2CLAA

Crystal structure of the asp-199-asn mutant of chloramphenicol acetyltransferase to 2.35 angstroms resolution. structural consequences of disruption of a buried salt-bridge
Total Genus 55
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
55
sequence length
213
structure length
213
Chain Sequence
b'MNYTKFDVKNWVRREHFEFYRHRLPCGFSLTSKIDITTLKKSLDDSAYKFYPVMIYLIAQAVNQFDELRMAIKDDELIVWDSVDPQFTVFHQETETFSALSCPYSSDIDQFMVNYLSVMERYKSDTKLFPQGVTPENHLNISALPWVNFDSFNLNVANFTDYFAPIITMAKYQQEGDRLLLPLSVQVHHAVCNGFHVARFINRLQELCNSKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CHLORAMPHENICOL ACETYLTRANSFERASE
publication title Crystal structure of the aspartic acid-199----asparagine mutant of chloramphenicol acetyltransferase to 2.35-A resolution: structural consequences of disruption of a buried salt bridge.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase (acyltransferase)
total genus 55
structure length 213
sequence length 213
ec nomenclature ec 2.3.1.28: Chloramphenicol O-acetyltransferase.
pdb deposition date 1990-04-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00302 CAT Chloramphenicol acetyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.559.10 Alpha Beta 2-Layer Sandwich Chloramphenicol Acetyltransferase Chloramphenicol acetyltransferase-like domain 2claA00
2XHGA 2CLAA 5DU9A 1XL8A 4KE4A 1CLAA 2BGHA 2E1VA 2II3A 2XR7A 1L5AA 5KJUA 2RKVA 2E1TA 4HVMA 5KJVA 1DPDA 1SCZA 1NOCB 5KJWA 4KECA 2VSQA 4N72A 2E1UA 4G0BA 1EACA 1EABA 1EAEA 1PD5A 2JGPA 3B2SA 4G2MA 3B30A 3MAEA 2RKTA 1QCAA 4JN5A 5FALA 1XMDA 5DUAA 3FP0A 1Q9JA 3FOTA 3U9BA 5KJSA 2II4A 3U9FA 1EAFA 1DPCA 3L60A 1C4TA 2IHWA 1EAAA 1Q23A 1XMCA 4JN3A 4CLAA 1EADA 2II5A 3CLAA 1CIAA 1E2OA 2ZBAA 5FANA 5KJTA 5T3EA 1XL7A 1DPBA 4G22A 2I9DA
chains in the Genus database with same CATH superfamily
2DEBA 2II3A 1L5AA 2FW3A 2XR7A 2E1TA 4HVMA 1T1UA 1NDBA 2H4TA 1EACA 2JGPA 5DUAA 3FP0A 1Q9JA 2II4A 3U9FA 1EAFA 3L60A 1XMCA 1EADA 2FY4A 2RKVA 1SCZA 5KJWA 1S5OA 1PD5A 1EABA 3MAEA 4JN5A 3U9BA 4CLAA 1T7NA 1CIAA 2ZBAA 1XL7A 1DPBA 4G22A 2FYOA 1T7QA 2XHGA 2CLAA 5DU9A 2FY5A 1CLAA 5KJUA 1NDIA 1DPDA 2RCUA 1NOCB 4KECA 2VSQA 4EYWA 4G0BA 5FANA 3B2SA 3B30A 2RKTA 1NDFA 1QCAA 1XMDA 1DPCA 1C4TA 2H3UA 1EAAA 2FY3A 1Q23A 2FY2A 2II5A 3CLAA 4EPHA 5KJTA 2H3PA 2I9DA 1Q6XA 4EP9A 1XL8A 4KE4A 2BGHA 2E1VA 1NM8A 5KJVA 4N72A 2E1UA 1EAEA 4G2MA 5FALA 3FOTA 2H3WA 5KJSA 2IHWA 4JN3A 1E2OA 1T7OA 5T3EA
chains in the Genus database with same CATH topology
