2CL6X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with s-caged gtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
molecule keywords GTPASE HRAS
total genus 64
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cl6X00
1YVDA 2VHCA 5TMPA 1MO5A 3IQWA 4NYMQ 1RRFA 4TQ9A 4XSHA 3T5GA 4DLZA 3A4NA 2V9PA 1KMQA 4AKGA 1LW7A 1DOAA 3NIBA 3L0OA 2IYWA 1SHKA 2Z83A 1TQ4A 2FF7A 2V7QA 3IKJA 5DYGA 4C0BA 3RABA 1JNYA 4CEJA 2AWNA 2VSFA 4MGKR 1UKYA 3SHWA 1M8PA 1CBUA 1V43A 1G5TA 2OFOA 1WB9A 5EZ5A 3DKPA 2F3RA 4LV6A 2IYYA 2CEAA 1Z28A 4KVGA 2CHQA 4PHHA 5JCPA 4BLSA 3K9NA 3EZ6A 1D9XA 1O87A 1YRBA 5ANRB 1NI3A 1T0JB 2GAOA 1X8LA 4EPRA 4HAXA 3T1TA 5BXQC 5CJPA 3SFVA 2F7SA 2CNWA 1PZNA 5KNBA 2K5UA 2FDCA 2VF8A 1T91A 4M9XA 3DEFA 4YXWA 4V0LA 1NP6A 3HWSA 4MRVA 2KE5A 2PEZA 5JRZA 3J81k 2E87A 3AVVA 3FFBA 3KXKA 4BFZA 3JVUA 3SQWA 2NO1A 4TN1A 2LKCA 4D2IA 2OEPA 1T5IA 1AJEA 3CX7A 4XVQA 3VU9A 1FUUA 3TUJC 4N0EA 3GJ5A 3HPRA 1Q1BA 2HV8A 1ZRHA 3B1ZA 3P26A 1Z8FA 3WHKA 4UNNA 3U7EB 4NCKA 2QZ4A 5EZ6B 1XRJA 2VHQA 3T5DA 3FWYA 2DWPA 4XOIA 3RWOA 4M1MA 1S9DA 1L4YA 3AM1A 4JSYA 5DN6A 2DWQA 2E9SA 1UBFA 2WPDA 2ZRNA 2VEDA 3KJEA 4TYYA 4A8JC 4C30A 3K9HA 2V1XA 4XH9B 1KO7A 1SVWA 1G64A 4RZXA 1CEEA 4PPQA 4LBWA 2ZM5A 1OF1A 1NG9A 1M7BA 2R6AA 2CDNA 4EPYA 3C7KA 4J0QA 4LHYA 3SE0A 3L0IB 3VX4A 3ZJYA 2DPXA 4IDNA 1KSJA 2G1JA 2JIZD 3CWQA 3ZQ6A 1OV4A 4P4SB 3W34A 3G0HA 1R8SA 3FHTA 3GEIA 5AJYA 3KUCA 5KNCA 4HZUA 3QKSA 1IY2A 4ESHA 2OV2A 4HAVA 1SHZA 4IFEA 4ON9A 4ERNA 5KPJA 3GFOA 4AIIA 1AQUA 1Z0DA 2QT0A 4M21A 4LUCA 1E2MA 5GVRA 4QFMA 5CLQA 1E2PA 3U3OA 5JRJA 2IS4A 2V1UA 1NRJB 1Z0AA 4QHYA 1ZD9A 2F6RA 3I72A 1DBSA 2GJ9A 1PUJA 3CZQA 5EE1A 2QNRA 1A1VA 3W6PA 1RE0A 1E32A 5HR5A 3R8CA 5FUXA 2P0EA 4KBGA 1WQ1R 4A0RA 1FZQA 2YWEA 3QY0A 1XEFA 2B92A 4Q9KA 5A0FA 2BMFA 2WICA 1G9XA 1K5GA 1UEIA 2R65A 4D4KA 1CU1A 4PAQA 3UWKA 2O8EB 4B73A 3KFXA 1JXMA 4BFWA 3ZZUA 1GM5A 1Z22A 2EYUA 5DI3A 3IHLA 4BFYA 2EFHB 1EFRD 1ZCAA 4M1KA 3K53A 5C18A 2QE7D 3W9YA 1OW3B 4US1R 4M1YA 2GF0A 4WVFA 2G9NA 2GJSA 5JSZA 4IXNA 3KTAA 4D0LB 3CX6A 2IYLD 1KK3A 3TNFA 2JCSA 2KB0A 3AVOA 5D3MB 1X86B 4YC7A 1COWA 1T9HA 3TKLA 1AIPA 2WPDD 2V4ZA 4AYWA 2OZEA 3ZS8A 4DUGD 2QTHA 2F9LA 1CR0A 2GCPA 4NYIR 1GP2A 1F2UA 2H5EA 1XTQA 3R20A 4QJ5A 3AVTA 3K09A 1TMKA 2ZETA 1W1WA 3TRFA 1GZSA 1RYHA 1R4AA 1GKIA 1EG7A 3K9LA 2FGKA 4OQLA 4BZPA 2JASA 3U7FB 5B57C 1TQ2A 2HDNB 3KJHA 1Z63A 1W0KD 1AN0A 2Q0HA 2YJTD 4LJYA 3X1DA 3QF7A 1KDRA 3IPXA 2QENA 1IN8A 3ZYCA 2ORWA 4W5HA 4O25A 1SVLA 5TV2A 4P4TA 3K0FA 1XTIA 4BPBA 3TR0A 4HI0E 3U3RA 1I4LD 1ZC3A 1SGWA 3HDTA 3K0CC 3SJBA 1G5RA 2YOGA 621PA 1RZ3A 3GJXC 4EAQA 5K8LA 1E9EA 2JLXA 2W0SA 1QHXA 3EIQA 4Q66C 4RFSA 4D26A 5BYJA 1S3GA 3CF6R 3CRQA 4MYHA 1DPFA 4TWZA 3GPLA 1GG2A 2IYQA 4OL0A 4BQSA 4LYHA 3SBDA 4GPTA 4QNRA 2BCGY 4E22A 2WSSD 2CVHA 2ZSBA 2ZROA 3QBVA 3CR7A 1N6KA 1XD2A 3I92A 5B58C 4C0AC 4ACBA 4W9MC 1G3RA 2G83A 4GRAA 2P6RA 2V55B 1VIYA 1Q22A 1XCMA 5TY0A 3NBFA 2HF8A 2VLIA 3NEYA 2Z4RA 4OYHA 1P2SA 2DB3A 2H18A 3QSYA 3AF1A 3FHCB 4QKQA 2QP3A 2CNWD 3KQNA 4BFUA 2QROA 3H0KA 2XZOA 1IM2A 1P9RA 2JATA 3EWSA 5C1BA 1RKBA 3KQLA 4DT1B 2QN6A 3H2YA 2XB2A 3B8HA 1EX7A 1XF9A 2AKYA 1E1RA 3QKSB 4DWJA 4LYJA 2X1VA 4HB3A 4JLPA 5J4HA 2GNOA 3AQ4A 3GJ3A 4X8OA 3EX7C 2ZRPA 5JFGA 4KVAA 5A4JA 3QKUA 1KI4A 3C41J 2IBMA 3VKWA 3LA6A 1HEIA 5FPHA 4PHFA 1T8TA 3CUEF 1ZM7A 1KK2A 3AF4A 3MMPA 5HE9A 1ZUIA 1MABA 2ZRLA 4ASUA 2GXSA 3A1WA 3D7MA 5CLLA 1EFTA 1UF9A 4DLWA 1FTNA 2O8CA 4TT3A 2J9RA 4JMPA 5DE3A 4A15A 3ZGXA 3EASA 2YWGA 1HTWA 2ZU0C 1MOZA 4US2R 1TL7C 4TZ0A 1XD9A 4K8OA 1G8HA 1AK2A 3UPUA 2ZANA 1NY6A 2NZ8A 1CLUA 1ESNA 2R2AA 4G5GA 4M22A 4G5SA 3X1XA 4LWZA 1NKTA 1M1YE 2ZIAA 4ZDIA 4BFXA 4OQMA 4EUNA 2FZ4A 2UVQA 4O2LA 1KYIA 3E2IA 4BFVA 2GESA 2F43B 2IXFA 1AM4D 2QGNA 2IF2A 4U7DA 4WZAE 3WYGA 2YVUA 4BLPA 3GLFA 1E9RA 3O8BA 4C0SA 4FWIB 1YKSA 3EPHA 2YC4C 1US8B 4ASUD 1W7AA 3BC1A 1U0JA 1JR3D 3SYLA 3WP1B 5AUNB 4QBHA 5DLQC 3ZVLA 6Q21A 3D3QA 1NN0A 4CZ2A 3ZLJA 3O8RA 1GNQA 1DAHA 1Z2AA 2I1VB 4HLCA 4KYIB 4N1AA 2WWFA 1YZTA 2C9OA 2VRWA 1WRBA 1JECA 1XZQA 3BB1A 4Q4JB 2XNDA 3QVVA 2GJKA 3A4MA 1EESA 4Q4HA 3K0AA 4LY6A 2LKDA 3B1VA 1CS4C 1E9AA 3VR4A 3GLFB 4A82A 4JBXA 1E2NA 2WV9A 2D7CA 1P2VA 2VL7A 3MWYW 1OH5A 1ETUA 4I1VA 4C0KA 1T6NA 5FL7A 1TEVA 3EZFA 3LWNA 3BH0A 4JLNA 3K09C 1IY0A 3CNOA 2P6NA 3LVQE 1XB2A 2FSIA 1G21E 1RFLA 4DDVA 3Q7QA 1CJTC 2FPMA 2GK7A 1R0YA 1S8FA 3N5CA 3Q7PA 3QIAA 4PTLA 3R9WA 5GJBA 4M1SA 121PA 2OCYC 4Q4HB 3TJZA 1FQKA 1SKQA 1TUEA 1X6VA 1VG9B 1D2EA 4DSOA 4CEHA 4HZIA 2E1RA 5FUYA 5DYIA 2RGNC 4TMWA 5G40A 1U8YA 2WWHA 3MFYA 4QL3A 2H8KA 4HB0A 2GBLA 2PZFA 2ZSFA 3W5IA 4C2TA 2VO1A 4AKIA 3NEJA 2IF0A 1KTVA 4PC6A 4A0GA 1UBEA 2YV5A 1CR1A 1F60A 5TVKA 5E7IA 1G7RA 5L3SA 1J8MF 3PG5A 1OIWA 4NCHA 2Y8EA 3VR6A 3G5UA 2CLSA 3W8RA 3U7HB 3GJ8A 4E5UA 2ZUDA 2ZYTX 3JVVA 4M2LA 3PENA 3KXLA 5DO9A 2VP9A 1D6JA 1Q3HA 3BFXA 1X8KA 3K9GA 1WA5A 4MYUA 5IHPA 1ESMA 2WTUA 4OI2A 4CEJB 1II8A 3EC1A 1JR3E 3VHXA 1NNEA 1OKKD 1T4GA 2Q3MA 2ZE6A 1E6CA 3QXHA 4LJ4A 1QHSA 1E9FA 2GRJA 2XB4A 1QDEA 2XNDD 2AK3A 1GAJA 3PUXA 4IEEA 1ZM2A 2VTKA 4LV5B 