2CL6X

Crystal structure analysis of a fluorescent form of h-ras p21 in complex with s-caged gtp
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
166
structure length
166
Chain Sequence
MTEYKLVVVGAGGVGKSALTIQLIQNHFVDECDPTIEDSYRKQVVIDGETCLLDILDTAGQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKSDLAARTVESRQAQDLARSYGIPYIETSAKTRQGVEDAFYTLVREIRQH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Newly Designed Microspectrofluorometer for Kinetic Studies on Protein Crystals in Combination with X-Ray Diffraction.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Nucleotide-binding protein
molecule keywords GTPASE HRAS
total genus 64
structure length 166
sequence length 166
ec nomenclature
pdb deposition date 2006-04-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF00071 Ras Ras family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cl6X00
2X2FA 1G5TA 2ZJ8A 4AC9A 4ZPXA 1N6HA 2PEYA 3DKPA 3BBPA 2REOA 3I4LA 2CMKA 1KYIA 4DDWA 3HU2A 2EVWX 4X8LA 2Q21A 4PR0A 1CKEA 4Q4AB 3KQUA 2AXPA 1AKEA 4RD6A 1K8RA 5AUNB 2XTMA 3OIWA 1G21E 4LYJA 4NZYA 1D9ZA 4II7A 4DBLC 2KB0A 3UG7A 4ZI2A 1YJ5A 2CNWD 1RJ9B 3QKRB 3MJHA 4TLAA 2GCOB 2W6ID 2R6GA 4KVGA 3FOZA 1AZSC 1VCMA 4B47A 4JVSB 5J4LA 5D3MA 1UPTA 3A4MA 4LJ4A 3KUDA 5B58C 2Z4SA 1OXSC 5L3QA 5DYIA 3H86A 1G19A 3OE7D 4M1YA 3WNCA 1E9FA 5EE0A 3NHAA 2H17A 1CLUA 1DAIA 1XTQA 1Z22A 2PJZA 4Q7MB 3SFZA 4TYPA 2ZEJA 1UEIA 3KQHA 3TVTA 1CJUC 1KI6A 4WXPA 4B32A 1DAKA 5C46F 3EWSA 3KDSE 1NKTA 2D3WA 2Z83A 2RHDA 1G17A 1VCOA 1ZU5A 2ATXA 4QGFA 1OPXA 1KGDA 4C2TA 4ACAA 2WZQA 1YVDA 2W58A 2UZ3A 5TV2A 4Q47A 1E9SA 4X8HA 4D81A 1ZU4A 1R5NA 1T4GA 2WWFA 1FX0A 2D2FA 2J9RA 4BEJA 2ZRLA 5BWMA 1DTSA 4LHZA 3EC1A 1NMYA 4XJXA 3FTQA 3K0CC 1QHHB 3EZ6A 3MWJA 4HEJA 3VNVA 2O8FB 5EXPA 1L4UA 3QEOA 4BZXA 2IWRA 4PHTA 3NBZC 1E99A 2DR3A 3SC3A 5DISB 4IEEA 4OHXA 3ZZTA 4Q4JA 4TT3D 4ILEA 4WA7A 4BLSA 2GZDA 1TL7C 2IEZA 4G3XA 3S1AB 3LXXA 3FFAA 1G3UA 1ZRHA 2ZJ2A 2JIZA 4MRNA 4QG7A 1TF5A 4HLDA 4JS0A 4JVNA 3W6NA 3R9IA 2GZAA 3V00A 2P67A 1IN4A 1G16A 3DPUA 1G8FA 2FA9A 2VP5A 3BGWA 3W8RA 1VCIA 4L4UA 2H8KA 4HAYA 4W5JA 2KBEA 1S1MA 2IHBA 1W46A 2PZFA 5AJZA 3T5GA 4DC9A 1DAMA 1XTKA 1Z08A 2PLRA 3NBFA 4HDOB 4JSTA 4LOAA 4XWAA 3G5UA 3SYLA 4D4KA 2HXSA 1UEJA 4JLOA 3K0FA 5L3QB 2HF9A 3CF0A 4JSYA 1VCNA 4LBWA 4Q1BA 4B3GA 2O8EB 3WYGA 4YXWA 3A4NA 3C14C 4LHVA 1E79D 2ZR0A 3TW4A 4A0GA 4E03A 4TL8A 1NL3A 3CBQA 1GNPA 4DCUA 1W5SA 4MYHA 2RH5A 4Q4AA 4XWOA 3QPWA 4LHXA 2W83A 4QBIA 5CDFA 1DPFA 3T34A 1NKSA 2JJ2A 2B6HA 3NWJA 2YWHA 3KJEA 2JJ1D 4PAOA 2QSZA 5DE3A 4MYUA 3SQWA 1Q20A 3K09C 1A2KC 1CIPA 4I81A 3TLXA 4BFUA 4A15A 4CEHA 4D4MA 4URVR 1G3QA 3W3ZB 5FUYA 4D0LB 3HP1A 1GOTA 1KDOA 2VRWA 3Q9LA 1VYTA 4FWIB 5LD2B 5IK2D 5DLQC 3A58B 4YMVA 4PFSA 2G6BA 5BN3A 2WAYA 2IYRA 1R10A 4POAA 4N1AA 4QHYA 1KMQA 4NCNA 5DGXA 2CHVA 2R2AA 3QEJA 5AJVB 4LJ8A 2BJVA 3QXCA 3PUWA 4D0NA 2ZYVX 2Q9BA 1FX0B 3B9PA 1OFUX 5C4GB 3V9PA 2CCGA 3OZXA 1JALA 3FE2A 3WBJA 3ZIAD 3IGFA 5JWOA 4M1TA 2W2VA 3NBYC 3SU8A 3KJHA 2GHIA 3AF4A 3BB3A 1YR7A 3MMPA 2W6IA 3JZAA 4MUAA 4BFYA 3U5ZB 4Q1AA 3WHKA 4S2EA 2ZAMA 2C99A 2NQ2C 4RD2A 1M7HA 2EU8A 3AKDA 1DO2A 1H8ED 2CVFA 3CW2A 1TF2A 3K0SA 4CDGA 1WCV1 2ODEA 4FD2A 5HE9A 2FSIA 4RD4A 1G7SA 2GJSA 2NGRA 4TQUS 1FP7A 1R8QA 2IYLD 2ASEA 4GZMA 1XPUA 2NO6A 4UNSA 2NO0A 2AFHE 3FMFA 2ZS7A 4GOJA 4XVQA 1KI3A 2QN6A 4F4IA 1FMLA 2NO9A 3A1SA 3KB1A 3GLIA 1FL9A 1SHZA 4EJSB 3WMGA 4KFRA 3NXSA 3L2OB 3OF5A 1IBRA 1I4DD 2JAQA 3PEYA 3UMSA 4JL6A 4IEIA 2GAAA 1OH5A 2G77B 2A5GA 3KJIA 4RFSB 5EUQB 3VTKA 2OE2A 2AWNA 3QXJA 4V0NA 1IY0A 4WBSA 2YOFA 2ORWA 1TMKA 4TLDA 1VIYA 2J41A 4KBFA 1GL9B 1KDRA 3UK6A 1SXJA 3DOEA 1KI7A 1SHKA 5JJIA 2GXUA 4Y0AA 2FE4A 4B73A 3WMEA 2C9CA 4P4TA 4XD7A 3LAWA 1BH2A 2VP4A 1M74A 3RAPR 3A6PC 2O8CA 5EP3A 5EP1A 3W34A 4EPTA 1NLYA 5HPYB 1Q44A 3PXGA 3P1JA 1C4OA 3IQXA 1D5CA 3THYB 1Z47A 4TMXA 3FMIA 3B1YA 1F48A 2PBRA 1A2BA 2ZSDA 2HYIC 5FPYA 2FSHA 1D6JA 3TE6A 3BB4A 2PZGA 1D9XA 2LWIA 5SZKB 4OHYA 2V7QA 4OQNA 1SKQA 4LHYA 2ZRDA 2QP4A 4IOMA 5JJKA 4UNPA 1HE1C 1AN0A 4MITA 3PEWA 2P2LA 4UJ3A 1CTQA 4IFEA 2QA5A 4KHZA 1UBGA 1XF9A 4PPGA 5IT5A 4HLCA 3VR5A 2LKCA 5KDOA 1Z07A 2IYTA 1NIJA 1NJFA 1Q21A 1ESMA 1NI3A 4TT3A 4PO1A 5EE9A 5HTKA 1B23P 1KK2A 4TMTA 2ZIAA 1R0XA 4TYYA 2WMOB 1IM2A 4IXMA 1E2NA 2W2XA 4RY2A 1YR6A 5CK5A 1ZNWA 3ONWA 3CF2A 4M22A 3H4MA 3K09A 2YHSA 3KKPA 5E7JA 1F6BA 3GFTA 2KSQA 1HQCA 1V43A 3LLUA 2Z6VA 3P27A 4KFTA 1G4UR 1GL7A 2H57A 5LDDC 2ZRFA 3B2EA 4LJ7A 1ZNZA 3RWMB 4A4DA 4MKFA 4P4UA 4XOIA 1XEXB 1IXRC 4BPBA 4MDEA 1VMAA 4BECA 3PJRA 1E9BA 2BCGY 3QPUA 1SULA 4Q9JA 5CYOA 3X1XA 1TAGA 2GRJA 4Q4HA 2XTZA 4WZAE 3PUZA 1IY2A 3AUYA 1M34E 5TB5A 5UKDA 2WKRA 1ZINA 3OAAD 4DZZA 2Q6TA 5J4VA 1E4YA 2FJUA 1ZYUA 3TAHA 4G0NA 5DN6D 3ZD7A 4AKHA 2PCLA 4LBVA 4DT1A 4A8JB 4C30A 2FV8A 3K9HA 2EWVA 3CH4B 1T5IA 2A5YB 2GEVA 2OFXA 2MSDB 4A0RA 2J0QA 5IF9A 1QVAA 2QGZA 3BH0A 3LX8A 2GZHA 1DVRA 2GVDC 4JYBA 5EZ5A 3AB3A 4OQLA 221PA 5K8TA 5G53C 4DKXA 5KNBA 3PEUA 1KKMA 2ODWA 3ZS8A 2GBLA 3NEJA 2IK8A 1G7TA 1Z2AA 3NDBB 2C5LA 3DOFA 3FB4A 2RGCA 4Q1CA 3A36A 3OIUA 2VBCA 3ZQJA 4RKEA 4EFMA 3AEZA 1CJVC 1RRGA 2JLXA 1IY1A 3T1TA 1OFIA 