2CL6X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with s-caged gtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GTPASE HRAS
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
total genus 64
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cl6X00
3S1AA 4Q9IA 1U8AA 5BW8A 2WM9B 3NWJA 3ZIAD 2YNMA 4O2RA 4DB2A 3U6KA 3SN6A 2YC4C 3CPEA 4BLRA 2HF9A 2MSDB 3GLHE 1WBDA 1Q0UA 2ZVQX 4OK6A 1JXOA 1Q1QA 3KTAB 2QN6A 1NY5A 2VTKA 2YKGA 1VHLA 3PEWA 2ZM5A 2BKUA 3BORA 4M9XA 3GLIE 3A1TA 5CB8A 1N6HA 1VCIA 2G1JA 2JDID 3PVSA 3J81k 2BJVA 4RKFA 5E7MA 2GTPA 4HYYA 5TY0A 3BH7A 2J0UB 1YR8A 5A0FA 3W34A 1R2QA 4LHXA 2QBYB 2JJ1D 4ESHA 2GESA 4DLZA 1KSGA 4Y0VA 5CJ2A 4NDZA 4DWJA 3THYA 1Q1BA 1YJ5A 3BFVA 5L3RA 1H8HD 4BWYA 1S2MA 1XMIA 2QPTA 3TW8B 4P4UA 4R2HA 2PZEA 3L0IB 4N1AA 821PA 2O8BA 1E2QA 4MKIA 1YZUA 1Z8FA 2C78A 1NLYA 3QXXA 1N6PA 2PJRA 2CNWD 3SQWA 4O2LA 1P62B 2FDCA 1IOZA 4A1FA 3BFXA 4DLRA 2IXFA 5AJXA 3SHFA 3ADDA 1MO6A 1P3JA 2CHVA 4JMPA 1KI2A 1E2KA 4LYAA 3RS2A 2WJYA 1LW7A 4D81A 1GRNA 1KK0A 4P4SB 2JGNA 4PR0A 4D82A 3PEUA 2GXSA 1TTTA 5FFMA 2IEZA 1G5RA 1UBCA 1SVIA 3PITA 1KAGA 4EPVA 4ZDWA 1CEEA 2XNDA 4HLQB 4A2QA 2ZRNA 5GADl 4BPBA 2Q3MA 4AG5A 1XTQA 2GEUA 2MSCB 4PANA 3U6BA 1MV5A 1VDZA 4M21A 1NJFA 1SKYE 2QMOA 3UPUA 3KQHA 3ZDQA 3LDAA 3CRRA 2QGZA 1DAEA 2K5UA 2NMVA 2GCOA 3HPQA 1SHKA 3GJ6A 1FUUA 2JLWA 1T9HA 1ZINA 3QOFA 3IQXA 2ZSFA 4IXMA 2VSXA 3JVVA 1TUIA 4JLMA 3GLIB 4B6EA 4CIDA 1UKZA 1OPXA 4B3DA 1QHSA 3NBZC 1MT0A 2ZRMA 4O3MA 2IYYA 3ZZUA 1PV4A 2HJVA 2ZVPX 1B0UA 1T5IA 1ZNWA 4PHHA 1GG2A 1XD9A 4Q4HB 2I1VB 1EXMA 1N6IA 2IUSA 1L7VC 1AIPA 4OI0A 4QM6A 1MO4A 2QTVB 3QF4A 1OKKD 5JEDA 1JPJA 2GA8A 4UNSA 4QM7A 2CE2X 3BBPA 4BRUA 4WAUA 2BOVA 3LXXA 1RRFA 3L2OB 4RFSB 3MRSA 3RRMA 2Q9BA 1Q22A 4QC2A 3PCRB 4BEJA 1Q3HA 3KQKA 4PX9A 3PUXA 1P75A 1II0A 1U90A 4ESVA 1AA9A 1D5CA 4FMCF 4AC9A 4V0OA 1Z0KA 3B6EA 3RLFA 4M1WA 4Q1FA 5FOVA 5L3VA 2NO9A 1W0JD 3IO5A 4WXPA 4YC7A 3KXKA 1YZKA 4LJ7A 1NL3A 1P9WA 4OI4A 3VR1A 3Q7QA 2BJWA 2I3BA 4Z8YA 5J4VA 4C0AC 1ELOA 4F92B 4FCTA 5F2EA 4EJSB 3GP8A 2A9KA 2ORIA 1NVXQ 4EJSC 3Q3JB 3FMOB 1DG3A 1SXJA 4GPTA 4NYMQ 3AKEA 4JJKA 2GKSA 3QVUA 4CEHB 2CJWB 5KDOA 5LDDC 2ZRPA 4PQYA 3T1OA 1Z6GA 1EFCA 4ZKEA 2FEMA 1CIPA 1IN5A 1E2GA 2QL6A 5F9FA 1JJ7A 4C2TA 1ZC3A 3PUWA 3WMFA 2FSIA 2XTMA 4OHWA 1SKYB 4DHEA 2A78A 3AQ4A 2WWYA 4LHYA 2JJ2A 3CWZA 3VNUA 4QL3A 3TVDA 2R44A 2AK3A 5AJVB 4OHVA 1IY2A 4KHZA 4IVQA 1N2CE 1R0XA 4LYHA 1FP7A 1G41A 1OFHA 3QE0A 3QSYA 1IN4A 1E1RA 2AX4A 2QE7A 1YE8A 3CF0A 2ZXUA 5JI3E 4QGFA 2FN4A 4A2PA 4FWIB 1Q1ZA 3IILA 5FOSA 2B92A 4BECA 3X1WA 1F48A 4KFRA 1E9DA 2ZETA 3TK1A 4DDTA 2OHFA 4YQFA 4C7OA 4DC9A 4ZI2A 1T4GA 1XD8A 1E2MA 1E2HA 2ZJZA 4TLEA 2CL7X 4LI0A 1SULA 4QXAA 4DSTA 1Q3TA 2F43B 5EXXA 1R5NA 4RD0A 1PUIA 2WSSA 3TQFA 2AK2A 1E96A 2QAJA 4M1OA 1ODFA 1NN3A 1TQ4A 5J4YA 5FOTA 3SI7A 1QF9A 4FCVA 3FKSD 5TARA 2NTYC 5EUMA 3RDPA 3P27A 1GRRA 3DOFA 2EW1A 4UNPA 1FW6A 2EQBA 4BZXA 4JVNA 1DAGA 2IC5A 2RKOA 2EYQA 1HA3A 4RD2A 3K1JA 4GL2A 3RC8A 1S1CA 3KKQA 4N0EA 3QXSA 3T61A 3TRFA 4YMSA 1W36B 4L4UA 3KTAA 2ERXA 5CITA 1XX6A 2WWIA 4RCZA 1W36C 4LBYA 3QNUA 1XMJA 4YMVA 2JLVA 1BIFA 5EXSA 1OSNA 1D9XA 1FQKA 3MSXA 5TB5A 3T12A 4CRWB 5JJKA 1RIFA 2ZEJA 2IUUA 3SDZA 2R9VA 4ARZB 2O0HA 2ZUCA 2NG1A 2Z83A 2IL1A 1DTSA 4TQUS 4URVR 4K81B 4BQSA 1E4YA 3KJIA 4KLNA 1H8HA 1KKMA 1S3GA 1CU1A 2VYFA 1N0WA 2NO7A 1W46A 2ZRAA 1NMZA 2HUPA 4POAA 2EFGA 4URWR 3KJGA 4CEIB 3RRNA 3CLVA 2ZANA 1DOAA 1OXTA 3DZ8A 4OQXA 4PPGA 3V9PA 3KXLA 1BOFA 4EDHA 1XCMA 2G88A 5FPHA 2ZYUX 2CNWA 2CMKA 3WYFA 3OHMA 5FPSA 4O25A 3VKGA 3K09A 2O8FB 2OESA 2CXXA 1K6MA 3VU9B 3C4JA 3O8CA 2ZS7A 1T5LA 3BS4A 2FSHA 4B75A 2P3SA 1E6CA 2FPLA 1O87A 4M22A 3U4QB 2J46A 3AB3A 3WBKA 3R7WB 4G5SA 4AG6A 3CR7A 1TF5A 1XEWY 2CDNA 3QBVA 521PA 3VR2A 1NKSA 5JSZA 1W4AA 3T5DA 4DLVA 2ZPTX 2Q9AA 4QGGA 5EP4A 1I4LD 1SHZA 2ZI6A 4MGKR 4QNRA 3SFVA 4BUJA 4E09A 4I99A 3NKVA 4HLCA 1JB1A 2QU8A 1J70A 5EE5B 4NYMR 4OQNA 3HU1A 2VHUA 3GJ0A 2L0XA 3CBQA 2QSZA 2XB4A 2JCSA 4U5XA 3ZS9A 2GCNA 5BQ5A 1KSFX 4PAOA 5CIQA 4UNRA 2VHCA 1X6VA 1P4SA 4HEJA 2C04A 2DPXA 5IRCD 2REXB 2JIZD 2CLSA 5KSZA 3RYTC 3G5UA 4MYUA 5E4FA 3GLFA 3NEJA 3K0SA 2AR7A 2HV8A 5B2ZA 3U7EB 1P2UA 4H9GA 1DAKA 2WOJA 1RVDA 3K70D 3LY5A 1WA5A 2W83A 5A5GA 1VYTA 3QKTA 2ATXA 1NN1A 1E69A 1NSTA 2ANCA 2QT0A 5JWHA 3B13B 3BAFA 2ODEA 1YR7A 3LWNA 3DOEA 2XJ4A 3C5HA 3SOPA 1HE1C 2EYUA 2G9NA 4Q4HA 3KQNA 2OFOA 1WE2A 2UZ3A 4A92A 1Z6TA 2GRJA 4HZUA 4LBWA 4G0NA 3TVTA 5FL3A 5A4JA 3KFXA 4PC3A 2YOFA 4FMDF 2MMCA 4YLGA 3W6NA 4CT5A 1GAJA 3L0OA 3ZS8A 5C1BA 3AKCA 4XSGA 1W0JA 4XWOA 1T6NA 5FH9A 1UDWA 1NN0A 4IDHA 5FTNA 2NPFA 4B34A 1BS1A 1OF1A 5AUOB 1GITA 2ZSAA 3CW2A 2IK8A 1W4RA 5HE9A 4OL0A 4ZDJA 2DY1A 3BB4A 3B1YA 1NLFA 4DEXA 2MMGA 3V00A 2DCUA 1JAHA 4LCBA 1DADA 4NKRA 1XRJA 1IJEA 1UEJA 2BM0A 1GILA 1XMSA 4CVNA 2AWNA 1E0SA 5FPTA 1OYWA 3QPWA 2A5JA 3A4MA 3GJ4A 2RAPA 5DI9A 3A4NA 5EXTA 3MWKA 4MYHA 4LUCA 3VR6A 4ZIRB 4AD8A 3ASZA 2ZJ2A 2R6AA 3P32A 4JVLA 3A36A 2I1QA 3A6PC 5FPYA 2C77A 3Q8XB 1AQUA 2ZU0C 1N5JA 1NY6A 2PX0A 4Q7KA 4F4JA 1W4BA 4LJ8A 2GETA 1SVLA 3U3KA 