4DCNA 1YR6A 4BFSA 3Q9LA 3SFZA 1H65A 1SXJD 2OM2A 4C4PA 4XJXA 2F1IA 1G4AE 2OCPA 1XTJA 1KNQA 3CR8A 1SVKA 2O8CB 2NGRA 3BFKA 4RD4A 2GJ8A 2WAYA 4G5OA 5C4GB 3GJ0A 2GCOA 4MDEA 1FNNA 1U90A 1F6BA 1E9BA 1FP7A 2NQ2C 1VIAA 3QVUA 3AUXA 4DLXA 3GLIB 3ECCA 4G0NA 4QGAA 2C98A 3VR1A 2QGZA 2P3SA 1G8GA 5EE0A 4TL6A 1N5KA 4PC2A 3ZIAD 3MWJA 3GLGE 3PJRA 1T3HA 4JZKA 2BJVA 4Q7LA 1E69A 1EX6A 2ATXA 2WJVA 3ND9A 2OBLA 2PH1A 5AK0A 1LV7A 1VG1A 2CLDX 2NO7A 5EXPA 3VX3A 2BJWA 5AUOB 1VCOA 3LX8A 1Z6YA 1LF5A 3MWKA 3V4FA 1G7TA 4BZQA 3NC0C 1MRSA 4L9SA 4MRRA 2NMVA 5DN6D 2JLRA 2VH5R 3DZ8A 3IO3A 2XSZA 1XP8A 1ZD1A 4HB2A 4RZ3A 3B9QA 1U0HC 3KKOA 5HCIA 1KK1A 5BN5A 4BGDA 5JJLA 1ZNXA 2XOKA 4GI7A 4Z1MA 5KSZA 4CYMA 2EVWX 3X1ZA 3HP1A 1ZJ6A 4JL8A 2Q9AA 3CF0A 4PHTA 2AFHE 2WOOA 3CM0A 4IXMA 4TLAA 2JLYA 2ZU6A 3NC1C 3WMEA 1DO0A 3PITA 4XWOA 1UDXA 2C78A 2GZHA 3DM9B 2Z43A 3OEED 4URUR 3ADBA 2PBRA 3ZVMA 1U8AA 2IUTA 1IHUA 4LC1A 2QL6A 5FOUA 3EPJA 1X3SA 4NBSA 4F4CA 1R5BA 3M0EA 2NTYC 4QM7A 3H1TA 1Z29A 4OQFA 1RJ9B 1T0HB 2IT1A 3LLUA 5KPDA 4P33A 5DI3B 4LCBA 3U60B 4RKEA 1EWQA 1PVOA 1KZ7B 2CCJA 3FVQA 2IHBA 2ZI5A 2XOKD 5AWFC 1F2TB 4Z1MD 1VCIA 1H8HA 5IF9A 2ZS9A 3Q5EA 4DLYA 2QM7A 1TQDA 2CXXA 2BMEA 5GVSA 4TLBA 3QBTA 1E2GA 4F4JA 5BQ5A 4CEHB 1VYTA 2OLKA 4W5JA 3R9IA 2ZI9A 1W36D 3QE0A 3LY5A 3ADCA 1XJCA 4FCTA 4YQFA 2WJGA 2PMDA 2V7QD 4ARZB 1AKYA 4NYIQ 3I73A 3M1IA 2WKRA 3CNLA 1ZMXA 3EXAA 4B33A 1YE8A 3KQKA 2IS1A 1XZPA 3AH8A 5KO2A 3GLGA 1VECA 3EZ9A 5D3MA 4HZUB 1COWD 3K70B 3EZ2A 4PANA 4MKIA 5CIQA 2ZUCA 1RYFA 1DAMA 1NJGA 2FSHA 2XAUA 3LW8A 1NN3A 3I32A 5E4FA 1K6MA 2XSZD 3TQFA 2BCJQ 1TF7A 2G0TA 1L8QA 2J41A 2JJ1D 4IJMA 1P6XA 5FPTA 2NPFA 1DAFA 2J1LA 4JBWA 1KY3A 2R62A 2JGNA 2WKPA 1N6RA 3BOSA 3LBHA 3Q5DA 5DGXA 3GLIE 4A2WA 4BWYA 2C77A 2ODEA 2ZRHA 4M1WA 2DWOA 2O52A 8OHMA 4I1SA 4URZR 2J87A 3C15C 1E79D 3WYAA 2ZE5A 2DCUA 2FE4A 2IUSA 2I3BA 2ATVA 3HR7A 3VQTA 1M7HA 3AF3A 2ZRIA 1KO4A 1EXMA 3CZPA 3LVRE 3ND8A 1TAGA 1G8YA 4FMCF 2WWWA 4Q03A 1L7VC 3KDSE 5CDFA 4NCNA 4L15A 4LHVA 4V02A 4A36A 1NF3A 3DHWC 2PX3A 4TYPA 4A2QA 1WMSA 1O3YA 1E96A 2GA8A 4Q7MB 1ZIPA 3SR0A 1HUQA 3UKDA 3O8DA 3U5ZB 2F55A 2ZS7A 2J7KA 3DDCA 1XJ0A 5TDHA 3WNBA 3LD9A 4D25A 4DLUA 3CX8A 2ZJ8A 4XVRA 1UAAA 2WSSA 2A30A 4GOKA 3S1AB 3TLXA 4D82A 4YMUA 2A5GA 1KAOA 1XD2B 1E4YA 5DIFA 3SI7A 4XSGA 2BBSA 3TE6A 4R9UC 1G291 1L2TA 2D74A 3EA5A 4KSBA 4QJ3A 3W6OA 3HU3A 3B2EA 1MV5A 4HAWA 4LJ9A 2CVFA 1KO5A 3FDIA 3OFND 3PVSA 4JVNA 5FOVA 2XXAB 2IEZA 4OHXA 4M1TA 3X2SA 4L8GA 3NVAA 3VR5A 5IK2D 2QSZA 1KI1A 2F43A 4WZBE 4HUTA 1MH1A 2QT1A 1ZINA 2RCNA 3ZQJA 1PLJA 2Q9BA 3H84A 2PEYA 2BBOA 2RGXA 4KFTA 1ZU5A 2CL7X 4AG5A 3U44B 5B2ZA 3K0FB 5HTKA 2IYZA 4U5XA 5IDVA 4AWXA 2J3EA 4PZZA 4LJ5A 1P2UA 4HAYA 4B3GA 2IYXA 4Q21A 2BM0A 1OB5A 3DZDA 1RIFA 3CF2A 3D31A 2OSBA 3P4XA 2JDID 4P4UA 1EFCA 3OIVA 1D9ZA 4XWAA 3QNUA 1NLFA 4C7OB 2V6IA 2RGDA 4BASA 5LPNA 3G82C 1G41A 2HLDD 2DR3A 2VP0A 2FOLA 1E79A 4HEJA 5JEDA 2PT7A 2BBWA 2R6FA 3QKTA 4OHWA 2VP6A 2IWHA 2GEUA 2WWIA 4FCVA 1IN5A 4C3ZA 1W5TA 4M8NE 2QE7A 3B60A 4UNRA 1Z0JA 3AGQA 1LFDB 2GILA 3KFVA 4P0TA 2WJYA 1OXUA 1XPOA 4YXWD 4PPNA 3EIEA 5EJEA 1G6HA 4GBMA 3R7WA 2C95A 2HCBA 3RAPR 3MGCA 5CM9C 2P5SA 2BC9A 2QQ0A 4DCTA 4KJZA 2ONKA 3NG1A 2EU8A 1E0AA 2RH5A 1NSTA 2VBCA 3GP8A 4L16A 4URVR 2P6UA 2ZAMA 2VP4A 2AWOA 1SVOA 1QG4A 3RC8A 1E1QA 4TSFD 2J0SA 3REGA 3IIMA 4IEIA 3CH5A 3W5JA 3AB3A 4AD8A 4Z8YA 5FTLA 2CMKA 1A7JA 2GXQA 4V0ME 1RRCA 1IONA 1W0KA 1ZM4A 1VTKA 4MRSA 3THYA 1UJ2A 4PPGA 2XZLA 3H86A 1I2DA 1BO6A 1Y3AA 3OIYA 4KFSA 2JLVA 2IYUA 3CRRA 3KKNA 5HZKA 1BIFA 3NH6A 4D0NA 1N6LA 2ZI4A 4B6EA 3N2EA 4ZV4A 4BLRA 1X1SA 2GHIA 4W7SA 1NKSA 4S2EA 3EARA 4URWR 2F3TA 4FCWA 3U3MA 3DM5A 4RVCA 1UADA 4JLJA 2OUKA 2X2EA 4F7WA 1H8EA 3A1UA 4B3XA 4P31A 5L3QB 3THYB 5CDFE 2PLFA 4PZLA 2FN4A 4Q1BA 4URXR 5J4LA 1JAHA 1NVWQ 4OI1A 4LYAA 1L4UA 2RB4A 1XMVA 5EXSA 4FD2A 4TL9A 5CYPA 3E1SA 3SYNA 3GEEA 3KUDA 1XDBA 3L8ZA 1ZYUA 1YU9A 2J5XA 2QBYB 4ZKEA 3DMNA 4N3NA 2REOA 5DI9A 1ZCBA 2H16A 2ZJAA 4YMTA 2X19A 4YMWA 5FBVB 1VMAA 2RGEA 4NZYA 1U8ZA 2D3WA 4JLDA 5FI1B 1NN1A 5H70A 4D6PA 3U6KA 2QUZA 1NJFA 5CB6A 3MRSA 4QGHA 4RZ2A 5L3QA 4JYCA 1FFHA 1QRAA 2R6GA 1GKUB 2ZXUA 3SJAA 3AKCA 2EFCB 1FP6A 4WW0A 2CCGA 1Z3IX 4YDHB 3GJ6A 2GCNA 1Q21A 4XWKA 1SXJE 1RRGA 4Q4JA 2IYSA 1U98A 2MMCA 1G5PA 2ZVPX 3TGPA 3Q72A 4JVSB 1TF2A 5SZKB 1D5CA 3VR3A 2DBYA 3FMOB 4IOLA 3RLFA 3RS7A 3SC3A 3NBYC 2FSFA 4RCZA 2ZI7A 4BRUA 3ZDQA 3QUSA 5JI2E 5BN3A 3CPJB 3E70C 3TIFA 1GNPA 2ODBA 1YR9A 4A8JB 1QHGA 5SZJA 4JJKA 4XD7D 2R8RA 3W90A 2AD5A 5GJWC 3KZ1E 3LV8A 2XZPA 2G6BA 2NO6A 2DHRA 5FBRB 3A6PC 3FMFA 4L5BA 1OHHD 2YINC 2XJ4A 3IILA 1GNRA 2A5YB 3BBPA 1OYYA 2ZSDA 1KJZA 1XD8A 4XTRA 1R5NA 4DDWA 3RS4A 3QF4A 3O8CA 3K1JA 4MKGA 3SDZA 4OJKA 1XWIA 3P27A 3SJCA 4CEIA 3LQRA 1G8PA 4KODA 4NMMA 4C2UA 2XXAA 1KMHB 4LBZA 2QP4A 3NWJA 5LD2C 3NKVA 5JHGB 5FL3A 5FR2A 2QAGB 2ODNA 4AC9A 2O8BA 5E7JA 3C4JA 1CRQA 5E3HA 2R44A 3ZS9A 3ZD6A 2PCLA 1E2FA 2RHMA 3FB4A 5J47A 5HCNA 1C4OA 5BYKA 3THXA 4B44A 2BV3A 4TMZA 5FBWB 4QGFA 1Q12A 4DB4A 4I1UA 1Z6XA 4EDHA 1KAGA 5FOSA 1E2QA 2BMJA 4TLDA 3LW7A 4II7A 