2XHGA 2CLAA 5DU9A 1XL8A 4KE4A 1CLAA 2BGHA 2E1VA 2II3A 2XR7A 1L5AA 5KJUA 2RKVA 2E1TA 4HVMA 5KJVA 1DPDA 1SCZA 1NOCB 5KJWA 4KECA 2VSQA 4N72A 2E1UA 4G0BA 1EACA 1EABA 1EAEA 1PD5A 2JGPA 3B2SA 4G2MA 3B30A 3MAEA 2RKTA 1QCAA 4JN5A 5FALA 1XMDA 5DUAA 3FP0A 1Q9JA 3FOTA 3U9BA 5KJSA 2II4A 3U9FA 1EAFA 1DPCA 3L60A 1C4TA 2IHWA 1EAAA 1Q23A 1XMCA 4JN3A 4CLAA 1EADA 2II5A 3CLAA 1CIAA 1E2OA 2ZBAA 5FANA 5KJTA 5T3EA 1XL7A 1DPBA 4G22A 2I9DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XHG A;  2CLA A;  5DU9 A;  1XL8 A;  4KE4 A;  1CLA A;  2BGH A;  2E1V A;  2II3 A;  2XR7 A;  1L5A A;  5KJU A;  2RKV A;  2E1T A;  4HVM A;  5KJV A;  1DPD A;  1SCZ A;  1NOC B;  5KJW A;  4KEC A;  2VSQ A;  4N72 A;  2E1U A;  4G0B A;  1EAC A;  1EAB A;  1EAE A;  1PD5 A;  2JGP A;  3B2S A;  4G2M A;  3B30 A;  3MAE A;  2RKT A;  1QCA A;  4JN5 A;  5FAL A;  1XMD A;  5DUA A;  3FP0 A;  1Q9J A;  3FOT A;  3U9B A;  5KJS A;  2II4 A;  3U9F A;  1EAF A;  1DPC A;  3L60 A;  1C4T A;  2IHW A;  1EAA A;  1Q23 A;  1XMC A;  4JN3 A;  4CLA A;  1EAD A;  2II5 A;  3CLA A;  1CIA A;  1E2O A;  2ZBA A;  5FAN A;  5KJT A;  5T3E A;  1XL7 A;  1DPB A;  4G22 A;  2I9D A; 
#chains in the Genus database with same CATH topology
 2DEB A;  2II3 A;  1L5A A;  2FW3 A;  2XR7 A;  2E1T A;  4HVM A;  1T1U A;  1NDB A;  2H4T A;  1EAC A;  2JGP A;  5DUA A;  3FP0 A;  1Q9J A;  2II4 A;  3U9F A;  1EAF A;  3L60 A;  1XMC A;  1EAD A;  2FY4 A;  2RKV A;  1SCZ A;  5KJW A;  1S5O A;  1PD5 A;  1EAB A;  3MAE A;  4JN5 A;  3U9B A;  4CLA A;  1T7N A;  1CIA A;  2ZBA A;  1XL7 A;  1DPB A;  4G22 A;  2FYO A;  1T7Q A;  2XHG A;  2CLA A;  5DU9 A;  2FY5 A;  1CLA A;  5KJU A;  1NDI A;  1DPD A;  2RCU A;  1NOC B;  4KEC A;  2VSQ A;  4EYW A;  4G0B A;  5FAN A;  3B2S A;  3B30 A;  2RKT A;  1NDF A;  1QCA A;  1XMD A;  1DPC A;  1C4T A;  2H3U A;  1EAA A;  2FY3 A;  1Q23 A;  2FY2 A;  2II5 A;  3CLA A;  4EPH A;  5KJT A;  2H3P A;  2I9D A;  1Q6X A;  4EP9 A;  1XL8 A;  4KE4 A;  2BGH A;  2E1V A;  1NM8 A;  5KJV A;  4N72 A;  2E1U A;  1EAE A;  4G2M A;  5FAL A;  3FOT A;  2H3W A;  5KJS A;  2IHW A;  4JN3 A;  1E2O A;  1T7O A;  5T3E A; 
#chains in the Genus database with same CATH homology
 2XHG A;  2CLA A;  5DU9 A;  1XL8 A;  4KE4 A;  1CLA A;  2BGH A;  2E1V A;  2II3 A;  2XR7 A;  1L5A A;  5KJU A;  2RKV A;  2E1T A;  4HVM A;  5KJV A;  1DPD A;  1SCZ A;  1NOC B;  5KJW A;  4KEC A;  2VSQ A;  4N72 A;  2E1U A;  4G0B A;  1EAC A;  1EAB A;  1EAE A;  1PD5 A;  2JGP A;  3B2S A;  4G2M A;  3B30 A;  3MAE A;  2RKT A;  1QCA A;  4JN5 A;  5FAL A;  1XMD A;  5DUA A;  3FP0 A;  1Q9J A;  3FOT A;  3U9B A;  5KJS A;  2II4 A;  3U9F A;  1EAF A;  1DPC A;  3L60 A;  1C4T A;  2IHW A;  1EAA A;  1Q23 A;  1XMC A;  4JN3 A;  4CLA A;  1EAD A;  2II5 A;  3CLA A;  1CIA A;  1E2O A;  2ZBA A;  5FAN A;  5KJT A;  5T3E A;  1XL7 A;  1DPB A;  4G22 A;  2I9D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...