2DFLA 3IHWA 2QPTA 2REXB 3IDQA 4MYCA 1W36D 3KKNA 1P3JA 1G9XA 2XSZA 1UBCA 4G01B 3N70A 1VG1A 3ECCA 4E09A 5KPJA 3A1UA 4I1UA 5IK2A 3UIEA 4ZKEA 2VHCA 2NOAA 3QF4B 3U6BA 2FPMA 4TMZA 3AP3A 3RVBA 2V4ZA 2A30A 5CB6A 1UF9A 2GBLC 2O5VA 2O8DA 4IVPA 4IOLA 2WICA 4LCBA 4F4JA 4BRWA 2C04A 2FX3A 4G5OA 5FBWB 2FSGA 4HB0A 1OXXK 4NP6A 2XJ4A 2CLSA 5FBQB 5L3RA 1VTKA 2PJRA 4BQSA 4CEJB 3ETLA 2OLJA 4Q9IA 4IJMA 3TQCA 2H92A 4Q4JB 1KDPA 4JJZA 1GM5A 4RJLA 1DOAA 1J8MF 3S1AA 2VSFA 2AKAB 3LBNA 1EESA 4Q66C 2RGGA 3QNUA 2ZS9A 4HUTA 1LS6A 2CCJA 3EZ9A 1QHIA 3EXAA 3U4QA 2WWGA 2XZPA 4IHQA 4M0LA 1KJZA 4JKIA 2GEDA 3MCAA 1SKYE 1D2NA 5HZKA 1P9WA 5CDFE 2VF8A 1YZGA 2HF8A 3FYHA 2NTYC 1NN3A 1F2UA 4P4SA 3T1VA 3KXKA 3W5IA 2JGNA 4TN1A 2ZI9A 2RGAA 1GSIA 3LD9A 3CO5A 2I1VB 3VAAA 2AK2A 2CXXA 5CITA 3MJRA 4NMMA 1G291 2VP0A 3LW7A 1XWIA 4Y0VA 5CJ2A 4I99A 2FSFA 4YMSA 1T5LA 4DUGA 2Y8EA 2SHKA 3SEAA 1BMFD 4OL0A 1KHTA 2WWWA 1HEIA 5J4HA 3D7MA 2EYUA 2W0MA 3IBGA 4H9GA 1XTJA 5EP4A 4KITB 2VEDA 3TQFA 4P33A 2WSMA 4C0SA 3B60A 4GSYA 3AKEA 2FPLA 4D26A 1Q12A 3MG9A 3BFVA 2ZE7A 4FMCF 1E4VA 2WPDA 3E1SA 1CJTC 3NH9A 4A9AA 1BIFA 4D82A 1CEEA 5KSPA 821PA 1OXTA 1XFAA 4NCIA 2W00A 3T06B 2ZRIA 1Z06A 4BGDA 3HR7A 4JVMA 2J0VA 2AD5A 1MABA 1NVVQ 2RGNA 5C4MA 1UJ2A 2GXSA 3M4YA 1GVNB 3PR1A 1JR3D 1BO6A 4TWZA 3DMDA 5DI9A 4D4JA 3ND9A 3DMNA 2GCPA 2WHXA 5E3HA 2CDNA 3AF1A 5HKKA 3FHTA 2QMEA 2GCOA 4GMXA 5JWHA 1IJFA 1NNEA 2AD1A 1KZ7B 1KK0A 2ZREA 1MO5A 3TSOA 2B8WA 5EE3A 1E96A 2QAJA 5FTMA 2OCPA 5L3SA 1KI8A 4WVFA 4QXAA 3OAAA 4HZUA 4LJ6A 3SJCA 2A78A 5FOTA 2RCNA 5GADl 4PXAA 1U9IA 4LDJA 3TW8B 4TZ0A 2YOGA 4V0KA 5TARA 4TQ9A 4ZV4A 4GDFA 2O8DB 1P2UA 4MKHA 4Q9LA 1K5GA 2IX3A 5TMPA 2EFHB 4FINA 1U8YA 5LPNA 1LS1A 4L9SA 4TLBA 1E1QA 1QVRA 2B21A 5FL7D 1MR3F 3BAFA 5FI0B 4JLVA 3KQKA 2HV8A 4I1SA 4W5HA 3BXZA 2R6DA 1JR3E 4QBHA 3U4QB 1E32A 4PC2A 5JHHB 2YWGA 2QG6A 3CR8A 5TY0A 3SS8A 3K70B 2HDNB 1BOFA 4G5QA 3RS5A 2BMFA 3UG6A 3F3YA 3EPLA 4LV8B 1BS1A 3TUJC 2RGXA 5FR1A 4QGAA 4EJSA 3FMPB 3MD0A 4F93B 1R0YA 3BH7A 3LBHA 2IT1A 5BXQC 2VHJA 2RAPA 3A4LA 4KCGA 5H68A 4B6EA 2JLYA 3GLGB 2ZI4A 5JFGA 4GZLA 2GXAA 3TBKA 2AL7A 1S2MA 1OKKA 1XJCA 5KSYA 3OE7A 2JLRA 4B3FX 5M04A 1TNDA 3VX4A 1UKEA 5SZIA 3AVYA 4TTQA 3C4JA 3Q7PA 2WSSA 3W9YA 3GLHB 1DAGA 3WNBA 1TQ4A 3MWYW 5GVRA 2HT1A 1P60A 4OHZA 1HV8A 4FCTA 3ADCA 1X1SA 1T6NA 4DSNA 1FZQA 4GI7A 3C16C 2BBOA 2MSEB 3AVQA 4OBEA 4RFVA 1WQ1R 4RCZA 5DN6A 5F3WB 4C4PA 4PAMA 1JQJC 3Q7QA 1MABB 2IEYA 1G8PA 1GRRA 2ZRKA 4WAUA 4QFMA 3R8CA 3B1ZA 4C7OA 4HUQA 1AA9A 3T1OA 3PUVA 2WKPA 4B44A 1UFQA 4EUNA 3Q5DA 4JL8A 2G3YA 1OHHA 3C41J 5FOWA 1E2PA 1VHLA 2ZJ5A 3I73A 2QQEA 2ZS8A 4R9UC 1J7KA 2V9PA 4XTCS 1PUJA 3GCGA 3CRVA 4CYMA 1QHXA 1CR4A 1US8A 4OQMA 4D2IA 2D06A 4BASA 3FKSA 3I1FA 4CEHB 2WVJA 4DCNA 2IXGA 5JCPA 1LB1B 1DAHA 3CLVA 4QM7A 1KDTA 1H8HD 4DVGA 4KFSA 5DIFA 3K70C 2BDTA 4UNQA 1U81A 3KKMA 4KODA 4LZZA 4QM6A 4MH0R 1U94A 1E1RD 4U02A 4IDHA 5IRCD 1E2QA 3IHLA 4HLUC 1AJEA 4GP7A 1SVLA 2F1JA 1S3GA 1ZCBA 2CVHA 4QNMA 3W5JA 5A0FA 5KUTA 5B30A 1ZD8A 3X2SA 5J4KA 3CH5A 2RHMA 1Z0AA 3GLFB 1E2KA 1E9EA 4F7WA 4JIMA 3MAAC 2O0KA 4MGIR 4XSGA 1W36C 2OV2A 2V54A 4NKRA 2GXQA 3N2EA 3QKSA 2FMXA 1FUKA 4RVCA 1U2RA 2CK3A 3L82B 2YINC 2ZJYA 3LDAA 4TLCA 4B2LA 4OI4A 4AKEA 2EFGA 1VG8A 2R44A 3VR6A 2ZRCA 2AWOA 3A37A 1Z6TA 1CF4A 3KB2A 2EW1A 1AK2A 1R8SA 1OKKD 4MKGA 4KJZA 3KKOA 1P2SA 4NCJA 3WP0A 5FBVB 3KTAB 1K6MA 3FHOA 3IIJA 2P5TB 3CKLA 2ZXUA 4XD7D 2F1IA 1W1WA 4HUQB 1CJMA 1CU1A 2I1QA 4JLMA 1LF5A 1LY1A 1F2TB 4JMPA 3DM9B 2DBYA 3QF7A 2ZETA 4YMTA 1HT1E 4QL3A 3IBYA 3TUIC 3RNLA 1NBMD 3EIQA 1R0ZA 5BN4A 1KZGB 2QPAA 2J45A 1OIVA 2P65A 3NG1A 4JLDA 3WYAA 3TH5A 2JASA 3WYFA 1TUIA 3LVRE 2V1UA 4UXIA 2RGDA 3QQ5A 4KLNA 2C8VA 5F9FA 1KI2A 3R9XA 5FTLA 2ZRMA 4BUJA 1NBMA 3EPJA 3I62A 3B7GA 2HJVA 2OCBA 5J47A 3BD9A 3BERA 4O0MA 1RKBA 2H18A 1G6OA 1QHNA 3BORA 2KI5A 3QOFA 1XRJA 1Q57A 4PAQA 4LY6A 3WP1B 3NDPA 2RGBA 5A5GA 3BJIC 5DO9A 2WAXA 1OXVA 1WF3A 1X86B 1CJKC 4YXWD 1WB9A 4KBGA 5JMTA 2N42A 1CULC 4ZDKA 3OIVA 4PHHA 5EE1A 4AG5A 4V0ME 1HUQA 4Z1MA 3CRW1 4Q7LA 3AKYA 2J1LA 2ERYA 2VHUA 1KO1A 3L0IB 4D0GA 5K8LA 4YMWA 1S3SA 2GILA 2WSSD 4V03A 1JB1A 1T0JB 4GMDA 5D3MB 5SZHB 3GJ4A 4TYWA 3U3RA 3LBIA 2GDJA 1GNRA 3KXIA 2ZRAA 1VIAA 1Z2CA 2WOJA 5FPKA 4GOXA 1E2HA 2MMGA 1W49A 4O3MA 1G41A 1KTVA 3R7WA 2ORVA 3SN6A 4LBYA 4Q18A 4C0KA 3B78A 2WPDD 4L5BA 2R8RA 1KSFX 5L8VA 5GJWC 3EW9A 1T9HA 2W2TA 3O8RA 2F43A 1TEXA 2FZLA 4OI0A 4AURA 4CRWB 5TXGA 2XNDA 4DLTA 2NZ8A 4V0MA 4Z8XA 2Q3FA 5JBQA 2GF0A 2GAOA 3PITA 2ZSAA 4ARZA 1F60A 4ZKDA 2J7PA 2YJTD 4BE7B 3QSYA 4XIGS 1ZCAA 3VU9A 2O8FA 1RYHA 2DFTA 1TX4B 5JHGB 1FUUA 2VSXA 1SVMA 4B6FA 1XD9A 1WP9A 2VTKA 3ZQ6A 1ZC3A 3ZGXA 1Z83A 4ZIRA 1XEXA 2QORA 5DHFA 2EQBA 1FP6A 3PEVA 3PG5A 3CWZA 4JJKA 1IQPA 1EXMA 4V0OA 2EFEB 1FQJA 4BFWA 1GNQA 1A4RA 1EWRA 2J0SA 4DB4A 5FOVA 2ZJZA 1NIPA 3I5YA 2OEPA 1M7GA 2PL3A 3FHCB 1G8YA 4QHTA 4EPYA 1RIFA 2P6RA 1Q3TA 4M9XA 1M7BA 3VX3A 4ZDIA 1FQKA 1W2GA 1YQTA 3SHWA 2O52A 2ZRJA 3B85A 2W0SA 4RZ3A 1ZW6A 1IXZA 1HTWA 4PO8A 4N0DA 5AUPB 1YZKA 4PQYA 3RSLA 1DEKA 1XP8A 1MO3A 1XEWX 5B64A 2CHQA 4OI1A 4TLEA 1CXZA 4CW7A 3EAQA 2QAGB 2C77A 3ZDQA 3R7WB 1KSHA 3ZVLA 2XOKD 4CT4B 