2CL6X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with s-caged gtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
166
Chain Sequence
b'MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
total genus 64
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cl6X00
2PMDA 3AKDA 1ETUA 3LW8A 2WM9B 4PC2A 2FFHA 2GF9A 2R2AA 5BWMA 4RZ3A 2ZSAA 2CMKA 4ZDWA 3D7MA 5JWHA 3AB3A 4A1FA 4HLQB 5JFGA 2GA8A 2KI5A 1VPLA 2ZQ5A 3BGWA 3L43A 5DIFA 3ADKA 2XSZA 1ZD9A 3NWJA 4LJ4A 2NG1A 2ATVA 4RZ2A 2BMDA 2H18A 1YE8A 1P3JA 1IBRA 4HLUA 5JHHB 4D4MA 2OXRA 4YC7A 1KK3A 4Q47A 3ZD7A 2JLVA 4LJ8A 1F2TB 4C9BA 3ZZTA 2GXSA 3C7KA 1RJ9B 1XTQA 5HKKD 1XWIA 3N70A 1F2UA 2XAUA 2QAGC 3S1AA 2G88A 1SHKA 1Q20A 2BM0A 5HZHA 3TSZA 3W8NA 1L4YA 1P61B 2MSCB 4I1VA 5FUVA 5H68A 1D6JA 4TQAA 2H17A 2ZJ5A 3OAAA 3AEZA 1W0JD 2YYZA 3CZPA 3BIFA 1DAHA 2WIAA 4PAOA 5FBVB 4M22A 4R7ZA 5DN6A 4IRUB 2ONKA 1G4AE 1UPTA 2RMKA 3HJNA 4BFXA 1MABB 5KHOC 5EZ5A 2OV2A 4M1YA 3X1WA 1XJCA 1SHZA 2WOJA 3BC1A 4R71A 4XD7A 3LY5A 1OFIA 4EPRA 5J4VA 1VG1A 3QBVA 4OJQA 1ZD8A 3THYB 4A92A 1COWD 1D9ZA 1ZM3A 3VR4A 3W6OA 2RGEA 1CU1A 1QHYA 4DLWA 4BLRA 3KXIA 2CBZA 3L2OB 3T1OA 4HAWA 3G0HA 2J41A 4PC3A 4QJ4A 4I1UA 3L0IB 2QAGB 3V9PA 2OCAA 4TMZA 1GFIA 4IEEA 3R9IA 2JJ1D 3HDTA 3TR0A 2H1LA 4O25A 2A9KA 2XTNA 3QKTA 4BZQA 1TQ2A 2IS2A 4LDJA 1N6KA 3QOFA 3F8TA 1TUIA 2GWHA 5EP4A 4L9SA 2IYXA 4K8OA 4RCYA 5JCZA 4K81B 5H1YA 1P62B 4LWZA 4B3BA 4DKXA 3DKVA 1Z6AA 4JJKA 5E7MA 3FFBA 2A2ZA 5J4YA 1JJ7A 1U9IC 4LHYA 2Q9AA 1TQ6A 4DT1A 2J0UA 4HAXA 1I2DA 2FU5C 3EG5A 2VHCA 3ZDQA 2XJ4A 3EIHA 4N1AA 1KK0A 1DADA 3QENA 3I72A 3HR8A 3B1VA 2BEJA 4QBIA 1SZPA 3SI7A 4AKGA 1QHHB 4KBFA 3JVUA 5FR2A 3LRPA 2ZRAA 4PR0A 2Z0MA 4F4CA 1TMKA 1DPFA 4D80A 2YV5A 1ESMA 1KKLA 5D3MB 3HWSA 1WQ1R 4KVAA 2GVDC 4BLPA 1G41A 2G9NA 1NKSA 1OYYA 3CX7A 3QXSA 4MYHA 4NCJA 2IEZA 2O8DB 2IA5A 1Z2CA 1HT2E 1OH7A 1DTSA 1N5LA 3I61A 3RS0A 1P2UA 2PT5A 1OHHA 5FTNA 2DHRA 2D06A 2BMEA 5G53C 6Q21A 3PEYA 2EFEB 1IXRC 4KJZA 5JSZA 1E1QA 3JZMA 5GVRA 1U94A 4Q7LA 2AFIE 4BFSA 2JATA 1XEXA 4PHTA 4QNMA 4NCKA 3BAFA 4UJ5A 4Q21A 1OYWA 5AJWA 2X2EA 4Q5IA 4A2QA 1D2MA 4TT3D 3NC0C 2J3EA 4TMXA 4LYHA 4JLPA 2YOFA 2QM8A 5FR1A 1IXSB 1D8TA 3FHCB 4MGIR 5B64A 1WBDA 4Q01A 4L5BA 1ELOA 4EJSA 4IDNA 1X8JA 4C0AC 1GWNA 2HJGA 1RW4A 2H92A 3OFNA 1E2KA 421PA 1AIPA 2OXCA 4V0OA 1EX6A 1KDTA 3NH9A 2WTUA 4C30A 5BYJA 3DZDA 2ZRMA 5C2JB 2NO9A 2CEAA 2PEYA 3QY0A 2R62A 1ZM4A 3DM5A 1DG1G 4DLTA 2VF7A 1Z6GA 1O3YA 4IDOA 1R5OA 1A2BA 1IY0A 2OAQ1 4W5HA 5J4HA 3I1FA 4HUQA 3O47A 1ZRHA 1TU4A 1XU4A 3KUCA 3BJIC 4YMUA 4NKRA 2J45A 1DAEA 1N0WA 3CWQA 2F7SA 2XOKD 4Z51A 2WSSA 1HE1C 2DYKA 2EYQA 2IXGA 4MUBA 5JRZA 5F98A 1R0XA 2F9MA 3EZFA 5GADl 4PC6A 4AYWA 4A15A 4NHOA 1OF1A 1P9RA 2N1BA 4QXAA 3EWSA 3QKSB 4KLNA 4IEIA 4LZZA 4UJ3A 2H5EA 1XD2A 2IYUA 1TEVA 2PZGA 2WKRA 3MRSA 5TDHA 4IKEA 3L0OA 2GK7A 1CIPA 1MO6A 1ONBA 1G7CA 2REXB 2VRWA 3OIUA 3UATA 5K8TA 4KU4A 3P4YA 3U7FB 1ZUNB 2DY1A 2UZ3A 1NJFA 3VKHA 1EFRA 3BH7A 1KK2A 1XD9A 4GZLA 4JBXA 2J0QA 2FFAA 3NTUA 4Z8YA 4IDQA 1N5JA 4TL8A 4U02A 2KWIA 4WW0A 4NH0A 2JJ2A 3O8RA 3NVAA 3T5GA 1B23P 4V0ME 1VG0B 2EQBA 2IYVA 4BFVA 1DBSA 3LBNA 5CK5A 4GOJA 5H70A 2G1JA 3FFAA 3SHWA 2QA5A 1PLJA 3FYHA 2IYQA 4M8NE 1WBBA 2JLUA 2QROA 3ZS9A 5EE0A 3M6AA 4D25A 1EFUA 1E0AA 3V4RA 2GXUA 2LKCA 5KSPA 4OI0A 3SFVA 5KPDA 2VP0A 1JB1A 1LF0A 3C5HA 3KL4A 4LV8B 5DLQC 4CEHB 4DXAA 3NKVA 4IFBA 3KQUA 1QZXA 3R7WB 5FUXA 4KFSA 1KY3A 1RKBA 1VMAA 1YZLA 1W5SA 3T1VA 5L3VA 3U7HB 4NYIR 4QGFA 5FTJA 2XEXA 2BBSA 2PJZA 4Q7KA 4DDVA 1NG1A 4Q4HB 2VHQA 3H86A 4FIDA 4GMDA 1M7GA 2JLWA 3B7GA 4FCTA 1F2TA 1FNMA 1RJ9A 4L8GA 3R9WA 1JAHA 1GL6A 1WF3A 1Q22A 1IY2A 1P9NA 2VYFA 1LVGA 5CIQA 5LB4A 4ABYA 1SVMA 4PANA 5M04A 1HH4A 3QXCA 2VO1A 2BMJA 3TRFA 1QG4A 1E9DA 2E9SA 2RHDA 2OLJA 4S35A 2XJ9A 5AUPB 4PQYA 1MABA 2AWOA 1E79A 5FOUA 4MUAA 3KKMA 1KI8A 1KOFA 5FTMA 1UF9A 3UIEA 1PV4A 1X8KA 5B57C 2EU8A 3K9GA 2DCUA 4V0KA 4B3GA 3A1VA 1VYTA 1G1MA 1VDZA 1SXJD 3THYA 3LX8A 3NBXX 1KI4A 5EP3A 1XX6A 2ZUCA 1Q1EA 4HB2A 4HDOB 2P3SA 821PA 2C8VA 3FKSA 2OBLA 2YOGA 4GMXA 5IF9A 2XXAB 3K9HA 3DOEA 4QM6A 4B3CA 1S1MA 2C03A 4OHYA 3RWOA 2BIFA 2JLYA 3GLFB 3A1WA 4HSEA 1FL9A 1H8HD 1P4SA 2QE7D 3KXKA 4GI7A 1NVVQ 1IY1A 2GCNA 3PEVA 4K46A 3BFVA 5C18A 4AG5A 3U3JA 1OH8A 2DR3A 3GJ5A 1QDEA 1NN1A 1W36D 4QJ3A 3EZ7A 2WWIA 4V0LA 1KSFX 3UG6A 1JALA 1OSNA 2QMUA 4B3FX 5FPKA 4LV6A 4NTZA 1E9EA 4ZCMA 5H8WA 1SXJC 1ZD1A 2BJWA 4LOAA 4Q9JA 4B76A 8OHMA 1AZTA 2OFWA 1TTTA 1IN7A 3H4MA 1KI1A 4OQNA 2FA9A 1KAOA 1SVWA 3TMKA 4XJXA 2P5SA 1JQJC 2B6HA 4URXR 4EQ6B 5HKKA 4ACAA 4B74A 1RPZA 2PX0A 1GOTA 3DMNA 621PA 3TVTA 4YXWD 3NHBA 4QL3A 1GRQA 2O8DA 4L9WA 1E4VA 1OB5A 4LHZA 3B1ZA 1OFHA 4GZMA 4LY6A 5DE3A 2GBLC 4XIGS 1U9IA 3ASYA 4NYMQ 2GHIA 1KHTA 2GJ9A 1W36C 3MWLA 3IHLA 4LYAA 4OHVA 3SS8A 3MG9A 4CEIA 1D9XA 3GLHE 2CJWB 1N2CE 1SGWA 4LJYA 4TMVA 4MYTA 3K70D 4C2UA 4IHQA 4IDPA 3GLIB 1COWA 5FBWB 5KO2A 3DO6A 3SBDA 3EX7C 3QKRB 2FSHA 3WRYC 4WOPA 1KZGB 3DPUA 3H2YA 4B3XA 5K8UA 4C7OB 4L16A 1DAMA 4TLEA 4DCUA 1SQ5A 2OBNA 1YZTA 2DPXA 4FN5A 4DCSA 4KLZA 4EKDA 1IJEA 4XVUA 1Q1BA 1R5BA 