4PO9A 3X1WA 3AVWA 3A1TA 4GT1A 1W4RA 2C9CA 3RVBA 1NIPA 4BLQA 1JJVA 4G1UC 2WWYA 2F9MA 5J4KA 1C9KA 2ZE8A 5H68A 1MO4A 5G3YA 2BHRA 5KOYA 3T15A 2OBNA 2QTVB 5H1YA 4Q48A 4AK9A 1E2IA 2ZAOA 1AS0A 4HLQB 5FUWA 1GRRA 3O47A 4JLOA 3UG7A 2JLWA 3FFAA 1UEJA 1XEWY 2PZGA 4GZMA 2W6ID 5HE8A 1EGAA 3GEHA 4IW3B 1M2OB 1AA9A 5C46F 2QMUA 2ZRMA 4IDHA 5CK5A 2R6DA 2G3YA 2J0UA 3GLHB 4F93B 3F0TA 1J70A 2N1BA 4CW7A 1GKYA 3A37A 4FN5A 2GCOB 3TVTA 1A82A 1XTKA 2HXSA 2FJUA 4XD7A 2OLJA 3OEHA 1P9WA 3B78A 1ZBDA 1CIPA 2RKOA 3D6TB 1NSFA 1WDTA 3AF0A 3WNCA 5EXXA 5B64A 4LBYA 2VSOA 1AZSC 4Q9IA 5L3VA 1D2MA 4O3MA 2R6CA 4NHOA 5D3QA 4AI6A 1W0JD 2MSDB 1ELOA 3TK1A 4DEXA 3AVQA 2ZPTX 1CXZA 1CJVC 2VYFA 2GTPA 4C0HA 4DLVA 3TQCA 2CK3D 4O0MA 2OAQ1 4M9ZA 5LBIA 2O8DB 3GLHA 1E4VA 4F91B 4NYJR 2XX3A 3ASZA 1TUIA 2RGNA 2OBMA 4C0QC 3IUYA 4PQYA 4PR0A 1GDDA 5FPKA 2YOFA 3AUYA 4BRWA 1TU4A 2ZR7A 4KO8A 5C2JB 1V5WA 1YZLA 2ZTSA 2B8TA 2C03A 1Q44A 2ZITA 3BERA 4DVGA 2QSYA 1N0UA 2DFTA 5CK4A 5DNYB 4TYWA 1P73A 2LCFA 1HYQA 1S4QA 1S0UA 2GXUA 3OAAA 3GLGB 4KFUA 2CCKA 2NO0A 4P32A 2O8DA 4R7ZA 1K8RA 1M74A 4A9AA 2FH5B 4FXPA 2QEQA 2YOHA 1UPTA 2YWFA 3WMGA 4WOPA 1UBCA 2FWRA 3QG1A 5C4MA 1E2DA 4LHZA 2IS2A 3THWA 1ZU4A 4KFRA 2B21A 2WMOB 4JKYA 1Z6TA 3QPWA 2O0JA 2GAAA 4AYXA 2FEMA 2EYQA 1IQPA 1E3MA 2F1JA 2GK6A 4IOMA 5FI0B 5BWMA 2H92A 1F2TA 5EP4A 5JZVA 4R98A 2YZ2A 1KO1A 2BEKA 4LGMA 3IO5A 2NOAA 2ZRGA 5KU1A 4ZCMA 3PUZA 2OCBA 1W36C 5F9FA 2I4IA 5KTYA 3B85A 2OFWA 2O8EA 1OXVA 3WYFA 1R7RA 2XJ9A 5ELXA 1EFUA 2YC2C 1EWRA 2ZYUX 1WP9A 3GMTA 1IN4A 1LS1A 1W4AA 1ZVQA 5JWRA 1OB2A 2IC5A 5KSOA 1F3OA 2GVDC 4UNPA 1TX4B 1TQ6A 4FINA 4CVNA 5KSYA 3NTUA 4NDZA 2JJ8A 2ECKA 1GUAA 4MA4A 2CJWB 1DG3A 4TLCA 4WIAA 1GOTA 2RGBA 1G7CA 1XTSA 1Z06A 4A2PA 1CR2A 2WIBA 3F8TA 3AVUA 4M0LA 1GRNA 4A0HA 1W48A 4Z8XA 2R9VA 3GLHE 2HJVA 2JJ2D 4I81A 2N46A 4YONB 1Y63A 1X1RA 3EWAA 3OFNA 4IFBA 1IXZA 2ZJ2A 4IOKA 2WMNB 3JZAA 1UKVY 5FOTA 3PUWA 5AJWA 3UATA 4JLAA 4EFNA 2OESA 4IVPA 3KKPA 1YQTA 4GMXA 1NBME 3GFTA 1OYWA 2HUPA 1T8UA 4WBSA 4HUQB 4Q00A 2NPIA 1G20E 4LK2A 4B47A 1UKEA 2W58A 4DIDA 5EP2A 1TF5A 5EE5B 1XJQA 1XXHB 3WHLA 1EFHA 1Q1QA 4MGYR 4WXPA 1KI2A 1Z0KA 1US8A 1KNXA 4EQ6B 3RSLA 2NZJA 2IUUA 3OE7D 1YR7A 3UMSA 1SVIA 1OJLA 4ABYA 1CTQA 2DYKA 4M53A 5EP3A 4DJTA 2P5TB 4UQOA 4NE2A 2C96A 3RYTC 4OHYA 3QENA 821PA 3FTQA 2UZ3A 4Q18A 1G7SA 3WBJA 1KZGB 3P32A 3I8SA 2W2XA 3ADKA 3RC3A 4IDOA 2QG6A 2O8FB 5LDDC 2CBZA 1W47A 2QMHA 2BWJA 3K8YA 1Z2CA 4QC2A 4WA7A 2JEOA 1YZUA 5JMTA 1FTSA 1LS6A 1YZKA 1ZUHA 2HT6A 1G3QA 2OXCA 1BMFD 5F3WB 1U9IA 2ZRFA 1WBBA 4HB4A 2FPKA 2W0MA 3ICQB 4FI3C 4BE7B 2EFDB 1DAEA 1P61B 2ZRKA 2Z0MA 3BAFA 1SXJB 4RD3A 4FMBB 4I99A 4KBFA 1I4DD 2VQSA 4IDQA 1ZNWA 4C0LA 1N2CE 4OI4A 4L9WA 5AJZA 1JB1A 4Q7KA 2UZIR 2GZAA 1S2MA 5G53C 2CL0X 3TSZA 1TTTA 2AL7A 3SS8A 3KQHA 4U00A 2WZQA 5TARA 4DXAA 4LI0A 2AX4A 4KU4A 3THWB 2ZYVX 4CF7A 1DTSA 2FNAA 3AP1A 1SULA 4ZDKA 1LY1A 4ZI2A 4MDFA 4UXJA 4ZIRB 5M04A 4TQAA 2RHDA 1HE8B 3OEEA 5GADl 1DADA 1QF9A 1ZC4A 1KOFA 1DVRA 1NVVR 3IIKA 1GFIA 4FMDB 1C1YA 3PFIA 4RFVA 4JS0A 2VPPA 4H1VA 5KSPA 2IW3A 2REXB 1AGPA 2QAJA 4F38A 4LHWA 3QEJA 2QPAA 3T61A 3ZVNA 4DEYA 3LH5A 1ZNZA 3LX5A 2QY9A 4EFLA 3EIHA 5AUPB 3RS5A 1KKLA 4DDTA 1PLKA 3TUZC 1J90A 2ZQ5A 4B76A 1KDOA 1R6BX 3VAAA 1PV4A 2ZJYA 1JBKA 1OSNA 2HJGA 1Q20A 2WJIA 3BWDD 1E94E 3DL0A 5CJ2A 3UIEA 2Q9CA 3K70D 3F5FA 5CB8A 1KI8A 1BOFA 5E7MA 4NH0A 3IQXA 5FL7D 3SEAA 2A5DA 1PJRA 3QPUA 3UANA 1Q3TA 3BRWD 2IXGA 3GLIA 4A4DA 2FX3A 2B7CA 2YHSA 3REFA 5BN4A 2W00A 2YKGA 3UMRA 1G16A 1KI6B 1OPXA 4JBYA 1VPLA 3LBIA 1MABB 1EK0A 2WVJA 4FMCB 2ZRBA 1N6NA 3BGWA 3GJ7A 3SOPA 4CGZA 1UM8A 2ZSEA 2KBFA 2X77A 3L82B 5H8WA 4Q01A 5KYKA 1IOZA 4Q19A 4NCIA 4QBGB 1G3MA 3B6EA 2EFGA 1U94A 3VNVA 4Z54A 2P65A 1ZNYA 3AVPA 1XNJA 1JXOA 1Q1EA 2OE2A 2ZR9A 3JZMA 4D4MA 5AJVB 1M6NA 1R0XA 1XX6A 4XTCS 1ZW6A 4S35A 1DE0A 3LNCA 1LF0A 3CO5A 2BEJA 1KJYA 4EJSB 2WKQA 1NY5A 4DDUA 2VA8A 4KITB 3BORA 1RVDA 2O8BB 3HU2A 3LXRA 1XPRA 2HYIC 1JR6A 2ZRAA 4LPSA 3CRVA 4PC1A 4H9GA 3UG6A 1IN7A 1W2GA 4Q1CA 2BKEA 1GL9B 5IT5A 1QHIA 3LDAA 5JI3E 1LB1B 2DY1A 1TADA 2G77B 1E99A 4XIGS 2O8FA 1ANKA 1S1MA 4IVRA 3WMFA 2VHUA 1KMHA 4DB2A 3DKVA 3P20A 1P60A 1Z0IA 2AFIE 4KI0A 1Z6AA 4KXFB 4OK3A 1RC8A 4BEBA 2QAGA 2OG2A 3BIFA 3I5YA 3I1FA 4G5QA 1VDZA 4LHXA 1E9DA 2HT1A 1JQLB 1U0LA 4WXRA 4IKEA 1CJMA 2JJ1A 4LJ7A 1KSHA 3KX2A 3AP3A 4GOXA 4LYFA 3P4YA 3QF4B 1E2EA 3AV0B 1TNDA 5FOXA 1NBMD 3TAHA 2OT3B 4IRUB 4CEIB 2O5VA 1ZIOA 4K46A 4PSKA 5JWOA 1YHNA 2Z4SA 4B48A 1JPJA 5B30A 2AXNA 4UKDA 2WJJA 2ERXA 1KHTA 4O2RA 2QPOA 4POAA 4V0MA 1SZPA 4ARZA 1W46A 1ZP6A 3PIRA 1YZQA 3ZIAA 1QHHA 2Q3FA 1D8TA 2V3CC 1E2KA 1KI6A 4GP6A 2D2FA 4B74A 2A5JA 4URYR 3T35A 2JA1A 1MKYA 4JT2A 3C14C 2IYRA 3SYKA 3FHOA 4TMKA 2ONJA 3K70C 2ZE7A 2VSXA 4JLMA 2AR7A 3SBEA 2RGAA 1XEXA 3GQBA 4X8MA 4PXAA 1II0A 3U6BA 5EQTA 1BYIA 5FTMA 5CIWA 1KI7A 1KJWA 2ZJZA 2IA5A 1IJEA 3OEHD 3AP2A 4UNSA 3ZH9B 4CT4B 2B7BA 1B0UA 1FQJA 3NHBA 4Q47A 4BECA 1XMJA 4QM6A 4Y0VA 3EZ7A 1Q0UA 5FUVA 3TSWA 1Z83A 1AGRA 4YMSA 4NYMR 2OILA 1AKEA 2HF9A 1NVUQ 5FPSA 1XFAA 2J45A 3VR2A 5SZHB 3D8BA 3ETLA 