFA 3DE0X 4FFPA 4WA8A 5KQPA 3H83A 3LXXA 3P0EA 4BNWA 1QP8A 1PNVA 3NC4A 1M1YA 2ENUA 2I3DA 4W8HA 4AJ2A 2Q3EA 1ADCA 2EKQA 2I6QA 2VATA 3H6GA 3DFMA 5AW0A 1A7UA 3N6VA 4RPHA 1THGA 5CB8A 1IHPA 4PLCA 3HVHA 2HIAA 1JR2A 1QGOA 3LSTA 5L4NA 2XQJA 1WWKA 4BIMA 3O4JA 3DB2A 2IOHA 2VRNA 1KE1A 3AO0B 4QPDA 1WD7A 1KQ3A 2GEFA 2YINC 1EFKA 4X85A 3IMGA 2LD4A 2RGEA 1EFPB 3ROQA 3WK5A 1CUGA 3QKSA 3H97A 4Q82A 3CRZA 2RH8A 2ZBDA 4JITA 4MLPA 2DKOA 2J9YB 2GILA 3IAXA 1O95A 1ZO8A 4YAWA 5D2CA 4D9IA 1LH0A 1GGKA 2C2KA 4ANFA 2Y77A 1EEXB 1XGKA 3H2ZA 4H60A 1TPYA 3AUXA 4MICA 3PQ8A 4NK4A 4HEA6 3ZVRA 5KX5F 2V0GA 3RFUA 4NZMA 2LUOA 5JY6A 3A25A 1OTYA 3FYUA 2K6GA 3LRXA 3TMAA 3ZWOA 2PR7A 5LD2C 2ZRGA 4G01B 3QXGA 4DDMA 1H6BA 1A4RA 1TUBB 1CT9A 3AI3A 4UHFA 1GVHA 1NXWA 4YRAA 2XI4A 2YVLA 3W8EA 3S2ZA 1DI0A 4FYJA 5EFZA 1VI5A 2C31A 4MROA 4M49A 3S2UA 4B0OA 1N2ZA 1E1QA 1JILA 4NBVA 1U0FA 1SU4A 4TV8F 3FTQA 3LYAA 3ZIAD 2JHFA 1JN0A 4A2QA 4M8KA 1OZHA 3QFSA 2HRCA 4E4TA 4MRMA 1GNPA 2QTVA 1ZIPA 4GXQA 5AW2A 3ROXA 4RQAA 1TZ2A 1Z0FA 4DSZA 1A97A 5I9SA 1KJNA 4WN3A 1XCGB 1K92A 2ZBEA 2P2LA 3QLUA 3UKJA 3G2JA 3AR9A 1GCUA 1ILEA 1WZUA 1EB8A 1LU9A 4FEYA 2V7VA 3GRPA 4YAJA 1P6UA 2FN7A 2PUWA 5CT5A 1SKYE 1YV9A 5A6SA 5AJWA 1TKBA 5JOQA 1RXUA 1T1EA 2ZULA 5C51B 4CV3A 1LS6A 2WR8A 3OCZA 4LBWA 1E1RD 1ECPA 1M6YA 3PNYA 4D8XA 3U09A 3IVAA 1NKVA 4RJJA 5J4LA 3QM1A 1G8MA 3GLTA 1LLCA 2EX0A 1XCMA 1C8VB 1E5XA 3HBNA 1N9GB 4WV3A 5IC4A 1H3EA 3QKIA 3T5PA 5CVEA 3A32A 3WL4A 4ZALA 1Z6QA 1JJIA 4UOEA 1PJLA 1DTSA 2X58A 4QHYA 2EFCB 3IJPA 1ZGBA 2A67A 1SUIA 2Z8YA 5F1KA 4C2TA 4YI3A 4DCVA 4MS3A 1IYZA 1MIOB 3HY6A 5AW9A 5DVZA 3PTAA 1A2OA 2I4RA 3MVEA 4EMUA 4G37A 1WLYA 4PN3A 5B2FA 4YMWA 2QSJA 5GV7A 2R7AA 3HK2A 4V39A 3Q2KA 4KC0A 2IX3A 2ONKA 3ZCPA 