2JJ1A 2IX3A 3AVUA 2HF9A 4B3DA 2ASEA 1DELA 3QPVA 5GJBA 2F43B 2ZXUA 2GK6A 1KO8A 1ZNZA 2NPIA 1GRNA 3AUYA 3AVVA 3MUFA 2KB0A 1XTJA 1KO1A 2DWPA 3F5FA 1W36B 4FWTA 4KXFB 2WJYA 4GT1A 1D2NA 4Q48A 3VX3A 2C77A 2Q21A 3CW2A 3VNVA 3B6EA 3A37A 2ZRBA 4G01B 2IXEA 2VP4A 4JYBA 4Q4JB 4D0GA 3K70C 1AA9A 4QBHA 1OKKD 3QG1A 3RLFA 5DISB 3AP2A 2GAAA 1M6NA 4HLDA 4JLBA 5FTKA 4AKHA 3VR3A 4E03A 1R5NA 2ODWA 4B71A 2ONJA 3AVXA 2AK3A 1G7SA 2IYZA 4I81A 3VKWA 1IHUA 3QKSA 4LYJA 4ZV4A 2IYLD 2BC9A 1NNEA 4P4UA 3D31A 4UNRA 2IXFA 2DFNA 4MGZR 1T0HB 4ESHA 2EFCB 1AGRA 2IUTA 5CJPA 2RGAA 3T1QA 1NKTA 3R9XA 4B2LA 1KMHB 1MO5A 2YKGA 2AK2A 2QPAA 2QP3A 1DO0A 1JR6A 1BYIA 4QBGB 4LV5B 4TT3A 3K70B 3I62A 4II7A 1S4QA 3ND9A 1TPZA 3RWMB 1CJVC 4NCHA 3I5YA 3UWOA 3L82B 2VP5A 1G3UA 1OJLA 4NYJQ 3GJ8A 3EPJA 4OK5A 3R7WA 5SZHB 5AUOB 3U3MA 1YJ5A 3MFYA 1OH6A 5CITA 4RFVA 3CZQA 1QVAA 2EFGA 5IRCD 1W5TA 4JL5A 3LA6A 2OILA 1UJ2A 2XNSA 1KJZA 1XJ0A 1L8QA 4EFNA 1NRJB 2ORWA 3ND8A 5JMTA 1GTVA 1Z29A 3AVTA 4KITB 1UKVY 3RRYA 1XF9A 4HB3A 4P3YA 2V6JA 2OT3B 2C9CA 2Q9BA 4U00A 1R0ZA 1P75A 1XMJA 2ZAOA 4AY2A 1M1YE 5KSZA 4DCNA 2IT1A 4UXHA 2WWFA 5GJCA 1KJYA 1OXTA 1JXOA 2HCBA 4U7DA 4W9MC 5CM8B 2F9LA 4QGGA 5DYIA 4FMCB 2J5XA 4M1SA 1W7AA 4C0JA 2FDCA 4IDHA 5FI0B 4DB4A 3ETLA 1Z0KA 4PHFA 1QG2A 2B7BA 4AWXA 1KMQA 2QQ0A 1CEEA 2OE2A 2CNWD 2GRJA 3NHAA 3LD9A 4V0NA 5J5CA 3WXMA 4R9UC 5J4KA 4XWOA 4Q00A 4DWJA 4AURA 1DVRA 4YQFA 2CXXA 1FZQA 3GJ4A 1IONA 4TZ0A 4DEXA 1E2MA 4O2LA 5AWFC 2FZLA 2VBCA 2XXAA 3VHXA 4WVFA 1EWQA 1FTSA 4P33A 3GLFE 3TIFA 3W3AA 2QN6A 2CLCX 3RVBA 4TLDA 4WIAA 1NL3A 4CW7A 4KSBA 3KQNA 4GL2A 2XZLA 1X86B 2V7QD 3IUYA 4N3NA 4AI6A 3HU3A 2R6GA 3HU2A 4H1VA 3I73A 1NF3A 2RH5A 3SJBA 4PZLA 3SJAA 1NSFA 1G17A 1DAKA 3GJ0A 1OLOA 3IO5A 4C2TA 1XB2A 1TF7A 4Q66C 4NL4H 2QQEA 3CKLA 1Z22A 4W5JA 1ODFA 2PZFA 3LX5A 4HEJA 2XB4A 2G83A 3QPWA 3KQKA 3CRW1 2IK8A 3QE0A 2PX3A 3P27A 1AQUA 2ZE5A 2FZ4A 2UKDA 4FD2A 4TTQA 1OH5A 3TUIC 3ZH9B 2GEUA 5FBLB 4PAQA 5BQ5A 4F4IA 4DIEA 4TL9A 2ZRKA 4OJKA 4EQ6A 3FMOB 4EFLA 2OFOA 1HA3A 1KSGA 4A36A 1D5CA 1XTKA 3PIRA 3UKDA 5DYGA 4LHXA 3PEUA 4US1R 5CK4A 3LQRA 3BBPA 1AK2A 2FN4A 3RNLA 2PZEA 3EA5A 1EWRA 3ZVNA 2P65A 2NTYC 2ZSBA 2DBYA 4RFSB 4D4LA 3CO5A 2JJ8A 1MT0A 4RD3A 2DWOA 2G0NA 5EE3A 3CF0A 2XX3A 3B60A 4CF7A 1SVLA 4O3MA 2F3TA 1Q57A 1QHIA 4NONA 1U0HC 4M21A 2CJWA 1KNXA 1T3HA 5DSZA 5KU1A 2MSDB 1MOZA 1SXJA 1YR7A 4NP6A 4A9AA 1VIYA 4DBLC 5J47A 3R8CA 3GLIA 4RD1A 3QKRA 4F93B 3MD0A 4R98A 4C7OA 2KJQA 5FPTA 3TUJC 1IOZA 3AGQA 2ZVPX 2V4ZA 3VKGA 3AF0A 3QKUA 1KO7A 1CF4A 1F60A 2GTPA 4ZO4A 2P5TB 1EFCA 4HDQB 3BH6A 5ANRB 5G3ZA 3GEIA 1R6BX 3VR6A 2F55A 4TYWA 1H8HA 4XVRA 3SR0A 2XB2A 2QE7A 1ZC3A 3QVUA 2F43A 3CNNA 4G0NA 4M2LA 4PPQA 2JLZA 4D0LB 1L7VC 2GBLA 2IHYA 4GRAA 4PO8A 3T1TA 3PQCA 4OQFA 2IL1A 4BEJA 1P5ZB 3BWDD 4D0NA 1H8ED 1PUJA 2CCKA 3HP1A 4JKIA 1NLYA 3IPXA 4WBSA 4BECA 2GDJA 3IO3A 4Q4AB 3GFOA 3CRQA 1Q1QA 4Q4JA 1J70A 2CHVA 2GXAA 2X19A 2ZREA 1OXVA 3A1SA 1I4LD 3QJYA 1FX0B 3CUEF 3CRMA 3U6BA 4HLCA 1Z28A 4WXRA 2JASA 3GP8A 2R8RA 4IOMA 4TLAA 1E4YA 3B1XA 2BBOA 2QBYB 2VSFA 4YXWA 2JLQA 3IGFA 1HY3A 2UZIR 1TF2A 2ERXA 1OIVA 4JLKA 4EPTA 2OSBA 2F1RA 3ZVLA 5C46F 4GSYA 1EFTA 4LHWA 3U3KA 1I4TD 2WKPA 1CR0A 1Z0AA 1MKYA 5L3QB 3ZIAD 2F3RA 3PJRA 1WCV1 2QUZA 1EESA 1KMHA 1Q0UA 4PSVA 1KI9A 5KYKA 5FBQB 4M4SA 2GZHA 4PX9A 3RS5A 4C0QC 5G41A 3SYNA 3SHFA 4QOSA 4JLMA 3NBZC 2VSOA 2ZRJA 4CEJB 1G8PA 1RFLA 2DFKB 3AQ4A 1XEFA 4A0RA 3K0CC 1TUEA 5TXGA 1YRAA 3KQLA 3ZS8A 4B48A 4C0BA 1YVDA 3EIQA 5BN5A 2NO0A 4C0SA 2MMGA 4LRWA 2XGJA 3DOFA 3FKQA 1S9HA 2QM7A 1EX7A 4CT5A 2XNDA 1KYIA 2ZYUX 4HB4A 4A2PA 1XP8A 1D2EA 3TQFA 1RC8A 1UBFA 4UXJA 2RGNC 2IHBA 2KE5A 1ZC4A 1NVWQ 3K09C 1Q44A 1R0YA 4PPFA 4KI0A 5LBIA 1E9CA 3K0EA 1RYFA 1KGDA 4JVNA 3SN6A 2XZPA 2GESA 4R2HA 4IVQA 2OBMA 4B43A 3DHWC 3IDQA 3OF5A 4ESVA 4PSAA 4MDFA 1OKKA 2ZETA 1NMYA 2AD5A 1MRSA 2ZE6A 1HV8A 4UNPA 1BS1A 1W4BA 4MKFA 2EYUA 1ZNYA 1BIFA 2IW3A 3IQWA 4ZCIA 1G3QA 4NDZA 3N2EA 3KKNA 2EFDB 2C2HA 4UNNA 1ZCAA 4N0DA 3RS2A 1RVDA 3E70C 1O87A 1ZNWA 3ZVRA 2JCSA 3FMFA 3WBJA 4LK2A 2GXQA 1XCMA 5JWRA 1DE0A 4AYXA 2ZJZA 2FPKA 2ZSFA 3CB4A 5ELXA 2BHRA 3WYGA 4A8JC 2IYYA 3AP3A 2Z5FA 2QTFA 3GLHB 4DCTA 2V3CC 1Z0JA 1TL7C 1C4OA 3EW9A 3FDIA 5AJZA 2I1VB 2A30A 1AGPA 1V43A 4DLZA 4M1TA 1N5IA 1UKEA 1HQYE 1Z6XA 2ZR7A 5TVKA 3X2SA 1FMLA 3CX8A 3ZQJA 1PZNA 3TNFA 2PMKA 2J59A 1U8YA 1CULC 3LLMA 1VTKA 1CRPA 1NVXQ 2QPTA 4W7SA 3Q85A 1Q1ZA 4KFRA 2B7CA 2ZU6A 2QP9X 2G3YA 1CR4A 1E98A 3DM9B 3B1YA 2ZM5A 1S3SA 1II8B 4MRPA 3ZZUA 4DSTA 4PZZA 2IEYA 4HAZA 1AM4D 1NN5A 2WMOB 1SKQA 521PA 1UAAA 2ZSDA 4MGYR 2W6ID 1NLZA 2WBLC 3PUXA 1M7HA 4A8JB 3W6PA 1FMJA 4RZUA 3A4MA 3PG5A 4KAXA 3L8ZA 4HZUA 4M0LA 1T5LA 1R7RA 5EUMA 5FOSA 2HT1A 4C3ZA 3OESA 2BKEA 2BBWA 3VTKA 3BB3A 2LWIA 2L0XA 4UQOA 2ZS9A 1R8QA 2QSZA 3VR5A 3OEHD 5FOTA 5DGXA 1KI3A 3P32A 1GRRA 2VH5R 1GP2A 2CNWA 4KHZA 3WP0A 2QRZA 2ZYWX 3U61B 4G5OA 2AL7A 2R6CA 4A0HA 1LB1B 5AJVB 2H7VA 1N6HA 3DKPA 4WA7A 4B75A 1OFUX 1XTSA 4TLBA 4Y0AA 4ARZB 4PTLA 2YJTD 5G40A 4C0KA 4KFUA 3NDPA 2FV8A 3L8YA 1LS6A 2YC2C 5TB5A 3UMSA 2PH1A 4QBFA 3W6NA 1Z63A 3NXSA 