4TMXA 3MLEA 4B43A 1TU3A 4NP6A 4TMVA 1DO2A 1JEEA 4I1OA 1HQCA 2EFEB 2FA9A 2WWXA 3VFDA 4ZKDA 1IY1A 2FZLA 3QKRB 721PA 1NVVQ 1F2UB 2O0HA 2PJZA 4RD0A 3WRYC 1IN6A 4FWTA 3KL4A 4DKXA 4LZZA 4BFTA 1MR3F 1OH7A 3TBKA 3U2QA 4DCVA 1IAQA 4MYCA 2CLCX 3I5XA 1NMXA 2XEXA 3V9PA 3TMKA 5J4VA 4OJQA 1GL6A 4NU0A 2AD1A 2P2LA 4HDQB 4JL6A 1QZXA 3LO5A 4R71A 1GITA 5KNDA 1E0KA 3PUYA 1G1MA 1JALA 3V4RA 5F2EA 1DG1G 1P9NA 1FUKA 4Q4AB 3ONWA 1E9CA 3ZVRA 1T5LA 2DFLA 3NDPA 4EPVA 3CH4B 3P1JA 1XCPA 2JIZA 4QRHA 2XTZA 4Q4LA 1WBDA 3C5HA 3B7GA 3DPUA 3EPKA 3IGFA 1KIMA 2D62A 2BVNA 2G1KA 4DSNA 3MUFA 2VP5A 3LFUA 3PEVA 4FIDA 5FTKA 3GFPA 2PZEA 1R5OA 3HU1A 2IK8A 2I1QA 4UJ3A 1R2QA 1N5JA 1X8JA 2J7PD 4UNQA 1DAIA 3SU8A 3EA0A 1CULC 3GCGA 3UMFA 5DHFA 1SQ5A 2QMOA 2Q3HA 1TPZA 2J0QA 4LC0A 2C5LA 4C0JA 4Y0AA 2QORA 4HSEA 2GZDA 3TUIC 1OFIA 4CDGA 3DMDA 3UK6A 1HT2E 2ZI3A 1E1QD 4E07A 4LRWA 4A6XA 4TQUS 2XITA 3CRW1 4OHZA 3QI2A 4Q9HA 4P3YA 2W2TA 4Q1DA 3EAQA 5F98A 2WWGA 3Q85A 4PX9A 3W3ZB 5A5GA 4DT1A 3B1YA 2FU5C 4TT3D 1N0WA 3TW8B 3Q3JB 3MD0A 3TSOA 4DCSA 2JLZA 1VHTA 3EPLA 3A58B 4JYBA 3N2IA 1CP2A 2NO9A 1ZAKA 3LRPA 1OFHA 4LJAA 4OK5A 4RFSB 2ZYWX 1DELA 4PZYA 5EUMA 3TW4A 4QOSA 1E2LA 3B1XA 1LVGA 3U3JA 1GWNA 3OIWA 1W4BA 1HQYE 2J46A 3BK7A 4RZUA 521PA 3SJZA 4D80A 4DLSA 5L3RA 4GMDA 1KI9A 1QVRA 1VYVA 1Z08A 4E03A 2PJRA 3U7GA 2X2FA 3W6NA 2ORVA 3ASYA 4PO1A 2ZI6A 2GWHA 4HUQA 2GETA 1G3IA 2IL1A 3QJYA 3BB4A 5FTNA 2WSMA 2KWIA 3U44A 1KI3A 5E95A 4BEJA 1AQYA 1DS6A 1VCNA 3M4YA 5FR1A 3A4LA 4PAOA 3OIUA 2AXPA 3EC2A 4EQ6A 2G0NA 4DLTA 1HURA 3RS0A 1OIXA 1I4TD 4KYUA 3VKHA 1YRAA 4TTQA 2EWWA 2V8OA 2RAPA 3T1QA 4EJSC 4EKDA 4OHVA 2MMGA 1R10A 4MKFA 3RANA 5FH9A 4TYNA 4MRNA 3CB4A 1OHHA 3QOFA 1Q57A 1HT1E 3IBYA 1CF4A 1N6OA 1NBMA 3AKYA 5HPYB 2QP9X 4OK6A 4TLEA 1A2BA 2OFXA 2YYZA 1FMJA 3B5JA 2CJWA 1NMZA 3CWZA 4RD2A 5CYOA 5HKKA 4UXHA 3S1AA 5SZIA 4B3CA 3RS2A 2QTFA 5GJVC 4A8JA 1RPZA 1IJFA 3KB2A 2ZUBA 2ZR0A 4B3DA 4WZ6A 2ZJOA 4IHQA 1W5SA 4ZCIA 1N5LA 1UFQA 2FMXA 3MJHA 3N70A 5JS8A 3FOZA 3WP0A 1BKDR 3MSXA 1JEDA 1XMSA 3KB1A 4GP7A 1PLLA 1GL7A 1II9A 4ESVA 3PR1A 2C8VA 4Q5IA 2QBYA 1S1CA 4HYYA 4QHTA 3T1OA 3A8TA 4GDFA 1PUIA 1CJUC 4LOAA 1ODFA 1XEXB 5JBQA 5KDDA 1XEWX 4OBEA 3SZRA 3DOFA 1Z07A 1BYUA 1P7CA 1II8B 2QA5A 2WBLC 3OESA 3OZXA 4JLKA 1OXSC 4US0R 4DCUA 2IHYA 4PAMA 1TEXA 2GF9A 3PUVA 4RD6A 4NKRA 1S3SA 2IS6A 4V03A 4Q9LA 1Z6GA 5HKKD 1BH2A 3QXJA 4Q02A 4JLBA 1CKEA 4MYTA 1E1RD 2RGCA 4PQFA 1QHYA 4R2IA 4GL2A 2Z6VA 4JL5A 2ASEA 3V00A 2HXYA 2ZSAA 4FW9A 4AY2A 421PA 4DZZA 1D2NA 4TSFA 3DOEA 4F92B 3C16C 4ZIRA 5FOWA 4MKHA 2QRNA 3BJIC 1A2KC 4MGIR 3RHFA 1M34E 4QHSA 4RCYA 2WAXA 5JECA 5K8IA 1N5IA 3A36A 2BBTA 1BS1A 5J40A 1WE2A 4EPXA 2NIPA 1NIJA 4JLVA 1Z0FA 5FPYA 1E98A 3IEVA 1WCV1 1NLYA 2SHKA 1MT0A 2BKUA 3VNUA 1M7GA 2ZREA 4MGZR 4DRZA 4ZO4A 2V6JA 4AYTA 3FPAA 2CHGA 4JIMA 1F5NA 4YMVA 1OH8A 4B3FX 2ZS8A 1VKJA 5L3SB 4AG6A 1XU4A 2QMEA 4X8HA 3RRMA 2A9KA 2OAP1 2QI9C 5UKDA 2H1LA 3VMFA 5P21A 1GSIA 2PX0A 1U81A 3LXXA 3QXCA 2Q6TA 2FFHA 3ADDA 2ORIA 1EFRA 1SXJA 2J0UB 2WOJA 2XTNA 1WF3A 2QM8A 5LB2A 4GFDA 1CR4A 1H8ED 3VHLB 1HV8A 1DAKA 3DO6A 3PEYA 4ZCLA 2ANBA 2PCJA 4RJLA 1XMIA 4IOJA 4JJZA 1E0JA 5LD2B 2J7PA 1LNZA 3CONA 2QAGC 4V0NA 5DHAA 3RWMB 1F48A 1NMYA 2CHVA 4B2LA 1VG8A 4CIDA 2EWVA 3T1VA 5AJXA 3GD7A 2B8WA 3OE7A 2MSCB 5J5CA 3WXMA 1HH4A 3IPYA 3RRYA 3T12A 1WXQA 2JLQA 3BH6A 3K0CA 2GDJA 4Q7JB 4Q9JA 2JLUA 4PC7A 4MITA 4RSGA 4QXAA 3B82A 4KV9A 4TL7A 4A6PA 1YZGA 2A3RA 2G88A 2WIAA 2CK3A 3L2OB 5KDOA 4TZ6A 4DIEA 1FX0B 1KKMA 4LSGA 4V0OA 2VHTA 4EIWA 3ICEA 2J59A 5CM8B 1NVXQ 3WBKA 4X8LA 5EE9A 3RS3A 1FPMA 1K5DA 2C2HA 1JQJC 2FFQA 5EUQB 2TMKA 4D0GA 4B34A 5BW8A 5DSZA 3H4MA 4NCJA 2FSGA 1VYUA 3BB3A 2D4HA 4PSAA 2REBA 3R9XA 3LBNA 1JR3A 3WNDA 2KSQA 3AKDA 1OXXK 2MSEB 4BLTA 2O0KA 4TL8A 2W6JD 4TTPA 1U2RA 1G17A 3RDPA 3MG9A 3VU9B 2A5FA 4Z51A 1MO6A 2AHOA 2L0XA 2WM9B 4EJSA 1P62B 2EW1A 4N0DA 1P5ZB 2ZJ5A 3QXXA 2ANCA 2XTMA 3UWOA 3THXB 1GRQA 1R0ZA 2GEDA 2IX3A 4OKSA 4P4SA 3F3YA 2WHXA 2ZJBA 1HA3A 2OO7A 5L8VA 1KGDA 3I62A 4IDPA 4ZPXA 3DVLA 4K81B 3FE2A 1ZD8A 2P67A 3BFVA 1XCGB 2C9YA 1OE0A 1G6OA 5FBLB 4YLGA 2JJ2A 4HAZA 4PFSA 3L0PA 5KHOC 4DSTA 2IEYA 1Z5ZA 1SKYB 1T3LA 3TAUA 2W6JA 3I8XA 3QEOA 3A1VA 1GIAA 1ONBA 1IBRA 2ZRDA 1JI0A 1OKKA 2ZRCA 4ZI3A 2IYTA 2KI5A 1W49A 2ODWA 2ZEJA 4ACAA 4DLRA 2W2VA 5TB5A 1AZTA 5JEEA 3C8UA 1E0SA 2N42A 3KQUA 3OHMA 2YWHA 3SNHA 4GSYA 5HZHA 5TXGA 3BXZA 3L0SA 4OQNA 1DAGA 4M1OA 2W83A 1I2MA 5EXTA 5JJIA 2AN9A 4LX0A 2ZVQX 3HR8A 3A1SA 1AS2A 3QPVA 3AEZA 2UKDA 5FFMA 4R2HA 1R0WA 3BH7A 3AGPA 1CJKC 1QHHB 1QG2A 2OXRA 4AKHA 1YJ5A 2HYDA 4RY2A 4B6FA 2OHFA 2W6IA 4MQBA 1N25A 3IDQA 2GEVA 2H17A 3FKSD 1Q1ZA 3FGNA 4QBIA 1OXTA 4H1UA 3K0SA 1IXSB 5JLJA 3MAAC 3IEUA 3BE4A 4G3XA 5JS7A 1NN5A 4KLZA 1KY2A 4JVLA 1W36B 4DUGA 2PT5A 2IYVA 2IXEA 4U02A 4IVQA 4Q4AA 1ZM3A 4JKIA 4TTRA 2JAQA 5DISB 5FTJA 1B23P 3QKRA 2BIFA 2B6HA 3AKEA 1JAIA 3HPQA 4UJ5A 3W8NA 3U61B 4G5RA 1VHLA 1KSGA 1XXHE 3KTAB 1U9IC 3PV0A 4F4IA 1W0JA 4PC3A 3AVYA 4TYQA 1NG1A 4M4SA 4YDSA 2QU8A 2FG5A 3AF2A 3MWLA 3Q8XB 1OT3A 4B32A 4LDJA 2Z5FA 2V54A 3T34A 2EQBA 4HLUC 