3GLIE 2PS0A 3O3CA 4IGFA 4CM4A 1YI1A 2NU8B 2F3QA 3L0IB 3RWMB 3E61A 2IIBA 1E5LA 3BFXA 2Y0DA 4HFJA 1UWCA 3HY3A 3ONFA 4B3BA 3QXHA 3QI7A 2HA3A 3D6FA 3GEHA 4M83A 1FE8A 5DT9A 4Q93A 5LB2A 3ZZMA 3UJBA 3LPMA 1SCQA 2DT5A 4PR3A 3VPDA 1A1VA 1MRNA 4RWEA 3RD5A 3BFJA 2UYOA 2QMQA 1T10A 1WCXA 4KFTA 1QNFA 3WDKA 3HCWA 4JLMA 2J46A 1EZ1A 4W5NA 4C7XA 2QYSA 1P7CA 2HBZA 3JD0A 1SWWA 1W8DA 2V7UA 3K70D 4H0FA 4CR7A 3GFQA 1N2CA 5CCXA 3AJ8A 2EBHX 1JQAA 2IXTA 1SQ5A 1IUKA 1TW2A 3K0BA 3LECA 4FWBA 5KHAA 1FRNA 1NBME 2YMQA 3SOZA 4HCJA 5J23A 2GESA 5HF6A 5GGXA 3TFWA 4BV9A 4EGFA 3ZDAA 4Y30A 1XRRA 2C0CA 3JX9A 4N54A 3L0PA 6CHYA 1IN1A 1I6KA 4KR2A 1LTHR 3EJWA 4PAGA 2AFHB 1FF9A 3GCDA 3HV2A 3QQPA 5GZ3A 2Q5EA 1W5SA 2FEAA 4OFXA 2J30A 1BHJA 3LWNA 3H1TA 3CLRC 4X1YA 4YK7A 4RHYA 1PR0A 5EZ6B 3PQEA 2O3TA 4UREA 5EIWA 3MCAA 2AYXA 4FR2A 4FJ1A 3I2KA 4AAYA 4XDGA 1R4ZA 3CSUA 3C98A 3JQ8A 4BTEA 1XFAA 1E6KA 4HWGA 5DGDA 1N5IA 1Y5MA 2OGWA 3EDYA 4KIWA 2GPBA 3TBKA 3TXYA 4AJIA 8GPBA 5KNLA 1FVHA 2YV2A 5TEVA 4UNQA 1AS3A 4I9GA 1EMDA 3PFFA 4LMBA 1JVBA 3PNBA 5IAOA 1M2OB 4FIZA 4YWHA 5E2IA 3M89A 3LQFA 3R7LA 3WGGA 4U8HA 4PX2A 3E1SA 5JZOA 1XZBA 4MAMA 4RZQA 2PV0A 1Q50A 2RGNA 3ET5A 1CIJA 1JXQA 3CVWA 1II8A 1VKHA 1TTTA 2X9VA 1E96A 2BM9A 3ZCRA 4KPEC 1AB5A 4UEWA 2OHIA 1EP3B 3EVCA 3G1WA 3L8HA 3P9QA 2FW1A 5AVJA 2BZ0A 1KRWA 4CMGA 2C2XA 2CHFA 1FQOA 5DBIA 4E22A 4YMLA 1NXPA 1AXRA 1G5TA 2XT0A 2ZDGA 2OZVA 3CVXA 6GPBA 5IPFA 1I33A 3KWLA 2A57A 4U9IS 4MW7A 5DBEX 5HFJA 1Q7EA 5CA1B 1FFSA 4JKYA 4M9SA 3OHSX 4BRWA 3A3PA 3GQVA 3SVZA 2Q4EA 1TZJA 3FNEA 1IWOA 2BEVB 1P6QA 1QZ3A 4QJ4A 4AMZA 2JLUA 5JS7A 2IH5A 1WXWA 3OE7D 4G1MB 1P80A 5HM8A 1JLHA 1NY6A 4ON9A 1R9MA 3UHOA 4BNDB 1TT5A 1V6CA 1Q0RA 4E3ZA 4FEAA 3JPWA 2C54A 3LVRE 4IKEA 4NDAA