4JVMA 4BLTA 2PT7A 2V7QA 4V0MA 1UBEA 1US8B 1U0LA 1P6XA 2F1IA 2Q3MA 4YONB 1E2DA 3RSLA 2V54A 3QF7A 4BFZA 4HAYA 5EUQB 4FCWA 5F2EA 3EZ6A 2FJUA 4GFDA 4DLUA 3THOA 3KUDA 5L3SB 5EP1A 1RYHA 1G3IA 1ZUIA 4MH0R 3B1WA 4DZZA 2VF8A 1QVRA 3WP1B 5JI2E 1ZM7A 1YU9A 4P32A 1NN3A 4AKEA 3IBGA 4GPTA 1N3BA 5JI3E 3KZ1E 4OHZA 1FTNA 1FFHA 2FSIA 1QHNA 2R9VA 1E0SA 1V5WA 3CONA 4IOLA 4TYPA 3PUYA 3PR1A 2CCGA 2F1HA 2YWEA 2ZRGA 5E7IA 3DMDA 1ANKA 2JLSA 4G5GA 1TAGA 1NBME 2W6JD 1FX0A 3C41J 1NIPA 2D2FA 1GSIA 4ZKEA 4RSGA 2HXYA 3THXB 2CDNA 5JZVA 1FQJA 4JMPA 2FH5B 4URVR 2IYTA 2OCBA 1CTQA 2B21A 3BE4A 5HTKA 3WNDA 1S3GA 1RE0A 2QBYA 3LVQE 2ZROA 4TMTA 1Z07A 1G64A 3X1YA 5TY0A 1FP7A 4DLVA 2Z4SA 2WIBA 5L3QA 4E09A 3K0FB 1TU3A 4ZIRB 1UEJA 4KVGA 3REGA 4MRRA 4TQ9A 4GBMA 4FW9A 2IBMA 5FBRB 1G8YA 4QGHA 1YZUA 1CJMA 3NIBA 4B32A 5LD2C 4XTRA 3SEAA 3W9YA 3AKYA 4URUR 4LBYA 1C9KA 3CNOA 1KK1A 3N5CA 4H9GA 1SVSA 2ECKA 3A1TA 1TQDA 2Q3HA 5JWOA 4CEJA 1Q12A 2AXNA 2QAGA 3D3QA 2P6RA 3A58B 3MJRA 2GAOA 2QEQA 4DHEA 3EC1A 4P31A 1EGAA 4IVRA 3FOZA 5AJYA 1T0JB 4D81A 3IIJA 4KODA 1DS6A 2CE2X 2NO6A 2CHQA 1MR3F 5CB6A 1XNJA 4IFEA 1S9DA 4KFTA 2QGZA 1Z5ZA 4I1SA 1VG9B 4NCNA 4IJMA 4TL7A 3ADCA 3WHKA 1FPMA 3HPRA 1QHSA 4KCGA 3QEJA 5L3RA 3DDCA 1KDOA 1Z08A 2O52A 3C8UA 4Q03A 1H8EA 4RD4A 3U5ZB 1QHHA 2Z83A 3FB4A 1DEKA 4H1UA 3WY9A 2P2LA 1E9FA 4X8HA 1XTIA 2JLRA 5LD2B 2YNMA 2JA1A 4URWR 3SJZA 2AKAB 1OIWA 2YWFA 5FL3A 5D3MA 3C15C 2G77B 2WWYA 5SZKB 2CLDX 2IF0A 4NPHA 3K0CA 5FOXA 2GZDA 1E2EA 2O8EB 1BO6A 2GETA 2P6UA 3SDZA 5B2ZA 2NO7A 2NQ2C 4D4JA 4D4KA 1F6BA 1T3SA 1R8SA 1EG7A 2B92A 2QMHA 4DSNA 2GEVA 5FOVA 2ORIA 4FMBB 2C04A 4ON9A 2R6DA 4NYIQ 4QKQA 2RGCA 1A7JA 1OE0A 2RGNA 1RIFA 3K09A 2VHUA 1ZIOA 2GEDA 3EXAA 1JR3E 3ZIAA 4TLCA 3PXGA 1X1SA 2Q0HA 2Q3FA 3GLHA 2K5UA 4ZDKA 1GITA 5K8LA 1IN4A 1XBTA 2ZITA 3RC8A 1KSJA 3K1JA 3A1UA 3KJGA 4DLSA 2WJIA 2IYSA 4JJZA 2UVQA 3SOPA 2P67A 2OLKA 1CBUA 4NZYA 4KBGA 4GP7A 1JEDA 1BYUA 2JIZD 3CRRA 4BFWA 5JECA 1E99A 2B8WA 1N6LA 2XNDD 2ZI5A 1A4RA 3KB2A 2D7CA 1N6RA 4HAUA 1H65A 5AUQA 3KTAB 3PITA 1KTVA 4A6PA 4JSTA 2ZRIA 2E87A 1G4UR 1U90A 1YR6A 1I2MA 1ZU4A 4DB2A 1UBGA 3AV0B 1NMXA 2ZYVX 4BZXA 4E22A 1P73A 3RYTC 2WWHA 2R44A 2B8TA 5KDLA 2ANCA 1G20E 1L2TA 2GKSA 1IXZA 3GLGB 3QG5A 4A8JA 5C4GB 1G18A 2ZI4A 5FPYA 3QXHA 4JSYA 5KSOA 1KDPA 4OI2A 1W0KD 2G1KA 4RD2A 2HYDA 2ZJ8A 1XMVA 1JXMA 3LBIA 2F1JA 3I8SA 3SZRA 3U44B 3U60B 4MRSA 3ADDA 4TYYA 4Z8XA 2I3BA 4PHHA 4DC9A 3BB1A 2A5JA 4JLAA 2YVUA 5CYOA 1M34E 4Q19A 4LSGA 1XDBA 1WMSA 4OK3A 2ZTSA 1T6NA 4JKYA 2ZANA 2BCGY 3T15A 4D82A 1E2JA 3BXZA 4G3XA 4PAMA 5FUWA 3B78A 4QRHA 5BXQC 4ARZA 3PUZA 1LF5A 1F5NA 1KI6B 2R6FA 1G291 1CS4C 4LPSA 4A82A 3ZZ0A 2NIPA 3FE2A 3GJXC 4FMDB 2HXSA 1LY1A 4LYFA 2DFLA 1ZM9A 1F2UB 3PFIA 1W47A 5GJWC 1CXZA 1NG9A 5E4FA 1G19A 2CCJA 1Q3TA 2W83A 1JQLB 2W00A 1Y63A 1OPXA 4MITA 5C4MA 4HATA 4LJAA 1M74A 4PSKA 1M7BA 3AP1A 5DHFA 2DB3A 2RGDA 2ZI3A 1E3MA 3L0SA 2N46A 2ZR0A 3PENA 4IOJA 3KKQA 1KIMA 3LV8A 5FL7D 3IILA 5L3SA 4ILEA 1N5KA 1ZU5A 4CEHA 3KJHA 2QTHA 1RRCA 2V9PA 2HJVA 2WJHA 4RJLA 4DLRA 2P6NA 4MA4A 3FPAA 2D4HA 2KSQA 4Q1AA 4PZYA 3W5IA 1LV7A 4JBYA 2FGKA 1E94E 3EA0A 2BOVA 3EZ9A 1Y3AA 3OE7D 4Q4HA 5CDFE 5KUTA 4RD6A 2ZJAA 1GZSA 1KNQA 2HCJB 3NH6A 4FINA 5E7JA 1CJKC 2GNOA 4GOKA 3LDAA 3Q7PA 2HLDD 1JBKA 2A5YB 3AUXA 4YMTA 3VFDA 2O0HA 1WDTA 3IEUA 1P72A 4IW3B 3THXA 3KJIA 2W6IA 1P2SA 5TV2A 4B47A 3V4FA 4YMVA 2EFHB 2GF0A 4PXAA 4LCBA 2WWWA 5CLQA 5JEDA 5JBQA 2V8OA 2YWHA 4QHSA 3NG1A 1JI0A 4DT1B 3A36A 1LFDB 4TTRA 5EE5B 4MRNA 3RRMA 5HE9A 3OEHA 1N25A 3K0FA 4MQBA 1BOFA 1Q21A 3WNCA 3I92A 4URZR 3KFXA 2YHSA 5SZIA 1E1RD 2PLRA 1SULA 3U7EB 4FMCF 3IPYA 5TARA 4DUGD 2BVNA 4BFYA 3AVPA 3AF2A 5K8IA 2IS4A 2X8AA 2OCYC 4MYCA 3NC1C 4NE2A 1E2GA 1U0JA 5SZJA 4AIIA 2ZS8A 1LS1A 3Q8XB 3GLFA 5F3WB 3E2IA 3LLUA 2F6RA 4G5SA 3SQXA 3SFZA 4J0QA 2IUUA 3WYAA 2VP2A 2AWNA 2WJJA 1ZCBA 1FQKA 3LWNA 4Q1DA 2FMXA 4MYUA 1Z8FA 3TQCA 3CWZA 4P0TA 2QPOA 1A82A 3B9QA 2QG6A 4X8LA 2BKUA 2C99A 2EW1A 4MKIA 1RRPA 3HU1A 2OM2A 1XPOA 3ICEA 1GNPA 1NN0A 1AN0A 2VHTA 1RZ3A 2R6AA 2ZI6A 3CNLA 1IN8A 4I99A 1HTWA 2FFBA 4NU0A 4JVLA 3JZAA 4W5WA 3VR2A 3W34A 2Y8EA 721PA 5AUNB 4RKEA 2QP4A 1Z6YA 4XOIA 2C78A 2HV8A 2ZI9A 3W3ZB 2OESA 2BJVA 3QPUA 5HCNA 1J8YF 5KDDA 5HPYB 5FI1B 4PC7A 5CM9C 1NBMD 3SC3A 4PHGA 4ACBA 1J8MF 4NCIA 1CJTC 2W6JA 1U81A 4JT2A 1KSHA 3B85A 2O8EA 2GVZC 2CK3D 1XEWY 3CPEA 3GQBA 2O0JA 4A0FA 3TW4A 5BN4A 3NBYC 5FOWA 3LXXA 2IUSA 2NGRA 4DEYA 1QBKC 3K9NA 3PV0A 1L4UA 1W4CA 4N0EA 3TR5A 2A78A 2J7KA 1UBCA 3LNCA 1CJUC 3B9PA 1KI2A 3MAAC 1KY2A 1ZVQA 4M1OA 1E2FA 2VL7A 3EASA 4LX0A 1MRNA 1HE8B 2LCFA 2FE4A 2WAXA 3BK7A 2JLXA 2VSXA 4Q7JB 1CRQA 3KXLA 4OQXA 2VEDA 1LNZA 3FWYA 4ZCLA 3UXMA 3VMFA 2ORVA 4KSCA 3OIYA 4DRZA 2ODEA 4M1KA 5DHAA 4B6EA 5JLJA 3Q7QA 1AS3A 1DO2A 1E6CA 2RGBA 5DI3B 3EAQA 3SYLA 1LW7A 3X1DA 1GNQA 3TAHA 2O8BB 3TVDA 3K0AB 4GOXA 3SBEA 1HYQA 1VCOA 2CE7A 3C4JA 3LFUA 3RRZA 3LBHA 1OT3A 2WWGA 4TSFD 3UMFA 4WZ6A 4ZDIA 3THWB 1X8LA 3KTAA 3NEYA 1OXXK 4M9ZA 3U4QB 3A4NA 1YZKA 2O0KA 4M53A 5JS8A 3D6TB 4BRWA 121PA 1Z47A 4LJ7A 1SVKA 3EPKA 1G8FA 3EARA 4MDEA 2ZE7A 