2CLEA

Tryptophan synthase in complex with n-(4'-trifluoromethoxybenzoyl)-2- amino-1-ethylphosphate (f6) - lowf6 complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
251
Chain Sequence
b'ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 251
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cleA00
5HWMA 2J24A 4RXFA 3PG9A 3SI9A 3PSVA 1L6SA 1EUAA 5MHBA 2CFFA 3O07A 3SW6A 3EWUA 3U8GA 3M16A 4UFKA 2E5BA 4XTIA 2JGQA 2Z2UA 2ZZ5A 4N4PA 5HJLA 5AN7A 2YW3A 4W9TA 1GVFA 2V5LA 3NQFA 3W7DA 3TSBA 1KM2A 5C2XA 2ALDA 1I45A 1JQVA 2GVLA 3L0NA 3L66A 3TW7A 4H4IA 3KAOA 3MHGA 2ABBA 3CC1A 2A5HA 2NX9A 2G95A 1DVJA 3DU0A 1YXCA 1VH7A 4M7TA 2H3DA 2WPBA 2HS8A 2B4GA 1YLVA 4JTTA 4JTKA 3N34A 4MJMA 1TYGA 2NV2A 4ZQOA 3NVTA 2G97A 1I4NA 2NZLA 4LRSA 3DXIA 2OJPA 3HG3A 3MJYA 1F6KA 2H8ZA 2ABAA 5K4XA 4XBSA 4LW7A 5LGZA 1XKYA 5HWJA 4JEQA 2Z1BA 1QO2A 1TPH1 3W07A 1LBMA 1PE1A 1G4PA 2ATSA 5J5RA 4HNTA 3KVJA 3GAKA 4ONVA 2WV8A 3UNDA 1OFBA 2FB3A 1X1ZA 3IIVA 4Y96A 5AFDA 3CEUA 3U6WA 4DO4A 1A5BA 3G1FA 2EHHA 1GTEA 1KLZA 2GQAA 4L4MA 3UD6A 3P8JA 4YLWA 3G1YA 4IGHA 2DORA 2RFGA 5U7SA 1ICPA 1WX0A 4BI5A 1RQHA 4N9CA 1NFBA 1W8SA 1M5WA 1THFD 5CZJA 1TIMA 5D2VA 4A2SA 1YXYA 1H5YA 2QDGA 4HPXA 5KTLA 2Y63A 5HUOA 1W3NA 1DJQA 1SO6A 4XWUA 4XQ6A 2LLEA 1OX6A 1LM1A 4YXGA 4LU0A 3G1HA 4QM1A 4E38A 4RZ6A 1XFBA 4JY8A 3LTPA 3LLFA 4IXXA 4TMCA 1KW1A 3S42A 3MBFA 1Q45A 2CLHA 1YADA 4YMZA 3LCGA 1DKWA 4M5PA 3G1XA 4M6QA 2FJKA 3BG5A 3W1UA 4HT3A 4D2JA 2C1HA 3L2IA 1SQ7A 3A9IA 4JYFA 4Y9AA 4O1CA 3P81A 5CPNA 2JKPA 1VGAA 2YPIA 4UNLA 3L5LA 3WK2A 2F84A 5AOUA 1BTMA 3GDTA 1O94A 3LCIA 1FDYA 5K7JA 4O16A 3S5OA 1XI3A 2V81A 1L9WA 3HF3A 3DFOA 2V2DA 1RPXA 3EXRA 1GVRA 2CLOA 3SY5A 3G3DA 1JUEA 2XN1A 3PBWA 4GXMA 1W0MA 4ML9A 5E1QA 1TV8A 4Z1CA 4E2BA 3PBYA 4XUGA 4M19A 2NXGA 3UQNA 5F4SA 3M6YA 4BI7A 1O95A 1PVNA 1LYXA 4ALDA 1YDVA 3S9YA 3FYOA 4FIQA 1TSIA 4S1FA 4UNKA 4XTDA 3C6CA 3BG3A 3ZWTA 3W83A 4AWTA 3S5ZA 5K2ZA 2FLIA 3N2XA 3O6DA 3P5YA 3PF3A 3W7HA 1QDSA 4GRSA 4J9JA 2I14A 3GR8A 3NPUA 4AHQA 2FPYA 