1GILA 1W0KD 2QTFA 2ZYTX 1XX6A 4JBYA 5H70A 4PZLA 2IYUA 4KVAA 3G0HA 3GEHA 4HDQB 1XU4A 4E07A 4ZO4A 1EGAA 2TMKA 4O2RA 5C1BA 1EFRD 2BM1A 1N2CE 4EPWA 3Q5EA 4Z8YA 2VO1A 3GJ8A 2IHYA 1E0AA 1QF9A 3VKHA 4R2IA 1YZQA 3VU9B 2CJWB 4E22A 1FW6A 1QRAA 3OEEA 4WIAA 2V7QD 4QBGB 5AJWA 4DEYA 2L0XA 2EFDB 1P4SA 3EA0A 5JEDA 1QBKC 1YE8A 3B6EA 3KKQA 4A2QA 4DIEA 3ZIAA 2GKSA 2QEQA 4TTPA 4XWKA 2ZRGA 5CK4A 4B48A 3RRMA 4G5GA 4QJ4A 3LQRA 4X8MA 3RRNA 1NN0A 2QM7A 3GEEA 2AK3A 1AS0A 3AV0B 3FVQA 3VFDA 2N1BA 1DE0A 1N3BA 1YZNA 1YZLA 2R65A 1N6LA 2DPXA 1ZC4A 3A1WA 4MGYR 5TDHA 2ANCA 3E5HA 2DFNA 1OW3B 1COWA 5C2JB 4US1R 1JJVA 2JLZA 2FGJA 4NL4H 5EXSA 4B34A 2A7QA 1OIWA 1PUIA 1R7RA 4LK2A 4LYAA 4UXHA 3NTUA 2DB3A 1JBKA 4ZIRB 5FOSA 3IIKA 1I2DA 1D8TA 5E4FA 2GJ9A 1KOFA 5EE5B 1CRPA 2JA1A 621PA 5KHOC 2CL6X 2OUKA 2P5SA 3ICEA 2F7SA 3LX5A 1F5NA 3D31A 1AGRA 4YQFA 2GK6A 4A92A 3GLGE 3BWDD 4HI0E 4ERNA 1OHHD 3ZS9A 3F5FA 2ZRNA 3RDPA 1YZTA 4MGKR 4Q5IA 2MMCA 3CUEF 3TKLA 2QP9X 2RB4A 3W6OA 1KK3A 1EFTA 2ONKA 4PZZA 3TRFA 4ABYA 2QAGA 5AJYA 3QIAA 2ZE6A 1SVIA 3D8BA 1F2UB 4P4SB 3B8HA 4A36A 3EWAA 2WV9A 3K53A 5TVKA 4HAZA 3I5XA 4TZ6A 3U7GA 2JLVA 1OE0A 5B2ZA 2F9MA 2MSCB 2ZVQX 3ASZA 5KSOA 2OFOA 1J70A 3DDCA 3GJ7A 3QUSA 3FWYA 3KQLA 5BYKA 1AQYA 1KNXA 2H7VA 1CR2A 1F2TA 4YDHB 4BRUA 2ZI3A 1I4TD 3R20A 2GJKA 2Q3HA 4URYR 1HYQA 1W4RA 1RYFA 2D74A 3EPKA 5CIWA 4B2PA 4DJTA 3LV8A 1TEVA 3RRYA 1W47A 2EWWA 4BWYA 4PSVA 4CVNA 2QAGC 2J7KA 2QI9C 8OHMA 2F1HA 4HZUB 1W4CA 2Z5FA 1AQUA 3LNCA 3Q8XB 3TAUA 1BYUA 3SYNA 1NVUQ 2G0TA 1MRNA 4JBXA 5AUOB 3CRQA 1OB2A 3NH6A 4A0FA 3QJYA 4BFXA 1W0JD 3WBKA 1RRPA 2FPKA 2UVQA 4R98A 1F3OA 1SVSA 4IVQA 3O8CA 2IUUA 3B1WA 2PEZA 3PIRA 4IDQA 1NSTA 1M1YE 2FFQA 1RFLA 5EQTA 2JJ1A 3K0AB 3RC3A 5JSZA 3TIFA 2XTNA 4YLGA 5FOUA 1X1RA 4FMDF 2ZI5A 3AUXA 4MKIA 4Q02A 1XJ0A 5BN5A 4EJSC 1XEFA 4NH0A 5KDDA 3QI2A 4L9WA 1WE2A 1GKIA 2ZAOA 3AVXA 3NVAA 5IDVA 3DEFA 2JLWA 1X3SA 2OBNA 2RGEA 2WJHA 2XGJA 1Z6XA 3LA6A 4Q4LA 3SYKA 1Z0JA 1OFHA 4AIIA 1X8JA 2BV3A 1E0KA 4M9ZA 2QE7D 5CM9C 3T5DA 2H1LA 2C9OA 1FOEB 1JECA 3CX7A 2WWXA 1G7CA 2A5JA 1WBDA 1WRBA 4G1UC 3P20A 1U9IC 1WA5A 4B2IA 1ANKA 2OFWA 3A1VA 4M1OA 2GESA 2QL6A 3SFVA 1OH7A 1CRQA 2DWQA 4OYHA 2XITA 5CIQA 1ZM4A 4RZXA 2NIPA 4URXR 5G3YA 2EFCB 1L4YA 4CT5A 3L8YA 1DO0A 1KI9A 2IYZA 2VSOA 4NPHA 1T3LA 2J59A 4Q48A 3TR0A 1GIAA 4TL6A 4P3YA 1Q1EA 5KTYA 4ESVA 4LYFA 3KL4A 5F9HA 1P72A 5BYJA 3SJAA 2V6JA 2HXYA 1MRSA 4U00A 2VHQA 5KNCA 2YNMA 1IONA 4J0QA 4D4LA 5GJVC 4CEIB 3EZ2A 1E3MA 4L16A 3WRYC 4M1MA 4LBZA 4PX9A 3HDTA 3R8FA 1Z28A 3L43A 3UATA 2J46A 2ODNA 1Q1QA 2QMUA 2QUZA 2YKGA 3GPLA 2D7CA 3E2IA 4IXNA 3CPJB 3A8TA 2FU5C 2Z43A 5DHAA 5KYKA 4DLWA 4GP6A 1NG1A 3QF4A 1DG1G 4U7DA 4OHVA 1XDBA 1E9CA 3AP2A 2W6JD 2OZEA 2DWPA 2ZJAA 3MSXA 2QT0A 2FGKA 4LGMA 4HB4A 3TSZA 4EPXA 2R6CA 3VKGA 2QMOA 2BWJA 4HSEA 1YR9A 1LNZA 1DARA 1WDTA 3EX7C 3M6AA 1R5OA 4EQ6A 1OIXA 4HAWA 1FNMA 5CYPA 4FXPA 1DS6A 2QRZA 1U98A 3U3MA 4DEXA 2QT1A 2I3BA 4C0LA 2HLDA 4JVLA 4PTLA 3B9QA 2GWHA 3NIBA 1TQ6A 2IA5A 4AWXA 1G7RA 3SJBA 3PUXA 2JIZD 3QBVA 1GUAA 2VYFA 1P2TA 4OQFA 1OYWA 3O8DA 4FN5A 5AUQA 1M2OB 1Z3IX 4I1VA 1JPJA 1II8A 2IXEA 3EASA 2IYQA 1XXHA 2WM9B 2ZI6A 1TF7A 5K8IA 1W2HA 1FFHA 2A5FA 2OLKA 3ZD6A 1O87A 2FZ4A 3ICQB 4NCHA 4AKGA 3W90A 3OEED 4LC1A 5B57C 2JATA 5IHPA 5G41A 4DHEA 2QY9A 3AVOA 2ZUBA 3EPHA 3BRWD 2VP2A 1JJ7A 4IOJA 2X1VA 2BKUA 3QXSA 4E5UA 4DWJA 4LJAA 5AWFC 1N0VC 2FH5B 1SVKA 1JXMA 1E98A 2BIFA 4IFBA 4Q9HA 2FF7A 5K8UA 1N6KA 3KXLA 4FMBB 4BLOA 4PC6A 2JJ2D 3SOPA 1JEDA 2P0EA 3NKVA 3ASYA 4C0JA 1RC8A 2QNRA 2WIBA 3WHLA 3REGA 4CEIA 2IC5A 1ZIPA 2WTUA 1XMVA 2ZYWX 4B43A 1QG2A 1TQ2A 3PUYA 2ERXA 1Z0FA 4KFUA 2IBMA 4ASUD 4WW0A 1FMJA 2G0NA 1G6HA 2F3TA 2CJWA 2C2HA 2BBSA 3W6PA 4TYNA 5JS7A 1OLOA 2GVZC 2IUTA 721PA 1II9A 1NVVR 2QQ0A 1X8LA 3I8XA 3K9NA 5FBLB 4MQBA 3DO6A 1UKZA 4URZR 5DSZA 2ONJA 4A6PA 1L2TA 1DADA 2IYXA 3B82A 1N6OA 2ZR7A 1MO4A 2UKDA 3THYA 3HU1A 4XH9B 4NYIQ 2OCYC 2IW3A 1CR1A 4U5XA 5D3QA 1CP2A 3CR7A 3THXA 4MUBA 3ZYCA 1ZAKA 3ZJYA 1GAJA 4H1VA 3B1XA 3GJ6A 3L8ZA 1HT2E 3ADKA 5L3VA 3K9GA 2R6FA 2R6AA 3QXHA 1P75A 1V5WA 2IYYA 4RSGA 2Q3MA 1ZD1A 1MO6A 1G64A 1C9KA 3WMFA 3QE0A 2WKQA 1CBUA 4HAVA 4RCYA 2AKYA 5FL3A 4DDUA 4FW9A 2ZSBA 4AI6A 3HYTA 1E1RA 1BYIA 4AKIA 5FPSA 3VNUA 3T15A 4EKDA 1E9DA 3K8YA 3LQQA 2D4HA 3N2IA 1ONBA 1H8HA 3CF6R 1XB2A 4GRAA 1D2MA 2XZLA 3UANA 4WZ6A 1QHSA 1S1CA 1XZQA 1OF1A 3CX8A 3MLEA 2IS6A 1E0SA 2F6RA 1HH4A 3IUYA 1GKYA 2NO1A 2V55B 2YVUA 4ZCMA 1QZXA 1P7CA 1ZBDA 3U61B 3TMKA 2O8EA 1ZM9A 4EIWA 2O8BA 4A6XA 2BVNA 4XVUA 4QNRA 5JI3E 4OK6A 4WOPA 3VHLB 4BLTA 1W0KA 1DAFA 3TNFA 1N5IA 1E2FA 4L8GA 4EFNA 4KYUA 4R7ZA 1II8B 3U7HB 2D2EA 3U7FB 2B7CA 2KJQA 4FWTA 4FIDA 2CLDX 4NU0A 3C5CA 5E95A 4F91B 2NPFA 1W36B 4RKFA 3I72A 1XCGB 3R9WA 1XD2A 3PV0A 1P61B 4GPTA 2E87A 4JLPA 1GDDA 1LF0A 2F43B 1N6RA 5DI3B 4LRWA 3KUCA 4IRUB 1ZP6A 3OIYA 4UQOA 1SQ5A 4HLUA 4EAQA 2E1RA 1OT3A 3P32A 2IYSA 1DBSA 1XMIA 4WXRA 3KZ1E 4NHOA 1NN1A 2ZVPX 3HWSA 4C7OB 1E94E 3AH8A 3U6KA 3O8BA 3CNNA 4DSUA 2WMNB 2FEMA 4LUCA 4KYIB 1VKJA 2FG5A 3CNOA 4QBFA 3EARA 2V8OA 1NSFA 1NBME 1VG0B 1TADA 1RVDA 1J2JA 2RMKA 3RYTC 1YRBA 2G9NA 1E6CA 1HA3A 4DSTA 5LB2A 2RKOA 5HKKD 2HYDA 2YYZA 