2X2FA 4IEIA 3P4XA 4OQFA 1ZAKA 1Z5ZA 4JVMA 2XZOA 3BK7A 4OQLA 3A1UA 1Q44A 4Q02A 3RSLA 3TQCA 4A0HA 4B74A 3ICEA 1T3HA 1YRBA 3I73A 2ZJ5A 2P65A 1NBMD 2GXQA 3MJRA 2W2VA 5DYGA 5TDHA 4LOAA 5C4GB 4DUGD 1ZM4A 4BEBA 3FHTA 1CULC 5GVSA 4UNQA 3ZVLA 3GMTA 4BFUA 1VTKA 2W00A 1XXHA 2ZI5A 5E3HA 5EE3A 4PTLA 2BDTA 2IS4A 4GMXA 3QKRA 3N70A 1HYQA 3HU2A 3O8BA 4C0JA 4D0GA 5D3MB 5GJBA 5SZKB 1GKYA 2VP0A 2J0QA 3CPJB 1XEXA 1AKEA 1VG9B 4HAWA 2H92A 4UXHA 4PPNA 4UXIA 2R6CA 3NC0C 5TVKA 1JR3D 3BB3A 4RJLA 4UJ3A 1WF3A 2VL7A 2Q0HA 2OZEA 4Z8XA 3W6OA 3AV0B 2J41A 4RD6A 1E99A 3NBYC 2QP3A 1RC8A 5JWOA 4V0NA 2QRZA 2V7QD 2B7CA 2WKQA 4JLBA 4BFZA 3TUIC 3MWLA 2YWEA 2REBA 4Q18A 1FNNA 3DKVA 4XVUA 1HY3A 1Z0DA 5J4HA 1G7TA 2XITA 5KU1A 1SGWA 2G0TA 1TQ2A 5FBVB 1FUKA 5F9HA 1KI9A 3GEHA 3MCAA 4Q1DA 2AD5A 2YVUA 1UADA 5LB2A 1R8QA 2QG6A 1IXRC 3ONWA 3VR3A 1I4DD 2FSFA 2WWWA 3I62A 4E07A 5FTJA 4ARZA 2IYVA 5DI3B 1ANKA 5JJIA 1EG7A 1K8RA 4JL5A 3OE7A 2CLDX 4CDGA 2OM2A 1SZPA 4R71A 2C03A 2PH1A 4QGHA 2J7PD 2V4ZA 1WBBA 2BBWA 4JSTA 3LNCA 1PJRA 2GJKA 3HDTA 1W48A 3LRPA 1QHHA 4FN5A 4JJZA 3VMFA 3JZAA 4A2WA 1KO7A 1M8PA 3V4RA 1IY1A 2WBLC 5GJCA 3U7HB 3AVQA 4K8OA 2WOOA 4UJ5A 2RCNA 2ZI7A 2VHQA 4GSYA 2IF0A 2YYZA 3FGNA 4IHQA 4C0LA 4Q00A 4XTCS 3OEHA 4BLTA 2EU8A 3UIEA 5LPNA 5KPJA 3U4QA 3LW7A 4GP7A 3AP3A 4CZ2A 1O3YA 1P7CA 2D7DA 2WWFA 1RJ9A 2XZPA 5F98A 3HU3A 2BBTA 1US8B 4F4IA 2ODBA 1BYUA 2QNRA 2YC2C 3LW8A 1QHYA 1TMKA 2Q3FA 1W1WA 2QPAA 3TW4A 3WRXC 3FTQA 4P0TA 2ZRFA 1D6JA 1GKIA 2CBZA 3L82B 1ZBDA 4IOKA 3TSOA 1E9RA 4N0DA 1GNQA 1S9DA 1UM8A 4EFNA 5HKKA 3LBIA 1CJVC 1EX7A 2FA9A 2EFHB 3IQWA 5CYPA 2F1HA 8OHMA 1NP6A 1AM4D 3BGWA 2IF2A 2C5LA 3I5YA 3ETLA 3K9LA 2Z43A 2IA5A 5JEEA 1RRCA 4PAQA 1JECA 1JPNA 1R0YA 1X1RA 2H16A 2O5VA 4HLUC 1A4RA 1Q1EA 4RZ3A 4DDUA 5KYKA 2JLZA 2ECKA 2LKCA 1F2TA 2DFNA 3I8XA 4JBYA 4JYCA 1ZUNB 1KO5A 2V6JA 2YOGA 4ZKDA 2RH5A 3KKNA 3R8FA 1C4OA 3ZD6A 5AUPB 3CX6A 4FIDA 4XJXA 1G4UR 4R7ZA 5J47A 2R6GA 4DLWA 1J90A 3AEZA 3CH4B 2KBFA 4GFDA 4XD7D 3DPUA 5H8WA 1CR0A 2BEJA 2F1IA 4L9WA 1RW4A 4UQOA 4B32A 5BN5A 4LRWA 3SJBA 2J7KA 1CRQA 3AVPA 1U99A 1G6HA 1IN6A 2FFAA 2VPPA 3QPVA 2O52A 4OI1A 4AK9A 4JS0A 3C15C 4TTRA 5FL7A 2J0SA 3G0HA 1R6BX 2ODNA 1TAGA 5JRJA 3EPLA 2HJGA 2IT1A 4MRNA 2QY9A 3ASYA 1G8PA 2R65A 4PPQA 4RVCA 2XGJA 1A2BA 1DAFA 5AR1A 5CDFA 2V9PA 4NCHA 4PO8A 3B9PA 1ZUHA 1LFDB 3GFTA 3RHFA 2JJ2D 4PSKA 3CZPA 1KYIA 2W2TA 4GBMA 1ZNXA 4JLNA 5KPDA 3FVQA 2GBLA 4PHFA 2CEAA 3PG5A 1K5DA 1HV8A 2A3RA 1OJLA 1AZSC 1E9AA 1EK0A 5FUYA 1CR1A 3EA5A 4Q21A 3BE4A 3PUYA 1Q12A 4FD2A 1QVAA 2F3RA 2UKDA 1FX0B 2FV8A 3O47A 2CHQA 3D31A 3I8SA 2XOKD 4M4SA 4QJ4A 3OFNA 4W5WA 1G9XA 2CVHA 2P5SA 2GK7A 2N46A 1LS1A 4MKHA 2Z4RA 4LHWA 5J4LA 4NHOA 5DHFA 2WSSD 5ELXA 4ZIRA 3SYLA 1UDXA 3OIUA 5F3WB 3K9NA 2ZE8A 3RS7A 3P20A 3VX4A 1OIXA 1G8YA 2QP9X 4B2PA 3AF1A 3M4YA 1IN8A 1G8GA 5L3QB 1NBMA 2ZJ8A 2PMDA 4DUGA 3QBTA 2PJZA 4M9QA 1IN7A 1IM2A 1E2EA 3BXZA 3IEUA 4IRUB 5KO2A 3D3QA 3GPLA 2CL6X 2XX3A 1DE0A 4KLZA 4JVSB 4XH9B 3WMEA 1CJUC 1H8ED 2D4HA 3HP1A 3UXMA 2IS2A 5BN4A 1TEXA 2A7QA 3B1XA 3E1SA 2IXGA 4PXAA 3KUCA 5HTKA 1R10A 2XNSA 1MH1A 1JR3A 1PLLA 1WRBA 3C14C 2CK3A 4IW3B 4EPXA 5D3MA 3GLGB 4QOSA 3SNHA 2GZDA 4JT2A 4F7WA 2HXSA 5EXPA 3AF4A 4Q9JA 3KZ1E 3B8HA 2V7QA 4ZDKA 4WZAE 4O0MA 3LLMA 2VRWA 4KYIB 3TLXA 2ZRKA 1LF0A 4FCWA 3EG5A 2YWHA 1FTSA 1GWNA 4GZLA 4M53A 1RYHA 4US1R 3SYKA 2BHRA 1Q21A 1YU9A 4B71A 5KOYA 1WP9A 4G5RA 1DPFA 1T8TA 1JR6A 2IYTA 4B2IA 1AK2A 1EESA 3TJZA 3CH5A 1HT1E 3SHWA 2HT1A 3K8YA 4HAXA 4CT4B 1VCOA 2ODWA 4F4CA 5JFGA 2Q6TA 2EFEB 3AUXA 3T5GA 2P6RA 4ZCMA 4IEEA 2F3TA 3B7GA 2J7PA 3T34A 4US2R 5E7JA 1N0VC 4TMXA 4JIMA 1D2NA 4Q4JA 4Q4AB 1W5SA 4DIEA 2DBYA 4ACAA 4E5UA 4KITB 2QTHA 1GZSA 1RRPA 2FZ4A 1KIMA 3BIFA 4KVAA 2FE4A 4Q5IA 4C30A 4EQ6A 2O8DB 1S4QA 1Z0JA 1KHTA 3EX7C 1NKTA 4TYPA 3O8DA 3R9WA 2D06A 1WQ1R 2KE5A 4LYJA 3GLHB 3CX7A 5B64A 4KV9A 3RNLA 4PSVA 1CXZA 1U9IA 4LSGA 1T8UA 2XZLA 3VKHA 1IONA 2D7CA 1VG1A 4MUBA 4AURA 1XEFA 1ZJ6A 3CR8A 4Q9KA 2PLFA 1QHGA 1L4UA 4YONB 1VIAA 2C9OA 3LO5A 3TKLA 4OKSA 1XCPA 4H1UA 4Q19A 3PUVA 4D6PA 2D2EA 2BC9A 4PC1A 4W5HA 5CIWA 2XEXA 3EZ6A 3WP0A 3HPRA 1CJTC 4QG7A 3ND9A 2TMKA 1GVNB 2ATVA 4IKEA 1JJVA 2ZRBA 4FMBB 1XCGB 2RGCA 1LNZA 4RZUA 2VA8A 3KKPA 5DO9A 3SFZA 5KDDA 4X8MA 1AGPA 4XTRA 4Z51A 3TE6A 2PCLA 4TN1A 1M7BA 2GJAA 2CL0X 3FPAA 4KVGA 3LX5A 1BMFD 5CYOA 2J9RA 2DR3A 1R4AA 4NH0A 4CEJA 2VF7A 3AKYA 4W7SA 1OHHD 3VR4A 2O8EB 1QVRA 4M9SA 1VG8A 1WDTA 2IYSA 5SZHB 4HLUA 1IAQA 2ZUBA 3TGPA 1KI7A 2WJHA 1UBEA 4XD7A 3ZD7A 2VF8A 2FOLA 5JECA 1E94E 1XTJA 4P33A 1JAIA 4TSFD 2ZREA 1KJZA 1EWQA 1RYFA 4FINA 4EPWA 1M1YE 1TX4B 3C41J 3BC1A 1GIAA 2BKEA 4IDPA 4URUR 4DBLC 3GD7A 2PEZA 4RZ2A 1E2LA 3TR5A 3VAAA 1RZ3A 3EARA 4W9MC 1G291 4RFVA 1GNRA 1SVKA 1V5WA 1IQPA 4LJYA 5P21A 5KSPA 5CM9C 2FZLA 1FZQA 3QENA 2D2FA 1D2MA 4MQBA 5CK4A 3R9IA 1RPZA 1N6OA 2H7VA 4YMUA 5HR5A 3AP1A 1Y63A 5D3QA 4AIIA 2WV9A 2C96A 4I1UA 1AGRA 1XPOA 1V43A 2IX3A 4RY2A 4I1OA 3GJXC 5JS8A 4NL4H 5KUTA 5L8VA 1ZMXA 1MABB 1IXZA 2FG5A 3U3OA 3I3SR 3THOA 4PO1A 1Z06A 3MMPA 4DT1B 2VLIA 6Q21A 3F5FA 1R5BA 3X1YA 2PZGA 3T1TA 