4LJ6A 5GVSA 1JECA 1WB9A 3D8BA 3TJZA 3AVOA 3GLGE 2JEOA 4Q1CA 3UANA 4DDWA 3RHFA 1ZP6A 1IQPA 3GLGA 3MCAA 1ZYUA 1DAIA 4URYR 3ZD6A 1JPNA 1GKYA 3CF2A 4LPKA 2ZS7A 3O8BA 4RZXA 4B73A 1VHLA 2ODNA 1BMFA 1ZUHA 3U44A 2ZRCA 2W2TA 2VA8A 4TMKA 4OHXA 1ZIPA 4BASA 1JNYA 1Z83A 1VYUA 3K53A 2OEPA 3T06B 4D26A 1Z6TA 2KBEA 3BS4A 3DVLA 4B2IA 4LBVA 4XWAA 2PCLA 4RKFA 1KAGA 1YZGA 2C98A 3BORA 1U98A 1KI6A 1TF5A 1W1WA 3GEEA 3MMPA 1UM8A 2FEOA 4HB0A 5KPJA 1G8GA 2QSYA 3G5UA 2CLSA 2GCOB 3O8CA 4HDCA 2G6BA 3MWKA 1JR3D 1JEEA 4NMMA 5EP2A 4AYTA 1QF9A 1XXHB 2OG2A 2IYWA 3DL0A 5AR1A 1J90A 1KI7A 4JLVA 5CLLA 1IN6A 1YR9A 2QNRA 5AJXA 3TUZC 4MKGA 3BD9A 2DFTA 2JDID 2QENA 1E2LA 2EWWA 3GCGA 4JLOA 1G3MA 2NO1A 1E69A 3QUSA 2KBFA 4AG6A 4YDSA 3RS3A 4Q9IA 5CIWA 2AD1A 1P9WA 4QGAA 1OXUA 1PUIA 2C96A 2ERYA 2ZJYA 1R2QA 2JIZA 1JPJA 5EJEA 2WMNB 1GDDA 1CKEA 4Q9LA 1Z3IX 4F4JA 1NP6A 3RSOA 1MH1A 2VP6A 3LO5A 3Q72A 2PJRA 3GEHA 1G21E 3IKJA 1HQCA 3TAUA 5F9HA 3P4XA 2W2VA 2QORA 4A6XA 1P2VA 3QSYA 2IC5A 2NOAA 4I4LA 4Z1MD 1SVIA 4V02A 1XCGB 4JZKA 4EDHA 1A5TA 3AGPA 3HYRA 3PCRB 1VCNA 2VHJA 3EPLA 2YINC 2AX4A 1W0KA 2NZ8A 3AH8A 4G1UC 3OHMA 3WMFA 3X1XA 3VX4A 2QRNA 4AKIA 1N6IA 2QU8A 2AHOA 3CR7A 1G8HA 4ZI3A 4AC9A 1X6VA 2HDNB 1E9SA 3VHLB 3U6KA 3AF4A 3P26A 3QXJA 4OBEA 4QG7A 2YZ2A 2GCPA 1E9AA 3A4LA 4Q9KA 1HUQA 1W44A 2ZJBA 4KV9A 4Q7MB 3ZJYA 4MKHA 1W46A 3Q3JB 4A2WA 1M8PA 5BN3A 4EAQA 3AVQA 3KX2A 2R65A 2HUPA 4JYCA 5AK0A 3LW7A 1Z2AA 4ITRC 2IWHA 2W0MA 1XD8A 1NMZA 2FF7A 3K8YA 1GVNB 2JGNA 2WPDD 3CLVA 5EZ6B 3HYTA 1UDWA 4L15A 3SQWA 1UKYA 1JAIA 5FTLA 5FL7A 3C5CA 4OI4A 1U8AA 2WKQA 1U8ZA 3KFVA 3QQ5A 3B2EA 4CEIB 1K6MA 5B58C 1TNDA 2BDTA 1M2OB 2HYIC 3ADBA 1F3OA 1ZBDA 4BRUA 4IVPA 4TWZA 4LI0A 2X1VA 2QMEA 1Z0IA 1TEXA 3OE7A 4HYYA 4E5UA 3MWYW 2Z6VA 1W48A 1VECA 1YZNA 5EXTA 2YC4C 2QI9C 5IK2A 3TH5A 3IQXA 4TYQA 1MV5A 4S2EA 3FHTA 4M1WA 1IM2A 3IHWA 2HLDA 3SE0A 3T5DA 1S1CA 3IIKA 3TK1A 2IWRA 4B6FA 1SVOA 3R8FA 3GMTA 2AN9A 2REBA 4DJTA 4M9SA 4FXPA 2PL3A 1HT1E 4XSHA 2ZUBA 4RD0A 1AQYA 4ZDJA 3UG7A 1IJFA 3CM0A 3OEEA 3M1IA 1E2QA 3B8HA 4RFSA 1Q3HA 5LPNA 1W2HA 4YDHB 2ZU0C 2ZAMA 2J7PA 2ZRFA 1GL9B 2J9RA 4EPVA 1UEIA 2EWVA 4LC0A 1VHTA 1PLKA 3TE6A 1WA5A 1DAGA 2WOOA 3QI2A 4TL6A 1E1RA 3AF1A 3SYKA 4TMWA 1W49A 1S8FA 2XZOA 3QVVA 2CL0X 5DI3A 4DUGA 1J2JA 4PO9A 3TGPA 1NVVR 2RAPA 3Q5DA 5CYPA 1AKYA 1X3SA 3LAWA 5EE1A 2RB4A 1B0UA 4X8MA 4CZ2A 1KO5A 2O8BA 3K0AA 1MO3A 4BLQA 3FGNA 1N6NA 5JJIA 4CVNA 3THWA 1CLUA 4XSGA 1G7TA 3U4QA 5F9FA 1ZW6A 1T8TA 4V03A 4B33A 3VQTA 5FUYA 1YZQA 2HT6A 3GD7A 2ZRPA 1N6PA 2GJAA 2WJGA 3CPJB 3UK6A 1NI3A 1YHNA 1ZM2A 2OCPA 3B82A 3CF6R 1P7CA 4A0GA 1SKYE 2V1UA 4Q4AA 4XH9B 2VPPA 1W4AA 3T12A 1K8RA 3A6PC 4XTCS 1ZJ6A 3TSWA 1YQTA 2H16A 5E3HA 5E95A 5KNDA 3TW8B 2CVFA 2CVHA 3QF4B 4FWIB 2OUKA 3P1JA 1G3RA 1W4RA 4ASUA 4BE7B 5HE8A 4QC2A 1NBMA 1VCIA 1RRGA 2GJSA 3E1SA 2D7DA 4Y0VA 2CL7X 5EXXA 4BUJA 4JL8A 4UXIA 4PFSA 3CH4B 3FHOA 1KKMA 4NYMR 3EWAA 1AS0A 5KOYA 2CK3A 2WV9A 3MJHA 2BEKA 4G5QA 1XFAA 2E1RA 1GAJA 3EZ2A 4O2RA 4YMSA 1UFQA 4BLSA 4B35A 1MO4A 4XWKA 2I1QA 4BPBA 3GJ3A 4NBSA 1XPRA 2GCOA 4Q18A 3KKPA 3W5JA 1XXHE 5FH9A 1WE2A 2OO7A 3AKCA 1C1YA 3SNHA 1T8UA 4EUNA 2XITA 2QT0A 1GILA 1FUKA 2OFXA 3RAPR 1XXHA 4BQSA 3G82C 1VG8A 2PEZA 2AFHE 3UWKA 1AJEA 3KKOA 2D3WA 5DO9A 2WWXA 3I3SR 1F48A 4JBWA 4KYUA 4LJ9A 3OIVA 1G7RA 4P4TA 3R20A 4IOKA 2ZVQX 2X2FA 3BRWD 2NMVA 4GDFA 1DOAA 2BV3A 2O8FB 5C1BA 3ZVMA 4OHWA 1E2HA 1E0KA 5KDOA 3AM1A 5TMPA 2MMCA 1J99A 1YR8A 4RY2A 4QHYA 4TSFA 4DDTA 5KNCA 2O8CB 2RKOA 3FVQA 4TZ6A 1E9BA 1KO4A 2AKYA 2QTVB 2Z4RA 4RCZA 4POAA 3WHLA 5EE9A 2CHGA 4CT4B 3ONWA 4CGZA 1T4GA 2WZQA 3WMEA 1CP2A 4MGKR 4B2PA 3RRNA 2A5FA 4UNSA 2ZRLA 1VIAA 3KJEA 2C5LA 1BMFD 2WVJA 2J0SA 4O0MA 4ERNA 4EPYA 1T9HA 1E32A 1WRBA 4PC1A 3VU9B 2A5GA 3PUVA 3E5HA 4IXNA 3VR1A 2GILA 2GZAA 4CDGA 2V1XA 3DZ8A 1E9RA 2XSZD 1QRAA 2FSFA 1GNRA 3BERA 2VQSA 4BWYA 4TYNA 1XCPA 1T5IA 4JLJA 2QY9A 4P4SB 4Q1BA 1FW6A 3ZYCA 4U5XA 3I5XA 3VAAA 4CRWB 2V55B 4WZBE 2WAYA 3WNBA 3M4YA 3W8RA 1LTQA 3QNUA 3C16C 1ZNXA 3OAAD 1S2MA 5IHPA 3KB1A 1E2PA 3BB4A 4HI0E 2WJVA 3K9LA 3K0SA 1NJGA 1II9A 4D2IA 3GFTA 5DN6D 1JR3A 2J1LA 5BYKA 5KTYA 3AVYA 1Z0FA 1A1VA 3C14C 1W0JA 4NYJR 4ZKDA 5UKDA 2FG5A 5D3QA 2CL6X 1E96A 1XPUA 4QFMA 1OXSC 4YLGA 3AVWA 2JDIA 3KDSE 4JLNA 1AS2A 3PUWA 4XD7D 1E2IA 3I4LA 4TN1A 1JJVA 5LB2A 4BFUA 3CX6A 4DLXA 2FPMA 1T91A 2V6IA 3BFKA 1OFTA 2FSGA 4Q1FA 2J87A 5G3YA 5CB8A 3CR8A 3B13B 2NPFA 2ZRHA 5EQTA 1S96A 4JS0A 3OIWA 1N0UA 5HR5A 5P21A 3I32A 1G5TA 1GL7A 1SXJB 4HLUC 1HEIA 4GNKA 3L0PA 1XZPA 3Q9LA 2H57A 2IS1A 3A8TA 3U7GA 3CIOA 1II8A 2GJKA 1EXMA 2FGJA 4C4PA 3QBTA 3GJ7A 1E0JA 4UKDA 2ZE8A 1NIJA 1R0WA 4AD8A 2FFQA 4D6PA 4WZAE 4JT4A 4R2IA 4HAVA 3W90A 5LDDC 2QL6A 4M9QA 1G6OA 5JJLA 4Z1MA 4XVQA 2JAQA 2EVWX 2IYRA 2ZIAA 5FPSA 4DDUA 3OZXA 1RRFA 1FOEB 3MLEA 1GIAA 1EK0A 3T34A 3I8XA 2BM1A 221PA 1KDRA 3RDPA 4JIMA 1BH2A 1G5PA 3ASZA 4C0HA 4WAUA 4Q1EA 3V00A 4EIWA 4WXPA 1XZQA 5A4JA 5J40A 1II0A 4B34A 3ICQB 1P60A 3MSXA 3FMIA 3NEJA 3SU8A 3WRXC 3MWJA 3RS7A 4DLYA 3PEWA 4F92B 3ZGXA 2FNAA 4I1OA 1NLFA 1WP9A 3S1AB 3REFA 2OAP1 2C95A 1DAFA 1UDXA 