1Z29A 2OBLA 3K70D 2Q9CA 2CHGA 5HCIA 4W9MC 2WBLC 4XVRA 3SZRA 1BMFA 3MWLA 4US2R 1U90A 4CZ2A 3HR8A 5P21A 5AR1A 1US8B 1KO5A 1LFDB 4L15A 1XTRA 1FTNA 4PQFA 4UNNA 3EC2A 1VYUA 1N5LA 3RHFA 2AFIE 2XJ9A 4PSAA 1XXHE 2YOHA 3UPUA 3CPEA 1KJYA 5FTNA 3A1TA 4PQRA 1OXUA 2GF9A 1MT0A 4JLJA 5JI2E 1G18A 4QKQA 3O47A 2DY1A 1KY3A 1RW4A 5FFMA 4XTRA 1QG4A 2G83A 2YV5A 5HE8A 5SZJA 3ZVMA 2IF2A 2ZSEA 2PMKA 5FPTA 3IO3A 4G5RA 3AVVA 5JRZA 1SXJB 2C78A 3U60B 1AGPA 4Q00A 3QKSB 3T1QA 2JLQA 3AP1A 2ZSFA 4IKEA 3L0PA 4QGHA 3OHMA 4IOKA 4C3ZA 3LLMA 4F92B 1QHYA 1COWD 4JLAA 1KMHA 1EFCA 4WZBE 1DAEA 3LY5A 1X6VA 1S8FA 2H5EA 1U8ZA 3IIMA 1YZUA 1QDEA 3DM5A 4NTZA 1ODFA 3X1DA 1ZVQA 3CRRA 4MGZR 4M1WA 3EZ7A 5CJPA 3RS2A 3SDZA 5KU1A 1N6PA 3L0SA 5JS8A 2RGNC 1G5PA 3G82C 2FFAA 4JZKA 5FBRB 4EFLA 2C96A 4Q7KA 2CE2X 3LWNA 4B33A 4AYWA 2E9SA 4M9SA 1GRQA 4HAXA 3WY9A 1ZUNB 5CB8A 1RPZA 1IN8A 2G88A 4Q9KA 5KDLA 1PV4A 1EX7A 2OSBA 4TMWA 2XEXA 4JL5A 4V02A 4Q21A 2Q0HA 2ZM5A 5H8WA 2QU8A 2X19A 4TL7A 3B1VA 4OK3A 2ZITA 3QKTA 1YR8A 2K5UA 1EFHA 2ECKA 2B8TA 1S9DA 4DLRA 3EA5A 3QG5A 3FGNA 3ZVRA 2P6NA 4FMDB 3TVDA 2N46A 1QHGA 2REBA 3VR3A 4F4CA 4NBSA 1T3SA 4ZDJA 2V3CC 1HURA 1AZTA 1E2LA 4MRSA 5JRJA 5KPDA 1R5BA 3RS0A 3IILA 1E2JA 3ZLJA 1E9RA 4JYCA 3AVWA 2VP6A 4B3BA 3CZQA 2ZE8A 1NMXA 1IJEA 2QMHA 1ZUHA 2BJWA 4HAUA 4JT4A 4HB2A 3BS4A 5F98A 3PQCA 5ELXA 4ZCIA 3BK7A 2HUPA 1KAOA 3AGPA 4N3NA 1HE8B 1NN5A 1KMHB 2OM2A 3VQTA 2GEUA 4RZUA 1P2VA 4NYJQ 1UBFA 1SXJD 1LW7A 2C03A 4DSOA 1W5TA 3IQWA 4EPRA 2AR7A 4M9QA 2CCKA 4DLUA 3GLFE 3NHBA 5EXTA 2HEIA 4B71A 2QZ4A 4QRHA 1GFIA 2DWOA 1T8UA 2CL0X 2PMDA 1SGWA 4Q03A 2ZTSA 4LYHA 1KIMA 1Z0KA 1KKLA 2OCAA 4LV5B 5FTKA 3SBDA 1EWQA 2XNSA 1TU4A 1Z6AA 4ASUA 2OAQ1 1KO7A 521PA 4QHSA 3U44A 3WNDA 5KO2A 4TSFA 2QBYA 2BM0A 3KX2A 2OAP1 1KJWA 1WXQA 2F1RA 4FMCB 3GEIA 3GFOA 4KU4A 1Q0UA 1SVOA 4B74A 5GJCA 3T61A 1BKDR 1P6XA 2QM8A 3OFNA 1G4AE 2ZUDA 1UDWA 2BMJA 3GLHA 3SE0A 3THXB 1M8PA 2C98A 4JLKA 3VR2A 3T35A 4A2PA 3BIFA 1MOZA 3RS7A 3AF0A 3IEVA 1R4AA 1AKYA 2YC4C 3CONA 3C8UA 3RLFA 4GFDA 2BEKA 4A2WA 3GLGA 3JVVA 4AY2A 1LVGA 1RE0A 4GOKA 2VHTA 4OJKA 2PT5A 2JEOA 2CNWA 4I1OA 2ANBA 3RANA 3BC1A 5FUWA 1KI4A 3N5CA 1VPLA 2Z4RA 1XCMA 3RC8A 3BH6A 4HB3A 5FH9A 4URUR 3EG5A 2NG1A 3FKQA 1D2EA 1G20E 4A8JC 4BLPA 2H16A 4OKSA 1NLFA 4QJ5A 3LW8A 2J0UB 4ACBA 4TYQA 3THOA 4ESHA 3GLHE 4DRZA 1U99A 1NG9A 2HT6A 2F3RA 1KSJA 1Z6YA 2A5DA 3DL0A 4B75A 1ZNXA 2GETA 4DCVA 4M21A 1L7VC 1KI6B 2OESA 4KLZA 4EPVA 3VMFA 2XAUA 3GJ3A 3FKSD 1E2DA 4AD8A 2OHFA 3NEYA 2VP9A 1EFUA 4M1SA 1XTIA 3VKWA 2BMEA 2IUSA 4P0TA 1VHTA 3Q72A 1S96A 1XNJA 4W7SA 4O2LA 3GMTA 3QVVA 3CZPA 3GJXC 4B76A 4P32A 2A2ZA 2D62A 2LKDA 1GKUB 2O0JA 3C15C 1NVWQ 1P62B 2QE7A 3ZH9B 4DUGD 2FWRA 3DVLA 4DDTA 2KWIA 1M6NA 4PHGA 1NMZA 1ZM7A 3UWKA 4B3DA 3OFND 4PPNA 2ZJOA 1N6NA 2JLSA 3GP8A 1OV4A 1N0WA 1SKYB 4TSFD 3QVUA 1GZSA 2QBYB 2VF7A 2A9KA 5E7MA 3I61A 1PLKA 1OJLA 1TU3A 1GITA 4GL2A 4TTRA 2QGNA 4BFVA 3SQXA 3BFKA 2XZOA 4M1KA 1IAQA 4LJ5A 3U44B 4ITRC 4M8NE 1E2IA 3H2YA 1S4QA 1E0JA 1GRNA 2WOOA 3QKUA 3FPAA 1RJ9A 1OH6A 3AF2A 4PZYA 1PLJA 3UWOA 2IWHA 1RRFA 3THWB 1UDXA 2QTHA 5JCZA 1KI1A 3CNLA 3GFPA 3KTAA 1XXHB 1JR6A 3LO5A 5DNYB 1CS4C 1JR3A 1QHHA 2DFKB 2QENA 3IEUA 4I4LA 4KAXA 4YDSA 3TR5A 2NMVA 1HQYE 4GBMA 4HZIA 4JLBA 4KSCA 4BFSA 3LVQE 5F2EA 3J81k 1KAGA 1Y3AA 3L0OA 4P31A 4PANA 5EUMA 3UKDA 2D7DA 3ADDA 2KBFA 2XXAA 3JVUA 3I8SA 4OJQA 2VA8A 3JZMA 1X8KA 1TUEA 3QY0A 2G1KA 4DLZA 5KSZA 1EK0A 4EDHA 1ZMXA 3KFVA 1Z5ZA 5HCNA 5DYGA 2B92A 1N6IA 3AF3A 4JT2A 4C0QC 5JEEA 1A5TA 3AQ4A 4Q1EA 3QENA 1HY3A 1XCPA 3PENA 1VG9B 3Q3JB 4O25A 2QP3A 3CB4A 3DZ8A 2G1JA 4A8JA 4UXJA 1II0A 3K0FB 2F9LA 4LX0A 1IXSB 2X77A 4H1UA 2YZ2A 3TK1A 5JWRA 1LTQA 5LD2C 2QPOA 1AM4D 5JLJA 3KQNA 1OB5A 3K0CA 1NVXQ 5JECA 1LV7A 2QTVB 1U0JA 3NC1C 5KOYA 1VYVA 4MRVA 2GK7A 2JDIA 4ARZB 5A4JA 4G5SA 3WRXC 2PCJA 4DLSA 3LXRA 1FTSA 3AM1A 1E79A 1TQDA 1IN7A 2AHOA 4A1FA 4HYYA 5H1YA 3AKCA 3PFIA 3SI7A 4R71A 2YWFA 3SJZA 1DG3A 1YKSA 2OG2A 4NONA 1R6BX 1TPZA 1ZNYA 4OK5A 2BOVA 3C5HA 2ZR9A 3FFBA 3I32A 1GTVA 1PVOA 1S0UA 1SZPA 1L8QA 3SR0A 1JI0A 4Q19A 4DT1B 4YC7A 1U8AA 1NF3A 4NDZA 2QRNA 3DKVA 1OFTA 2CEAA 4LI0A 4ZI3A 4KI0A 1KSGA 4PO9A 2GA8A 4RZ2A 3CX6A 3I92A 3GJ0A 3W3AA 4MYTA 4XSHA 2Q9AA 3F0TA 1EFRA 4Q01A 2YWEA 3H0KA 5KNDA 1WMSA 1AS2A 2WIAA 1G3IA 3FMOB 3THWA 3SNHA 1Z6GA 1Z8FA 1PLLA 1SXJE 4KXFB 2BHRA 2NPIA 2XNDD 4IDPA 5AJXA 2WWYA 4A0HA 3LFUA 4OHWA 4V0LA 1ELOA 4S35A 3VR1A 2OT3B 4LWZA 4MRPA 5E7IA 3P4XA 5C18A 4LSGA 4BZQA 2ZYUX 4YONB 3CRMA 1KO8A 3QG1A 3ZVNA 2BBTA 1R2QA 3NC0C 1FPMA 4FCVA 4DLXA 3RS3A 2PT7A 2FEOA 4ZCLA 2ZROA 4M53A 3ZZ0A 1G8GA 3GQBA 2YC2C 1XD2B 2KE5A 2HJGA 1N25A 4BLRA 1UKYA 4D6PA 4HDCA 4NYJR 2JLUA 2VQSA 3GLFA 1CR0A 4K8OA 2DHRA 4K81B 3VR4A 3GLIB 4B3XA 3QKRA 2NZJA 1UADA 4MA4A 4N0EA 4OQXA 1Q3HA 3RRZA 1G3MA 2WJGA 1W44A 1VDZA 4K46A 5DH9A 5HZHA 3CPHA 3K1JA 2OXCA 4NYIR 2CK3D 1S9HA 4JLNA 1ETUA 2FN4A 1OSNA 4RD0A 1P5ZB 4LPKA 1VECA 1G3RA 1T0HB 5CLLA 2ZUCA 4CIDA 2A3RA 4TQAA 1I2MA 1GL6A 4LPSA 3QBTA 2PX3A 2ZU6A 2AN9A 1J90A 1W48A 2ZRPA 5DI3A 5EP2A 1MH1A 2WJJA 3M0EA 3OESA 2ZU0C 5LBIA 2HCJB 3V4FA 5FUVA 1H65A 2IS2A 1P9RA 3IPYA 3IO5A 3TSWA 2ZE5A 2GJ8A 2J0UA 4PC3A 