1L4YA 1RKBA 1CKEA 2ANBA 3IIKA 4B43A 4BFXA 1MRSA 4HDQB 3EC1A 4GRAA 4PZYA 4TMKA 4TMWA 4URZR 2XOKA 1K5GA 1D8TA 4OK5A 1E2JA 3SC3A 2HCBA 1FX0A 1KK2A 4M1YA 1TU4A 2BVNA 4DXAA 4QJ5A 1CRPA 1OFIA 3F0TA 5J40A 1SVMA 3REFA 3I1FA 4LYFA 2ZRJA 2OXCA 2KB0A 3K9HA 3VQTA 1E79A 2FMXA 4DLUA 5HZKA 3UMRA 1B23P 2GVDC 4PFSA 2PX3A 3IO3A 1OB2A 1ZM2A 4D80A 1XNJA 621PA 4A6PA 1PVOA 1Z63A 4Z1MA 5FUVA 2Q21A 1E9CA 3IEVA 2BMJA 3M1IA 1H8EA 3BH0A 4QBGB 1ZYUA 1DAHA 1Z08A 2W0SA 2OCBA 4II7A 4I1SA 1XD2B 2NPIA 2R62A 2WMOB 3HR7A 4HAVA 4IOLA 4OJKA 5GJWC 4BLOA 2ZYWX 3TAHA 4V0MA 4HB4A 3A4LA 2HLDD 3D6TB 2Z6VA 4KJZA 3REGA 4I4LA 2BV3A 2J0UA 2EWVA 1DELA 1KY3A 1VPLA 2QBYA 1TUEA 2BMFA 4DCTA 2BCGY 2C8VA 2A5FA 2OUKA 4WVFA 3NXSA 4EPTA 5JMTA 2IYLD 1EGAA 4DCNA 3E5HA 3LH5A 3OE7D 3QKSB 4JLDA 2FFBA 1H65A 3G82C 4QBHA 1P6XA 2ZSDA 3OAAD 2C2HA 3U61B 4HUQB 4YMWA 4DRZA 5UKDA 3GLGA 2JLSA 5JHHB 1X1SA 3KXIA 2BIFA 3N5CA 2QSYA 2WIBA 4J0QA 3AVVA 3KQLA 3MWYW 3OZXA 2ZJYA 4URYR 2ZQ5A 3TUZC 1NNEA 1OFTA 2CHGA 4PZZA 5CM8B 1KJWA 3I32A 3U44B 4GDFA 4D26A 2ZS8A 4B3CA 2VBCA 1N6LA 3E2IA 2C9CA 1DO0A 4ZCIA 3GFOA 3OEHD 4NP6A 1RFLA 4WBSA 1J2JA 4WXRA 2EFCB 1GTVA 1JQLB 4GOJA 3WP1B 4A8JB 1P9NA 3GEEA 4UKDA 1J8MF 3IBGA 4P4SA 4A8JC 5C18A 1OH6A 3CIOA 1W36D 1RE0A 2OCPA 4TT3A 3KFVA 5G41A 4DLXA 1N6NA 4TL6A 3C8UA 2VEDA 2BCJQ 1QG2A 3DM9B 5H70A 5FTLA 2ZRCA 1UEIA 1QHXA 4NCNA 1P60A 3N2IA 4Q47A 1A82A 5DISB 2VH5R 2JJ8A 2GCPA 4MITA 4HLDA 1TL7C 3RWMB 5HKKD 2ZR9A 5LB4A 1WB9A 3GLHA 1KSJA 1F5NA 2AL7A 1COWD 1OE0A 1DS6A 3RS5A 3ZZ0A 3PENA 4PC7A 3AF2A 3W3ZB 3P26A 2WWXA 2VP6A 2GEVA 3GLIA 1EWRA 1Q20A 1LF5A 5CB6A 1QZXA 1FMLA 2WSMA 3TAUA 4G5OA 1Z0IA 2WICA 2GAOA 3RS3A 1TQ6A 4TMVA 1OV4A 1KDTA 2ZJBA 4U02A 4D0LB 2QAGB 4QFMA 1UKVY 2IEYA 4QRHA 3SE0A 2QAGC 1J7KA 3NH9A 2GWHA 4KODA 3CNNA 3AKDA 2F9MA 1E1QD 3FHOA 3DKPA 3QG5A 4IOMA 3H2YA 4LJ9A 4C2UA 3THXB 2HCJB 1VYVA 5BYKA 1G4AE 4Y0AA 4NZYA 2IXEA 5SZJA 5K8UA 1CJKC 1NJGA 1TU3A 3EASA 1XWIA 1BMFA 2NO1A 4RCYA 4MRRA 4N3NA 2HYIC 3NBXX 3AGPA 3F8TA 5FL7D 1NLZA 3CWQA 4RFSA 1OHHA 1XJQA 4DSNA 3K9GA 3NHBA 2CVFA 3FKQA 5FPKA 2KWIA 2DFKB 1F3OA 3T15A 4TLCA 4IJMA 4MGYR 4DJTA 1HT2E 4B2LA 3PR1A 4HAZA 4M9ZA 1G21E 2IYQA 2QGNA 1WMSA 5IT5A 3T1QA 3Q72A 4XVRA 3HYRA 2O8EA 4HSEA 4TSFA 1Z2AA 2N42A 4ASUA 3AH8A 4DLYA 2YOHA 1W0KD 3KUDA 3RS4A 2ZJAA 2G0NA 3EPHA 2CCJA 4EJSA 1LB1B 4ERNA 2GILA 1KMHB 4FXPA 2NIPA 4PQFA 3R9XA 2GF0A 4LWZA 1AKYA 3B82A 4D4LA 1GSIA 4M1SA 3PEVA 3FWYA 3RRYA 3L8YA 1M2OB 5G3ZA 4CEHA 3AM1A 2CJWA 3QKUA 4JLVA 5DLQC 3W6PA 2ZS9A 3A37A 1PLJA 1KNXA 1U0LA 3OFND 2CCGA 4LZZA 3SU8A 2RGXA 2QA5A 3WMGA 2Q3HA 2ZI9A 121PA 1Z0FA 2NQ2C 2OBLA 4IVPA 3FMIA 3EIHA 4TZ0A 2C98A 2VP4A 3DMNA 3BD9A 5G40A 4OHYA 2ZR7A 1MRNA 1G3QA 2ZE6A 1G20E 3B1WA 4LJ5A 3GJ3A 1N6RA 2G77B 1N25A 3U3MA 1P2TA 5AUNB 1G8FA 1U2RA 2ZE5A 2F1RA 2ZJOA 4PO9A 5K8IA 1ZCAA 1ZNZA 2W6JD 3BWDD 4BE7B 4LJ4A 1NMYA 4KSBA 4CYMA 1E0KA 1QBKC 1KMQA 3HJNA 1A7JA 4P31A 1NF3A 3RABA 1HQCA 1MO5A 4FMCB 4HDOB 4DCSA 3ZZTA 1G3IA 3MG9A 4OHXA 2OILA 4QHYA 2YJTD 3CRQA 2F43A 5DN6D 3CNOA 4Q7LA 1HEIA 3PEYA 2W6IA 3IPXA 1G3MA 1SQ5A 2CK3D 2CE7A 2ZRLA 2VP2A 3EZFA 4LV5B 5KSOA 3KB1A 4D2IA 4JLAA 2A30A 3B1VA 4LC0A 4UNNA 5EP1A 4BZQA 4EFMA 3EW9A 2FNAA 5EJEA 3THYB 4LHVA 4F91B 2PT5A 2WPDD 3LV8A 2B6HA 3VFDA 3CM0A 1E2DA 3NG1A 1JQJC 5J5CA 3WHKA 2QENA 2VP9A 4G3XA 1C9KA 2H17A 3QY0A 4NE2A 4Q1BA 3X1ZA 1DARA 3WYAA 1YHNA 1KOFA 3OESA 4RKEA 5FUWA 3C7KA 4BFYA 4MUAA 1C1YA 4NYIQ 1MR3F 2HLDA 3K0EA 3EZ7A 1AS3A 1E9FA 4AKIA 1FFHA 2W2XA 4LV6A 3D7MA 1TF7A 4D4MA 3U3JA 3K0CC 3A1SA 5EQTA 4PSAA 3IGFA 4TQ9A 2WWGA 3EPKA 4NBSA 1W7AA 2P0EA 5ANRB 3VKWA 3VHXA 1NSFA 2OFWA 4Q48A 3AVWA 4Q1CA 3OAAA 4DKXA 2YWGA 3B9QA 5KNDA 1VCNA 2WJJA 1SXJE 3EC2A 4NYJQ 1W2GA 4LK2A 2ZSEA 3IHLA 3RRZA 3ZGXA 4CEIA 4V03A 5H1YA 4B73A 2QM7A 2X2EA 1HURA 1Z2CA 4G5QA 3SEAA 4YMTA 3R20A 1MO3A 4TTQA 1N6KA 2QMEA 2B8TA 1HUQA 2VIIA 3KQUA 4Q1AA 1R8SA 3ZVRA 5B30A 4JLKA 2O8FA 4EAQA 3VU9A 5FTMA 3LLUA 4WOPA 4BFVA 1X8KA 2YINC 1KAOA 5EZ6B 2ONJA 3TSZA 1KSHA 5EZ5A 4GMDA 4L15A 2GHIA 3R7WA 1I4TD 4B48A 4LPKA 4B3BA 3U44A 1YZGA 5B57C 3H4MA 2RHMA 3WNDA 1G7RA 2H8KA 4KCGA 2J59A 1E2FA 4YDHB 3CKLA 2AFHE 4A8JA 2E9SA 2RMKA 3A58B 3QUSA 1YZLA 2AN9A 3SJAA 3NBFA 1GRQA 3BRWD 3T35A 4DVGA 3LX8A 2WTUA 1E9EA 1COWA 3CUEF 2NGRA 2VQSA 2IHBA 2WVJA 1BKDR 4HAUA 2J45A 1GL7A 4ZCLA 2GXUA 3FFBA 5AWFC 5FI0B 1F2UB 4DSOA 2PT7A 4MYTA 4F38A 1AQYA 3NC1C 2GJ8A 3CF2A 2OT3B 2QT1A 3A1VA 3B60A 3EA0A 1KY2A 2QORA 2QMUA 4F93B 1BYIA 1E1QA 4DCVA 2E87A 3CRMA 3H0KA 2G1KA 2R6FA 4G5GA 3L43A 2QTFA 4JT4A 3QEOA 3W8NA 3KDSE 1ZNYA 4A15A 4TLBA 2QAGA 4HB0A 4L5BA 1KGDA 1Z6XA 3MWJA 3X1DA 1RRGA 1X86B 3ADKA 1A1VA 4OBEA 1F6BA 3QF7A 1SXJB 1TPZA 2F1JA 1SXJC 1KDRA 2FFHA 2OBNA 2RHDA 3QPUA 4JLOA 2JEOA 4Q1EA 5AJZA 4TYYA 5FR2A 1XEWX 3SR0A 1ZP6A 4Q9LA 5IHPA 2WAXA 3FMFA 1CBUA 1ZRHA 5EE9A 3IHWA 1A2KC 1T3SA 1ZD1A 2FGKA 3SZRA 4WA7A 1KI4A 4V02A 1W0KA 4WZBE 2OO7A 4WIAA 1MOZA 3IIMA 2FF7A 3MD0A 2PL3A 4JBXA 2GVZC 4PC6A 5EP3A 1FQJA 3DZDA 4A0GA 1FOEB 2G3YA 2PLRA 3LVRE 3AUYA 2GK6A 1KMHA 2WWHA 4Q01A 2HEIA 2ZU6A 2NO0A 1DG1G 3CF6R 4DZZA 4LX0A 