5DBTA 4O4WA 3G1VA 3DI1A 3VKJA 3K30A 4O28A 1O60A 2VXNA 1KTCA 3F1QA 4O57A 1AW1A 1LLWA 5AC6A 1EWEA 3ELFA 4QITA 1TPB1 3EWYA 5CPLA 1LRQA 2R14A 5K9XA 1LROA 3C0JA 4X2RA 2C6QA 3BW4A 1P1XA 1HO1A 3R2GA 1OYAA 4I7VA 3IGXA 5CSSA 3M7WA 4M7SA 2ZZ6A 3QF0A 4Y6GA 1H62A 3LBMA 2CW6A 3EWWA 5D2YA 1ZY9A 3TW6A 3IRDA 4JTIA 2GVJA 1QAPA 3O6CA 1QMLA 2GJNA 4S2BA 5EY5A 5HINA 3WJXA 3G22A 4S2CA 3G1SA 1EP2A 2YYUA 4IMFA 3KRSA 1LOQA 3TJLA 3W7EA 2PRLA 3D0CA 3FJLA 1KV5A 1VYRA 3NQDA 1VQTA 4Y8FA 3HG5A 2E6YA 3AO0A 4OBTA 3DFQA 2ZZ2A 5AHLA 1AL7A 1TPFA 2CZDA 3C2RA 4CCDA 1DORA 4FNTA 3Q94A 4WY0A 4RCXA 3YPIA 4Z1DA 3BW2A 2A85A 3KFTA 4WQ6A 3OG3A 3SECA 3A21A 2E5CA 3WFAA 3H53A 1VRDA 2QUVA 4HSNA 4NJHA 4R7JA 4CNOA 4O0KA 2JBMA 3GXTA 1VC4A 2NX1A 3C4UA 4GFSA 3LCXA 3ZR4A 2CWNA 1OX4B 3HGSA 3LB0A 2A6NA 4Z1AA 3T4CA 2E1DA 4LV4A 4Y90A 5E0KA 4MLRA 1G67A 1TREA 5FF0A 4N6EA 1W31A 4JGDA 3ABRA 3NG3A 5I3KA 4QSHA 5KINA 1YTDA 3B8DA 3DI0A 1A53A 2QKFA 3G8EA 1W5MA 3WJWA 3TQVA 4BWLC 1HUVA 1ZALA 2KZHA 3MI3A 2O7SA 2OT1A 1XC4A 2FQIA 3UPBA 3W84A 3C52A 3MP3A 4JTHA 3DKJA 2VENA 1ICSA 4NX5A 4RJEA 2ZA3A 3DKLA 3NGJA 3QQ1A 2A1YA 1W5OA 2Y89A 1TPWA 2A2IA 3IVUA 2ZZ7A 3HO8A 1TCDA 1KFLA 4WXZA 5FI8A 3BPWA 3IV3A 3PWAA 1YPFA 2CZEA 4FNPA 3QYQA 1T99A 3Q58A 5CZSA 1JQXA 3STEA 2NLIA 2VFFA 3OA3A 4DELA 1SFLA 4LC6A 4P2VA 5C6MA 2NV1A 3GR7A 3Q37A 3LOTA 3B4UA 3HBLA 4XBKA 3BO9A 2P10A 4MZ8A 5LNWA 1KBIA 2EAWA 1Z48A 2ZQ0A 2W0UA 4A29A 1YTKA 1ZJIA 2OT0A 3IVSA 5DXYA 3QW4B 4JYDA 3LRMA 1KV8A 3TUUA 5HUPA 5IBXC 3EWZA 1SO3A 4WOZA 1WA3A 3TR2A 1V5XA 2ZCGA 3NZRA 1N55A 4UTIA 3W3OA 3W7RA 1TRIA 3O05A 4ZQPA 5HR7A 1ME8A 1WQ5A 4XZ9A 3LXAA 2TMDA 1Q6LA 1TV7A 4M6PA 2YCEA 2FPVA 1OHLA 4FO4A 5D05A 1W54A 3W72A 3LCHA 5TQLA 2YR1A 4JTGA 2RDWA 4IMGA 2WOQA 1QCWA 3NOEA 4O54A 2C18A 5EMUA 4IX0A 4RXGA 1MO0A 1N7KA 2ZZ3A 2DU2A 2Y88A 5GVJA 3A23A 3B06A 1QPOA 5D04C 2B7NA 3GK0A 1EP1A 1LBLA 3W1RA 5CKSA 2YFNA 1C29A 1D3HA 2YX0A 4N9EA 1UB3A 5E93A 4ZVJA 4HIBA 3I68A 2IQTA 1OVDA 4ZQNA 3QRHA 3A5FA 1SO5A 5KSWA 3GYEA 2QCLA 3ANYA 3EX4A 3SIZA 