2AXPA 2W58A 1HURA 2WSMA 2ODBA 2QZ4A 2RCNA 1AZSC 2HEIA 5DI9A 2C9OA 4OL0A 1GKIA 1VKJA 3TKLA 2Q9CA 1N0VC 5CJ2A 2FX3A 4PQFA 1US8A 1WXQA 4G5RA 4LC1A 1OHHD 4OYHA 2W0SA 4US2R 2OHFA 1IN5A 2D74A 1AKEA 1E1QD 4Q02A 2ZUDA 2Z43A 4FMDF 4E07A 4OKSA 4EPXA 5A5GA 2WPDA 4PQRA 3NDBB 1ZAKA 1XMIA 4LUCA 3O8DA 4Q4LA 1OB2A 4BLOA 1GG2A 1OW3B 4PO1A 2FWRA 3VNUA 3H0KA 1Z06A 3BFXA 3H1TA 1NY6A 2ATXA 3GFPA 3LH5A 3NBFA 2ZYTX 2W2XA 1TQ4A 1XTRA 3HR7A 4OK6A 2BCJQ 5CDFA 2RGXA 4IXMA 4ZI2A 3OFND 5DH9A 5B30A 3QIAA 5IK2D 2NZJA 3QF4A 4B44A 1W2GA 2DWQA 1PLLA 2C9YA 2YOHA 2ZRDA 3IEVA 1BKDR 1J7KA 1VCMA 3RC3A 4X8OA 1IAQA 3TBKA 4CIDA 3T61A 3AKEA 2HF8A 1OV4A 4MRVA 3M0EA 1UADA 3P20A 3OEED 1QHGA 3FTQA 1G5RA 2VLIA 5JRJA 4EFMA 2QAJA 2FPLA 4DVGA 5JHGB 2X77A 2ZJOA 2G0TA 2J0UB 3X1ZA 5L8VA 1XEWX 3ZQ6A 2ZPTX 2XTMA 2QMOA 1GM5A 3TLXA 4US0R 5EXPA 1ZINA 2J7PD 1FUUA 2A5DA 3CRVA 4JL6A 4OQMA 1DG3A 4ZIRA 3LVRE 3Q5EA 4LBWA 2MSEB 1KJWA 5KNBA 2OZEA 1S0UA 2ZR9A 1NY5A 2ZSEA 2WSSD 3U3RA 2PBRA 1YRBA 5BW8A 4LHVA 1NVUQ 2PLFA 1GKUB 5JEEA 1I4DD 4TQUS 3IBYA 4EJSC 2XOKA 3DEFA 2ZI7A 1DARA 5FPHA 2IF2A 4DSUA 2N42A 3U2QA 3TSOA 4KO8A 1K5GA 2O8FA 1XRJA 4TTPA 1X1RA 2QT1A 1XJQA 3RABA 3GJ6A 1PVOA 3JVVA 4FI3C 3F3YA 3J81k 2J0VA 2Q6TA 3QEOA 1EFRD 2A3RA 2VIIA 2YWGA 3T35A 4GP6A 1TADA 5IT5A 4F91B 2O8CA 5JSZB 3HPQA 2H8KA 3WBKA 2JJ2D 3UPUA 1XEXB 2SHKA 2WICA 2XTZA 1XMSA 2A7QA 2FEMA 2ANBA 5J4LA 4LBZA 5KSYA 1UKZA 4QNRA 3CBQA 1G6HA 4DIDA 1E2NA 4F38A 2QGNA 2PCJA 3WYFA 4M9XA 4ASUD 4BFTA 4FCVA 4QM7A 1PJRA 3RS4A 4EJSB 1QHXA 1G16A 3MGCA 3VU9A 2TMKA 1FP6A 5JCPA 1ZMXA 3H84A 1FNNA 1N6OA 2ZRNA 2ZJ2A 3RANA 4HUTA 1CR2A 5JS7A 2RGGA 3QXXA 4OI1A 4JVSB 4QJ5A 4P4SA 3GPLA 4UNQA 4Q9HA 4BZPA 2BWJA 3WMGA 3F0TA 4HUQB 1R10A 4Z54A 4BGDA 3EPHA 1TX4B 1GUAA 3U3OA 1YKSA 2WHXA 4F7WA 2LKDA 3FMPB 3N2IA 5IDVA 3CH5A 1T3LA 4JLDA 1U99A 1EFHA 3SJCA 1A2KC 1NSTA 4HZUB 4LGMA 3CPHA 2IS6A 4CYMA 1E79D 2P0EA 2VTKA 2BMFA 1U2RA 3B5JA 3LXRA 3ZLJA 5A0FA 3EIEA 1R4AA 3ECCA 3BH0A 5GJVC 4DSOA 2AR7A 2GJ8A 1XD2B 2I4IA 2REOA 5EXSA 1SXJE 3FKSD 3KQHA 4DCVA 3GLIE 4HZIA 4PPNA 1OIXA 3IIMA 1K5DA 4EPWA 1G9XA 4RVCA 4QHTA 4A4DA 5FFMA 1Z0DA 1CR1A 2D2EA 2D62A 5DNYB 5HCIA 2J46A 3PVSA 4L4UA 4M1MA 5JJKA 5HZKA 4KYIB 3AF3A 2O5VA 4ZPXA 2BBTA 4BEBA 1KZ7B 4PPGA 1P2TA 2FOLA 4OQLA 1ESNA 1VYVA 3EC2A 3LQQA 4YMWA 2VP9A 3BOSA 4C0LA 1SKYB 4LJ5A 3UMRA 2RHMA 2ZEJA 4AK9A
chains in the Genus database with same CATH superfamily
1ZGAA 2PMDA 4HDMB 4XFDA 2F4VB 2ZSAA 1N9KA 5ALGA 3JALB 3Q8KA 5JCJA 4QQ8A 1Q7BA 2CEKA 4HLQB 4TV9F 1X3LA 5EERA 3DOJA 2APJA 2ZQ5A 1LLCA 1PVDA 3L43A 4Y3UA 4DKJA 2BT4A 2JLBA 3G17A 4H59A 4E12A 4EUHA 1N4DA 2ID7A 2H9YA 3IX7A 3NWJA 4FNOA 4LJ4A 1DV1A 5AYVA 3TRJA 3GLVA 4AZVA 4TWIA 5I9BA 1U9YA 2ADOA 5C9ZA 1FU4A 4HLUA 1U3GA 2ZWAA 4QICA 4Q47A 3ZD7A 3CSSA 2UYOA 3PTLA 4LJ8A 3KVOA 4QE3A 4C9BA 1YS1X 3IBFA 5HKKD 5LP6B 1XTQA 4G5YA 3N70A 3BTUA 2BTQA 1V7PC 4KRGA 2UDPA 4ZGGA 2PVSA 1ONNA 2W2LA 2BM0A 3ASVA 3GOHA 5HZHA 4H16A 3IV9A 3I4FA 5H68A 1PU2A 3P2KA 2XGOA 5K0JA 5FWYA 2PUVA 3OLQA 3L6OO 2BUCA 3HCRA 3MWEA 3OAAA 3AEZA 3ESRA 1L5LA 4V1CB 1U2TA 2V7VA 2WIAA 3SQMA 3NNDA 5B7PA 1M76A 3ZWYA 4IRUB 2ONKA 1U2PA 1DWOA 1ZLYA 2LE0A 5KHOC 4F8JA 5EZ5A 2FSPA 2VUTA 4D0SA 4M1YA 1O57A 1VLHA 4EMUA 1SHZA 1KC1A 1M1NA 2WOJA 4R71A 1PJQA 4XD7A 4MARA 3BMCB 2W2KB 3MB8A 1H4SA 1VG1A 3QBVA 3QGMA 2ZYHA 4OJQA 1ZD8A 3LIIA 4R1NA 4RA6B 1VC2A 1ZM3A 5CEFA 5FV7A 4ETIA 4DLWA 2DCMA 2CBZA 2GKGA 3I2IA 2CLIB 5IC6A 4H15A 3VYWA 3ISVA 4KQEA 4Z2YA 4I1UA 3Q3HA 5ICEA 2EGGA 2QAGB 1U5BB 4XAQA 3R9IA 5ALEA 2CBGA 4BV3A 3MD9A 4ND8B 1Y6FA 1TQ2A 3VDMA 2VJKA 3RVKA 3QOFA 3F8TA 5EP4A 4FFPA 2HSGA 4L9SA 2IYXA 4RCYA 5EJ4A 4K81B 4DBVO 5B6PA 2P9ZA 3MJVA 4LWZA 3NIDB 4Z2AA 4KQHA 3WO0A 1WB4A 1Z6AA 3OCZA 2PYDA 1HZJA 2A2ZA 3QVGA 5J4YA 2HREA 2O7QA 4S0XA 1A9TA 3JSAA 4CKEA 2IH5A 4DT1A 1I2DA 1KYZA 3EG5A 2QIPA 5D1HA 2SECE 2P9JA 4GKAA 3V6LA 5LOVA 2IVZA 1DADA 2FYTA 1UWVA 2FKNA 3M33A 2R96A 3PXDA 3QENA 3SLGA 1ML4A 3I72A 1NC1A 3B1VA 3KP1A 4YS6A 5A1JA 1L6IA 1EXNA 4KBFA 2GCEA 1EDDA 3UUFA 2FUEA 2JVIA 2ZRAA 1P5JA 1P2DA 2Z0MA 1B6GA 2BFCB 4L7QA 4F4CA 3FTPA 1DPFA 1OFUA 1HDGO 2ADMA 3QPAA 1Z4OA 1KKLA 1XU7A 3VJKA 5KTOA 3HWSA 5BOSA 3K71B 1ZJZA 3H13A 4R8MA 1YQUA 2W4QA 4YAOA 1PJAA 3VXKA 2I34A 1EQ2A 1GYRA 5F7JA 1NKSA 4GGMX 1Y7TA 5THXA 2CVQA 3PRJA 4HXGA 1PO7A 2IEZA 5ECWA 1R4MB 5TVGA 3OZBA 2IA5A 3SKVA 1YZYA 2R68A 3OJOA 1HT2E 4D74A 3UGJA 1W8IA 3CVUA 2FRXA 1C9MA 1YGPA 1E77A 3I61A 3RS0A 2PT5A 1BRMA 3JASB 3TFWA 4UDOA 2RGYA 4JLUA 1X70A 2B2CA 4EVRA 2A94A 2MR6A 1FDUA 2BAGA 5EWLB 3DE4X 1GD1O 2JATA 4PYJA 4CKWA 3L8DA 4FFRA 1Z5GA 4PHTA 2JCBA 4NCKA 4Q21A 2AFIA 3UPDA 1DCFA 4NBKA 5A04A 4N5NA 4Q5IA 4A2QA 1FIUA 2F1OA 1J8FA 3MOGA 1U0GA 3LP5A 5JQGF 1N2CB 2YOFA 3ND6A 4MA0A 5BQXA 3WYCA 1K6IA 3T3EA 2Q5FA 4C3VA 4JU9A 4Q01A 4JOCA 4N03A 2XV1A 4RLQA 3ZKWA 1X8JA 4Y8VA 4EJSA 2QWXA 3JS5A 1E20A 1ITZA 3F6YA 1DQRA 2BSAA 1EX6A 1Z6PA 3MTAA 4JHLA 4RJIA 4JROA 1E6MA 1T6XA 5BYJA 2WTUA 3DZDA 1AKNA 3H8JA 5IHXA 1JQKA 1KRWA 1VSVA 1U0FA 2P0YA 3PS9A 5F73A 1ZM4A 2FG6C 5HF9A 1DG1G 1X1AA 2QN9A 4LXIA 4DLTA 1P4HA 4UASA 