1Z83A 1UPTA 3T1VA 1AS0A 4NYJR 4JKYA 3AP2A 4L16A 3U7GA 2ZE7A 2WKPA 1Z0AA 2FWRA 5JI2E 1M74A 3AF0A 3N2EA 3KB2A 3THWB 3PQCA 2C9YA 4R98A 4NCIA 2W0MA 2A2ZA 1BH2A 1E79D 2NOAA 2W6JA 2XTZA 2PBRA 4PQRA 3TR0A 1S0UA 4B3GA 4FMDB 3VNVA 4HZIA 4MH0R 2FJUA 3GLFE 2BWJA 4Z1MD 2EWWA 3GCGA 3I61A 2VHTA 3NH6A 2IYRA 4IXNA 1UF9A 4X8OA 5DN6A 4A82A 5E7IA 3DO6A 1OXVA 4L8GA 5FUXA 3T06B 3EIQA 3VR5A 1P73A 3OIYA 4HATA 4MKFA 1S96A 3C16C 3E70C 3EWAA 2WPDA 5GJVC 2WKRA 4DIDA 4QBIA 5JZVA 4G1UC 5JRZA 2HYDA 5JWRA 1FL9A 1S8FA 3CPHA 1HH4A 1G5TA 3IDQA 1P72A 1QDEA 3UG6A 1XFAA 1G19A 3CRVA 1EFRD 2WJGA 4MDFA 2XXAB 3KKOA 4WZ6A 3I5XA 3MUFA 4BLSA 3K09C 4IOJA 4XWKA 1U94A 4PAMA 3TNFA 1G3RA 1XTRA 5DH9A 3MFYA 5FBWB 4OQMA 3MAAC 3K0CA 1NIJA 3LQQA 3K53A 1UFQA 2WAYA 5LD2B 1JEEA 5LD2C 5JSZB 1VMAA 2AHOA 2ZAOA 5DI3A 3ZVNA 2FU5C 3GJ8A 1GKUB 3W5JA 4BGDA 4TT3D 3PUZA 1DEKA 3NDPA 1J99A 1I2DA 4QHSA 1M7GA 5L3SB 4DDVA 2UVQA 5AK0A 2ZRDA 5LBIA 2OFXA 2RGEA 3BERA 2P6UA 1W5TA 4KU4A 4I81A 1Y3AA 3GJ5A 2AXNA 1UKYA 2DFLA 4GOKA 4KO8A 1R5OA 2XJ9A 4GP6A 2ZTSA 2PEYA 3BOSA 2IYWA 2DFTA 2BBSA 1JI0A 2AWOA 2KSQA 1LV7A 3D8BA 3GQBA 3QEJA 5JS7A 4TL9A 1GFIA 5IK2D 3QXJA 2ZIAA 1JEDA 5CLQA 4LBZA 1S1MA 2B7BA 3Q7PA 4QKQA 3TSWA 3GLFB 3LD9A 3U5ZB 4C9BA 2F9LA 4E03A 4KFTA 1NI3A 3FE2A 3LFUA 3Q85A 4Z54A 2BBOA 1JNYA 3DHWC 1ZU4A 2JLRA 3MJHA 3NVAA 4S35A 1US8A 1Q57A 5BXQC 5K8TA 3WY9A 2QM8A 3GFPA 2HT6A 1XB2A 4Q03A 4QBFA 2IW3A 1GL9B 1W2HA 1GUAA 2B8WA 3AGQA 3FDIA 2QP4A 4LDJA 4PHGA 4GZMA 5FOWA 4IFEA 2JLYA 1PUJA 1G5PA 1SKQA 1XXHE 2J87A 3GJ7A 1A5TA 1CJMA 1FP6A 3RANA 1CF4A 1E4VA 1XZQA 2QQEA 3CX8A 2IS6A 1OIWA 4B35A 2D3WA 3U3RA 2E1RA 4M1TA 5HPYB 4EPYA 3FFAA 4PPFA 1YR6A 1Z6YA 4HZUB 4JBWA 3AVYA 1U81A 4GI7A 3RVBA 1XDBA 4M0LA 2IS1A 3LA6A 1SVWA 3FHCB 2Q9CA 1VYUA 5DGXA 2VP5A 1GM5A 3CNLA 4LGMA 1F2UA 3ICQB 1Z28A 4X8HA 3TH5A 4JLPA 1D9ZA 3HWSA 4DLSA 4B33A 4TLAA 4ASUD 4NPHA 2H57A 1X3SA 2FFQA 1KNQA 1E0JA 4QJ3A 5C46F 2AD1A 3SQXA 3NHAA 3ECCA 5SZIA 4FWTA 4ITRC 4OI2A 1YVDA 5FI1B 1KI8A 3H84A 4EUNA 4RD4A 2YWFA 3A1WA 3GEIA 4NU0A 3H86A 1SVOA 1TADA 4GNKA 5TXGA 3UMFA 5K8LA 3EZ9A 5FBRB 5KTYA 4M8NE 5DYIA 4TMZA 4C0HA 5E95A 4KSCA 3LQRA 4B44A 1CP2A 4OHZA 3MLEA 1OH8A 1ESMA 5G53C 1E9SA 1EFUA 1XZPA 3FOZA 2O8CB 1E2IA 4A0FA 3K0FB 1YQTA 4IVRA 4Q7JB 4U7DA 1GP2A 3AVXA 3UK6A 5AJYA 2YHSA 1PZNA 2BMEA 4KBGA 3SBDA 3UANA 4LPSA 5KHOC 1TQDA 2J5XA 3UG7A 2GJ9A 2OSBA 2X19A 4V0KA 4XWAA 1E32A 4BFTA 5TV2A 1JALA 5FTKA 4LHZA 5EP2A 3P4YA 3VX3A 2H18A 4DCUA 1YR9A 5BWMA 2ZRHA 1WCV1 4KXFB 4EPRA 3U60B 1P9RA 3W5IA 3BB1A 1UJ2A 3Q5EA 2FH5B 1EX6A 4KFSA 1IBRA 3W90A 1VG0B 3H1TA 4IDNA 2BEKA 1XXHB 4JL6A 2GXAA 4NTZA 2IWRA 1DVRA 1ZIPA 1CS4C 4B47A 3QKRB 3ADBA 2W6ID 3W9YA 1W44A 4A0RA 2RGDA 1VIYA 1XEXB 4DDWA 3ZIAA 3SJZA 3KJEA 4V0LA 1E9BA 5HE8A 3I92A 1OYYA 1XTKA 3BJIC 4DSUA 3THWA 5L3QA 2V1UA 2JLUA 2JA1A 1LVGA 1G17A 2D62A 2FPKA 1XBTA 2ZUDA 4DLTA 3RAPR 1SVSA 1Z6AA 1CR4A 1N5LA 4MRPA 2WJVA 3ZYCA 3IKJA 1S3SA 1ZC4A 2JDIA 4P32A 1ESNA 1G6OA 1E3MA 1IY0A 1GDDA 3EXAA 4NCKA 1T3LA 3B1ZA 3PJRA 1LTQA 2EVWX 1E98A 1KKLA 4AY2A 5KNCA 4JYBA 1KZ7B 3RC3A 3HR8A 3ADCA 3WNBA 2OLJA 5EE0A 3SBEA 3QXCA 2JJ1A 2WZQA 3CZQA 2ASEA 1E2PA 3DM5A 1AN0A 2IYZA 1T0JB 2X1VA 5BN3A 4ILEA 1DAMA 3L8ZA 1MKYA 5CLLA 3QG1A 2GZHA 2V1XA 1EFRA 4TLDA 4KAXA 3B5JA 4U00A 2IHYA 1XPRA 2VO1A 4TZ6A 3F3YA 4C0BA 4A4DA 1ZIOA 2IYUA 2F7SA 1XJ0A 2XSZD 1QHHB 1VCMA 5CDFE 4B3XA 3WNCA 1VKJA 3DVLA 2ZRIA 3C5CA 1DBSA 4FI3C 4BRWA 2I4IA 5H68A 1J8YF 2XXAA 3BFKA 1UKEA 5C4MA 1R0WA 5JLJA 4JLJA 2AKYA 4BFSA 4B76A 3WRYC 1KO8A 3M0EA 3KX2A 2DYKA 3PFIA 2OAP1 4IFBA 1RJ9B 4Q4AA 1EFTA 1P2SA 5M04A 2GDJA 2RGAA 5KSYA 1JBKA 1QHNA 1ZM3A 5J4KA 2O8DA 1G7SA 1XJCA 2YZ2A 2V54A 1G8HA 1VECA 1D2EA 5L3SA 1G16A 3W8RA 2F6RA 721PA 2QROA 4CW7A 5DE3A 4RD1A 2HF8A 1G3UA 2H5EA 2OAQ1 5IK2A 5TMPA 1YKSA 3MGCA 4D4JA 2R6DA 2R2AA 1I2MA 2ZR0A 3IUYA 1S9HA 4R9UC 4URXR 4LC1A 3R8CA 1AJEA 3K0AB 1E2NA 1NIPA 2HDNB 1FPMA 3ZQJA 4TWZA 1XPUA 4EIWA 4M1MA 1T0HB 3DEFA 4PC2A 5DSZA 3EAQA 4LBVA 1II8B 1NBME 3K70B 2GAAA 2H1LA 3K70C 4C3ZA 4QHTA 1N5IA 3RWOA 1F2TB 1GL6A 2O0JA 3LBNA 3M6AA 2PCJA 4NONA 4EFLA 1TF2A 1P5ZB 3QVVA 2UZIR 1N3BA 2W58A 3FMPB 1KTVA 3OEED 1KK3A 1XU4A 3RS0A 4MDEA 2R8RA 2CCKA 2J3EA 1NG1A 1OKKA 3OF5A 3AVTA 2IYXA 2DWPA 3AF3A 1XP8A 2QI9C 4BLQA 2RB4A 1JR3E 5FBQB 3VTKA 3A8TA 4MRVA 5AUQA 2RGNC 1N0UA 2IUTA 1M34E 4LJAA 4MRSA 3TIFA 1YRAA 421PA 5DNYB 4C0QC 2WIAA 1IJFA 3CONA 4Q66C 4KYUA 2FSGA 2VHJA 4W5JA 3NDBB 2FPMA 2ZRGA 2FGJA 2V55B 1KI6B 3NIBA 3UWKA 1GOTA 1Z29A 4RSGA 2XAUA 1P61B 3ND8A 2P2LA 1R7RA 2GBLC 2P6NA 3B78A 4C4PA 1QHIA 1X8JA 2NZ8A 1YZTA 4I1VA 4D4KA 4RZXA 2JLQA 1Z47A 4AWXA 1L2TA 1ZD9A 2ZYVX 4CGZA 3ZH9B 3ZVMA 3U2QA 4MA4A 4CF7A 4B3FX 4TQAA 2BMDA 4ZV4A 2QEQA 1ETUA 3LVQE 4YXWD 2PZFA 4AI6A 2ONKA 3S1AB 2WHXA 4MKGA 4H1VA 4A9AA 1U98A 1KZGB 3Q9LA 5JCZA 4D25A 2OCAA 2LCFA 2Z5FA 3I4LA 3KKMA 4HDCA 1NG9A 1NMXA 1HE8B 2O8CA 1NVUQ 1CTQA 2ORVA 4QNMA 1EFHA 1G18A 3QIAA 4ZI3A 4DB4A 1MABA 3K0FA 4ZO4A 3LAWA 4MYCA 4D0NA 5JJLA 4DT1A 1N5KA 5GVRA 3TUJC 5FR1A 4DEYA 1CR2A 2Y8EA 4TTPA 2JATA 5CK5A 1G1MA 1PLKA 2QPOA 2LWIA 3X2SA 4XSHA 