5J5CA 2IXFA 2O0HA 2GCNA 5L3SB 5G40A 1IOZA 1GP2A 2BKEA 4X8OA 1A82A 2WWHA 2J3EA 3UMFA 3DHWC 3BE4A 3EIHA 2XOKA 3B13B 1G5RA 4IDOA 4DCTA 3QPVA 2O8BB 1J8YF 3B5JA 4C0AC 4DXAA 4QGGA 2ORIA 3EZFA 4NYMQ 3SBEA 2XB2A 2HLDD 4M2LA 4DB2A 3QXXA 1XEWY 4TL9A 2JJ8A 2OXRA 3OEHA 2CL7X 1B0UA 4UKDA 1TTTA 2ATVA 3Q85A 4TMVA 2IS1A 4Q7JB 1Y63A 1XPRA 2CE7A 4QOSA 4DDVA 2GJAA 4W5WA 3K9LA 2C9YA 1YU9A 2ZI7A 2PLFA 3VHXA 5EXXA 2J87A 2IL1A 3FDIA 3U3KA 1XMSA 4B35A 4ZDWA 3H84A 4C2UA 1UBEA 1DELA 3RABA 2JCSA 2B7BA 1ZM2A 2VL7A 4JKYA 4D25A 3IKJA 1A7JA 1SVWA 1P9NA 3SHFA 3MWKA 1NY6A 3ND8A 1Z63A 4KO8A 4LHWA 2ZPTX 1Z0DA 1ZM3A 5BQ5A 1U0HC 1IN5A 2ZRHA 2V1XA 3HJNA 3X1ZA 6Q21A 4Z51A 1T91A 4C9BA 1J99A 3BB1A 1RZ3A 1ZD9A 4ON9A 4PPFA 2BCJQ 5J4YA 1Z0IA 2CLCX 4HATA 4Q4HB 5JZVA 3K0EA 4EQ6B 2BMDA 5BW8A 2Z0MA 4FI3C 3IPXA 4TMKA 1ZJ6A 2UZIR 4DLVA 1P73A 4CGZA 1KY2A 3CWQA 3W8NA 1UKVY 2FNAA 3BOSA 4BLQA 3AVUA 1E2MA 1N5KA 2XX3A 4AK9A 5J40A 3UXMA 4D80A 2DYKA 3AGQA 4IDNA 3WXMA 2FDCA 3U7EB 2QSYA 1N5JA 1ZUIA 1T8TA 4MDFA 1JPNA 4A82A 2IS4A 1JQLB 3ZZUA 3C7KA 2P3SA 2IF0A 2F55A 1MKYA 1UM8A 121PA 2VLIA 5G3ZA 4CEJA 3HPRA 1JXOA 1ESNA 4PC7A 3RS4A 5JJLA 4NYMR 4PC1A 1W0JA 1O3YA 5LB4A 2EYQA 3RSOA 4DCSA 1I4LD 2NO7A 1NY5A 2OBMA 5HR5A 3AVPA 3OEHD 3U3OA 4BZPA 4PHFA 4PSKA 2HCBA 5EZ6B 1Q1BA 2IYVA 1XJQA 3GJ5A 3U2QA 1E2EA 3K0AA 5JSZB 1AS3A 4DLYA 2VIIA 1NRJB 1PZNA 3X1YA 1GWNA 2WJVA 3D3QA 3T12A 3KJGA 4AYXA 4CF7A 1KK1A 3MFYA 2JDID 1MV5A 3LRPA 4GNKA 4Q1FA 4R2HA 2VPPA 4RD3A 1NLZA 4C0HA 2X8AA 2X2EA 1PJRA 2LCFA 2AXNA 2XSZD 3PCRB 3PVSA 3MGCA 2ODBA 2WJIA 5GVSA 1XBTA 5AK0A 2C95A 1JAHA 4DIDA 1Q22A 3P4YA 1G8HA 4LJYA 3BFXA 2ZQ5A 1E2GA 3TUZC 2XXAB 5FR2A 4IVRA 2QROA 4B3CA 2PZEA 3E70C 4OI2A 4BEBA 5FOXA 2W6JA 1EX6A 2VH5R 3KFXA 1AIPA 4URWR 5FUXA 1E1QD 1NJGA 4RFSA 1XPOA 3U3JA 1E9AA 2DCUA 2FFBA 4NE2A 4UJ5A 3REFA 1C1YA 2P6UA 3I3SR 3F8TA 4Q1DA 1UAAA 5CLQA 4US0R 2BEJA 3HYRA 3D6TB 5FI1B 5EJEA 2V6IA 2GNOA 4NCKA 3TJZA 1XMJA 3TGPA 5GJBA 1XD8A 4FCWA 4KV9A 1YHNA 4PPQA 2BC9A 5FTJA 1E69A 2I4IA 3GLIE 2PX0A 1IN6A 4AYTA 1RRCA 1A1VA 1OYYA 1T3HA 1H8EA 1SXJC 4RD1A 3ADBA 1W4AA 3EIEA 4LC0A 1JEEA 2OO7A 4M4SA 4MRRA 421PA 4F38A 2OILA 2CBZA 1OH8A 4IW3B 4C0BA 4BFZA 3UMRA 1FNNA 1U0LA 5CM8B 2AX4A 5ANRB 2R9VA 2XB4A 3M1IA 4Z1MD 4KSBA 1NP6A 2BBWA 2J5XA 3DZDA 1EG7A 3X1WA 1N0UA 3HPQA 1KNQA 4LV6A 3HU3A 2ZJBA 3RWOA 3CM0A 1K5DA 2IYWA 2FOLA 2GTPA 2PH1A 2FFHA 2ZANA 3CIOA 4BFTA 4YMUA 5FPHA 1ZIOA 1W7AA 4UNRA 1WBBA 1IHUA 1YRAA 1W4BA 2WJYA 1JAIA 3LH5A 1Q1ZA 3P26A 1R0WA 3NBXX 3V4RA 4AG6A 3MRSA 2WWIA 2ZRBA 3GD7A 4LJ9A 2O8CB 1XZPA 4GT1A 2R62A 4HLQB 3AVTA 1KO4A 1XTSA 4JBWA 1GG2A 5FL7A 4QJ3A 3H1TA 1JNYA 4QC2A 1G1MA 3MUFA 2J7PD 4Z54A
chains in the Genus database with same CATH superfamily
3QFHA 4NEQA 5IARA 1EQUA 4HPWA 4IUDS 4ZEVA 1N6HA 2PEYA 3GEDA 3K71B 1Q14A 1TGYA 2G63A 1IWBB 3EQ6A 4CQMB 5BNWA 3BBPA 1KU0A 4HS9A 3WR5A 3CVXA 1J4AA 5AW1A 4DE5A 4OAQA 2PMEA 4DDWA 2XGSA 5B3JC 4NBTA 1ZWLA 2GI4A 3HU2A 4B5LA 2EVWX 1X7XB 1YQDA 1C1DB 3O1HB 4PR0A 1CKEA 2W4MA 1KEVA 1DX6A 3ZWDA 2AXPA 1AKEA 4MR8A 2ENUA 1K8RA 1FDSA 2VJAA 3FNFA 3R6DA 4RD6A 2CJYA 2XTMA 3UNXA 1Y1QA 2WF6A 1KJ8A 3EXIB 4NZYA 4HWGA 1XVUA 1I3CA 2XA9A 3WDKA 4DBLC 2UU9B 2HF7A 2VUSA 4ZI2A 1YJ5A 4RGQA 4AKSA 4BE9A 4HC4A 2YN4A 5JCJA 2BELA 1EK5A 2C2WA 4QEDA 1Z7GA 1E3TA 2ENWA 2R6GA 5EJ6A 4YYZA 4B47A 1K7YA 1WO8A 3GFGA 5EZYF 4F0JA 2XD4A 3OBBA 2MYNA 4FMPA 3HY6A 2Z4SA 4NBUA 3P2KA 1VJ5A 3IUBA 1FU7A 1K4KA 4M1YA 3WNCA 1IFXA 2Z3ZA 1YS4A 3NHAA 1QP8A 2DKOA 1CLUA 4FJ2A 2QXYA 5J43A 3EH2A 3NCHA 4CIVA 2YY5A 3EEIA 1SU7A 4OXRA 2JD2A 3TVTA 1KI6A 4MUXA 2OC4A 4A8TA 4B32A 5HK8A 3FCSB 4C7BA 4RTQA 1CUWA 3ZH2A 1YMVA 1N78A 2RHDA 3AQIA 4XWTA 1P7PA 4ZU6X 1E6MA 1VCOA 1ZU5A 2ATXA 2TS1A 5CHEA 1OY1A 3KHSA 4QGBA 4DY4A 3OX4A 4I1PA 1QWSA 4L7VA 3LTNC 1ZPDA 2EW2A 4FC7A 4TSRA 4TLLB 3OI7A 1DKNA 1SB9A 3PGJA 4F6RA 3VH3A 4BNTA 4CCWA 3TS1A 3TJRA 3ND6A 1ZU4A 2WWFA 1FF9A 4RTMA 2J9RA 3RC1A 4FYVA 2CDBA 3EC1A 4LHSA 5LP6C 4N0PA 1NMYA 4HVTA 1C81A 1U1EA 5JROA 3FTQA 1PJQA 1XDUA 2LV8A 5ALEA 1PRYA 2D13A 3EZ6A 1I4OA 1Z33A 3O4GA 4JC5A 3WLPA 5F7OA 2PSDA 1YCFA 2VP3A 2R6HA 3A4TA 3GEMA 3PNOA 3QEOA 5BSUA 2O8FB 4X7RA 2IWRA 3NBZC 4ZCPA 1U8FO 2DR3A 1PO7A 1I4WA 2GD1O 2GN6A 1OAAA 3GW8A 4GHWA 2ZYIA 4UTPA 5JRDS 3PU6A 4TT3D 4ILEA 1VPWA 1DDOA 1UBNA 3PQ4A 1UXJA 3MHPA 3INYA 3AUAA 3DOUA 1J39A 1TL7C 2IEZA 3I0NA 4HN9A 4U3JB 3S1SA 4YRMA 4I55A 4P3NA 2ZJ2A 5IAOA 4EI8A 4MRNA 3M81A 1HFEL 1MZPA 1G5HA 5TR9A 2C2KA 2PLAA 4S05A 1G16A 2RG1A 3E0XA 5TGZA 2FA9A 2GRUA 4Q05A 3CZ4A 1KVUA 8GPBA 2H8KA 2JGKA 1RHMA 3H2JA 4WKGA 4MUKA 5BPHA 5JQGB 2SECE 3ZDDA 1MX3A 4N6OA 3AI1A 3ANSA 4KIWA 1DBIA 4J4BA 5BYBA 3T5GA 3ZEAA 2BGWA 1DAMA 3UMMA 3D54D 3GPCA 4G23A 1B2LA 1J42A 3E3AA 3LWBA 4XX1A 3VC3A 1YDMA 2HXSA 3LCUA 2VHEA 1HDXA 4JOQA 4QUIA 1WB5A 3LUBA 3ZDAA 4B3GA 1VCNA 1ZHFA 2E3JA 1LZLA 4LBWA 1NR1A 3IP5A 4BQIA 4YXWA 4BVLA 3MWDB 4IGFA 3OEYA 3C14C 1CEXA 1TOAA 4WNAA 1CG6A 4CHGA 2WIDA 1T3ZA 1DGQA 1F1JA 1ZISA 4TL8A 5DNAA 3AEUA 4Q4AA 4XWOA 2XBUA 3QOXA 3FCXA 4H0FA 2W37A 2W83A 3HLTA 4BNDA 3KELA 5JISA 2JGRA 1JQBA 1MJ5A 4O08A 3NWJA 2X4IA 2YWHA 4J7AA 2JJ1D 4JA0A 1KDZA 1ODCA 2FZCA 2C0CA 3HCFA 2C1ZA 