5L40A 2HHCA 3AYXB 2V58A 2WJZB 1WKBA 3IJRA 1KYVA 3JQAD 2G5TA 2A1IA 2JAOA 4IDOA 4N8EA 1EE9A 1R5OA 3LKBA 3IBCA 1K98A 9ABPA 4BJ6A 5GV7A 3RFVA 1BTOA 4KIJA 3I1FA 4O4JA 5T41A 3TTYA 3O47A 5IVKA 4B6SA 5FA8A 1ZRHA 4ECAA 1TU4A 2Q5CA 3KUCA 4N49A 1TJ5A 4BWVA 5IS2A 4NKRA 4PYKA 2QRVB 2B2NA 3I9LA 4Q3AA 2PFGA 3WIVA 4P3KA 1DAEA 2XOKD 3IPAA 1ZIYA 1X80A 4Z51A 2DYKA 2EW8A 2EYQA 4CLEA 2NLOA 5EGSA 1ZEJA 3TLYA 3CW8X 5MN4A 4RA9B 2YW9A 3COSA 1A8UA 1SN7A 4ZTBA 3EZFA 1Y9DA 2OSVA 4PC6A 1NF9A 4WT7A 2OD2A 1AB5A 3IJPA 1N4AA 1OF1A 5CDHA 2FUNB 1XDDA 2VJMA 4N5MA 2NUTB 1VYHA 2CNNA 5CNMA 2AKEA 3AERA 1SBZA 2WKRA 1TEVA 2X15A 2QZPA 3Q88A 5TDHA 5JD6A 2MT9A 2G82A 1G6Q1 2GK7A 1GQYA 2WT4A 1CIPA 1MO6A 4QEZA 1KBQA 3P9IA 2ATIA 3SZMA 3TPFA 2DFDA 1ZUNB 3DC2A 4X9XA 3P9PA 4IH9A 1Z12A 3R5XA 3KAPA 3BH7A 3V8PA 1GGFA 1XD9A 1T4CA 2P78A 2VPYA 1E5QA 4GZLA 2BZGA 4ZYXA 2FFAA 5REQB 3WK9A 3WLAA 1N5JA 4OH1A 4XVHA 2QI9F 3HI4A 4K7JA 4TS1A 3V8RA 1SG9A 1I8TA 4NH0A 1LVHA 4TRRA 4KK3A 3O8RA 2HQ1A 2AZMA 3T5GA 4FHGA 3NWOA 4BIMA 1JEQA 4BFVA 1DBSA 4ZZIA 3T0GA 2G1JA 5KKCA 3CJQA 4BNTA 2G9VA 4X1IA 4CPDA 3FYHA 1V26A 4O6VA 3NWBA 1SUPA 3NQ41 4R7GA 3QOXA 4D25A 3IXMA 3B3GA 2LKCA 3TZEA 2AJTA 1EVYA 2GI4A 1S2OA 3PGMA 2BGIA 3KL4A 1JG1A 3AUUA 3EGWA 1Z18A 2CNBA 4UBLA 3EEOA 4KWHA 3MMSA 1QZXA 4KGXA 2VDLB 1NDQA 4LK3A 1HPLA 1VMAA 5AVJA 4IILA 3OC6A 4RHEA 1GZ6A 4DBLE 4Q7KA 3DTNA 3LQYA 2A9FA 4ZVVA 4G26A 4DCCA 2HBZA 3BXFA 1F2TA 1GLNA 4L9AA 3PA6A 3A04A 4O5OA 4ZV7A 3R9WA 2MSNA 1Y9AA 4FZRA 1GL6A 5K7SA 3MS2A 1R0CA 1A9QA 1U8TA 3GPDG 1TFUA 5CIQA 4ABYA 5AESA 4PLFA 3O83A 1ZZEA 4DQUA 1UKBA 1JIQA 4BO6A 5M04A 3QXCA 1YK0A 3KEFA 2BMJA 3PLNA 4JWTA 2H08A 4RZHA 5P21A 4CE6A 4CQNA 1NWHA 3WQSB 3DNFA 4EYSA 3G8BA 5BSKA 1WDMA 4ZZ1A 1ZNQO 2QR2A 5AUPB 3A11A 4X66B 3ON5A 2WVHA 1E79A 1YB2A 3Q1LA 5FOUA 3V97A 1APBA 1XTTA 5IVHA 4X62B 5DNAA 1UF9A 4B7ZA 3B6ZA 1D0VA 3L7NA 5LQSA 2IGTA 2OC9A 3LX8A 2Y0PA 1UPAA 5EP3A 4HB2A 1Q1EA 4CM5A 4WLEA 3AR9A 3TAXA 2OBLA 1N1GA 1PQUA 4WUVA 4GMXA 4IIVA 3VHXB 5KJCA 3PNMA 2A9VA 5TPWA 4FOTA 4EA8A 5EJ6A 4WL0A 3HM9A 4QM6A 1PT9A 4G2NA 4OHYA 2B4KA 2JLYA 3RO7A 2LVBA 3DL4A 4OYYA 1DFIA 3I64A 1ODIA 3KALA 4RK6A 1IAVA 3W0LB 1FL9A 1BEUB 3GUYA 3GHHA 4C08A 3N0RA 2Q5EA 2Y3IA 2P0AA 1JEJA 3EQ7A 1SU6A 2QMZA 3KXKA 4M60A 4MCIA 2O3QA 1GV0A 1ODSA 4QEDA 4HPWA 3EULA 1E6LA 4LXQA 5K4AA 2N75A 2DR3A 1L7BA 2OYSA 2AW5A 4CCYA 5FOQA 1KRHA 2R85A 3FYUA 4KMSA 2PSFA 3JQ6A 1E7MA 1H2FA 4UULA 1YI8A 5NULA 4DV0B 1FUIA 2YXNA 3CC8A 4B3FX 4LHSA 3KPUA 4GOOD 4RAQA 4OMUA 1E9EA 1N5MA 4RUKA 4UAJA 4YTEA 4PG8A 4FJ1A 3MT9A 1UT8A 3JWPA 3KSBC 4X92A 2OFWA 1YSCA 1TTTA 5EINA 1AHPA 3VR0A 2FA9A 4K3UA 1XYGA 4Q4DA 3SK0A 4HWTA 3PGLA 4KX3A 4OQEA 4WZBA 3DH0A 2JFZA 1IUNA 2CNLA 5P8WA 4ACAA 5ICSA 4AAYA 2J6IA 4B74A 1JYEA 1GOTA 1XLTA 4REQB 2ZTVA 3TVTA 4YXWD 3NHBA 2Q8PA 3AY0A 2VDNB 4HK4A 4L9WA 1J2YA 1BW9B 5JOQA 4BGUA 3H5TA 1E4VA 4GZMA 4ITUA 5DE3A 4IV0A 4DN6A 4UEWA 4DHWA 3ENVA 4UCWA 1W88A 4P81A 4ZTUB 4M98A 2IDMA 5CGQB 3ABIA 3UFBA 3MWLA 4AFNA 2DKFA 1V11A 4UHBA 1RM3A 5EKDA 3MG9A 3S2IA 1D9XA 2D1RA 3SYRA 4LXHA 5BYBA 2CJWB 1U31A 4OGKA 4P84A 5A3QA 3C5WP 1BWPA 4C2UA 2BE7A 3U0VA 2R1UA 2OFPA 2WM8A 4FGZA 4MW1A 3TM4A 3UJ8A 4F5ZA 2CLFB 3GLIB 1G42A 2C9MA 5CVUA 1P0MA 3H7AA 2FSHA 1R6DA 1T34A 1KZGB 1ZK4A 3H2YA 5K8UA 1TLFA 2FR8A 4C7XA 3TPZA 3NHRA 3OQOA 2H2DA 2DH5A 2NNWB 3GI1A 4XM1A 4BTLA 1WHSA 2EL9A 2P30A 3OPVA 1HMPA 2CXPA 4O4IA 1R5BA 3UCXA 2TMDA 1FFGA 3ZY6A 4TWAA 5K8JB 2HF9A 2XW6A 1VJTA 1U80A 2EZ9A 4IGFA 2JCVA 4IIYA 3FGZA 4JJ6A 4JX9A 1T10A 1ZCZA 3QPVA 2BEUA 4R40A 4Z1OA 1VIVA 1J21A 2F43B 4CUZA 2PS0A 3K4HA 1I5RA 2G63A 2O19A 1O77A 2OXTA 1GRNA 4QECA 3AVVA 4V38A 3T5AA 2O3UA 4BCCA 3WLLA 1ORIA 3DDZX 1XELA 3F5FA 1W36B 4KXFB 3WDKA 5JSKA 3H2IA 3HRIA 3ORSA 4QWMA 4Z0NA 2ZYDA 1MJNA 3MGKA 4OHUA 4EB8A 5CDYA 2ZRBA 3E22A 2JZNA 3LU1A 2E89A 3NGXA 4YRMA 4JYBA 3T3DA 1RPAA 2V5VA 2W6MA 2GK3A 3JD2A 4QBHA 3RLFA 2IEAA 3GROA 5DISB 3AP2A 4CMAA 3FPCA 3VR3A 1GV1A 1OFGA 1QFSA 1DQNA 2G07A 4P08A 3BFJA 2ONJA 4CM4A 3CYFA 4CUJA 2AK3A 4GI1A 1G7SA 2DHCA 4X20B 4QBKA 3VKWA 2E2WA 4YB8A 1CD5A 2IYLD 2XUAA 4EW1A 1XQ6A 1KMMA 1Y0BA 3H16A 1CDDA 2WSBA 3CE9A 5E6UB 3T94A 4BO0A 3BE8A 3MXTA 1SEPA 5LA6F 4RY8A 4Z9BA 3OPNA 5EJ9A 1PEKE 1HXHA 2EXXA 3DR5A 3FPBA 3ROTA 2JBAB 1AGRA 2EFYA 2WU1A 3JAKB 1FLNA 3OPXA 4RIEA 4S12A 2RGAA 4MV9A 1LDYA 1NKTA 1UUFA 2E4UA 1LWNA 1YH3A 4IIBA 3T3OA 2PVCA 2QVYX 3WLRA 1UMCB 3W78A 4NESA 2B2XA 2HU2A 1MO5A 2YKGA 1JBQA 2AK2A 2CJXA 3GBVA 1DO0A 1BYIA 3D8SA 1YFJA 2PSSA 1EZ4A 5E4TA 2VTBA 2BGLA 3AINA 4LV5B 4TT3A 4MPJA 5EYPA 4KAJA 1N2JA 3A6JA 3O0TA 4AJ9A 2G6TA 2X58A 4RTRA 1N34B 2GD1O 4RNCA 1TPZA 4Q37A 2C3UA 4NCHA 4QPJC 3UCFA 2JGDA 3O7WA 4CF5A 2NADA 4L8YA 1QIIA 1T2DA 2JGEA 1X7WB 1BVHA 1NE2A 1U8CB 2CUKA 3GO4A 3JQFC 4NNJA 5AW7A 1PT7A 1JQDA 3WAKA 4LGYA 1YS4A 2YUIA 2PAAA 2YJNA 5CITA 3CEJA 1QOZA 2VHXA 4OAQA 1G59A 1QWSA 4ARSA 4G65A 3ETJA 4XXHA 2HMVA 2QJRA 1TAQA 2ZXEA 2J6BA 1VHDA 5KNLA 3VDQA 1KBOA 4BXOB 3R0ZA 1M2JA 1BAPA 2JL1A 3RRYA 4C43A 3IT1A 3L8CA 4HB3A 4P3YA 2G17A 5L4NA 2Q9BA 5DXFA 1R0ZA 4EABA 1XWWA 4CM8B 3F1KA 2FOIA 2WWFA 