4A36A 4BLPA 2P5TB 2WJIA 2B21A 4AKHA 4LV8B 5CJPA 4EKDA 3PV0A 5DHAA 5KNBA 3AVOA 1OT3A 3CB4A 3HYTA 3LBHA 4LJ6A 1XF9A 4UXJA 4M1KA 1OH5A 1XTSA 4Q9HA 2QUZA 4R2IA 1ZM9A 4AYTA 1OXXK 3ZLJA 4KFUA 3B2EA 2GNOA 4TYQA 4S2EA 3FB4A 4YDSA 1OIVA 3B85A 3FKSA 2A5GA 2RGBA 5FBLB 3X1XA 4K46A 3DDCA 2O8BB 3SYNA 4HUTA 4L9SA 1KI3A 2VSOA 1TEVA 1IXSB 1KJYA 4KBFA 4TL7A 1ZUIA 3WYGA 4M2LA 4C0KA 1II9A 2GEDA 4Q4LA 1HQYE 3QI2A 1OB5A 1Z22A 2N1BA 2GJSA 1XD2A 2X8AA 4TL8A 2G83A 4AYXA 2JLXA 4GT1A 1XMVA 4JSYA 2OXRA 4OJQA 4RD3A 4A6XA 5AJWA 1XTIA 1R0ZA 2NO6A 3AVUA 2MSEB 1NVVQ 2OBMA 3QKSA 2NZJA 1ZM7A 1AZTA 3PXGA 4PZLA 2ZAMA 3SJCA 3Q5DA 4Q4JB 2HXYA 2BM1A 3OIVA 4HUQA 1U8YA 5JBQA 1JXMA 2XSZA 4WW0A 2Z0MA 2EFDB 3CO5A 2A5DA 4B6FA 1DO2A 2AXPA 4JKIA 4EQ6B 1UAAA 3DMDA 1FTNA 2LKDA 1HTWA 1OXUA 4LY6A 5BYJA 2G6BA 3UKDA 5JHGB 2F55A 2XNDD 2GCOB 3IBYA 2OLKA 1LS6A 1FMJA 1W49A 4QGAA 2OCYC 1U9IC 2SHKA 3RSOA 4JL8A 1P2VA 1KI1A 4OYHA 1ZCBA 3O8RA 2V3CC 1YZQA 2A5YB 1WXQA 3QXHA 2YV5A 1CLUA 2WMNB 2OE2A 1GNPA 3UMSA 3I72A 3QJYA 1OXSC 2JAQA 1UBGA 5G3YA 2KI5A 4TMTA 3CRW1 3QF4B 3P1JA 4X8LA 2OEPA 1M6NA 1BO6A 3KJHA 4PHTA 5IF9A 1IHUA 1TNDA 4TYNA 4AKGA 2FX3A 4NMMA 3KL4A 3L0SA 1UBFA 1DAIA 4KI0A 1L8QA 2ZITA 2ORWA 2XTNA 3OIWA 4JZKA 1AS2A 2JASA 2AFIE 4OK3A 221PA 2JIZA 5EUQB 5JCPA 2IBMA 4BASA 4TYWA 1VHTA 1U8ZA 2ZYTX 2CLCX 4CEJB 3LXRA 1ZU5A 3K0AA 4ABYA 1OH7A 3V4FA 2OV2A 3W3AA 3TMKA 4G01B 5DIFA 3PIRA 2J1LA 2IWHA 4ZDIA 1W4CA 2C95A 2QZ4A 1ZVQA 1II8A 2FEOA 3JZMA 3IPYA 2ERYA 3OEEA 3IIJA 1Z3IX 5HCIA 2DWQA 1OLOA 2X77A 1ZD8A 4Q7MB 2QRNA 5EE1A 1KDOA 4V0ME 3ZQ6A 2ZI4A 3THXA 4AKEA 2J0VA 1KO4A 1QG4A 4MGIR 1W47A 2ZSBA 1NRJB 4NCJA 4ZPXA 2DB3A 5HCNA 2V6IA 3UATA 1T91A 3DL0A 5FOUA 5HZHA 1Z07A 3JVUA 2V8OA 1G64A 4IDQA 1SXJD 2C99A 5KDLA 2QQ0A 1KO1A 3VHLB 4C0SA 1KK1A 2O0KA 1NVWQ 2RGNA 1G7CA 4HB2A 3GLGE 2GZAA 1E0AA 1ONBA 3WBJA 2AKAB 1FNMA 4GOXA 4MGZR 2XB2A 2D74A 2KJQA 3WXMA 4AYWA 4NYIR 4P4TA 2DHRA 3L0PA 4IDOA 4XIGS 2DWOA 4HAYA 2ZROA 4US0R 4HI0E 3U7FB 5C2JB 3NEYA 1KI6A 1X8LA 3EZ2A 2ZI3A 4ACBA 4ON9A 4P3YA 4XVQA 4FW9A 1ZW6A 3ZJYA 5IDVA 2OG2A 3EWSA 4YXWA 1E1RD 2QE7D 3SS8A 4E22A 3EPJA 1U0JA 4C7OB 1KDPA 3UWOA 1QRAA 5B58C 3WHLA 1OW3B 3EIEA 1NVVR 2VSFA 1LY1A 3NTUA 2RGGA 3FYHA 1NN5A 5FOXA 1OFUX 2GF9A 4BFWA 3TBKA 2P67A 2PMKA 2Z4SA 4BZPA 2QMHA 1F60A 1U0HC 3BH6A 4XOIA 2REOA 3QQ5A 1M7HA 1YZNA 2KBEA 4HB3A
chains in the Genus database with same CATH superfamily
1WXGA 5BO5A 4Q9IA 1Z4IA 2WMDA 3IV7A 3LRTA 1APBA 1QRUA 2VHVA 3FTCA 1Y37A 3DFIA 4R8RA 4D9BA 4EGFA 5K3OA 1KHHA 2YC4C 1UC4B 2I7VA 2H8GA 3GZJA 4G26A 4BLRA 1GZ4A 3H1GA 4L6IA 1WBDA 2GYWA 5D5HA 2JD0A 5T5QA 1NUQA 4CCAA 4MJ7A 2GR9A 2TECE 4GHWA 5JD6A 3FSEA 1PT8A 4BO6A 1X7YB 3KU1A 1NM5C 1XJ5A 2RHBA 3GLIE 2CJXA 3A1TA 3BHIA 3RYIA 5HRAA 3CGGA 3DCNA 4E5YA 3L7JA 2G1JA 4IZ6A 3ROFA 3PVSA 1U11A 3DDZX 3AJRA 4RJIA 1ZIYA 3OE4A 4O4HA 5LUBA 5CNKA 5ISMA 1RZRD 4KN6A 4Z4FA 3GUVA 5K6AA 1YD7A 1A9QA 3HXKA 4LMBA 5TY0A 4DRYA 5B55A 4FFOA 3PNBA 2YW9A 1LV8A 4X20B 3ZWYA 2C9ZA 4RTLA 4BN5A 3OIDA 4DLZA 1KSGA 2DE0X 2DLDA 4NDZA 2QX7A 3BF7A 3D6JA 3UJDA 3EZYA 1GUYA 5CX1B 1AHNA 1EM6A 1N57A 1L5WA 2HSDA 3H9BA 1VHWA 2QPTA 1JHXA 3GL9A 2CMFA 3QVLA 3RR2A 4QFDA 5CA0F 5IMSA 1G21A 4R2HA 1NR5A 4AWAA 4BNZA 1BMTA 3PNLA 2H1OA 1OGJA 2I8LA 4ER0A 3H5WA 4GYYA 4PONA 2BUCA 4MKIA 3QXXA 1DKUA 1LTHR 4KIWA 2CNWD 2Q50A 4TV9A 3LHFA 3LC1O 1P62B 5FP0A 1WDKA 1ONSA 2Y2UA 3X43A 1WEHA 4Y6OA 1XT6A 4DR5B 4DLRA 4EUHA 1R9MA 1BQEA 2IXFA 3SHFA 3BL5A 3A7DA 5ALXA 4JMPA 4LNUB 3SAJA 4DG5A 3ADDA 5LXTB 1KI2A 5I9SA 3VV3A 1IL0A 4LYAA 4DAEA 3WBBA 1PUXA 2WJYA 4IKOA 4C89A 2BFPA 2Q5OA 1EJ6A 4PR0A 5IH3A 4F46A 1PR2A 2PAFA 2HRZA 2DBQA 2IEZA 3V4VB 2OO5A 5GV8A 2I6SA 1N2XA 4CPDA 2P9YA 1HE3A 5EIEA 1ZXXA 1TFRA 3QFRA 4A2QA 5A04A 2WZBA 2ZRNA 3DBOB 3O5AA 2IIQA 4RTMA 3DWFA 1DHRA 2WG2A 2WSYB 2JGDB 5ALDA 2GEUA 5JCJA 3CRNA 3U6BA 4I9GA 4P7JA 3JSAA 1MC1A 4R2XA 2DR0A 2YY6A 1GG5A 1V26A 3ZDQA 4FUTA 1FFEA 5IEBA 6CHYA 4IMJB 4AZWA 1DAEA 3IV9A 3L6DA 4GICA 4CIAA 3S3TA 2OZLA 4EECA 4GKVA 2FWNA 3HPQA 2QJRA 1OASA 3NUZA 1EVJA 5ILGA 2VNHA 1V37A 1ZINA 2ZSFA 3OETA 2IDMA 4K9KA 2PO5A 2VSXA 1CEQA 5KC9A 1TYBE 1U1CA 4J2OA 4LOLA 4JLMA 4MDHA 1ZIXA 4N6NA 4EDFA 3SHTA 3U31A 1UKZA 1OPXA 4B3DA 3EULA 1QHSA 3NBZC 4HVCA 4AROA 3C48A 2BSQA 3O3CA 4O3MA 4UD2A 2OKGA 2ZVPX 1T5IA 5ETJA 3DWIA 1YC2A 4Q4HB 1MIOA 1DKOA 4D3FA 5I7SA 1D8AA 3KAQA 1I24A 4UUOA 4X63A 4Q24A 2XUZA 1GTRA 2VDUE 4MRMB 3DMTA 3KJQA 4QO7A 4XKJA 1WKBA 2QTVB 1ACMA 4GX5A 3S81A 1GDTA 5J2UA 4FOTA 3T7AA 1K97A 4DWOA 1JPJA 5G1OA 2W2LD 3K7EA 5AKKA 4C08A 2WDZA 1NQUA 3BBPA 2ZQYA 2ZIVB 1LX6A 2BOVA 3LXXA 4HEQA 4WAUA 2FZCA 3H6HA 2DRIA 3MRSA 4XR9A 3V2HA 2E5WA 1Q22A 4QC2A 4CUZA 2HHHB 4BEJA 3M4JA 4HSGA 2HI0A 3NATA 2JGJA 3E22B 4PX9A 3KU4A 4U0JA 1UQRA 3R6TA 1V71A 3DEIA 4EO7A 2IY8A 4U7JA 5ES4B 4ESVA 4U7GA 4ZAFA 1ZNQO 1MPTA 4M9UA 1EPUA 2VDKB 3B6EA 5K0NA 4RDXA 1XRNA 5FOVA 5L3VA 3TIIA 1C9MA 2HBQA 1J5PA 1W0JD 4LRSB 4DAOA 2YMMA 8MHTA 4WXPA 1E8MA 4RENA 1RQNA 4AMBA 2GTHA 2H1WA 4MHSA 1NL3A 3BMCA 1P9WA 1Y98A 3H2ZA 1QYVA 1Y1LA 1TEHA 1EVKA 1JL3A 3LGAA 2DJ5A 4F92B 1U7HA 