4QBFA 5JCZA 1OFTA 4MUBA 1FMLA 1SVMA 2RGGA 4OQXA 2DFKB 3C5CA 1XXHA 3AVXA 2VHJA 4GOJA 4B2PA 3I61A 4BZXA 2C99A 2X8AA 5DH9A 3UXMA 1XTRA 3IBGA 1AS3A 4C7OA 2A78A 4UXIA 4D4LA 1RJ9A 3NH9A 3B13B 3QXSA 1NL3A 3LQQA 4EFMA 4Q1AA 2BOVA 1QVAA 3RRZA 5LB4A 1RW4A 2AKAB 2VIIA 4GNKA 3T06B 5IK2A 3TR5A 5GJCA 2C04A 3KKQA 2D7DA 2FV8A 3EW9A 3U4QA 4I4LA 1E2HA 3OAAD 3FYHA 3HJNA 4HAUA 4HLUA 1BMFA 1P2TA 2YNMA 4GZLA 4NONA 4ZDWA 2ZRJA 3LAWA 5AUQA 3SHFA 3R7WB 1FW6A 3VTKA 4LBVA 1A4RA 3CLVA 2GBLC 3CPEA 3W3AA 4LV8B 4CRWB 2FPLA 4PPFA 1KDTA 1J7KA 1FNMA 4MUAA 3TH5A 3NDBB 1W2HA 3MJRA 1GVNB 1W4CA 5F9HA 4PSVA 3NXSA 2JDIA 1G19A 2CE7A 3PCRB 2IWRA 2D2EA 1N6PA 4ILEA 4B71A 1XBTA 2HLDA 4G01B 5IRCD 3GJ4A 1ZM9A 3I3SR 4ZDJA 1SKYE 4DBLC 3FKSA 3PEWA 1OLOA 1W44A 3L43A 3CIOA 1N0VC 4A1FA 3KJIA 2GKSA 1S96A 4B35A 4V0KA 3NBZC 3U3KA 1A5TA 5FBQB 3ZD7A 2A7QA 4NL4H 4QJ4A 1KO8A 1DARA 1OFUX 1JJ7A 4B2IA 2GXAA 1OIVA 3M6AA 2J0VA 1FX0A 3IIJA 4NTZA 4AKEA 2QPTA 4MRPA 4DHEA 1QHNA 4MH0R 4HDCA 4PQRA 4DSUA 4EPTA 4LPKA 3B1WA 1KDPA 3RRNA 1GTVA 1UKZA 2NG1A 3CW2A 2RMKA 1MO3A 5G41A 1VG0B 1J8YF 2BDTA 4W5WA 1H8HD 1S9HA 3WY9A 5EE3A 5G3ZA 3RNLA 1SXJC 5JHHB 1LTQA 3KJGA 2D06A 3NHAA 3BS4A 2F1RA 3CNNA 4C9BA 3QG5A 3ZZ0A 1NLZA 3FMPB 4HATA 2FFBA 5KUTA 3RSOA 3B9PA 4JVMA 3OF5A 4BUJA 2GVZC 2PL3A 3HYTA 1OH6A 5K8TA 3LLMA 2BM1A 1HY3A 4KAXA 3QQ5A 4QG7A 3MCAA 4ITRC 3GLFE 2PMKA 3SN6A 4PHGA 4AURA 5KDLA 2KJQA 1N6HA 4QGGA 3BD9A 3EG5A 3CKLA 1ZUNB 4B75A 4DC9A 4JSTA 3PXGA 1FL9A 1RRPA 4B3BA 4KHZA 5CITA 2CL6X 5K8UA 1N6IA 2PLRA 4JT4A 2QQEA 1G4UR 2FFAA 2H7VA 4NYJQ 2JLSA 4E09A 4KSCA 1G3UA 1HE1C 2DFNA 1IXRC 3E5HA 1DEKA 1E2JA 3FKQA 1E9SA 2VF7A 4KLNA 1YR8A 2AK2A 3NBXX 4HLDA 2FEOA 2QRZA 2H57A 3CBQA 4LJ6A 2WJHA 5AR1A 3K0EA 3FMIA 2Q21A 1XPUA 3CRMA 5JSZB 3ZZTA 221PA 3K0AB 4BLOA 4KCGA 4LJ8A 4QNMA 4Q1EA 5J4YA 4M9SA 2HCJB 4D81A 2XGJA 3PQCA 1UDWA 2F1HA 2ERYA 5JWHA 2BMDA 3HYRA 1QBKC 1U99A 2XNSA 1Z47A 3KXIA 4PO8A 3WRXC 3KKMA 1N3BA 1R8QA 4D4JA 1CRPA 4RKFA 2GJAA 1KK0A 1P3JA 4NPHA 5EP1A 2KBEA 3X1YA 3SQXA 4A0FA 4HDOB 4CT5A 2LWIA 1VCMA 3L8YA 4EPWA 1P4SA 1YZNA 4XVUA 4FMDF 1MRNA 2CE2X 2OCAA 3THOA 3CPHA 1J2JA 4L4UA 4WAUA 3R8FA 3U4QB 4OI0A 5JJKA 3TVDA 2A2ZA 4Q1FA 3IHWA 1FOEB 1P72A 2HEIA 3I4LA 4TMTA 1T3SA 4M9QA 4RD1A 3VKGA 1G8FA 1JPNA 4A92A 1UBGA 1KSFX 1GILA 1P75A 1SVSA 2VP2A 1G18A 2FGJA 1J99A 3PEUA
chains in the Genus database with same CATH superfamily
2VHCA 3FCOA 3PGLA 1MO5A 1SQ6A 3IQWA 3HLTA 1AK1A 2HC9A 2WFMA 4S1PA 1HORA 1NXPA 2ZP1A 3H8WA 3S2FA 2F2TA 3AERA 1QIHA 4PO3X 2HU2A 5E3JA 3CYFA 1KMQA 4OHRA 2J0EA 4PBSA 1DKNA 4CMJA 4F5WA 1R37A 3AETB 3H42B 4XVCA 1L5GB 4AKGA 1ZN8A 1UP7A 5IT9A 3AM3A 1Y98A 1BQEA 1SHKA 2I67A 1OXKB 2Z83A 1P1JA 3JW8A 4INJA 4NNJA 2OG1A 2Q7OE 1GSOA 2GM3A 4MUGA 5KYXB 3BMQB 1KJNA 1W88B 1Y1PA 1JNYA 1ZL2A 4YHHB 2AWNA 2VSFA 2B1RA 5GIPE 4MW4A 3QWIA 4WBXC 2QXTA 2XA2A 3SHWA 3AW9A 3IJEB 2YXLA 2OFOA 1ATIA 2G9ZA 5EZ5A 2XRZA 3DKPA 1EX1A 1Z28A 1M34B 2DH5A 2CY0A 4PHHA 3KWJA 4BLSA 1R15A 4F3KA 3AUUA 2WUVA 4JK3A 1V8ZA 5ES4B 1NI3A 1T0JB 3UW3A 1X8LA 1N1DA 4MI9A 3JASA 4RHEA 4QODA 1RRMA 3EGWA 1NQ5A 2F7SA 2XTAA 5KNBA 2K5UA 2FDCA 4YXWA 5KX5F 4V0LA 3HWSA 5JMWA 1UOQA 1EP2B 2CDCA 4XPIA 2PWAA 3ULKA 5JRZA 3IKTA 3U39A 1UMCB 4BFZA 1ZH2A 4K6CA 3JVUA 5A06A 4MR9A 3WJ1A 2OEPA 5JFOA 1IG0A 2G8LA 1X1CA 4II3A 4UM8B 3URMA 4I6JA 4KIWA 3ZHBA 1E5LA 4N0EA 2CHUA 5HIAA 5ICSA 3DE3X 2HV8A 2QVLA 1HDZA 3H5OA 3HPRA 4L4RA 1YRWA 1LDBA 4PAWA 1WZ2A 4DUPA 5B3JA 5KYYB 4TZTA 4O4HA 4QSMA 1BKYA 5JSKA 2RKBA 3KJZA 4Y2XA 4RBNA 4ZOLA 3NTLA 3D54D 3WLHA 1MLDA 4FNGA 1A9XB 2BUCA 2DWQA 5DN6A 3IT3A 3U9LA 2E9SA 3VC2A 4JT9A 1YCFA 2VNIA 1SU8A 3P71T 2RHBA 3VOBA 4TYYA 2H4HA 3ETHA 1BWRA 5HF8A 1ZD3A 2V1XA 3FSRA 1HE3A 1V1RB 1M54A 4PPQA 2ZM5A 4GW3A 1F20A 4R1MA 2CBGA 1YUMA 2GUWA 3AJRA 3MS7A 1M7BA 4ETMA 2CDNA 4K9RA 4RKWA 2CFTA 5H9VA 3L0IB 3QVMA 2TMYA 3ZJYA 4DYVA 2DPXA 4IDNA 1CY0A 1KSJA 2IYOA 1R4MA 3O8OB 5EJ2A 4BJHB 4L4YA 3TDMA 2IEDA 4ZV7A 3MTBA 2EBWA 4EA9A 2WTXA 1PFYA 5C31A 4K7JA 5HZMA 4ZVMA 3WKCA 2J30A 4M55A 5AJYA 4AJNA 4X65B 5KNCA 4MXDA 2JH3A 1C4WA 3F6BX 3PQDA 5KYXA 2QTCA 3IXLA 2BTQB 4CMEA 4ERNA 4WOKA 1SCNE 2G5TA 4BGIA 1KL7A 1RI2A 3GFOA 5AHOA 2POCA 4YH1A 4M21A 4LUCA 3RU3A 1PCXA 2Y4NA 2GKGA 5ICFA 2PMBA 1E2PA 1J2RA 1SBQA 3H99A 1FFCA 3K6SB 1Y5MA 5CNJA 2DUJA 3I72A 1DBSA 4ZZ1A 3CZQA 5H4HA 1A8SA 1RE0A 1E32A 2ISCA 4R8VA 5BSMA 3W6PA 4EATA 1AKRA 1T8RA 4LFCB 3UC9A 3QY0A 3HBMA 1CB7A 1RLOA 1IM8A 3NHUA 4JP5A 2I2WA 4KGXA 4RQAA 2O7RA 2VDRB 4J29A 1UKAA 1D04A 2BMFA 3UVEA 1WWKA 1G9XA 5EIHA 4DGSA 1U7UA 4D4KA 1CU1A 4PAQA 4BTEA 1MJFA 3IUQA 3KZCA 3O4IA 1VL5A 3ENZA 4V2UA 2HLHA 3ZZUA 3WLLA 3TW6A 4DR5B 1LQTA 3PT9A 3BZBA 4BFYA 1ECCA 2EFJA 1BRMA 5ADWA 1ZCAA 3NHKA 1VPWA 5KNCD 1SQFA 2QE7D 2J3LA 2Y3IA 4HAOA 1MJHA 2GF0A 2OQRA 4IZOA 4XZ3A 1BS2A 3DC7A 2VRBA 3U4AA 3WTCA 3KTAA 3PL1A 4C4OA 1DC7A 4D0LB 5JRDS 4OIMA 2QJFA 2CJYA 2QOEA 4I9FA 1CUBA 1VSVA 3S2YA 4AJPA 3AVOA 1ZICA 1X86B 1OOEA 1Z7EA 3PUJA 4J1TC 4QXOA 5JSYA 2GASA 4DTIA 3IV9A 3OOEA 4C4RA 5JOQA 1ULAA 2IBSA 1AIPA 2V7VA 1RJWA 2OZEA 2A1UA 4RFLA 3L40A 5B12A 5ADVA 