4JI1B 4N40A 4CEHA 1GZDA 1KC3A 5EOVA 5IT4A 3T9AA 5FUYA 5EEHA 4E2YA 5I9IA 4D0LB 1A27A 1IHYA 2JCBA 4ZWNA 2J3MA 2VRWA 2DUUA 1VYTA 1JE0A 4OCZA 3AONB 1NUSA 3JYQA 3DNFA 5IK2D 2XGGA 1W85A 1QE3A 4N7BA 2FX2A 2AS0A 3W3AH 4XRGA 2E89A 5DTMA 1YDWA 2G6BA 3VVLA 2WAYA 1F6WA 1L5WA 3MAJA 4A3SA 4QT4A 4EMSA 1R10A 4FYHA 4KE8A 4DNXA 4B6RA 2O3TA 4ZQBA 1O2DA 2CHVA 3FTFA 1ID8A 3K4PA 2CZCA 5L7TA 3EMKA 2COKA 5H9VA 3NORA 1ZZGA 4RHYA 4CTMA 1Z18A 5KNCH 5C4GB 5HTOA 1L6IA 3EFOA 3OZXA 4TM8A 5HWSA 1ULSA 2YCLA 1RSZA 2BF4A 3AUUA 3ZIAD 5JWOA 1AQNA 3DBRA 4M1TA 2W2VA 3NBYC 3K9FC 3FZGA 3VDQA 2W6IA 2Q4RA 1R9GA 2FP4A 3GVCA 4K7JA 4MUAA 1LNSA 4CPDA 4DGSA 3QE3A 1Q50A 4LOLA 2A67A 4WY2A 1E63A 1CD5A 1IHXA 5ALZA 3WRVA 1CFJA 4DJFC 4FFBB 1LUAA 1NI4B 5GY7A 1BQ4A 3GLSA 5I3CA 5BR1A 3AJ9A 3CW2A 4HDKA 1TF2A 2VT6A 5DDIP 1QC5A 1XQVA 3W5CA 3KVNA 2WVAA 1AT1A 1E60A 4FQ7A 2FSIA 3CR3C 4IO1A 1GA1A 1BWSA 2XGOA 4QVKA 4F21A 3ZOKA 2ASEA 5C80A 4G81A 5BOSA 3LCJA 3D8NA 4WXEA 2NUPA 2ZS7A 1GG8A 4GOJA 4YRQA 5K3AA 1J5EB 4KFCA 3U4MA 3ITDA 4XVQA 3UJBA 2ZYDA 2Q1TA 1ILWA 4JLSA 2Q7DA 5EPUA 3C8MA 3WB2A 2DFVA 4DCSA 2I6GA 4KFRA 4RF4A 5BWCA 3L2OB 2FN9A 2D00A 1I4DD 2VXOA 5KTTA 1B00A 2JAQA 1E3EA 2OBBA 1FLNA 1XOIA 1ZMRA 3OPVA 4GMGA 3TQQA 4AN0A 4N41A 3PEYA 1OH5A 2G77B 2FEKA 4TTJA 5EPOA 1TMOA 3INRA 1UQRA 5EUQB 5AVKA 1F06A 3E58A 1D2CA 2AJBA 1VA4A 4QO7A 2Q2OA 2ORWA 4TLDA 1XTZA 5K0LA 4CFZA 4NMXB 1SXJA 4MB2A 1XYYA 3DOEA 2VDVE 1HTTA 1QH8A 2B4YA 3G23A 3L6CA 1XNRB 2C7VA 3N53A 1SHKA 5U1PA 4TOIA 2AC7A 2EZ4A 2AC2A 3H9QA 1R9JA 3WMEA 5L51A 1O8CA 4P4TA 1DSSG 2ZQYA 3O4IA 4BX0A 4JUBA 3AFOA 4Y6OA 4H27A 3TQOA 4EPTA 1A04A 3S6JA 1NLYA 1NTOA 2KLHA 1PGOA 2OK7A 5HPYB 1Q44A 2H4FA 3PXGA 3G6KA 1C4OA 3P1JA 4TV9B 1Z4MA 1EQAA 3KE8A 2O14A 1KH1A 2ZSDA 3D4PA 4M9UA 4OGWA 1VMIA 2FSHA 1NBWB 3EEFA 3IV7A 4Q6WA 4BMCA 5LM3A 4Z4EA 4DIOA 4M0KA 2O7NA 4P82A 2X0EA 3K31A 1SKQA 3NV7A 3JTMA 1Y8QA 2ETVA 2JKZA 2AZDA 2ZRDA 3PRYA 4IOMA 4R40A 1OWOA 3DEZA 4GXNA 3I6ZA 1CTQA 3LC1O 4IFEA 4BTLA 3IV9A 4NV3A 1EUDB 4Y3UA 2AG5A 4MP6A 5IT5A 4UHEA 1LDYA 3VR5A 4ZOLF 2XGMA 5KDOA 2IYTA 1NIJA 1NJFA 2Y3IA 1B15A 2HIAA 4EBBA 1MC1A 1KKUA 4EJ6A 4FNMA 1ZEMA 4ZVNA 1B23P 4XDYA 2CVQA 3RNOA 1TKRA 2WMOB 4MCIA 4NE7A 4PNZA 3VYVA 1IM2A 4IXMA 4L2IA 2W2XA 4J2HA 4R3UC 1BX0A 5JSQA 3HCNA 4ECEA 4QICA 3EEOA 4X1OA 1ZNWA 4YJ2B 2QSJA 3ONWA 1VSVA 2OR3A 3DMGA 4C06A 3A1EA 1UMKA 2W2KA 3F9IA 4FZRA 3ZDFA 1DEAA 4I46A 3CVUA 3KKPA 1OFVA 1EYZA 1F6BA 1V16B 1BTOA 3E23A 3GFTA 4HWKA 1UIMA 1XAIA 3SC6A 1GL7A 3HHEA 5EIWA 4BMNA 2BEWA 2VPZA 3PE3A 4LJ7A 4TYMA 3T5AA 1J0XO 4O63O 2BE7A 1NWHA 4P4UA 4XOIA 4Z0HO 1C1XB 4BPBA 1Y7LA 4BECA 2CFRA 3UAZA 5FNVF 3EGXA 3LG2A 3HB7A 3WB0A 3R9KA 2HO5A 3QPUA 5CYOA 3X1XA 2ZT8A 5I45A 5LIPA 1AHIA 2GRJA 3M2PA 4Q4HA 3O8LA 1V4BA 4RE5A 3HGTA 4ZMSA 1IY2A 4R1QA 4MW1A 1ZINA 2QRMA 1U3TA 3H0EA 4HDRA 2G06A 4QUAA 1RIIA 4XGIA 1FNDA 2C2YA 3RFVA 1CFZA 1KFBB 4G0NA 2J3QA 2B99A 2PCLA 4LBVA 2VNAA 2I7VA 4B4KA 3VR3D 3VPFA 1NNUA 3TNDA 5IC5A 1I9CA 2NV0A 1E8NA 1XCBA 1T5IA 4JDUA 1V96A 2OFXA 4OQPA 4FZ3A 1K2WA 1SU4A 4JR1A 4C7KA 2PXHA 3WLFA 3TOZA 3A26A 3CF4A 5K8TA 3H8WA 4FS3A 4DKXA 3SZUA 3TBHA 2JFGA 3ZS8A 3NEJA 1G7TA 1Z2AA 2W6NA 2X86A 3DC7A 5JDIC 1KQFA 1M6VA 4I5DA 3M1YA 3OU6A 1NJ1A 4N5MA 4YV2A 2JLXA 1WD7A 3QA9A 3EHEA 5HJ2A 3LSYA 4ZT4A 1RWWA 1J1IA 3R7BA 4KN5A 4YRPA 1B26A 1FP4A 3ENVA 4GI1A 3SIRA 5B4UA 4WLEA 2B1JA 1UAYA 3KZOA 1ISRA 5BRJA 4EG1A 4DJEC 3KWMA 5JR3A 5IK2A 4R2XA 4Y2VA 4ZKEA 2VHCA 5ESWA 2NOAA 5AHOA 3E4DA 1E6LA 4AWAA 4LJRA 2Z9BA 4TMZA 2ORYA 3F7MA 5CB6A 5LXTA 4MJ7A 5H81A 5BWOA 2GBLC 3DAPA 1QH1B 5G4KB 4IVPA 1U8CB 4NG5A 2D0OB 1W1UA 1OLXB 4AZVA 3CVYA 3PWKA 4CMEA 2K7ZA 4RAOA 2C88A 1IZ8A 2C04A 4MB6A 5EL0A 5DBOA 2OB1A 3ZGNA 4BO9A 1E3DA 2FDRA 4BGEA 5CFPA 3PHGA 3AHGA 3JVDA 3WLKX 2PJRA 3FLBA 4LGCA 4BQSA 3ETLA 2OLJA 5IJAA 1M2JA 3TQCA 4V1CA 4IQ0A 2I3GA 2WFMA 4R4JA 2PRKA 3U7JA 5BVHB 1GM5A 1OTXA 1XHLA 2Q5LA 5DF1A 4M76B 1CX9B 3U4IA 4YCBA 5CEEA 2AKAB 5ALSA 4BAGA 1ETHA 3ANMA 4CT0A 3NRJA 3HVHA 1GGKA 2VTBB 5ARDA 1ONOA 1C8BA 2O2YA 1I5EA 4HUTA 4G0QA 1LS6A 3BEDA 3MOGA 4FYPA 1QHIA 2XZPA 3ONDA 1LKZA 4M0LA 2F3UA 2WSBA 1LQUA 4IJQA 5JVDB 1YZGA 5COBA 3EGXB 4RIIA 4P4SA 3T1VA 5U4XA 1GU7A 2H00A 1EDZA 1GSIA 4KJXA 3EF0A 1BW9B 3CO5A 4QWMA 2Q45A 4CQNA 3KPYA 2OM6A 3N3BC 3V32A 4CFSA 2CXXA 4R1TA 2BKVA 2VP0A 3CQ9A 5GIPE 4I99A 5KTOA 1K06A 1X3LA 2XXJA 2X7JA 3H16A 4QQNA 1ZGJA 5AI4A 3IRVA 5LQJA 2Y8EA 2SHKA 5IXJA 1BMFD 4UM5A 4R9SA 5J4HA 1HEIA 1GZHB 2EYUA 4OUDB 4Y2GA 1GUBA 3R76A 4M86A 3WWPA 3ZV5A 3WAKA 5EP4A 4KITB 3L4JA 2HX1A 5ICSA 1BGWA 4CLEA 2WSMA 3VI3B 3NVKI 4FR5A 4HDMA 4G0MA 2FRXA 2FPLA 1P6UA 3U7QA 1NDQA 5G4LA 3MG9A 3GP5A 1LQ2A 3LPDA 2YXDA 3OT4A 1CEEA 2I71A 2JKVA 3D5EA 4ZGBA 5KSPA 5LQAA 1OXTA 1XFAA 2W00A 3NT2A 3UJ7A 1XDSA 3T06B 2ZRIA 4CV1A 2XBMA 5BURA 3OURA 1EMDA 4JJFA 2WM2A 1AUXA 5ALXA 1JYSA 2RGNA 4AY5A 1UJ2A 2PGDA 2BRUC 1GVNB 4P4GA 3OLCX 1PQYA 1KERA 3DMDA 2E5LB 4D4JA 5AKKA 3L84A 4QDZA 1E77A 5E3HA 1TJYA 3NIFB 2CDNA 4GH5A 5HKKA 3E9EA 2QMEA 1UOPA 4NG4A 4LYYA 5A71A 2P69A 4C6RA 4WV3A 2O2CA 5JWHA 3FVRA 3X3HA 3NHSA 1IJFA 4OQEA 3LUKA 2WHEA 1NNEA 3OCZA 3A04A 2ZREA 1KK0A 3DCJA 1MO5A 2ZSIA 3TSOA 2B8WA 3DLAA 4K03A 