2GFQA 4UU8A 4EJSB 1DO8A 2EOAA 2ORIA 4BN4A 1NVXQ 3L6RA 4EJSC 3FMOB 1QPGA 5A3RA 5BMOA 3GPIA 1V4VA 2M9MA 1BXRB 3HCWA 3OY2A 4GPD1 5HJ5A 2VHWA 5MN5A 3NR2A 4BCBA 3AKEA 1K8ZB 2GKSA 3QVUA 5DEOA 1MFZA 1XGKA 5ERGB 5JO9A 5KDOA 2QQ5A 1XO1A 2C2YA 4CCWA 3CH6A 1AA6A 1EFCA 5CCDA 1IN5A 2I8AA 2QL6A 2QB5A 2UVPB 3RAGA 3E7WA 1GPKA 4HTFA 4PX2A 4JI4B 1JJ7A 1RI2A 3A2NA 2AN4A 2H29A 1POXA 3PNMA 3W5VA 5M04A 4JV5B 1Z9BA 2BHLA 1SKYB 3DAHA 4I4TF 3VNAA 1L4GA 1FUYB 3AQ4A 4LHYA 3VNUA 1IZ9A 1MA3A 3TVDA 3U4CA 4D3SA 1M2FA 4G1CA 4RABA 5LNK6 1VI6A 2BEWB 2CFTA 3GXOA 4MVJD 4ALLA 2DHEA 1N2CE 3AY7A 3OU7A 4KQCA 4LYHA 4CMIB 3AUSA 3ZLTA 2NADA 3MTEA 3QFHA 4MV5A 2AX4A 2QE7A 4D9NA 2O5EA 1CZKA 2OHIA 4DV7B 1HE5A 1W25A 1MQ8B 4J43A 3OQ6A 4DGSA 5BWOA 2I4NA 4MUJA 5ITZA 4K0KB 5FWDA 1LRKA 5AK4A 4M0EA 4CTOA 4FX2A 1FTYA 1QVZA 1C0EA 2OBBA 3S29A 1HM5A 3CCCA 5DRTA 4H0NA 3ZW8A 1XD8A 2XE6A 4XDZA 1E2HA 5F1YA 3DR3A 1QGUA 2FR1A 3RC9A 2H1FA 2CC2A 3ORFA 5KYWA 4JI2B 5SY6A 4RD0A 3NEPX 2FWPA 3DP9A 3G1UA 5LQUA 1G59A 3TQFA 1LI4A 2AK2A 1E96A 3H4TA 4LRXA 1ODFA 2RHRA 3NYRA 4M1OA 1ZBQA 5TIIA 4MR9B 5J4YA 2PMWB 3DBHA 4KOEC 1QF9A 1R4ZA 5T67A 3HGMA 3OECA 3ZWCA 3RSCA 2NTYC 4KPEC 3P27A 1T4CB 2EW1A 3DOFA 3R7LA 4BZXA 4MOWA 4JVNA 5CVUA 3S5UA 4B4WA 5K0EA 1GFSA 4YRIA 2RKOA 5K9ZA 3R7FA 5BQPA 1BEEA 1MB9A 4N0EA 4YP1A 2ZSIA 4F6LA 5LU8A 1I33A 4PLHA 3CLUD 1KOJA 1EM8B 3KTAA 1OFGA 1XX6A 3R24A 4RCZA 1AGNA 3ZDYB 1GR0A 1OI3A 3JCZA 1TM3E 5EXSA 1DCTA 5EMLA 1JSZA 2WJPA 3CF4A 5FORA 5JDIC 1R0SA 3T12A 5JJKA 3QMMA 5U4XA 2R9VA 3GN1A 4BQQA 3MINB 5AOCA 3ZDRA 5JQWA 1T34A 1GY8A 2QN1A 2Z83A 2I3GA 1DEAA 4AZ3B 3F6EX 1DTSA 5TF4A 3UBMA 3UK1A 2ISCA 4F7DA 4EF5A 1CFJA 4TQUS 3HHEA 3W9SA 3A3PA 1H8HA 1ISPA 4AMGA 4BRZA 4C7KA 5JBNA 3W5AA 1N0WA 3Q10A 3UMMA 1FDSA 1HFKA 4POAA 1ZH6A 1VI5A 4AXXA 1MGPA 1OFVA 4IY1A 2YV4A 3KQMA 1I7QB 1OXTA 2OV1A 4PPGA 3V9PA 1U2PA 3KXLA 4FQ7A 4DV3B 1XCMA 5TQ0B 5FPHA 3TEJA 3CVYA 2C42A 3U4DA 1UOPA 3OHMA 5E6UA 4O25A 5TLSA 5F76A 4D8YA 3K09A 1KH3A 2GHTA 2OESA 3E5NA 4NH0A 3VU9B 1GGEA 5FQNA 4MV9A 4FYIA 1TW3A 3B6ZA 4RK4A 1KS9A 3T3DA 1F7VA 2FPLA 1DTEA 2CUTA 3GCDA 3DUFA 3HBLA 2AYZA 3EDMA 2NYRA 4IMIB 3R4VA 3OEWA 5TEVA 2GO1A 4G5SA 5ALFA 2WINI 3MGKA 5B1YA 3CR7A 4UE6A 3JALB 1XEWY 4RMNA 5CDSA 2QLNA 1U3FA 2CDNA 1YDGA 1B2RA 2VSQA 3OVMA 4GMHA 2A4KA 1W4AA 3BE5A 4I1RA 4IH4A 521PA 3IKTA 2R00A 4S1NA 4RVHA 4DLVA 5A0TA 4QWWA 1UC8A 3PRYA 5JZSA 2ZI6A 4BUJA 2C7PA 1MMFB 2N47A 1JR2A 2Z1NA 2AJTA 3NKVA 3LPNA 4HLCA 1JB1A 1J70A 1C0KA 3CVOA 4EVRA 5EE5B 4W1SA 1QZ3A 1GFZA 3GJYA 1ECLA 4G5HA 4N49A 3SSOA 1KQ3A 1LW6E 5LA6B 1I1OA 2ABWA 2Z98A 3OKFA 2QSZA 3TQOA 4U5XA 3ZS9A 1RQ7A 2I4RA 4FYPA 4B82A 4PAOA 1KY5A 1LPBB 2GFHA 4HJXA 2VHCA 2WJ3A 4Z4IA 1DXOA 1L3CA 3EGVA 3FF4A 5KSZA 3PL5A 1V1MA 3B3AA 4R8MA 5U4QA 5C8YF 2X0KA 5KINB 4CMCA 5C8VA 1FJGB 2PR7A 1T2UA 3KQYA 3I9MA 4HDSB 2P3LA 4P5PA 4BVFA 5A7GA 1X74A 2J9FB 3ZV4A 2AR7A 3W3AD 5B2ZA 2Z9BA 8ATCA 3G79A 4ME6A 1RVDA 2DHDA 4IJKA 3LY5A 1OZ0A 3W77A 1VYTA 2NSDA 1NN1A 1NSTA 2ANCA 4O2BB 5IVPA 3CX4A 1P1BA 2O2SA 5A71A 4NOLA 2HJSA 3LWNA 3Q3CA 2VDLB 3B6IA 3BJRA 1JVNA 2WPNA 2XJ4A 1HE1C 1JNXX 1DBVO 3P2EA 1Z4MA 3VZSA 2RG1A 1WE2A 3ON5A 1AU9A 2F67A 1WB6A 4PYKA 4EENA 2GRJA 3SE7A 3PC4A 1AVTA 1X8XA 4LBWA 4NI5A 4X1YB 5IZCC 4KAJA 5CVVA 3K8OE 4FMDF 2MMCA 4YLGA 1NVGA 2Y9MB 1C81A 3AG5A 2GASA 2RI1A 3DLAA 3HJHA 3JVDA 3MJVA 5DHUA 1IULA 2QRVB 1UQUA 4HWKA 1FMFA 1L4LA 4XSGA 2XHZA 4RVDA 1E3LA 3UAYA 1PT7A 1UJBA 2I2WA 5ADHA 1OA0A 4B34A 2H1HA 1KEEA 4AJJA 1GITA 1VOTA 1IPEA 3ZGVA 4ZI7A 3U26A 2ZSAA 1BW9A 1SUWA 3MA0A 4XOUA 3LOQA 1HE4A 2E4UA 4CKBB 5HE9A 4HDKB 2Q1UA 3HCPA 1RJGA 5GONF 4NEQA 4CQLA 3IB6A 3VPFA 2DCUA 3T41A 1JAHA 4JU9A 4AZTA 1A9OA 3FYSA 4H77A 1MHTA 1XRJA 3LWDA 5TSDA 3ZWVA 4MP8A 3TS1A 2VRCA 4DF3A 2B8EA 4QQFA 2BI4A 1ISIA 2AWNA 4AJ1A 2VTBB 5FPTA 1OYWA 1Y6JA 5CH3A 2A5JA 3GJ4A 2O1XA 2P7IA 2RAPA 4PXSA 2XNHA 3W5BA 4ZGGA 3A4NA 2R7NA 5CXQA 3MWKA 4CIVA 2WFAA 4LX8A 3VR6A 3A9TA 4MW1A 1J8DA 1P91A 3BMQA 5ARBA 1D07A 2FVYA 1Q1AA 4L3WA 4NENB 3RG8A 4PYJA 3JQBC 4R1MA 2ZJ2A 2R6AA 4MVJG 4TYMA 3TWOA 3DE0X 5BW5A 3R4CA 4D02A 3QEMA 2I1QA 1V1RB 5JNWA 1S8NA 1M8KA 2P2SA 4NLLA 4Q7KA 4F4JA 1ZH4A 5MHTA 3JR3A 4AN1A 2GETA 4BRSA 3WGOA 2XT0A 1FE8A 4IEIA 4LMAA 4OQFA 3MFQA 1Z5ZA 4TUYB 1DRUA 2WFLA 3BK7A 4ZREA 3TQCA 4RESA 2EJBA 2AFRA 4UMFA 3KYDA 3T7DA 4ENTA 3F7TA 4JH0A 4XX1A 4ZFNA 2GERA 3O4GA 1NBMD 3PF8A 5TDHA 2H06A 3R3HA 4J3JA 5C4GB 1QCZA 4IIYA 3FHTA 4JENA 1W88A 2EJUA 4UNQA 5GVSA 4AUEA 4BFUA 5GZ1A 1B8OA 1SO8A 4MS4A 2C7OA 2GN9A 1NJ8A 3NXKA 1QH1A 2BDTA 3ER6A 3OA0A 2IS4A 1IHPA 3QKRA 1TGVA 2V7EA 1EXWA 1HYQA 3DE1X 2YN2A 3HU2A 3N70A 3QLVA 3UWMA 1GA1A 5CFRA 1JFTA 3HBFA 1F7UA 3DZJA 1N32B 5FA5A 4O3FA 1AKEA 3IULA 3L7CA 3GLUA 1TAQA 1BAPA 1T9AA 1P8JA 1VSUA 1Z74A 2DUMA 2H92A 3BMOB 3QGMA 4R5MA 5CGZA 4CJXA 1YDFA 2H2WA 1IBKB 4JJ6A 3WK6A 4CLRA 4KHPB 1O95C 1JR3D 2OQIA 3QFCA 4OQYA 5FLKA 1PJTA 4M7OA 4EUFA 1U2DA 4Z8XA 2C3UA 2J41A 3PHHA 4RD6A 4BNJA 4BNMA 1E99A 1GQOA 2JI8A 2VXCA 3NBYC 1ORRA 4V0NA 2HTEA 1AV6A 2B7CA 1A97A 1DQYA 1SOUA 2EBWA 3CN7A 3TUIC 3MGBA 2YWEA 3GUHA 1ZMOA 4Q18A 3PGKA 