2F9LA 2CGEA 1E3TA 4ZI7A 3GDOA 4NYIR 5K0NA 1RHJA 1XTQA 4QJ5A 4COKA 3RK4A 4F2HA 3K09A 1KJ9A 1IPFA 1TMKA 3EXHA 1W1WA 3GRCA 3QMWA 3AWIA 4KVZA 4QO8A 3AR8A 4ZJUA 5FWXB 5D2CA 3JQFC 5D8DA 3T4XA 3I76A 8AT1A 2VNJA 1YA6A 3SHOA 1GY8A 1TQ2A 3EY9A 3HGQA 4BTVA 5SY6A 1FDOA 1AN0A 2YJTD 3A6JA 3X1DA 4KUGA 1QYDA 3G17A 3L5OA 4ZJPA 2EIXA 1L8XA 1U3WA 3AIIA 3GFQA 3MTEA 3S29A 1IN8A 5U9CA 4CM9A 2I2DA 1SVLA 2B83A 1JV2B 3VVMA 4P4TA 4B7ZA 3U3RA 4DNXA 1XDWA 3OD5A 4UVIA 4ZQEA 4F12A 3L7NA 2ON6A 4D4GA 3WGHA 2DT5A 5ICMA 1MG5A 2A9VA 3F98A 4MINA 4HDNA 5K8LA 4GG1A 3DBVO 4QLBA 3EIQA 4DV4B 4HQKA 5AH0A 4FOPA 1SC1A 1YS7A 1LC3A 4Q7QA 3CRQA 4MYHA 4RTKA 1DPFA 4JOBA 4WDRA 2IJGX 4AWAA 1T43A 2PX2A 5EIEA 4X7MA 1TGVA 4FYYA 2Q1SA 2HSGA 1CY6A 4GPTA 3BIWA 5DX8A 4E22A 3U5TA 4JI5B 2WSSD 2GLUA 4HV4A 5C32A 2Q45A 2XT9A 4JASB 1XD2A 5AKZA 3P2KA 1W75A 5B58C 4E1VA 2YNMD 1KJIA 1MAUA 4S3MA 4EHHA 1KDVA 3B48A 3BMOB 1C4XA 5EQJB 1VJ5A 5B7QA 4FB4A 4DCMA 2P7IA 1LI7A 2BI8A 2VLIA 3NEYA 3DEKA 4OYHA 3A6ZA 1BX3A 2C2BA 4DV7B 2H5IA 3QSYA 3TSAA 1DJMA 5A5DA 3LT5A 5CXUA 1DXQA 1QNFA 2P6PA 3EMDA 4CM8A 1BWQA 1L0BA 2PKXA 1IM2A 3FCXA 1T2AA 1W5EA 4NICA 4URHA 1T10A 3EWSA 2OCIA 1RKBA 3QW2A 1ENZA 3TOSA 3H16A 1FBNA 4Q1VA 4EYOA 2AKYA 1XF9A 4DV6B 3L9WA 2Q5HA 3QKSB 1GEGA 2FXIA 3R5FA 4ZI7B 1BA2A 4ND3A 5J4HA 2GNOA 3AQ4A 3CSDA 4LXTA 5AHRA 5JFGA 1SU7A 3KYDA 4MZDA 1ZI9A 4OATA 1NUAA 3HRKA 3C41J 3FUWA 3OPYA 1KFKB 3QKUA 2R5NA 4Y2GA 1TJ5A 2ZT7A 3MT7A 4WXHA 1T8TA 1FP2A 4XJTA 1GPYA 2APJA 3AF4A 5ALRA 3TRJA 1SKUA 1U0BB 3VKUA 4C4AA 2M9MA 3G8CA 3D7MA 1NW8A 4X64B 3TLKA 4P4GA 4DLWA 3N0WA 2PWYA 4TT3A 2EZ8A 2A57A 1DEHA 1NLMA 3AM5A 4JMPA 5EKDA 4EB6B 1YMUA 4PLZA 4F7DA 2Q6OA 1TL7C 4HNUA 4TZ0A 2FRDC 4CKEB 1G8HA 3O6VA 1AK2A 4JGGA 2ZANA 1GTRA 2XODA 4MGHA 4EHJA 1JVBA 4I6EA 5KS2A 3DUFB 1XRPA 3E5RA 4O5OA 1TYEB 1EBBA 3AEUA 4NARA 5CU7A 4M22A 3WK7A 4B0PA 5K6AA 4JI7B 4KAAA 5AOBA 1Z35A 1HEYA 4YRBA 1F9EA 2IE8A 2M2IA 2W90A 3OA0A 4H08A 3MJDA 2PXXA 1QORA 2M32A 1E4EA 3EZGA 3EXEB 1GTJ1 3HFSA 4O2LA 1CUSA 4ZT7A 2GESA 3BA1A 4W4TA 1AM4D 1SBZA 2Q1TA 1TYZA 1U0SY 2BN4A 2DMRA 4PICA 5L9AA 5G1PA 1GCAA 3RRFA 3D6HA 1BOOA 1CIJA 4E5PA 4GYKA 3DHEA 1US8B 1CSEE 2ZSJA 3BC1A 1JR3D 1M2KA 3FKJA 3FLAA 3SYLA 3NNDA 4OLFA 1QZ3A 3ZVLA 3D3QA 1YAHA 3BICA 3VC3A 1NE2A 3K2QA 3O8RA 4OBXA 4LJRA 3UUEA 2E6KA 3HVHA 1BE1A 4M0MA 5DNDA 3FCEA 1POWA 4KYIB 1V5GA 2WWFA 1ZPDA 1YZTA 4MQFB 1TC1A 1XZQA 3D64A 3NRBA 3KETA 2C59A 1PHRA 1CUEA 2GJKA 4LX8A 3K0AA 4XARA 1GCOA 4PQGA 3EFEA 4D5EA 3JS5A 2VYQA 1P1FA 2GMWA 1X7ZA 3GLFB 1SAYA 4JBXA 5EVCA 1O5IA 1TT7A 2GN2A 4KAJA 4YRLA 1P2VA 2IV3A 2OPBA 1OH5A 2HX1A 5T6BA 4I1VA 1UC8A 4N47A 4C0KA 5FL7A 5D7BA 4HBZA 3KZMA 4HWPA 3EFOA 4NENB 2X5XA 5GZ3A 1FSZA 4WY5A 3SF8B 4DE5A 2KW5A 3SVLA 2FXVA 1GPLA 2JLCA 2HSDA 4ZYLA 1SUSA 3R7AA 4LXUA 5HK8A 3T5PA 5T4HA 3LPNA 3KTOA 4UE3S 3VBCA 1HSZA 4HGYA 4JOSA 4LWPA 3RYHA 1S8FA 2A33A 1WZUA 4KQ6A 5ER9A 4BC1A 5CT5A 2I78A 4PIPA 3U3XA 3ZLUA 4EI8A 5A6VA 2OCYC 2YS7A 4Q4HB 3UGTA 2HA6A 2J4CA 1FQKA 3V7FA 5KCZA 3D8RA 1D2EA 5EWLB 4HXYA 4YAFA 5G40A 4BNWA 5HIJA 4AS2A 1XCOA 2NQTA 4YVFA 4G2NA 2I76A 3G49A 3TBFA 4PC6A 3ABRB 4A0GA 1HRKA 2DR0A 1IOVA 4X92A 1W25A 3CLTC 3NVDA 4HGPA 2YV5A 2DEUA 1CR1A 3ZI0A 4ZHSA 2FWNA 1M2VB 1ZK1A 4B79A 5LDGA 2IOFK 4RQTA 1Y1KE 4AZ0B 4CFZA 5KWEA 3U7RA 2PJUA 4A6DA 3ZIDA 3DLTA 3M9WA 4DMGA 4Q39A 4U6QA 1W87A 4YP0A 3BRCA 2ZUDA 3D7NA 3GDGA 4JH0A 1I7SB 2ZYTX 4M2LA 4BKQA 1ORIA 1NOKA 5DOZA 1NJ1A 3GEGA 1HT3A 3BFXA 4C1BA 3L8GA 4EHKA 2DH6A 1WA5A 2PR7A 1QCZA 3H1EA 3K9GA 4D8YA 2IH2A 4GLLA 5C3MA 1WKCA 5IMBA 2P4QA 3KTDA 1Q7EA 3HUEA 4OI2A 4D6YA 1H4VB 1P6UA 1E6WA 1SM4A 2QRHA 1PS8A 2VAPA 2ZIWB 1I32A 1GZUA 1YDFA 4I36A 2QUIA 1MORA 4XWGA 1YXMA 1OKKD 3VHXA 1T4GA 2LR0A 3P2YA 1ADFA 2ZE6A 3D0OA 1QHSA 2BONA 5IKXA 3HSKA 3SM9A 3K05A 8MHTA 1NDHA 5EERA 4BNMA 1P2BA 1NXWA 1C8LA 1QDEA 2XB4A 3PUXA 3TB6A 1WQ4A 4M36A 4K0KB 4DCNA 4Z7JA 1MEJA 3N7UA 5AKJA 3Q9LA 4M8SA 1N34B 1H65A 2JI6A 4C4PA 2OCPA 4ALLA 1GNSA 1FY2A 1XTJA 3GNSA 4L1KA 1J5XA 3HK2A 1UXIA 1OCEA 5LVAA 2WAYA 3C6YA 4I50A 5C4GB 3GJ0A 1R0CA 1FNNA 1M33A 1F6BA 1HQKA 1E9BA 1Y9EA 3FHLA 1UDAA 2XMQA 1P7VA 4WN9B 1Y1LA 2FJPA 3U19A 4Z4FA 4OKIA 5JC8A 3IAS6 1OAOA 3BJRA 3LRXA 1G8GA 4E5SA 3GYBA 1N5KA 4PC2A 3U48A 2HQRA 2OD7A 3CG0A 3VKVA 3G2PA 3QH4A 3GLGE 4JZKA 3QKIA 5JZ9A 2QRGA 3NUGA 1E69A 3W7BA 4EITA 5J1TB 3IMEA 2PH1A 2VYCA 1KYYA 1R74A 2QRQA 2JFFA 4AMVA 1ODCA 2G63A 4YP7A 4A91A 4I50F 5DTRA 1NC1A 2RBEA 4S1VA 2WDZA 5GINE 2VDWA 1XAJA 3C3JA 3HA3A 3JD3A 1TA4A 3NC0C 1BXGA 1E1DA 4MRRA 1U0EA 2VH5R 3CLSC 1XRLA 5JYCA 1GXSB 3V1LA 5BN1A 4QATA 1U0HC 4O2BF 4ZO6A 5DM0A 5E8RA 5C53B 2XOKA 4CYMA 1XELA 3DE0X 2A9FA 3DAHA 1ULZA 4WKBA 4EI7A 2Q9AA 4MIYA 3SKYA 1UR5A 3C1UA 4WT7A 2ROQA 4N8SA 4BMSA 3TOZA 2A88A 1O97C 2PY6A 3C87A 3OTIA 4RM2A 1M6YA 3WMEA 3X2EA 4F86A 1UKBA 4PXSA 4S24A 4X0EA 4BVEA 1IE3A 2GZHA 1KOGA 4FEYA 4Q3NA 3ZVMA 1MQAA 1U8AA 2IUTA 4WCDA 1P44A 4DCGA 2QL6A 4XA8A 3EPJA 3LCUA 1X3SA 1JHQA 2QSJA 4QLAA 3WVNA 4MIOA 3B6JA 4X6LA 2UXDB 1U1CA 4F2DA 3E7WA 1OU0A 4YJ3B 7MDHA 2CXNA 3SQMA 1RJ9B 2EHDA 4GR9A 4HNHA 2XQFA 3LLUA 