2CLAA

Crystal structure of the asp-199-asn mutant of chloramphenicol acetyltransferase to 2.35 angstroms resolution. structural consequences of disruption of a buried salt-bridge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
213
Chain Sequence
MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCNGFHVARFINRLQELCNSKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Crystal structure of the aspartic acid-199----asparagine mutant of chloramphenicol acetyltransferase to 2.35-A resolution: structural consequences of disruption of a buried salt bridge.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (acyltransferase)
total genus 55
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1990-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2claA00
2II3A 3U9FA 1XL8A 2JGPA 4HVMA 1DPDA 1Q9JA 1C4TA 2ZBAA 3B2SA 5DU9A 1EABA 4KE4A 4CLAA 2I9DA 4G2MA 4G0BA 4JN5A 2RKTA 2E1UA 2II4A 5KJWA 5KJVA 2CLAA 5KJTA 5FALA 1Q23A 1E2OA 1SCZA 3CLAA 1EADA 2E1VA 4G22A 5KJSA 3B30A 2II5A 3MAEA 1XMCA 1EAEA 3FP0A 1CIAA 4KECA 2VSQA 5T3EA 1DPCA 1XMDA 3L60A 1XL7A 1CLAA 3U9BA 1EAAA 1PD5A 2RKVA 4JN3A 5FANA 2XR7A 1L5AA 5KJUA 2BGHA 2E1TA 1DPBA 2XHGA 4N72A 5DUAA 2IHWA 1NOCB 3FOTA 1EAFA 1EACA 1QCAA
chains in the Genus database with same CATH superfamily
1XL8A 4HVMA 2I9DA 4G0BA 5KJWA 5KJVA 2CLAA 1NM8A 1Q23A 2FY2A 2H4TA 1NDFA 2H3PA 3B30A 2II5A 1T1UA 5T3EA 1DPCA 3U9BA 1CLAA 5FANA 4JN3A 2BGHA 1DPBA 1T7QA 1NOCB 3FOTA 1EAFA 2FY4A 3U9FA 1DPDA 1C4TA 2ZBAA 3B2SA 1EABA 4KE4A 4CLAA 4EP9A 2DEBA 4JN5A 1Q6XA 2E1UA 5KJTA 5FALA 2H3WA 3FP0A 1NDIA 1EAAA 2FY5A 2RKVA 2XR7A 2XHGA 1QCAA 2II3A 1NDBA 2JGPA 2RCUA 4EYWA 2RKTA 1SCZA 2E1VA 5KJSA 3MAEA 1XMCA 1EAEA 4KECA 2VSQA 3L60A 1PD5A 1L5AA 1S5OA 5KJUA 5DUAA 1EACA 2H3UA 1Q9JA 5DU9A 4G2MA 2FW3A 4EPHA 1E2OA 3CLAA 2FY3A 1EADA 4G22A 1T7NA 1CIAA 1XMDA 1XL7A 1T7OA 2E1TA 4N72A 2IHWA 2FYOA 2II4A
chains in the Genus database with same CATH topology
2II3A 3U9FA 1XL8A 2JGPA 4HVMA 1DPDA 1Q9JA 1C4TA 2ZBAA 3B2SA 5DU9A 1EABA 4KE4A 4CLAA 2I9DA 4G2MA 4G0BA 4JN5A 2RKTA 2E1UA 2II4A 5KJWA 5KJVA 2CLAA 5KJTA 5FALA 1Q23A 1E2OA 1SCZA 3CLAA 1EADA 2E1VA 4G22A 5KJSA 3B30A 2II5A 3MAEA 1XMCA 1EAEA 3FP0A 1CIAA 4KECA 2VSQA 5T3EA 1DPCA 1XMDA 3L60A 1XL7A 1CLAA 3U9BA 1EAAA 1PD5A 2RKVA 4JN3A 5FANA 2XR7A 1L5AA 5KJUA 2BGHA 2E1TA 1DPBA 2XHGA 4N72A 5DUAA 2IHWA 1NOCB 3FOTA 1EAFA 1EACA 1QCAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2II3 A;  3U9F A;  1XL8 A;  2JGP A;  4HVM A;  1DPD A;  1Q9J A;  1C4T A;  2ZBA A;  3B2S A;  5DU9 A;  1EAB A;  4KE4 A;  4CLA A;  2I9D A;  4G2M A;  4G0B A;  4JN5 A;  2RKT A;  2E1U A;  2II4 A;  5KJW A;  5KJV A;  2CLA A;  5KJT A;  5FAL A;  1Q23 A;  1E2O A;  1SCZ A;  3CLA A;  1EAD A;  2E1V A;  4G22 A;  5KJS A;  3B30 A;  2II5 A;  3MAE A;  1XMC A;  1EAE A;  3FP0 A;  1CIA A;  4KEC A;  2VSQ A;  5T3E A;  1DPC A;  1XMD A;  3L60 A;  1XL7 A;  1CLA A;  3U9B A;  1EAA A;  1PD5 A;  2RKV A;  4JN3 A;  5FAN A;  2XR7 A;  1L5A A;  5KJU A;  2BGH A;  2E1T A;  1DPB A;  2XHG A;  4N72 A;  5DUA A;  2IHW A;  1NOC B;  3FOT A;  1EAF A;  1EAC A;  1QCA A; 
#chains in the Genus database with same CATH topology
 1XL8 A;  4HVM A;  2I9D A;  4G0B A;  5KJW A;  5KJV A;  2CLA A;  1NM8 A;  1Q23 A;  2FY2 A;  2H4T A;  1NDF A;  2H3P A;  3B30 A;  2II5 A;  1T1U A;  5T3E A;  1DPC A;  3U9B A;  1CLA A;  5FAN A;  4JN3 A;  2BGH A;  1DPB A;  1T7Q A;  1NOC B;  3FOT A;  1EAF A;  2FY4 A;  3U9F A;  1DPD A;  1C4T A;  2ZBA A;  3B2S A;  1EAB A;  4KE4 A;  4CLA A;  4EP9 A;  2DEB A;  4JN5 A;  1Q6X A;  2E1U A;  5KJT A;  5FAL A;  2H3W A;  3FP0 A;  1NDI A;  1EAA A;  2FY5 A;  2RKV A;  2XR7 A;  2XHG A;  1QCA A;  2II3 A;  1NDB A;  2JGP A;  2RCU A;  4EYW A;  2RKT A;  1SCZ A;  2E1V A;  5KJS A;  3MAE A;  1XMC A;  1EAE A;  4KEC A;  2VSQ A;  3L60 A;  1PD5 A;  1L5A A;  1S5O A;  5KJU A;  5DUA A;  1EAC A;  2H3U A;  1Q9J A;  5DU9 A;  4G2M A;  2FW3 A;  4EPH A;  1E2O A;  3CLA A;  2FY3 A;  1EAD A;  4G22 A;  1T7N A;  1CIA A;  1XMD A;  1XL7 A;  1T7O A;  2E1T A;  4N72 A;  2IHW A;  2FYO A;  2II4 A; 
#chains in the Genus database with same CATH homology
 2II3 A;  3U9F A;  1XL8 A;  2JGP A;  4HVM A;  1DPD A;  1Q9J A;  1C4T A;  2ZBA A;  3B2S A;  5DU9 A;  1EAB A;  4KE4 A;  4CLA A;  2I9D A;  4G2M A;  4G0B A;  4JN5 A;  2RKT A;  2E1U A;  2II4 A;  5KJW A;  5KJV A;  2CLA A;  5KJT A;  5FAL A;  1Q23 A;  1E2O A;  1SCZ A;  3CLA A;  1EAD A;  2E1V A;  4G22 A;  5KJS A;  3B30 A;  2II5 A;  3MAE A;  1XMC A;  1EAE A;  3FP0 A;  1CIA A;  4KEC A;  2VSQ A;  5T3E A;  1DPC A;  1XMD A;  3L60 A;  1XL7 A;  1CLA A;  3U9B A;  1EAA A;  1PD5 A;  2RKV A;  4JN3 A;  5FAN A;  2XR7 A;  1L5A A;  5KJU A;  2BGH A;  2E1T A;  1DPB A;  2XHG A;  4N72 A;  5DUA A;  2IHW A;  1NOC B;  3FOT A;  1EAF A;  1EAC A;  1QCA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...