3HWWA 1HY3A 3I83A 4B7CA 4XVUA 1NASA 3B6MA 4FLFA 1KI9A 2O1EA 2PUJA 4JROA 1U9JA 1M54A 2OSVA 2AD5A 2IHZA 4GBED 4PGMA 4X45A 3HE3A 3RRJA 1ZOIA 3HDJA 1OGIA 4B4VA 1V95A 3DYBA 3NRJA 1H9AA 4E07A 3I6YA 2GCIA 4L73A 4MQEA 5CVTA 3MIIA 4D8VA 5TS2A 3EXG2 3K5PA 1RM5A 2IOQA 2CLDX 3R8XA 1CR6A 1YQXA 2OM2A 3OLZA 1TK2A 4R71A 1K6EA 2LR0A 3GXBA 2X0EA 1R6XA 3LNCA 5IKMA 1PJRA 3Q6NA 4WJKB 3ZZ0A 2J85A 4E5VA 3LRPA 3RARA 5CBPA 4JR0A 4BMNA 4XGKA 1BX3A 1QDUA 4KW7A 4IQ8A 4A2WA 2TMGA 4HDNB 3SR3A 3DMRA 2ILVA 1FPQA 2GH1A 3SG0A 4JJ7A 4UTOA 4XQEA 4C0WA 3AL2A 2IH4A 1GCUA 2WBLC 1SZJG 2VHQA 4JGIA 1ZUWA 3FGNA 3G02A 1GA6A 4R3WA 4C0LA 4Q00A 4XPIB 4XTCS 3UIEA 3KJZA 3N8IA 3W1EA 4PLFA 3NT4A 2I9PA 4MARA 1YVRA 3RM3A 3TZ6A 2BMVA 4KQ6A 1O3YA 2XUGA 2WWFA 1RJ9A 4TWAA 4UD6A 1RZUA 1WS6A 3DNPA 4K2AA 1PQWA 5F98A 2NP6A 1DWQA 5JS2A 2BEVB 4R1TA 5B3LA 1YA4A 3C3BA 1TC1A 3U0BA 4QWMA 3EJ6A 4GI1A 1BYUA 1PEAA 3B3JA 5ENVA 1RXWA 5DKFA 1UBNA 1PFWA 2QPAA 4KK4A 5HKOA 3FTQA 1GGVA 1UP7A 1GKIA 2CBZA 1BQ4A 1H0RA 3L82B 3O4JA 4K5QA 4WBNA 3TSOA 1E9RA 2XT6A 4J1QA 1X92A 1GNQA 1S9DA 1YB5A 1M2NA 1U4NA 2FA9A 1OXKB 1E3DA 1PSZA 1K8YB 4ALMA 3I5YA 1NP6A 1FUEA 2IF2A 2C5LA 2YS6A 4H27A 1PZXA 2H6EA 3ETLA 4AO7A 5JEEA 4PAQA 5A3SA 1SBNE 4EM6A 2O5VA 2CLIB 3E9CA 5M7EA 3H9UA 2PMFA 1P3DA 1KC1A 2V4UA 5T41A 3W6UA 1NONA 2ECKA 5DRYA 2R1VB 3RREA 3L04A 4JBYA 4EYEA 1DAPA 2BE7A 2VXOA 5BRNA 1EFLA 4IHAA 5J2TF 5ESDA 2V6JA 2DJIA 3SS9X 2YOGA 3R8FA 3KKNA 3VOBA 1C4OA 3F96A 5AUPB 3K4PA 3D8HA 4FIDA 4WCFB 1G4UR 5BNIA 3TRDA 4NBKA 1DC3A 4WCFC 2R6GA 2ZATA 2B78A 1LSJA 2PBZA 4XD7D 2I4OA 3DPUA 1YR3A 1JJFA 2BEJA 5BN5A 1RW4A 4EF6A 4B32A 1EK2A 2UUCB 1TUBA 1AMOA 1CUIA 1K92A 3OZBA 2HKIA 3SJBA 1U99A 1ZRSA 2FFAA 1AUOA 3QPVA 5IARA 1GCIA 3BCSA 4RO0A 5D01A 4JS0A 3C15C 4TTRA 5LDGA 3RKUA 2J0SA 2RH4A 1Y3CE 1F6DA 1IEQA 2QY6A 3SICE 3DMHA 1EK1A 1BX0A 1TAGA 5JRJA 3K1AA 3ASYA 4RVCA 1G8PA 1FFCA 4CKEA 5EJ7A 3FOCA 1WXIA 4EW1A 2VH2A 5JC1A 2L69A 5JAMA 3WZ2A 1K66A 3QWIA 3WLOA 3DO8A 3B9PA 1MEOA 4RTPA 2V8BA 2HZBA 3L4SO 1LFDB 5HEKA 3V8NA 2JJ2D 2O14A 2P78A 2X86A 4OO3A 1BMQA 1KYIA 1V3TA 3CZPA 4KQIA 2ZUSA 2P77A 4KXYA 4HYEA 4K3VA 3L41A 5BQFA 5KPDA 3QV1A 1Y8ZA 5K3FA 1YVUA 3BGOS 4BMSA 1I0LA 2PZBA 1HV8A 4CQMA 4N48A 1BEUB 3G9XA 3EDYA 4D98A 1WSAA 4ND3A 4L9AA 3BSFA 1IMJA 1EK0A 2GCGA 2QGFA 3EA5A 3GDHA 2OORC 3H8JA 4G07A 2NN3C 4XIFA 3QVJA 3JASB 3BE4A 2YYYA 2DTEA 1VE5A 3KUUA 2G71A 2WTNA 4WKBA 1KU6A 4P8RA 3OZDA 1L7NA 2NO5A 3MOGA 3O47A 2C2WA 1JDUA 1DIOB 1TAHA 2XOKD 4QJ4A 4D8XA 2C88A 4W5WA 1G9XA 2CVHA 3ESAA 2GK7A 2N46A 2WNHA 5EWMA 3HV0A 4LHWA 3LCJA 3CVUA 1BCSB 5DHFA 2ZSHA 5ELXA 3J7TA 1FB5A 1RJDA 2IPAB 4H4EA 4LYDA 3ZQKA 4D41A 1H2HA 1B6GA 1N5RA 2ZE8A 4TS9A 5F3WB 5HMLA 5LOVF 5CG1A 4F5WA 1OIXA 2AMLA 1SVNA 3LZCA 3PUIA 1WPGA 2EGHA 3UOAB 3AF1A 3M4YA 1BA2A 1WTAA 1IN8A 4YLEA 2A7XA 3AOGA 1T29A 3JAKA 3FOAA 1OT5A 4KN5A 3TEMA 3FGPA 1YB7A 5JSUA 4MYRA 3B2QA 4M9QA 1IN7A 4GR5A 3KKZA 1IM2A 1EI9A 5KO2A 3IEUA 4IRUB 2GM4A 1AZLA 4M7PA 4F9EA 2CL6X 2VSYA 4I9HA 1CJUC 4BAUA 3CUWA 2B4TO 2REQA 2BKLA 2IYNA 3NFYA 4AMUA 3RAEC 2A7QA 2RHOA 3ILSA 3K16A 4OLFA 2JBAA 3H1AA 4BQIA 1B0ZA 5E2BA 1XHLA 1E6EA 4LXYA 2IBSA 3Q3VA 5LZ4A 2DCMA 1WRBA 3MN1A 4B6SA 3C14C 1PWZA 1BVUA 2CK3A 1UANA 2C5SA 2V7XA 2QKYA 2VWHA 3P9ZA 4LY9A 5DZSA 2O2DA 3R7DA 2F4NA 3ROGA 2GZDA 2ROQA 3WWZA 1VB5A 2W48A 3P45A 2HXSA 4C03A 4MWZA 3AF4A 4QUAA 2JVJA 5KYGA 1VMDA 3JARB 3LCVB 3LQKA 3IAXA 4G1BA 2HA7A 3LLCA 5HFJA 1XDDA 3IEPA 5DTIA 3BULA 4P82A 3WZMA 2BF7A 3ZTTA 4B09A 4BCCA 4U2DA 4H17A 1DB3A 3TD9A 1GWNA 1USKA 4NBTA 4US1R 3SYKA 3ZXYA 3GMIA 1EP2B 5B4UA 1Q21A 2J6HA 5A5VA 1KA9H 2PAAA 4UULA 7REQA 1PWHA 4Q1VA 2A0XA 1JR6A 3G2MA 1AK2A 3LU1A 3QWAA 1QS0A 3SHWA 1JTFA 2TS1A 4GS5A 4DJ5X 4F4CA 1Y9JA 4X90A 4ZOAA 1YZHA 4D6XA 3LT0A 3T5MA 1XLTC 4M49A 4YJ3B 1QV9A 5LMZA 4IEEA 1CUHA 2J7PA 4RS3A 1ADBA 3M3DA 5I9NA 1TT5A 3TDNA 1AUVA 3J81A 5IT0A 4JIMA 4KITB 2DBYA 3I9FA 4W4TA 4YP7A 5HM8A 3Q8KA 3BIFA 1KIMA 2ZGVA 4M8IA 2ZIXB 4C30A 3H5NA 1G9SA 1RAHA 4Y6QA 1JA9A 1HO3A 2O0MA 1KFKB 1N2ZA 2FR8C 1WQ1R 4UU0A 1UPXA 2AA3A 3S2ZA 3UGTA 2EBFX 10MHA 4BWVA 3G0IA 1XTZA 2EC5A 2O7QA 4PSVA 4PLTA 1U9IA 2G07A 1THZA 3IMGA 5F1KA 1FP4B 3VKHA 1H85A 2X6QA 5CH5A 3V1LA 3OPMA 4MUBA 5IJ0A 1RLTA 4RVSA 2ZT8A 5LMNB 2QLJA 1H4VB 4XGIA 3UJHA 3H4VA 3GRUA 4UTXA 1BTOA 1TU0A 1U3GA 4NABA 2CLOB 5D3KA 3UNXA 1VI2A 4A2CA 5JH7A 5C80A 3TKLA 1P18A 4O0LA 1XCPA 3EIFA 4QEZA 3Q3EA 2Y76A 4Q15A 4RXUA 5BORA 1M2EA 4YCLA 4W5HA 1RT9A 2YZMA 3DPSA 5K0CA 3C7CB 4I9FA 5EWLA 4UASA 1J24A 1EYZA 4RM3A 4QDJA 2DPYA 4TTVA 2R8ZA 1X0XA 2ZRBA 4N82A 4Q7EA 4TRMA 3IRVA 4GUDA 4RZUA 1Z7BA 1XRSB 4ZVLA 3SFZA 1MC4A 1CHDA 2P7HA 3LP8A 4X8MA 1UMKA 1JDNA 2LPMA 4R1LA 1AGPA 4OBWA 4P7FA 1PGJA 3BVPA 4G0WA 3EAGA 1JEYB 1G63A 4PNHA 3DMPA 3EDCA 3ITEA 5HQJA 3SXUB 4C05A 3LX5A 1D2AA 3RVJA 1L8LA 2RAVA 3Q7EA 1XVIA 4IDGA 1EQ2A 4HP8A 4GI3A 3NUGA 3LYAA 4F1WA 3DYIA 5SZHB 5JAOA 1JILA 1PHRA 2XKJE 2ZUBA 1H2XA 3QEAZ 3TGPA 4YK7A 2J0EA 3BZWA 3KE8A 1O8BA 2JH3A 1UBEA 3I39X 3R09A 3UJ7A 4GC5A 1R0BA 3V1MA 4X66B 3ZD7A 5JECA 1KFCB 1ZKMA 4DRXB 1YCGA 1XTJA 2ZLBA 4RHXA 2BFAA 