2XQGA 4JZYA 2JAXA 4MUEA 5FTMA 3I04A 3UTCA 1V71A 2OCPA 4ZVVA 2XVMA 1RADA 3IDZA 4WVFA 4F9GA 4QXAA 1E6UA 3EOAI 3H9EO 3K72B 2AB0A 1NXQA 2AF4C 5FOTA 3SJCA 5LBUA 3DG9A 2PNJA 5DP2A 2PRZA 4YI3A 5CB0A 2BH2A 4Y8VA 4JP5A 5A1JA 1ID1A 4IVNA 4V0KA 4TQ9A 4YAFA 4JT8A 3RSFA 9ABPA 3SSOA 5C1PA 4DPLA 3F2IA 1EVQA 3GAMA 3LOPA 2OZLB 3JQEA 5TMPA 2QNBA 2GPAA 2WZDA 4FINA 4JLWA 3BWYA 4S1PA 4DJAA 5LPNA 5A0VA 4L9SA 4TLBA 3T9CA 1E1QA 4MLPA 3ZDBA 5FL7D 1RC0A 4FUQA 1MR3F 1RHJA 1LV8A 1P0CA 4JLVA 3GCWA 3ETJA 3BXZA 2R6DA 1GVHA 1M6HA 3OECA 4MSUA 4QBHA 2H0AA 1T1SA 2CV1A 1E32A 4U2KA 4PC2A 3SG0A 5JHHB 1Q0HA 4AXXA 2YWGA 2IXTA 2QG6A 2XUOA 4BX8A 1GKLA 2IY7A 1SXIA 1SIBE 3F3YA 3EPLA 1W6UA 2EZ9A 1BS1A 5KB3A 1P4GA 1VI2A 1YB4A 3D6JA 3O4RA 4LSZA 3DUWA 5HFNA 5JYDA 3MD0A 2IU0A 1QLWA 4UHBA 2EIHA 2H48A 1XRMA 4BO0A 2JFZA 1AK1A 5C3MA 2VHJA 3A4LA 4KCGA 4AB1A 5BORA 2RARA 2FN8A 2R7KA 3BPSA 3C7TA 3DV0A 3NNDA 3WRWA 4CLXA 4NU8X 3KCNA 3TBKA 3EXFA 2Z8XA 2EERA 3WLSA 1RM3A 2XUKA 3WIUA 1XQWA 4CODB 2MSWA 1ISHA 5SZIA 1DMRA 1EUCA 4TTQA 4UUBA 3C4JA 1XO1A 2JIRA 3A06A 4LIPD 1ZI9A 2R11A 3MWYW 3RUHA 5DX8A 3EY4A 2IHUA 3W9SA 2A1IA 1OZHA 2HT1A 3ZU2A 1P60A 2ZUSA 1PTJC 4OHZA 1HV8A 2AEJA 3KQVA 1ZGHA 4UBIA 1FZQA 2FZKA 4GI7A 1USVA 3C16C 3CSDA 2BBOA 2CWDA 3OCXA 1JDUA 3MGGA 4GVPA 5F3WB 5CXQA 3AXTA 3B51X 4PLFA 2AFIB 1JQJC 3W2EA 1MTOA 3TOSA 2OGZA 1GRRA 2BHSA 2ZRKA 3OPMA 1C3LA 5AKEA 3WSTA 1H3EA 4G1FA 1FW8A 4BP8A 4C7OA 2VBFA 4HUQA 5CDUA 1AA9A 3K73O 1SBIA 3T1OA 2WKPA 4V0RA 3HDHA 1UFQA 2PQ6A 4EUNA 4JBIA 3EBLA 2WG0A 4JL8A 1FFAA 1OHHA 1RYBA 2BSQA 3BCUA 2ZJ5A 2MINB 1QPBA 1I1OA 1PUJA 3NWPA 6YASA 3CRVA 4P7GA 4IJ6A 4EG8A 4GDMA 3QPCA 2PKYX 2D06A 2QVZX 5HFAA 3H5VA 1Z2PX 3L8DA 3P0HA 3TLCA 4JI4B 2J3DA 1B0AA 1QYDA 1C0IA 5D5PA 4D8XA 4P3XA 2D1FA 1KDTA 1YQEA 1UMCA 3TTXA 1FMTA 2B78A 5ALPA 3L9WA 3ROKA 3WLTA 4DQ0A 4UQLA 3K70C 1VJTA 3GJQA 3KKMA 2WV7A 3IA2A 1Y9EA 3FRHA 5GPBA 2QTGA 1U94A 3R3YA 5IYZA 4QFBA 2Y1OA 5BSMA 1DLIA 4EVQA 3PVZA 4G9EA 1YT5A 5FLYA 1V5EA 4HLUC 2P0YA 3NLLA 1MFZA 4NBRA 4MINA 5ALRA 1V35A 1ZCBA 1ZL2A 1I32A 4QNMA 1WNFA 4X44A 3ROTA 2DH5A 4W5RA 3ZCQA 1JTVA 3TLGA 1B8OA 5JMWA 3GRYA 3GUZA 2HIGA 2AG0A 1HDEA 3L1JA 4AZTA 3QX9A 4YASA 3HXPA 2J0EA 3T4PA 4IGKA 4XSGA 2C3PA 1JPUA 2V54A 1W36C 1TRHA 3QKSA 1JFFA 3K1ZA 3F74A 3JAMA 1EU1A 1V7QA 4H35A 3SEQA 2CK3A 3LDAA 2YINC 2H2HA 2DX7A 4G1EB 4TLCA 5E4JA 4OI4A 3CJRA 4RDHA 3RVKA 5AW0A 2R44A 4DV6B 2V5UA 3E53A 4W82A 1XLTC 1Z5UA 2X8BA 2EW1A 3V7WA 1AK2A 3CBGA 1HEYA 4GUDA 5JD4A 4MKGA 2C2XA 3KKOA 2J3KA 1P2SA 3N0TA 4JQOA 4F2DA 4FONA 5DYNA 2GLUA 3I37X 3FHOA 5DJ5A 1M2VB 2XY4A 4MI3A 3IIJA 4PX5A 3CKLA 5T67A 4AMVA 2XB9A 2VK2A 5KOJB 4JOBA 4NECA 2OZPA 4TXLA 3O1IC 1W1WA 4YJFA 4JLMA 3S2EA 1G4HA 1EJ0A 3AUKA 4J9UE 2BGNA 2QN1A 1BE1A 1U7WA 3BGDA 4UREA 3DM9B 4F3TA 2IHVA 4F2PA 3QF7A 1T2NA 3LECA 4L5YA 1A3CA 4MVWA 4YMTA 1HT1E 3H3XA 2WAOA 3RNLA 4OSPA 4O8CA 3AHFA 3QU4A 1KZGB 1PK7A 2GO7A 5K4AA 2P65A 1OIVA 3WYFA 2H31A 2I6FA 2V1UA 4WDRA 4UXIA 2RGDA 4WLNA 4KLNA 1KI2A 3UPDA 2IV3A 1L1QA 1NAHA 1PJBA 2HJVA 2OCBA 1LGYA 2VJPA 1SBNE 3B7GA 3L4EA 4AMZA 1KOJA 3W5AA 1AO0A 4IPTA 1RZUA 1G6OA 2H18A 3O31A 1QG6A 3O8OA 1KXZA 2KI5A 1XN4A 4REMA 5ALKA 3JD4A 1XRJA 1NJ2A 2R1VA 5D1NA 2Y67A 1CIJA 4LY6A 1C1DA 1D6MA 4BKRA 4NBKA 4DDHA 4ENUA 5LQDA 3IAFA 2REQA 2JI9A 2WAXA 3MQ4A 3F3KA 1X86B 1CJKC 4YRJA 4YXWD 5JD5A 2B98A 1DKRA 4MS3A 5FFFA 2X2PA 4ZT6A 3NOVA 5DYWA 4BIIA 1GNTA 1JBEA 1I51A 1TT5B 1WXXA 4WBXC 1A77A 1TVKB 2PK3A 3RJMA 3JQAA 4ISBA 3BRCA 5FB3A 4D0GA 1ZD5A 4YMWA 1P5JA 1S3SA 1TM1E 2WSSD 5HF5A 1EPUA 4F4DA 4TYWA 2GDJA 1UANA 2UZAA 3KXIA 4NOMA 4PWYA 2I6QA 1VIAA 2WOJA 4NDNE 4AW9A 4GOXA 2MMGA 5CXXA 1W49A 2PPLA 1JUDA 1XC7A 2WM8A 2WDZA 1WW8A 2XMCA 2X0FA 1KTVA 1YACA 1DJQA 2W2QA 3ZHXA 4AMBA 3SN6A 4JD5A 3D2CA 3KKZA 4C0KA 2WPDD 5T6BA 5JCOC 5IM4F 1GSOA 5IAEA 5CLHA 3MK31 2FEXA 5GJWC 4F6RB 2QSUA 3EVCA 1IY8A 5LN1A 4WZZA 1RI4A 4OI0A 1DUIA 5E9AA 1JE1A 2X5KO 5E2AA 3SQNA 2Z6UA 2Q3FA 4BX2A 5JBQA 3PITA 1HE4A 3GGGA 3Q2IA 5TPZD 1JL3A 2XWJI 1YRYE 2YJTD 4FX2A 1K98A 1Z4NA 1GTSA 4GU5A 1EA7A 1EJBA 3FDFA 2O8FA 1RP7A 2DFTA 4HXEB 4RA6B 1E1DA 1JN0A 1SOAA 1ZC3A 5KQSA 1JHPA 1RLJA 2IOHA 1TIKA 4TWAA 2R87A 2SNIE 3I53A 3VV2A 3OLWA 1P1IA 1STOA 4UUNA 4CL3A 2B8NA 2EQBA 3I39X 3W2GA 1FFGA 2QF7A 3PG5A 4LXTA 3U3ZA 3PXCX 2EFEB 3FM9A 3OZVA 4L27A 2Y9PB 4HJXA 1FNCA 1GNQA 1NYQA 1KEEB 3V9AA 4DB4A 5FOVA 2JFFA 5CVVA 5C8YB 4DM4A 1NIPA 4NULA 3OCYA 4KN6A 1DC8A 1O77A 1W5EA 2OEPA 1M7GA 1SM4A 2PL3A 1G8YA 4ZVOA 2PZMA 1WCWA 4H7HA 3QLVC 4ZJZA 4ZQGA 2H08A 3VX3A 5CFOA 3MC1A 1VRCA 3SHWA 1YB5A 4OBBA 2ECFA 1F12A 1HTWA 4MIEA 1PFQA 4N3AA 1JHOA 1WG8A 4L3WA 2VT2A 4RBNA 1GARA 1NBHA 3QNWA 1DEKA 1CE8A 3FTEA 1U02A 3GRPA 1MO3A 2CW5A 3OE5A 2IIBA 5IASA 5HX7A 2CHQA 3MLAA 1JQEA 3EAQA 1Z6QA 2Y1LA 4JBGA 3GV0A 4BO6A 4BU0A 1XTBA 3BSSA 3I9V6 1GHTA 5IJXA 1WD5A 2VHYA 2WUDA 1DRJA 2AOWA 2XPCA 4X1KA 3R7WB 5H4GA 1IVSA 5K8VA 5G2OA 1HF3A 5AM5A 1GILA 4MXDA 5DNVA 1T2DA 1EUDA 1TW2A 4KAAA 1NPYA 5JANA 1RAGA 3M7IA 1SRQA 1T5DX 3KV1A 3QP9A 4OEHA 2HHHB 4TTSA 4BFLA 4HDQB 3ZHSA 1XU4A 1PV2A 1CHDA 4QX6A 2TMKA 1GZVA 2DMRA 3O3CA 1PZFA 1BDBA 1EFRD 2BM1A 1SZCA 2AT1A 4JGBA 4DCJA 4EPWA 1T5TA 4E2WA 