4WNCA 3CKKA 3PDIA 1QGZA 1T9GS 1OXTA 3CN9A 5I9TA 5JZMA 1GPNA 1Y1QA 2WHQA 4P82A 4W9MC 5CM8B 2O7SA 2ZB2A 4FMCB 2J5XA 3LC0A 4M1SA 5DYIA 3VR5D 2IXTA 1W7AA 1O0CA 4PHFA 1QG2A 3WWEA 5AVOA 1CUYA 4U2GA 3MTJA 2QQ0A 3STTA 2F8TA 1SBNE 2OE2A 2ZSUA 4C01A 3NHAA 4XPIB 3WXMA 5EIBD 3KPWA 2C9ZA 4XWOA 4DWJA 4CR8A 4BDTA 4D41A 4FB5A 1HL7A 4CMHA 1KY5A 2RJNA 3NHWA 3ZW9A 3IURA 1LUAA 3EDOA 4Z4EA 4YUZA 4RTOA 5A7HA 1TTPB 3GUCA 3T99A 1T25A 2XXAA 1VGRA 4RK7A 4YBRA 4P33A 4RULA 2IBSA 3T4EA 3GFBA 3RB8A 5ICMA 1P74A 2QN6A 2R47A 2CLCX 1M33A 2FMUA 1F0KA 3LZCA 2QV0A 3R3JA 5HJ2A 4BN5A 1YGYA 1YQQA 4CW7A 4GL2A 3AHEA 4QJBA 5FNZA 2PLWA 3IUYA 3ZOKA 1WXHA 1I94B 2XZLA 1ZA1A 2R6GA 3NKLA 1L5HB 5LSAA 3IP3A 3MQ4A 4EJFA 1NF3A 1MQ8B 4UE6A 3SJBA 3GGJA 1NSFA 3WWCA 5JD3A 2QN2A 4YR7A 1ZMBA 3KEOA 1OLOA 3O1LA 3ODGA 3WSTA 4YRBA 5BWOA 4C2TA 2IHKA 1TF7A 3DXYA 2HF7A 4Q66C 1H4QA 2QQEA 3FLMA 1B26A 1WMFA 3CKLA 4QQRA 4D99A 4N5IX 5H81A 1ODFA 3LX5A 4HEJA 2QSUA 4UD2A 3IE2A 4ENUA 3L6RA 4Z4QA 3EVDA 4QFCA 3KQKA 1E3TA 3CRW1 1T2FA 1GGKA 3L8HA 5CT8A 5IABA 1PJ3A 1HYBA 2PX3A 3B3AA 3LECA 3W8FA 3FJOA 5AOCA 5CX1B 2ZE5A 3WTCA 1V6AA 4TTQA 2Y9PB 4TTVA 1GSOA 1SCAA 3ACBA 4NATA 1RBYA 5DEIA 1NXWA 3QWBA 4PAQA 4HVTA 1DFGA 3M4JA 3PYMA 2QX4A 4F4IA 4ALLA 4LNUB 4JQOA 2XZTA 4Z7OB 5L45A 1EEHA 1ZK3A 3RIHA 2OD7A 3U9TA 1UBJS 2G76A 3RIYA 4OYLA 3MW8A 1XTKA 1UXOA 3HB9A 1ODJA 1XDGA 2G04A 4QU5A 1LQ2A 3SS7X 5TLSA 2J9FB 3NTXA 3REQA 2WAAA 4RL6A 5EQJB 2NYAA 1PR0A 1AK2A 3AFMA 3RNLA 2SICE 1EWRA 3RU2A 4MI6A 1TM7E 1JX6A 2YDYA 4RFSB 1SC6A 4O2AF 1SUDA 5IJAA 4CIVA 3EEFA 2AG0A 5EE3A 4RD3A 2G0NA 3ONEA 4CF7A 5HUQA 3WFZA 2VAXA 3B60A 1SVLA 1HYEA 5K6TA 1D1SA 2ZT6A 3OT1B 2CBXA 3W2TA 3TX6A 1KNXA 3RVMA 5KU1A 1KEZA 3U80A 4MULA 5GIPE 4MJ3A 3WOHA 4NP6A 2KQUA 3Q7SA 4YRZA 4TTJA 3QKRA 4U2FA 3FRJA 2KJQA 3WL8A 5FPTA 2VS1A 3LHIA 1CX9B 1JA1A 3OETA 3QKUA 4MQEB 4EG3A 4MHTA 1LNQA 2GTPA 1UBUS 1XRQA 5TEWA 3LPCA 1L4NA 2R4UA 5KWSA 3BH6A 5ANRB 2UZAA 3FUCA 4NV0A 1QX4A 3VR6A 4CMGA 2D2XA 3TLKA 4G0NA 4PPQA 4UHFA 2QL7A 3BRQA 2IHYA 3HP4A 4CWAA 3T1TA 3PHHA 5B1EA 3PQCA 4MCHA 4OQFA 3BWDD 3LLCA 2R4QA 1J5PA 4FX2A 3UAZA 1ONPA 3MJEA 1HLPA 2XGGA 4P3XA 3G2NA 2H52A 1I7PA 1Z13A 3DCNA 3IO3A 3L01A 1IG0A 3GFOA 4WKNA 4EVQA 4PSDA 4EM6A 4XWWA 4QYIA 2CHVA 2QZ9A 3OZ7A 4L5AA 1J49A 1UKCA 4DCNA 1QGDA 5HQ3B 1PWHA 3PRHA 3QJYA 1FX0B 2QG4A 4PXYA 4RQBA 3LYLA 2W8ZA 5F35A 2P7HA 1TTQB 4YAIA 3JYOA 1FRFS 2R8RA 4RGBA 1NNSA 1HNNA 3K0BA 4NOJA 1Z8NA 1Q1GA 1XQ1A 4UUQA 4XZ3A 2ZJ3A 2BBOA 3RTCA 3E0XA 3R76A 3SWWA 4JDPA 3V46A 2XADA 1U4SA 1HY3A 2UZIR 3A70A 1P1CA 1TF2A 2ERXA 1OIVA 4JITA 3DMHA 2C42A 5A7GA 2OSBA 5CTAA 2F1RA 3ZVLA 5D5HA 4EPTA 4F2WA 2YQ5A 3NOQA 4BYMA 4LHWA 3U3KA 1KMIY 3L7IA 1KWKA 4FFLA 3TW0A 2BP7A 1MKYA 1J2RA 4B5LA 4BZZA 2PKXA 2OAEA 3BKWA 3O7MA 4PSCA 3ZIAD 1R6UA 4QUGA 3HQ4O 4K1LA 5EEHA 1Y6GA 4RH3A 1JEYA 3I2GA 1ISRA 1KMHA 1OGIA 1Q0UA 5CXXA 3TI9A 3VZPA 4HV4A 2WE8A 1FS4A 3UAXA 1J22A 2H1FA 2OGSA 4KVZA 4WUTA 3GVIA 3ZK8A 2ET6A 3GELA 4PX9A 1H1LB 2OGUA 2YNMC 3EOAI 4OQQA 5IJ9A 3RJMA 3EYWA 3RV3A 1NV9A 3SHFA 5BNWA 1U7HA 4C5CA 4QFBA 3NBZC 4BMOB 1WPXA 2ZRJA 4NMXB 5KJEA 3ER9A 1XEFA 4Q7QA 4KQMA 2W5UA 4TKMA 1TUEA 4U6NA 1GXSB 1YRAA 4JQYA 5TPZA 3ZS8A 4B48A 4WFJA 3RR2A 4IWYA 4C0BA 4Z7QB 1VKHA 5CDUA 2WJAA 1L5YA 1EVLA 2J33A 2Q46A 2MMGA 1PKEA 4C0SA 3DOFA 3TS1A 1WM1A 3WK5A 1FYFA 4KOEC 4PONA 1GCAA 4WSOA 1EX7A 4Q3DA 1R9JA 3VYUB 1FK8A 3L5OA 4KDEA 4DRYA 1WAMA 4CLRA 3M82A 4DJJA 3TQFA 2IHTA 1XTZA 1YIAA 5FIUA 1CRLA 4OQPA 1MLDA 2RGNC 2IHBA 5F64A 1YE3A 2KE5A 1NVWQ 1U0OC 1V37A 2OZLA 4PPFA 3RARA 3ER8A 5L53A 2Q1SA 3JQ8A 2B9EA 3K0EA 5HYVA 4NG4A 3HCBA 4DABA 2EHDA 3UWDA 2V5AA 3SN6A 3KUKA 4LVOA 2XZPA 2GESA 1Y3HA 4RVUA 2XWSA 4N82A 5HGXA 1TYBE 4EO7A 3KQSA 3NZEA 4RYDA 3HA2A 3VYSB 2QLTA 1AE1A 1NMYA 1KPHA 2AD5A 3TCKA 4E7PA 3TGWA 1JHRA 1V48A 1HV8A 3GN2A 3M9LA 5JCOA 1W4BA 4MKFA 3C98A 2PMBA 1C9DB 3NDIA 1BIFA 3T7AA 1E60A 1R66A 4IMIB 4RTNA 1G3QA 5AM4A 5IXJA 2CLMB 3RUFA 4EF4A 4Z4IA 3RS2A 2OM6A 1KR2A 3IVXA 2JKYA 5IFLA 3QJ5A 5IDQA 4UU7A 2W43A 2XAAA 3HDGA 4Y6QA 3JV7A 2NSLA 3KJQA 4MOWA 2XB8A 2C58A 3WBJA 4EA6A 3SZGA 1DIRA 1U8FO 2SKCA 1O5IA 1GAEO 4LOHA 4AYXA 3B1KA 2M6KA 1TT5A 3HCOA 3OEWA 3QVTA 2QRUA 2BHRA 6CHYA 2P6OA 3EFOB 3EXEA 2IYYA 2JHGA 4ZODA 1Q1AA 1H6AA 1I2CA 3KJZA 4BL5A 3R74A 2BDUA 2NP6A 1TL7C 3KYDB 1HF3A 1UJBA 4M6WA 3GJYA 1PS0A 1PR4A 1KA9H 4ZEOA 4QUIA 2OV4A 3WLHA 1UKEA 1HQYE 1LJLA 3O1HB 4B4DA 5G0SA 2C8LA 1Z6XA 3WNQA 4EECA 4G5FA 4J9VA 3X2SA 4DUYB 5D5PA 1PZNA 2YIVX 4UEJA 3GEDA 4XM2A 3QE4A 5EXDA 3TYXA 7MHTA 1YQXA 2H1IA 3ZLBA 1U8YA 2PX2A 3OWHA 3C97A 3LLMA 2V65A 4POOA 1OUMA 1NM5C 1CV2A 1TFRA 1ZMTA 2QPTA 2NAFA 3HYSA 4W7SA 4E11A 1G8AA 2ZU6A 1RM5A 1X74A 3A2NA 4GZ6A 4ZVPA 1SUSA 3QVSA 1DQSA 5AXDA 3B1YA 1P91A 4AMUA 3TQSA 1GQFA 2QRGA 4IV5A 4RM2A 4F71A 5IMSA 3IQIX 1PK9A 1SKQA 1UAAA 4RF5A 4YQZA 1YFZA 4MGYR 4J1TC 3WYDA 5IM4F 1R15A 1YWGO 5FPQA 3H9BA 3UJ7A 3TXXA 3O03A 2H5JA 3BRCA 2H7CA 1VXOA 1GSAA 2R11A 3D6VA 3KQOA 5GZ1A 5JUWA 2H31A 3PG5A 1PJLA 3J81A 4IDEA 4KAXA 1H2YA 4M0LA 2AUTA 1SWVA 1ZVKA 1F4PA 2VNSA 5FI5A 4OV6B 3K1AA 3OESA 1YC2A 3JWIA 