1L1FA 3FWPA 4R9VA 2BE7A 2PRIA 1AB6A 3AFGA 5FPQA 3TNLA 1X9GA 4AFNA 3BDVA 3ZPXA 1T9ZA 2NYUA 5REQB 4ZYXA 2CCJA 2R1VB 4W5TA 1HEUA 1O0SA 1FA9A 1TZJA 3N05A 3L4KA 1ZWLA 2XOKD 3X0DA 4OSEA 1VCIA 5DTEA 4DLYA 2QM7A 5C80A 2VXCA 2H0QA 4YUXA 2AMYA 2R8YA 4IIYA 4WGFA 5E0KB 1Z7YA 1XE3A 1E2GA 2HB6A 1ZXBA 2Q3CA 2VPZA 3H6KA 3N74A 3OIFA 4FOTA 4WEQA 2X5KO 3GN2A 3FZQA 3CGGA 3JQAD 4EARA 1XJ5A 3QE0A 2JIPA 3EEBA 1XJCA 2H9AA 5FV7A 3FFXA 3DV9A 2HZBA 4MUIA 1DRKA 4BVGA 2V7QD 3K6SA 1C5KA 2J48A 3ZN2A 2SKCA 4HRVA 4NYIQ 2YN0A 3I73A 4EHFA 3M1IA 4PLCA 2AE2A 2G9VA 4B6RA 5H4GA 1R6XA 3EXAA 3QVTA 4LWQA 2P8JA 3TLYA 4B33A 3PT5A 3ILVA 3L6CA 3KQKA 2NU6A 5JAQA 4CF6A 3KWMA 1J8FA 4O4IB 3WI7A 1Z9BA 3UAWA 3LT4A 3S0JA 3H9GA 2E7ZA 5IKOA 4UU7A 3F7NA 4IG9A 4MKIA 4YP9A 3SQNA 3ZDAA 3PHCA 4LGVA 4TROA 3WLSA 5DMHA 2UXBB 4L07A 3ZZMA 3FTEA 1NT4A 2BCJQ 2RIRA 1L8QA 2ZJ4A 3U4IA 4R9SA 5FPTA 1NYLA 4DMCA 1DAFA 3L1IA 5A9SA 1EU1A 3DLBA 1JBQA 4RU1A 1Q0ZA 5JPCA 1NUSA 3GLIE 4A2WA 1N5MA 2BFFB 2YDXA 3G7SA 4M1WA 2O52A 4RJIA 1MNAA 2H07A 1O94A 1V4BA 1W35A 1E79D 2J87A 3C15C 1XTZA 1GR1A 2OO3A 3FUVA 3R3WA 1ULTA 2FE4A 3IAFA 4H1HA 3R74A 3VPSA 4CIBA 5FCDA 1K4KA 3QTTA 1IK4A 1M8JA 2QUBA 3HR7A 4G24A 2ZRIA 1KO4A 4AULA 2A9OA 5ICGA 3FW1A 3LVRE 3ND8A 2ZIXB 3WLIA 4DG9A 1G8YA 3UMYA 2WWWA 4KDCA 4Q03A 3RTAA 4RLSA 4YJ3A 1EXNA 4NCNA 4V02A 4LHVA 4A36A 2WW8A 3RAGA 3R75A 2VHVA 3VR6D 4CMEC 1NF3A 2X7XA 3R5TA 4O2AA 2LW7A 2PX3A 2KQUA 3SQOA 2A58A 1QX3A 3VDRA 2GA8A 2VF5X 2OZKA 3A9CA 4AZTA 2ET6A 1IZYA 4Q7MB 1MB4A 1XLTA 3M7IA 3O8DA 1JIIA 4XRRA 1OU4A 1NBAA 1OZFA 1WHTB 2V96A 4CETA 1CT9A 2HO5A 2WTMA 5EIXA 1R27A 2WAAA 4ZVPA 2W42A 2UV8A 4D3YA 4Z4GA 1X94A 1JL3A 4BMNA 3G2IA 4M1ZA 4GXQA 4XVRA 4ENPA 3GIDA 5T57A 7GPBA 5I9NA 1Z0UA 2DU8A 3RRXA 1UBLS 3ZNPA 4NBWA 1CYEA 2XY4A 5G2OA 4ABTA 4JWKA 4R9UC 1A96A 3EA5A 1V8OA 4Z4IA 2R6JA 3W6OA 2JFYA 4X1KA 3NTXA 2J9YB 4YWJA 1CDDA 1KKUA 1RKQA 3I37X 2XUHA 1XZGA 2VDOB 5FOVA 1JKJA 5AW5A 1EJ0A 5K4GA 4PXYA 2R66A 1VSTA 4MUFA 2YWRA 4M1TA 3HCWA 4NWIA 3MCVA 1AQLA 1Z15A 4L8GA 1SD1A 2VDVE 3M1YA 1KI1A 1QJ4A 2F43A 2QQ5A 2YMPA 3D0KA 4WZBE 1RP1A 1GFZA 2K4MA 3DE6X 4FXOA 1PLJA 1THTA 2EKPA 3ZWQA 3ZE9A 4RV4A 2PEYA 2BBOA 1UC5B 4JBLA 3UT5B 3L0BA 2X0DA 3Q7IA 1DFGA 2ZUFA 5ARBA 3UHJA 3QPAA 3UV7A 2C7RA 3VTAA 4J1QA 4TKUB 4YRRA 2IYZA 2GH1A 3AL3A 1ISFA 1MOPA 3ELYA 4PLPA 4AWXA 1WR8A 3ZCQA 4LJ5A 3EDQA 2J5QA 3QK7A 5FLYA 1P4GA 2AZ4A 2H2GA 2R1UA 1AURA 5ENVA 3IDAA 3CF2A 3D31A 2OSBA 4RKYA 2JDID 4R8SA 4ZTBA 4AP9A 2RD2A 1U7TA 1D9ZA 2ACKA 3QNUA 1A8QA 1NLFA 2LP4Y 2EW2A 1CEXA 2LIPA 2P2YA 2X41A 3D6MA 2C3OA 2V6IA 4HDSB 2RGDA 4ND7A 5LPNA 4C7OB 3G82C 1GV0A 2VP0A 1OBHA 2Y4OA 4B84A 3IOEA 2FOLA 2V7TA 3QWHA 4LA4A 5L40A 1QFMA 2C8LA 4ZJZA 1P33A 4HEJA 2R6FA 4CLHA 3RBVA 2NZVG 2J8ZA 4A6EA 4C76A 1SXIA 2GEUA 4R7TA 3ELWA 3MT9A 4M8NE 4RPKA 3ABQB 4DA7A 3ROFA 2C7PA 3IHKA 1XZDA 2Y77A 1GSAA 2ZYHA 1E8DA 1WUTA 4FZJA 4G5XA 3GPDG 1AV6A 3L41A 3GMIA 4O4HF 4LF4B 2PS1A 4EYGA 5BR4A 2HCBA 3MGCA 2M6RA 2WF9A 4F2GA 4DKJA 2PL1A 4NEHB 5CVVA 4KJZA 2Q6LA 3NG1A 2YCBA 4N48A 2EU8A 5JD5A 2PXAA 2VBCA 3GP8A 4W7HA 3V8EA 2ZAMA 3VPFA 3JYHA 4IF4A 3PWTA 1QG4A 1E1QA 4ZYVA 4MW6A 2J0SA 3KT3A 1H2WA 4HDKA 4PYIA 1U1EA 2ADOA 1QAOA 2JW5A 5TQ2B 3AB3A 5FTLA 3QLEA 2CMKA 4P98A 3DH0A 4ZTZB 1QP7A 5TMDA 3SKVA 2QTGA 2XMRA 5SYAA 5CXQA 1IONA 1W0KA 1ZM4A 2PSSA 3FZGA 4K88A 4PPGA 3PR2B 3PRKE 1E0DA 1I2DA 3H86A 5KTNA 4Q3KA 4GOOD 5BVGB 2E85A 2IYUA 2QLBA 4CCWA 3KSMA 3NH6A 1D07A 3D81A 1XI2A 5AVWA 2DSTA 1Z34A 3GVCA 2HDHA 4G86A 4NBUA 5JVDA 3L6UA 3N2EA 4BLRA 2EKDA 7YASA 2ACVA 1BAPA 3UB2A 3HCDA 4S2EA 2WK1A 2YYYA 2FUCA 4UMEA 3V9AA 4URWR 2F3TA 1MVOA 3T1NA 3V7UA 3DJFA 1TCUA 4MPTA 1UADA 1XGKA 4JLJA 4RVCA 5T4FA 3M4JA 3U1BA 3AB8A 2EDAA 1CLEA 1SUDA 2QK4A 2VJMA 4YP1A 5CFOA 4YJ2A 3KLNA 1H8EA 4WV3A 2PV0A 2AOTB 3IMCA 3NTRA 4ZVSA 2Y0PA 4BAGA 4I1IA 3MJEA 4NQZA 1UQUA 3THYB 2B9VA 4EDFA 5CDFE 1S6YA 5J4LA 3UHFA 1NVWQ 2GGSA 3GU3A 3OJCA 4XCXA 5TPWB 2XCRB 4MCAA 4LYAA 1Z6ZA 2VNKA 4F97A 4QDXA 5ALJA 1EM8B 1UOOA 2R8XA 2RB4A 3IXQA 3P2OA 1W34A 5ALTA 1YMQA 4FD2A 3VNSA 3N28A 4YLEA 2P2NA 1K6XA 3KHUA 4HR7A 5DGTA 3GEEA 1KEZA 4MKZA 2WJ6A 5LXTA 1N8KA 1YA4A 3I58A 3T3PB 2I7VA 2Z09A 2Y1DA 2Y05A 2Z1NA 3DMNA 4KGDA 1YO6A 2IY7A 3G79A 4MR7B 4QQNA 3T41A 5IEJA 4OJYA 2IHTA 1A9XA 1ZCBA 1EDEA 2ZJAA 1W30A 5FBVB 1QGOA 4FYIA 4J2HA 1GR0A 2D3WA 4JLDA 4OU4A 1O57A 1JKFA 4U5QA 5CB6A 4AL4A 3MRSA 1EIZA 3S4YA 4JYCA 4Z4EA 3RIXA 1FFHA 4JUBA 4HADA 3UTCA 4ITVA 3SJAA 3AKCA 1B6RA 5FDFA 4RTMA 4ODIA 1YRHA 1J1UA 3GJ6A 2GCNA 3K9WA 1SG0A 4KWEA 4J43A 1RRGA 2IH5A 1FJ2A 1UOEA 2MMCA 4P86A 1G5PA 4E5NA 3FCUB 3WGIA 2CDRA 1YQDA 5SZKB 5LQRA 5AJHA 2DBYA 2Z5LA 1DJPA 3LHSA 4P84A 1L7XA 3RLFA 4AMGA 4JHLA 5CX4A 3RBXA 1A8HA 2ZI7A 4EZEA 3WGMA 5JI2E 2ECPA 5BN3A 4YRJA 4OHMA 3E70C 3TIFA 3WV4A 3E82A 5DNWA 3WBBA 5K5EA 5SZJA 1JQ5A 4KE6A 2WM2A 2R8RA 4HL6A 3K9FC 1L7NA 1LWNA 2XZPA 4ENVA 1L4FA 2G6BA 1P1RA 4BDTA 4EL5A 2HW8A 4J7CA 3IMFA 5FBRB 5EGNA 4UHKA 1T9CA 3FMFA 4L5BA 3TQQA 3BMNA 2WMDA 3AM4A 2XYQA 3IILA 1EE9A 2C1ZA 3IQIX 3TOXA 3V8RA 4XIFA 1IWOA 1QPGA 3I9FA 3RS4A 4CHTA 3BREA 4ARBA 