3MD9A 1JEQB 2QG9A 5ALYA 4FINA 3DCIA 4II2A 1HFEL 1AXRA 1R66A 3GOHA 1M1YE 1Y1SA 1EQUA 1VRWA 3AI3A 3DEAA 1K7SN 4HH1A 4URUR 1C2TA 5GTDA 2ZUTA 3IA7A 3E9QA 1HZJA 5EJMA 4W5OA 1NF9A 3M83A 4RZ2A 2XE4A 5EJFA 5GGXA 3TR5A 2H2FA 4YHHB 4QUEA 4I5FA 4DLPA 3CEPB 4W9MC 1V5WA 1VJTA 4Q3LA 5P21A 5BMVA 4DM7A 2VPIA 5CM9C 2D1RA 3LUGA 5CVDA 2H5JA 2H7VA 3RQSA 4QUBA 1JU3A 4YMUA 3AP1A 3EMKA 3SKXA 4U8HA 4I1UA 3QEBZ 1ICIA 2FHPA 4AJNA 3X2EA 4QYTA 2IGTA 3P71T 1NJ6A 2D1YA 3ENZA 4RY2A 4BNVA 3GJXC 4CUKA 3UKOA 2R25B 3LUBA 1X77A 1P4AA 3D1VA 3LLVA 5KUTA 1ZMXA 5F52A 5JS1A 3NGLA 3HL0A 5D87A 2B4AA 5JFTA 4PO1A 3KCQA 5DHQA 5DYTA 2VLIA 1H4TA 1PGQA 1R5BA 4IAOA 3RVMA 3AU8A 4QASA 1EFPA 2ANBA 1RKBA 3BWBA 2E6UX 3UT0A 1RQLA 1NLMA 1HOTA 2YRFA 3IIKA 4RUKA 3F7MA 3FN4A 4FZRA 1O9GA 1ZK4A 4HDQB 4O8CA 3E9RA 1XLUA 5E8RA 4FLEA 1OWPA 3UPDA 3OICA 2OBXA 3DD5A 2P8SA 1I3NA 1K5GA 3DC2A 3HA5A 2HH9A 2QN2A 3HHPA 1NPYA 4PICA 4X97A 3VC1A 2W2NA 4HJRA 1FX0A 2YX1A 4RVOA 4M1YA 1BVYF 1OROA 4QJ5A 5I7EA 4EEXA 3UC9A 4P0QB 1OFIA 3G1TA 1EVLA 3NM4A 1SVMA 5K45A 3I1FA 1SU7A 2PR2A 4BS9A 1JSCA 1MDBA 1T15A 2ZRJA 4LQLA 5AM5A 1EBBA 3MB8A 3G0DA 5JFOA 1EEHA 4G84A 3E2PA 3K9HA 3DVAB 2J6CA 4NFHA 2IV3A 4GKBA 4UUMA 2C92A 1XZLA 4U2BA 4DLUA 1IZ0A 1IWOA 5IF3A 1QYRA 1RSZA 2AF4C 1XNJA 4Q3EA 2CXQA 4YRCA 5FUVA 3UK2A 1HSZA 2CKDA 5HW0A 3AR4A 1T2VA 3M1IA 4OLHA 3U13A 2H52A 4EW6A 1GJRA 1FFBA 1QIEA 1OOEA 4ZI5A 1N7JA 3UA4A 5FT9A 4JITA 4KAAA 4BQFA 3SSNA 4M9RA 5AVVA 5M5BA 1BXGA 3K8ZA 1R64A 4FFNA 1YB4A 3TAHA 2B4QA 1D2HA 4XEUA 1B73A 4EMSA 5AESA 2J0UA 3P2MA 3IQFA 1IG3A 1G6KA 3JVIA 3LX6A 1CCWA 2A9RA 3HEAA 2AOUA 3CJTA 3TX6A 1O6ZA 3LTEA 1FVFA 2C8VA 2OUKA 1FXSA 3NXSA 1NW8A 4HYTA 1X1AA 3E5HA 2W4QA 5DX1A 1H65A 1ISFA 1SHJA 4TOIA 5H59A 3AQIA 1PW7A 5TNXA 4RSMA 2QYTA 2V6BA 3L18A 1TCUA 1FFSA 4PS0A 2IEAA 1X1SA 3KXIA 1RP7A 1X0VA 2BIFA 2EEZA 2P40A 2WIBA 3KQLA 2BR3A 4DGQA 1N2CB 4URYR 5DCWA 4KBYA 3ZUGA 3TUZC 1P1HA 2CHGA 4PZZA 1E63A 1RPTA 3IQGX 1KJWA 1T13A 3QZUA 4IICA 5CM8B 5T3YA 3WLMA 3HXOA 2WF5A 1N6LA 3L3BA 3ETHA 1RHQA 1B1CA 3RSZA 2D2VA 5AOVA 3KHSA 2JLAA 1VIDA 3IQDB 2NYUA 3PDUA 1V5IA 3GFOA 3KV1A 3OEHD 1RFLA 2UUPA 1J2JA 4R41A 4WBSA 2JAWA 4WXRA 4BFLA 1QQAA 1JQLB 1UDRA 1ZRNA 4QBTA 2V0GA 3VO8A 2PSJA 1SBZA 4EKNB 5FF9A 5T4HA 1JE0A 1E1NA 1P9NA 3MOSA 1OH6A 2EV9A 4P4SA 4JOQA 3CIOA 4N3GA 3FI0A 4A26A 2CD7A 1IY8A 2OCPA 3JD0A 1DZIA 1IHDA 2XLBA 1TO1E 2YYSA 4HGOA 4TL6A 2VQ6A 3C8UA 2SCUB 2VEDA 4LJSA 5AVUA 2RIPA 4PVDA 2AOWA 3I6BA 5FTLA 2LDBA 4REMA 2XE7A 3NW9A 1T5HX 3OUZA 4AY4A 3IESA 3N2IA 3NAMA 2P9HA 3DSRA 3P9RA 2Z58A 4PZ9A 3ZHXA 6LDHA 2UYHA 3EBPA 1ZJJA 4PYNA 4UVIA 4WKGA 4RA9A 3EGXA 5LB4A 4OFXA 4B9EA 3GLHA 4HH3C 1F5NA 2AL7A 1COWD 3QVWA 1DS6A 1SY7A 4ECAA 1D1QA 3FY4A 4PC7A 5TGZA 3F6YA 5CFLA 2WQ7A 2EP8A 3W3ZB 1H2FA 1UBHS 4BOYA 4FHFA 4XJTA 3KKLA 5BXQC 2G1PA 5A0VA 5A9SA 2JGEA 4YT2A 1GT6A 3NT5A 1H66A 3ZBQA 3IUJA 1Z0IA 3RS3A 3PRKE 4FYXA 4HCJA 2PZJA 4U02A 1E7SA 1GPAA 1O4WA 1UKVY 2Q4DA 3FWKA 3E3AA 4XDHA 5BWCA 1J7KA 4KODA 3BGDA 2JK0A 5JNSA 3AKDA 4NPAA 1EVIA 1WZEA 3DKPA 4FDAA 4TN5A 4WECA 2G40A 4XD2A 4DUYB 2VT3A 1VYVA 4E22A 1Q19A 2VR1A 3JYLA 3T3PB 5LIPA 4K9DA 1EGQA 3KSAC 3OTOB 5IC5A 4IMRA 1CJKC 1ACJA 3MNFA 4LVCA 4QOIA 5H7XA 3FZNA 2NO1A 3BIWA 2B4KA 4N3NA 1HXHA 2JFBA 1EP9A 2E4XA 1NLZA 3CWQA 3N2LA 5FPKA 2ZT7A 3NHBA 2CVFA 1QE3A 1MVNA 1U7TA 3FKQA 4ZMSA 2XMGA 4RKYA 3WDMA 2HM7A 4TLCA 4MGYR 4G24A 3P9SA 5COAA 1V8FA 4HAZA 4M9ZA 1G21E 4PSDA 5BSRA 2IYQA 3DWEX 2CVPA 5IT5A 4OB8A 4YO7A 3Q72A 3EEQA 5L6MB 2SECE 1WDMA 3L01A 2QX8A 4HSEA 4TSFA 1RHJA 1ZN2A 3AR2A 2HX1A 4U7WA 4MQFA 4YECA 2IHKA 2J33A 4BBAA 3K4QA 4FWBA 5FCDA 5FNVB 3AH8A 1WWKA 2H0QA 4UVGA 1LDGA 1I2AA 3QELB 3T3GA 1UQTA 4DLYA 4RJJA 5LC1A 2G0NA 3SEFA 4BNTA 4DADA 1MG5A 2WE7A 4CU5A 3SKYA 5DGTA 1DXQA 1E1CB 4XI9A 3VYSB 1AKYA 4D4LA 1MW8X 1GSIA 1P74A 4M1SA 3B52X 3H17A 3HCRA 3W7BA 5DTEA 1UP4A 5DNWA 3T4EA 4CEHA 4DNPA 2AQ8A 1WMAA 3AERA 1Y1TA 5DLQC 1N7GA 1OMOA 1QP8A 4OJNA 4ZYVA 4HRYA 1XG5A 2LCIA 5GV7A 1NW7A 1U0LA 3K2BA 1CERA 3PKZA 1E8DA 2CCGA 5HFAA 3EGOA 1GFWA 121PA 3Q98A 3UJ9A 2JGLA 2ODAA 3AJ9A 2H3HA 3IQEA 3VPCA 3G2NA 3WR5A 3FYDA 3SZUA 2WJZB 2F3QA 4KREA 2IUFA 4PGFA 4V2UA 3BJEA 5CD9A 2C98A 1W52X 2HOQA 3T9EA 3BD9A 1VPEA 3WGGA 2CLLB 3AR8A 4ZO6A 3RV3A 3GJ3A 2LIPA 1N6RA 4MVJM 2BGNA 5LXTF 5IJZA 3T7TA 3U3MA 2ZCUA 4P92A 2O9JA 1SEPA 1IZ7A 3ASUA 6PFKA 4PO9A 3ZJTA 3AZQA 2DY0A 3OLYA 2PU5A 3BWDD 4LJ4A 1NMYA 4KSBA 2OV8A 4P31A 1NF3A 4Y1RB 1HQCA 4FMCB 2NACA 2AJDA 5CX4A 2HDOA 3N76A 4UFNA 1M6HA 1PZHA 3WOHA 2QZZA 5JVDA 3MG9A 1XKTA 4KNVA 5AFSA 2AVDA 2OILA 3C7TA 3GMSA 1N33B 4J2HA 1J2RA 1EAMA 3GC6A 4IPTA 1WBJB 2Y1EA 3NHKA 3TZLA 4BMCA 1V2GA 4MVCA 1GZDA 3LS2A 3MLBA 1B0AA 2OHOA 1QIDA 4WK2B 4J0HA 1PV1A 2P9EA 3PEYA 2W6IA 1BGVA 4PGAA 2FPGB 1KXJA 2CT8A 2ZRLA 3EZFA 2ZCJA 5AVKA 3ZV6A 4BWGA 2A30A 4ODIA 2FETA 3EW9A 2X5XA 2XD4A 3DE3X 2WA2A 3THYB 3IUPA 3JAWB 3LV8A 2B6HA 4F72A 5HX7A 1Y4ZA 3NG1A 1JQJC 1QLWA 1J7JA 1O95D 2WR8A 4G3XA 4GUAA 3FNBA 5JE8A 4NE2A 3WB1A 1BFKA 3GNSA 5CB0A 3BWYA 3WGKA 4EARA 1KYTA 5FEUA 1TCBA 5FUWA 1PO7A 1N3YA 3C7KA 1XTUA 4K6FA 3KK0A 3AFNA