1W75A 1OWNA 1X1CA 3MILA 3UHAA 2RI0A 4K9QA 3VU9B 2GFHA 1S2NA 1QFXA 3KEFA 3LSTA 5ERYA 3TW0A 3WLRA 1SHJA 2JFNA 4E22A 4W5NA 3TQSA 3CVOA 1ZS9A 3QX8A 4X94A 4XASA 1XQYA 1DIAA 4E21A 3I0MA 3M9WA 3N5KA 3SY8A 2G4VA 3P52A 1K68A 3ZD9A 4DEYA 1ZN8A 4M1QA 3IEIA 2VFAA 3M5WA 2EFDB 4NQZA 1P4SA 2EQAA 3O84A 2H1VA 5EFOA 2BGGA 3HU5A 1D4AA 1PJLA 1YE8A 3FAKA 1Y3BE 4YQZA 1IUNA 4DMLA 3X1JA 1QMPA 2R66A 1V11B 1UBJS 2QEQA 4TTPA 5CBKA 1JIIA 3SQMA 1JMKC 3W4KA 3GDWA 3BMOA 3Q87B 1BHQ1 3SZMA 3GEEA 1UDCA 3R5FA 2N1BA 1DE0A 5CH8A 5JNVA 4JWKA 2CHEA 2WU1A 1ADCA 2DPXA 1ZC4A 2P2DA 1PK9A 4OM7A 2GBGA 3CJQA 2ANCA 1I7LA 1QTRA 2H2GA 2C4HA 2P3OA 3GI1A 3A2KA 3FCUB 1Q16A 4HH0A 4U7PB 4NL4H 2QWXA 4OXYA 5EXSA 4EB0A 4WTOA 2KPOA 4FHFA 2CC2A 1PUIA 4LYAA 4M8SA 4J0GA 1B42A 2I22A 4KGZA 2X0KA 3ORFA 1EFVB 4E5KA 4M9CA 4BVHA 5FOSA 1E8MA 1WV0A 5EC8A 5EE5B 3DB1A 5IZ4A 1B3RA 1GA6A 3PE4A 4DA0A 2BYTA 4G1VA 4LMAA 2CL6X 2JK1A 1C0KA 3ZY5A 5B12A 4GUAA 1XJWA 4S1WA 1F5NA 2TMGA 2ACWA 4HI0E 3WWEA 1OHHD 4KXWA 4ZMRA 2G9UA 2OGWA 1ZJYA 1AMNA 2RK6A 5K51A 3OU7A 1IZYA 3FWPA 5JCXA 5E6UA 2DY0A 5A3SA 2Z1DA 3I01A 3QUCA 4ZVKA 3TKLA 2GPBA 4EB8A 1HYEA 2RB4A 4EA6A 1CZHA 3LQ1A 4PZZA 3VKUA 4CGYA 3WNQA 3W78A 1SVIA 4GKAA 2XB2A 5AIAA 4Y9TA 1PT6A 1QH8B 1SBHA 4MNTA 3OC0A 4TZ6A 3R5KA 1M2EA 1OE0A 3Q15C 4MVXA 2FWPA 2QRPA 3ASZA 4I3HA 3FWKA 3M6LA 5JXJA 1WCIA 1J70A 1LX6A 2CN1A 2VUHB 3GJ7A 2AUMA 1AQYA 2QR2A 4JI0B 1L4BA 3ZCPA 1PW7A 4EEZA 5JCJD 4CV2A 3NHRA 4EMBA 5BWBA 4URYR 1LPMA 2Q3HA 4DCCA 3IERA 1W4RA 3EPKA 5A06A 4PLYA 1VJ1A 1JILA 5T3YA 3PS9A 3R6LA 2CNDA 1TEVA 1AX9A 2W6MA 1W47A 4KWIA 2XH8A 2X9NA 2EWWA 3VTZA 4BWYA 1XVLA 3EUEA 4AJLA 4R8MA 1O4WA 2IZ6A 2J7KA 1W36B 1PWHA 2KQUA 8OHMA 2F1HA 2J9YB 1JXAA 3SHTA 1THGA 4H7IA 3Q8XB 3KOOA 3LNCA 4MMXB 5DRYA 1BYUA 3H75A 4FS8A 4AM8A 1MRNA 5DGIA 3U56A 1U5BA 2DULA 1OPRA 3NHUA 4LWOA 1OB2A 2I34A 4YGYA 4BFXA 2QJTA 2OFPA 2HRCA 3PX2A 5DCWA 2OYCA 4REQB 1RRPA 2FPKA 3AIOA 1MAWA 4QQ8A 5A7HA 4K6OA 1H1DA 4R98A 1F3OA 2Y1KA 3VGJA 3O8CA 1SMKA 2GAIA 1E1YA 1ZAYA 3IVXA 1JVNA 1EHCA 1D0IA 2FFQA 1NSTA 4O1HA 2W42A 1T2CA 1A98A 3ONNA 3VJKA 4BNNA 1U1CA 1CR6A 1W30A 2JJ1A 4KQ2A 3K0AB 4UTXA 3T41A 4PRLA 1O54A 5JT1A 4YV0A 3EPPA 3O3MB 2Z6QA 2ZI5A 5L40A 4O59O 2VPXA 2GTIA 4R3NA 4XGKA 4DQDA 3NM4A 4EJSC 4NFSA 3D7LA 5KDDA 5TEWA 2PZ8A 1FJHA 1SCBA 2B1QA 2IDZA 3LLVA 3NVAA 1C4XA 1LZKA 3SHVA 1X3SA 3CW8X 2RGEA 2J5RA 4Q4LA 1I6KA 3T4EA 2O1EA 3G7SA 4OHFA 3U49A 1X8JA 2ZOSA 2YWBA 2FR8A 2W4QA 2Q1WA 5GGXA 3FOEC 1LEHA 2H1LA 2C9OA 3DXXA 1JX6A 1Y33E 4QTYA 3G13A 4Z53A 2WWXA 3NUGA 2A5JA 3LS2A 4G1UC 4ZEMA 3P20A 2HTEA 1GEEA 5T41A 1WA5A 2IEDA 2XHZA 4CMGA 2XAAA 1FXWF 1MIHA 1BU5A 1D6NA 2QXUA 3V8PA 5EMJA 1D4OA 3ELUA 2ECPA 2EATA 2IV7A 3SFVA 1CRQA 1ZUWA 4PEVA 1OH7A 2XMPA 1G8MA 5EINA 2OXEA 2XITA 5JARA 3H1AA 2OA0A 1PQWA 5CIQA 1WDWB 1EXVA 4RKYA 3BE8A 2C42A 2NAPA 4Z5XA 1WSDA 5G3YA 1Z3CA 1X1QA 1DO0A 2X1HA 2IYZA 2VF5X 3F5MA 1J1ZA 3PJGA 4Q48A 1GIAA 4CMEC 5KTYA 4JP1A 1P1BA 3GOQA 5CR9A 2MTBA 5CGQB 4YO7A 2V8BA 5BYJA 3SJAA 1H3FA 4O0LA 4UHJA 1NVFA 4E7OA 1AURA 1QV7A 3L6OO 3CFYA 3I9JA 4AMGA 4D4LA 4KGXA 4OIMA 3F8WA 5GJVC 2TMDA 4K9PA 2JVKA 1GQQA 3Q12A 4JJ6A 4HUJA 1PV1A 4M1MA 2HIHA 3G5AA 4XWWA 3BMCA 2PO5A 1MW9X 2R1ZA 1G20A 3JY6A 4BATA 4TUYA 1EG2A 1JJIA 3MOSA 1K7SN 4EA9A 5LU8A 3WDMA 3HB9A 4X3OA 3QUTA 2IH5A 3I05A 1P80A 4FFSA 4JVOA 5EJ9A 1IMJA 2QMUA 2QUZA 2YKGA 3SDBA 1M1YB 3AUTA 3CPJB 3VUEA 2Z43A 5KYKA 3ACBA 3VRHA 3LHFA 2DQZA 3P0EA 4FGWA 1PW5A 4B17A 1M5TA 1BKSB 3SSMA 2Y27A 3AP2A 2CD7A 3DWEX 1TEZA 3G0CA 3ZWNA 3OKAA 2PSEA 3AILA 4O2AA 2V97A 2WTAA 3JTEA 4GX0A 2R6CA 3ZHOA 2BWJA 2P75A 1R6UA 1TO6A 3I64A 3VPGA 3L6DA 4PYIA 2BFFA 2NYAA 4MV5A 4A0QA 1WDTA 1V2GA 3AR8A 1Y5RA 2Z9DA 1NW8A 1XZFA 1U2EA 2MYPA 5CYPA 1YCDA 2Y05A 4LZNA 1HLFA 2JA2A 4BL5A 1ULHA 2D8AA 2QRZA 4RHXA 4L8VA 1JDBC 4BV2A 3BHNA 1EUCB 4DEXA 2QT1A 2I3BA 2HLDA 3OZGA 4P2BA 3NJ8A 1NURA 4PTLA 3ZJ5A 3LQ2A 1P74A 4S1VA 4JWTA 4D98A 2DBVO 3NIBA 1TQ6A 3SR3A 2FDXA 3UW3A 4LKOA 4KIGA 1KIAA 2Z56A 3UAOA 5C1OA 3GVPA 4JX8A 1OAOC 2VYFA 3TGLA 3DF7A 4OQFA 3DZIA 1K66A 1OYWA 1QOZA 3GG9A 2GN8A 4QREA 1Z3IX 4I1VA 4O02B 1JPJA 2D54A 1SQFA 1FXWA 1XXHA 2WM9B 2PJDA 3MYRA 1JDZA 2B4QA 4YRFA 3USCS 4ALJA 4B2YA 3E48A 5K9ZA 3IQEA 5JZSA 1W5FA 4G8CA 1TLTA 4QUDA 3GNLA 3GJZA 3T3PB 4KE6A 5CT5A 4YJ2F 1ZSVA 1K7XB 5KOHB 2QG4A 1C2TA 1CB7A 3D02A 3P9XA 4N3BA 4PYKA 2EGHA 2ZUBA 4CUZA 4D0SA 4KXVA 2AUNA 3ZC3A 1P8JA 4LXQA 4MR8B 3ZCRA 5LYJA 2BKUA 4DA9A 1W5AA 1G8JA 4PZDA 4Z49A 1N0VC 2FH5B 2H65A 3PC7A 1K6XA 2ET6A 4IIDA 3RARA 1B7GO 3K32A 1LTHR 1CNMA 4NBVA 4ZTUB 2BIFA 4IFBA 3OCUA 1P7VA 2FF7A 4HY3A 5ICFA 5T4EA 4Q9NA 4YREA 1AKVA 4FMBB 2BI7A 4BLOA 1YI0A 1SQGA 5BO5A 3FDZA 2P0EA 3NKVA 3QITA 2RHRA 1TJ3A 4M1EA 4KE9A 3RI3A 3RSQA 3ABSB 2IC5A 2W48A 1XMVA 4YAJA 4B43A 2QRVA 2CFTA 1LBEA 3PUYA 1Z0FA 3DZCA 4HK4A 3D4LA 4KFUA 4P81A 3SBXA 3TDNA 5HIKA 5LQRA 2COEA 3FNBA 2C2OA 1G6KA 4HTAA 1WKVA 5ADHA 2EC5A 2E4UA 3KZCA 1G6HA 5JASA 1PN3A 2D59A 2CJWA 2I1LA 2JCYA 1UBKS 3IOMA 5GTDA 2IIPA 1Q0TA 5B3AA 3H05A 1KWGA 4URHA 1NVVR 4FFRA 3C3EA 4HWSA 4MQBA 2XODA 4TV8F 5T64A 1VJDA 1BEZA 1U1IA 1M1YA 1BOOA 4EG0A 3KSUA 2NSDA 1DP4A 1JLKA 1UPXA 1GZ5A 3ZBQA 3EGIA 1CR1A