1WB4A 2QTBA 2ZCUA 3NQ41 3T95A 4RF2A 3BL8A 2ZB3A 4NF2A 4QLOA 3DDUA 3LQRA 1G8PA 1PWXA 2C0CA 3NETA 5KQSA 3L7OA 4QPNA 4NEQA 4UBKA 2QP4A 3V8PA 3R5XA 3ZZ1A 5LD2C 4MQEA 1Y4AE 2WTBA 4KREA 3R4CA 2JC3A 5FR2A 4ARVA 2QAGB 2O8BA 2H00A 3DE1X 3SMVA 2R44A 2H2IA 3IYLW 1E2FA 5FEMA 4L7VA 5L6LB 2VYVA 4OF4A 4PRKA 1DC4A 2B5OA 3PC4A 3LC1O 1YT5A 1Z6XA 4WBNB 5JZBA 2PWPA 3R0ZA 5FOSA 2A1UB 1XUOA 1DB3A 4PO9A 3AVWA 3A1TA 1CHDA 4P9NA 4HGOA 3M2TA 2O4CA 3O7WA 4MI3A 3RF6A 3AOEA 3FUUA 3KJNA 2GX6A 3RRBA 4FFPA 1HYHA 3QA3E 4BLQA 3I1JA 2BEUA 2FR0A 4EHLA 4EUEA 5J4KA 2ZE8A 3TFOA 5G3YA 4I9NA 5KOYA 5H1YA 1O9HA 1MX9A 3DUWA 5JNRA 1J5EB 1B74A 2G70A 2HWYA 2OO5C 3HH8A 4YCJA 4DM7A 3W4JA 4Y2YA 2NXNA 4RH1A 2ZAOA 4GNRA 2BYTA 1T8SA 1U2QA 1QQBA 4PLGA 1M0WA 4MTCA 4EGSA 1W6RA 4GZMA 2HU7A 4QUGA 4DR7B 5I7RA 3A2LA 4M0KA 3NC4A 1TVMA 4R3NA 2GPWA 1Y3DE 3ZE0B 4UEJA 4CFSA 2FMIA 5BN3B 2GCOB 2AF3C 2VYVD 2QYHA 3OEHA 1DJLA 1DIOB 4FX2A 3E5MA 4AY4A 1CIPA 3OA2A 5C1PA 1NSFA 3AF0A 4FFBA 3VJMA 3OLVA 1MU0A 4LBYA 3UJ8A 4LG1A 1A9YA 1AZSC 1Q95A 4WLFA 4ZZ3A 5L3VA 1J23A 5FUBA 3SZ3A 4DA6A 1JN0A 1W0JD 3EOZA 3TK1A 1OI3A 1ZOPA 3KZVA 1O95D 2XWSA 3WWEA 1XHLA 1V7CA 2ZT6A 3U4DA 3S70A 1CXZA 4JXXA 1PJ2A 1G8MA 1OXBB 3MW8A 9MHTA 2GTPA 4YRAA 4ZYWA 2CK3D 2HMSA 3DDSA 5CR9A 5LBIA 2XHZA 1UQTA 2RC5A 1YVUA 3GLHA 2VJCA 4NYJR 4D9BA 2XX3A 1QO0D 3ASZA 3DBIA 3RIMA 1ZOLA 4V0SA 1R6AA 4PQYA 1XCJA 3ZTYA 5MN6A 1Z2NX 2YOFA 4L2IA 3K2IA 4B4DA 1YL7A 2VZ9A 5AKKA 3NXKA 1DL5A 2ZAIA 4HWGA 4PR3A 1LLQA 3BVPA 1BXRB 4RLFA 3LWDA 2DPGA 2BFCA 1Q44A 3L93A 1MMFB 1WKBA 4DVGA 2CF5A 4N8DA 2QSYA 4N3NA 5EIBD 2HNBA 3GLUA 5CK4A 3QUCA 4RA6A 1L5YA 1NUUA 1HYQA 1PWHA 2JHFA 3WWDA 4D7AA 2P9JA 5JD6A 1OC4A 1U3DA 1S0UA 3G0CA 2MDTA 3COWA 2GXUA 5FP0A 4KFUA 5B1SA 1P91A 1ESCA 3K32A 4M9RA 1Q50A 3KO8A 1F1JA 2O05A 2Q3LA 2RDMA 1K8RA 1IJKA 1LX6A 4A9AA 3CVOA 4TXMA 1B6SA 3TW0A 1JVSA 4L7QA 4FXPA 1U6JA 1FU7A 2QEQA 2PDAA 3EGXA 5A04A 4TKMA 1UBCA 1YHZA 3KUXA 4DANA 4LHZA 2W7TA 2HZ7A 2B21A 3KB6A 4FYKA 2AGVA 1G2OA 2ISSD 3C3WA 3QPWA 1QO0A 4EEKA 3ZCXA 1IQPA 1JUDA 1HLFA 2QRKA 3MFQA 5TX7A 3WL5A 5CB0A 4Z3OA 4URFA 2JANA 3OFJA 4GRIA 5FI0B 2H92A 4IBOA 2QD3A 4AUKA 2R8ZA 4R8MA 4UCXA 5IF3A 4I9HA 1ACLA 2ZIZA 3T0GA 2RARA 5KU1A 1O7JA 3ETGA 3W2EA 4AF6A 3GHHA 4UBMA 3SZGA 4ROTA 4BIIA 5KTYA 1GPWB 3SQLA 5I7OA 2UYHA 3B85A 2QU7A 4CDMA 1IY8A 5TQ0B 3WYFA 4IPTA 4O4LB 1NI4A 5TF0A 2FQQA 2V03A 1IK6A 2XJ9A 1M73E 2JRLA 2YC2C 1EWRA 4OHUA 5E1DA 5ELXA 3SEZA 5JDCA 3MN1A 3ROEA 1ZVQA 2LVBA 4IXDA 4QRIA 1FYWA 5GY7A 4B82A 4YRSA 4AQYB 1F3OA 5KZMB 1I14A 2GVDC 1UMBB 1WKVA 4OQDA 5AM3A 1XLTC 1Y9JA 2OZLB 3PTZA 4FINA 4Q9NA 4R8RA 4WESA 1JEAA 5KSYA 4BXOB 2B4QA 2OV1A 2JJ8A 1D0VA 3QYAA 1GUAA 1JLRA 3HCRA 4QTXA 4WZZA 5IJXA 4UPEA 3GCXA 3Q0IA 1DG3A 3BWXA 3AY3A 5M29A 1XTSA 4I14A 3F8TA 3KE8A 1FFEA 1AQ6A 1OD6A 3OCVA 5BYAA 2QR2A 2D00A 2X0KA 1VFNA 1ZMTA 3NCTA 2R9VA 2HJVA 3LQFA 2JJ2D 1KP3A 2N46A 3KD2A 3OJLA 4I81A 3WLAA 2HDWA 5I7EA 1K75A 2IWRA 5MGNA 3EWAA 3K1ZA 3FSGA 3OFNA 5D6NA 2ZJ2A 2F8SA 2DUNA 3JZAA 4ZTUB 1UKVY 1T34A 2OQIA 3N8GA 3TTYA 4JLAA 1JQBA 4EFNA 3MPUA 1G66A 4LRQA 3T1YB 1IB6A 5C8YA 3ZDBA 4UHBA 4WBSA 1X19A 4HUQB 1LD3A 1BCSB 5TE9A 4I19A 1JBEA 1I2ZA 1KZ6A 4DVJA 4JI2B 5ECDA 5MDHA 1RXVA 4P38A 1KPHA 3KEGA 1XJQA 3BMQA 4UQPA 3W9UA 4HT3B 4DMHA 3DQPA 3H2SA 3OT5A 2O8NA 4DMLA 2AT1A 1I8TA 1LUAA 1H6DA 3HABA 4MGYR 4PWZA 2CW5A 4CQMB 4EQ6B 5JANA 2WKSA 2NZJA 1R5JA 3OE7D 2IUUA 2O59A 1B4DA 2GPNA 1OLXA 1OJLA 1SVIA 5DDIP 3UMSA 4IGEA 1M34A 4OD0A 5EP3A 4DJTA 3UT6A 1MVLA 1YHYA 1N2SA 4TV8B 3HXKA 3VHRA 3MGBA 3FPCA 1EVYA 2FPOA 4RMIA 3RVKA 2XGGA 2AS0A 1I9CA 2ZTHA 3CFYA 1N77A 1KZGB 1XL0A 4IDDA 3ZXXA 2PX4A 3ADKA 4YQEA 1ADJA 4MK4A 3UMVA 3N5KA 2O8FB 1EVZA 4LY0A 4M7RA 5LDDC 1C30B 1S01A 2QMHA 3GA0A 2BWJA 3K8YA 1NI4B 1Z2CA 3VR0A 4X9XA 3PNBA 3SVZA 1JFLA 1ZUHA 1DHTA 3F9RA 3BA6A 3G13A 4W1RA 4C06A 1OI4A 3FPLA 4OKNA 1GPDG 2Q5QA 1Y6FA 4HRYA 4HB4A 4L57A 4XAQA 3VDNB 3ZDRA 3RAFC 1VJDA 1EZ4A 1FLVA 3SJUA 5K0EA 2OZLA 4BY9E 2B0JA 4CR8A 2I8LA 2OYCA 4BE7B 5BORA 4Q9AA 2Q3DA 4UZFA 1P61B 4UOZA 2ZRKA 1Y8CA 4D8TA 2Z0MA 4OB6A 2I4TA 1AKNA 2YL2A 4UUPA 1E1MA 4PYQA 2VOJA 3ZWWA 1XN4A 2DPMA 1ZNWA 2I3ZA 3FBTA 1FP1D 4YJDA 1QPZA 4OI4A 2W4MA 2A4MA 1BC5A 4H7DA 4HCJA 4L9WA 4RL4A 1REQA 4IO1A 5G53C 4MEAA 3ZK8A 2P68A 3OY2A 2AL7A 3IA7A 1OQAA 4MUKA 4EEXA 4GBGA 1PV1A 4CF7A 1M1ZA 1DTSA 4U2CA 2O14A 3WLKX 1LSSA 1Z25A 2AFVA 3KQSA 3OWXA 3QU2A 1DWQA 4IWNA 4Q6BA 2QVGA 4OQZA 4TKZA 5EOVA 5CA0B 4ZHQB 2JKVA 4OA8A 4UXJA 1J8QA 3RIYA 3WGTA 3EVBA 3DYIA 2J3MA 2H4FA 4M3NA 4BZWA 4Y6LA 1ISSA 2F4VB 2NSLA 4R0NA 5K7SA 2YVLA 1QGUA 1LBEA 3Q11A 1X7GA 4WKNA 5LSAA 1ZJ5A 4FKZA 1L1QA 2G09A 1H05A 4JQSA 4QUJA 4JS0A 6REQB 5CH8A 5KSPA 2IDJA 4CQMA 4UHHA 1ILEA 2IW3A 3E9CA 1LXCA 2QD2A 4WVLA 4GSKA 5AM4A 1H2HA 3T9BA 2QAJA 1JDPA 2CHFA 4OJTA 3V8NA 4D79A 5K01A 4MV5A 3L6BA 2QPAA 4J16C 5TEVA 2XUDA 1VLHA 4IIXA 2X9GA 1GZ3A 1QQ6A 4EFLA 2PE5A 1P81A 2OBXA 1KKLA 3JRXA 3TUZC 1TCCA 2D5LA 2ZQ5A 3V4VB 4EG7A 4J2TA 3SBOA 4I4TA 3BTUA 3PU6A 1RKXA 2VDMB 3M33A 1XNQB 4OHBA 4KPEC 2HJGA 4HYQA 4ZVKA 2V6BA 3BWDD 4QOIA 3K70D 2I6SA 2PX6A