2BBWA 1MVOA 1CUIA 1RHMA 2C59A 2L0XA 2QAIA 4MS3A 2H2HA 2QSZA 4UQOA 4GX0A 4RV4A 2OO5A 5ESDA 4CV0A 4IHJB 5KQPA 1KI3A 2DY0A 1K7XB 1BU8A 4JGIA 4LDAA 1JIVA 4AJPA 2VH5R 3QU9A 4IQ0A 5ALFA 4R1LA 3JY6A 1E4EB 2ZYWX 5L7YA 1MHTA 4G5OA 2AL7A 2OL4A 2R6CA 4QPNA 5AKYA 3O93A 4LFCB 4F84A 1LB1B 1ECCA 4Q3OA 1FP1D 4IQ8A 2YRXA 2JFQA 3DKPA 4RQTA 4DOMA 1ZL2A 4ZJZA 1IN1A 1C0PA 4LXYA 1QGOA 4ILKA 2WU0A 2YJTD 4ZJUA 2R7NA 4QZVA 1ZBQA 4Y6PA 3LUJA 2WHPA 3NDPA 4KQ6A 3WGKA 2FV8A 3FPFA 2HADA 3GNSA 3L8YA 5HDBB 2XECA 4E08A 5TB5A 4PLWA 4ZYUA 2ZCJA 4XIJA 2PH1A 2CFOA 3LT5A 1J00A 3HHEA 4CQMB 1EP2B 1LPSA 1I51A 3CRZA 5JDCA 4N47A 1EP9A 3GA7A 3MUEA 2Q3MA 3PVCA 2A1TS 2V54A 3EIXA 4HAYA 5F2EA 4FCWA 3MILA 1ZQ1A 2NSJA 1KY4A 3ND5A 1WOMA 4P36A 3ZHZA 1H3EA 5CLFA 3LPMA 5JASA 4YGXB 2X9GA 3JALA 1G3IA 1N2OA 3HADA 4C22A 4DL9A 5B1IA 2WF6A 1U11A 4K2HA 2QLLA 3E84A 3HCWA 3ZHUA 2VF8A 1EK1A 4CLXA 2PX5A 3ROFA 1TT7A 1YU9A 2CFIA 2WTNA 4FMPA 4OBBA 4P32A 4TLLB 4B6PA 3AFGA 4EL0A 7REQB 5AVRA 3I2YX 5LDGA 1XZCA 1FTNA 1PWEA 1E0SA 4RF4A 4C0XA 3FTEA 1OI3A 2YWEA 5E7IA 4AN4A 4V3BA 1GPUA 2CLOB 1C9NA 3IEIA 2FRDA 2CXSA 3FHLA 4OOEA 2D2FA 3ZBTA 2WYHA 2R1VA 4NULA 2HXYA 3VTFA 3K0HA 3ECSA 1L1QA 1WF6A 4PYRA 2IV3A 4AJKA 2ZIEA 3IVAA 1M1YB 4BVHA 1DC6A 2HSJA 1U5CA 3A7DA 4IYJA 3D0OA 2ZQYA 3HE3A 4CQMD 3GIDA 2RHLA 1MTZA 4HYTA 3DEAA 1Q2XA 3QX7A 3NONA 3W8DA 5THQA 3RU9A 3GBPA 3M2TA 4FDAA 3TOXA 2E5LB 4JENA 1KAHA 4HGYA 4O4LB 4ZGWA 3RVPA 1ILWA 3V4ZA 1CUSA 2I3AA 3BMCA 3IBTA 3DLBA 4AWAA 4ZIRB 1QIKA 2NT4A 1UEJA 4KVGA 4QASA 4MRRA 4RANA 4D9JA 2E4XA 4GBMA 1RPNA 2A9OA 1QH1A 3EEQA 3NIWA 4KV7A 4QGHA 4ND5A 1G98A 3NIBA 5AKIA 1BGXT 3TLBA 1JSLA 5LD2C 5BRAA 4URUR 1NVKA 2CXHA 1KK1A 4FFBA 4H9GA 3TLMA 2ECKA 4EZIA 1TYAE 2Q3HA 1PYDA 5GONF 3CT6A 2C31A 3P52A 2VNJA 5ALXA 2QAGA 5KOHB 3PXBA 1HOXA 1U5BA 3BWMA 5LMCA 1JKXA 1H6CA 3QYJA 1QORA 1TDJA 4P31A 4UTPA 5HP4A 5HILA 1RE1A 1Z15A 5DGHA 4E7OA 2ZIXB 5AJYA 2IOQA 4D81A 3IIJA 1DS6A 4G81A 2B4QA 5FWDA 2WM3A 2CHQA 2OFFA 4ARIA 2VBIA 4J0EA 5ALKA 1S9DA 5F9MA 2QGZA 5TQ2A 1CVIA 2E1PA 4FDTA 2JW5A 4IJMA 1FXWF 1GUDA 1T1GA 1EK5A 1FPMA 4YJHB 5HQJA 3PNOA 1QHSA 4HHEA 2X1MA 2B8JA 2BGUA 4B83A 1EBUA 5BRNA 1Z08A 2G71A 1BJTA 4QBTA 3FFXA 5D3KA 2YWXA 3GRZA 3SQDA 2AI1A 1HSZA 2Z83A 4Y98A 3X2EA 1XZJA 2IU3A 5LDHA 3K6SB 1E9FA 2FMIA 3G5TA 3TLEA 4F96A 3DAPA 1NJ6A 2JLRA 5HM6A 3VC7A 5IULC 5IP5A 4FDUA 3DF7A 1EWKA 1GR0A 2WLTA 3B52X 2WD7B 3DFMA 1CZKA 1USGA 1IEQA 1V25A 2G77B 3C15C 4HFMA 2HGSA 1XV5A 4IHKA 4PICA 4OQDA 4W8OA 1NVGA 3DHEA 4CU2A 2CLDX 3QE9Y 1PFWA 4KK4A 4YUYA 5FOXA 3MGAA 4FOLA 2W70A 1U7PA 2VHWA 3GQBB 2NV0A 3KT3A 3L84A 1AGYA 1GLVA 5JPIA 3OQ1A 3HO6A 4P5PA 4EHKA 3O0DA 3BVPA 2FTKE 1KP2A 1R50A 3ETGA 1J25A 4D4JA 1T3SA 5HBGA 2B92A 1WMDA 2QMHA 3G3EA 2IEBA 1GFZA 5CW2A 3CZ5A 1NPDA 4ON9A 2R6DA 4NYIQ 4FFDA 1PEYA 1ZK1A 2HPVA 4UEKA 5EWLA 3BCUA 1NQWA 3D4PA 2Z2KA 3NYIA 5E8JA 3ZDEA 1ZIOA 1XCJA 2NU7A 4LZLA 4K9DA 3UMJA 2Q3FA 1J1UA 2GZ3A 3K8QA 2K5UA 4ZDKA 1N2CA 3UK7A 5FULA 5I7FA 4N48A 4N18A 4Y2UA 5CA1F 3HO8A 4M0KA 2Z4TA 2HIGA 4M49A 3K1JA 2OWEA 1MPTA 1VA4A 1NF2A 7MDHA 3A1UA 3IELA 3KJGA 3M4ZA 1QFXA 2X0IA 3MIZA 4INJA 3TR6A 3LHSA 2EBHX 2PD4A 3VKUA 4JJZA 2P67A 2GCGA 2OLKA 2VN8A 3LBYA 2FHPA 1UC9A 3KIPA 1J24A 2BN4A 1I3OA 1ZISA 3W5SA 4FKBA 2R3SA 3PI7A 4FWBA 2ZI5A 3AJ9A 2CMHA 3DC7A 1N6RA 4WADA 4HAUA 5DHPA 1H65A 2QM0A 5AUQA 4AJHA 3DEJA 1DXOA 1LJ8A 1ULHA 3L46A 1C14A 2RBEA 4FPXA 2Q7OE 3WZLA 4DIFA 4D8TA 1UBGA 2BGRA 3C3CA 4A0QA 1E1CB 2RIRA 4YLYA 1HZZA 2ZYVX 3TL6A 2VK1A 3EXIA 1KC3A 1OXMA 3OJ0A 2DEUA 1LA2A 1E64A 1LQTA 2V45A 2WWHA 4G1CA 2I33A 3OFVA 4WEOA 5CVVA 5EHGA 4X7PA 1G20E 4Z4GA 1J23A 1IXZA 2VJCA 1GRVA 1ID1A 3G5AA 4A8JA 4ZRMA 1G18A 5KSOA 3RYCB 3FOEC 1PV1A 1W0KD 1U0NA 2OXIA 2BF7A 3DUWA 3ZUPA 1C4WA 5LUBA 4YYEA 1XMVA 2QMYA 3LBIA 2F1JA 3AR2A 3I8SA 2XYRA 4MUIA 4RA9A 5EKXA 3VO8A 4Z8XA 1YFKA 1M0WA 2CXQA 2H3EA 4MGEA 5K9ZA 1MENA 1XRLA 1YI0A 2AVNA 2NUAB 2QX9A 4DC9A 4EW2A 2CFTA 3O4VA 4BWFB 1D07A 2IKQA 4G4SO 2YVUA 2IIQA 3QJGA 1B1CA 4LSGA 5FBZA 1AHNA 2ZTSA 2P27A 4G41A 4JKYA 3HTXA 5IAAA 1E2JA 4NCXA 4G3XA 3I4CA 3KBBA 5FUWA 1DIAA 2JFWA 2Q27A 1D03A 3B78A 1K2VN 1ZUNA 1FU8A 3EHEA 4QRHA 1Z7EA 3FVVA 3ED1A 3OQIB 3PUZA 4J1QA 3A9RA 2I6SA 4ARZA 2CUNA 4LPSA 4A82A 2CB0A 3R7LA 2H5IA 1FCJA 2NIPA 4LYFA 1OAOA 1LY1A 4R2JA 1XAHA 3PJDA 4UU1A 1W47A 3DE6X 2VUIB 3O3MB 5KYXA 2B8NA 2RG7A 1RQLA 2W00A 1Y63A 4EJMA 1OPXA 1NKVA 1M2VB 4PBRA 2XA1A 4LJAA 2SNIE 4D45A 1M7BA 1JLHA 2HTEA 3WA7A 2DB3A 1XKTA 3AWIA 4YJDA 4H0FA 1E3MA 5HNKA 1BDIA 3RD5A 3ZNPA 3GT7A 1DC5A 3IDZA 3LMKA 2W2OA 2H00A 3FGPA 3I9FA 5HIIA 2IW1A 4AJ4A 4TMYA 5L3SA 2PJUA 1N5KA 2YZ7A 4IIEA 1OBVA 1C9YA 3EWIA 1QYIA 1XUOA 2V9PA 1RRCA 1X7HA 3AXSA 2P6NA 2HWWA 4MA4A 2PNJA 3L6BA 2ADFA 4CTNA 2IH4A 3DV0A 5DSTA 2UUBB 2GO1A 4PZYA 2PRSA 1R0KA 3DOCA 1JKJA 5ER6A 1LV7A 4HRYA 2FGKA 3O91A 1L1FA 4CBVA 4F3RA 4ZZ2A 1SVUA 1VJRA 2BRUA 2XCLA 1GZSA 3NKFA 4G84A 4MV6A 3KS9A 1M9NA 5CU7A 5LNK6 4CI9A 2I6XA 3W4KA 2YWBA 1Q0LA 4QUAA 5KYYB 3Q7PA 2AF4C 2A5YB 3ER6A 3W7BA 2WF9A 1P72A 5JAHA 1P77A 4OHMA 2YW2A 4PX2A 2ZTUA 1C81A 5TMBA 4E31A 2BFAA 4QTXA 4B47A