4YCPA 2VFGA 2YDAA 1PIIA 1TPDA 1OF8A 4X22A 3PR2A 4JTSA 4EOUA 1H1YA 3GIYA 5D30A 1YDOA 2DZTA 1F05A 1LOSA 3JS3A 4JX6A 1AG1O 3TQ0A 3EEGA 3MW7A 2JK2A 3M41A 2UV8G 3G0XA 3EX2A 3NDOA 1F7BA 2QCNA 2J88A 2VEKA 4UIOA 3FJ6A 3UWZA 1WXJA 3B05A 5D37A 4LC8A 2OCZA 1DOSA 2C19A 1C9DA 4JDYA 3S0CA 3QMSA 3DAQA 3HGJA 4LVAA 5KITA 3OEXA 1EPXA 2R8WA 5DCEA 3LHWA 4HHPA 3WK1A 4O8RA 3TIMA 3PB2A 3QM3A 1VS1A 1WBJA 3QSTA 4AMAA 3CQ0A 2GPTA 3TROA 4MKNA 2H6RA 2ZZ4A 1UASA 1GVQA 3NZ1A 1YDNA 1R2RA 2BX7A 3KRUA 3M5ZA 1VLIA 3O15A 3B0PA 2Y70A 4N02A 2CLKA 4PODA 3C61A 4LNYA 1EB3A 3NA8A 1FQ0A 1NF0A 3WK0A 2QCEA 1JRCA 2WNZA 3PBVA 1X8FA 5EA9A 3F03K 1TPEA 4K7VA 4JXCA 1IXPA 4R34A 3CWOX 3TMQA 5A8GA 1UJPA 3QQ0A 2DZPA 3G3MA 4TO8A 4BF9A 3E12A 3M9YA 2NUXA 4K39A 4MY8A 1M6JA 2C14A 2QUUA 2NUWA 3NNTA 4MPQA 2J6XA 2X1SA 5A5WA 1B3OA 2X30A 1FX6A 5D2TA 2TSYA 1PL9A 4PL1A 3W7OA 1LORA 2Y62A 1A50A 1KFKA 4O1DA 5H91A 1OF6A 1R46A 2QCHA 3FOKA 4OE7A 5G1YA 1UUOA 4JICA 4LUJA 3HOJA 3DENA 1G4TA 3GVGA 4JNMA 1FXQA 5EL1A 3ZFHA 3UYCA 3TNOA 5AYYA 4UTJA 2X2GA 2DZVA 4NJJA 5LHFA 1MEHA 4HKPA 1ZCOA 3UWQA 1DQXA 4AXKA 2EGZA 4CQAA 1R47A 5K3VA 1G7UA 2GJLA 3G8RA 2OX1A 1VHNA 4JTJA 3BARA 5LZLA 1M7PA 2E09A 2PURA 1VLWA 4DO5A 3RFAA 1HO4A 1OK6A 3DZ1A 2VEPA 3W1TA 4FNRA 1HL2A 3T40A 4UMCA 2TYSA 1GVOA 4K8EA 1KLYA 2QAFA 1EIXA 3ATYA 4ADUA 4R53A 1WAUA 5DELA 4AEOA 1HG3A 1WBHA 1KTNA 2QCCA 2X16A 4UUIA 5U4NA 3S1XA 2YFOA 3WJZA 3USBA 1ALDA 1BKSA 1ZAJA 2ISWA 3UY7A 4MVAA 1QFEA 3W7PA 3NL2A 2QCDB 2WSRA 5L9FA 2VEIA 1CX9A 1PCWA 2YZRA 4FNUA 5CPOA 4AF0A 3S5NA 1KFBA 2QCMA 3MMTA 4AB4A 3CIWA 4JX5A 3LM7A 1SZEA 3GKFA 1SSGA 3CU2A 4OWGA 2QDHA 3L0KA 4DPQA 1OFQA 4EF8A 4Z0SA 3LXBA 3PM6A 4WD0A 4FEZA 1EX5A 4IXHA 3W23A 3P82A 4UMBA 4TIMA 3OVQA 1PHWA 4NT0A 1GEQA 3OVPA 2TPSA 4U4MA 3N73A 3STFA 4DF1A 1R30A 2CLFA 1OX4A 4Q33A 1QPRA 1BEUA 3MYOA 4FX8A 3LCLA 5LNRA 2ZRXA 3NQAA 2E6FA 3TAOA 5CZTA 1TB3A 1ONRA 3W71A 2O7QA 3F4WA 3HJZA 3EKZA 1H7PA 5G5IA 3PC0A 1K7XA 3TKFA 1ZHAA 1RVGA 3DH7A 1GYNA 1YPIA 3GKAA 1VPXA 1OFEA 1S5WA 4K37A 1SSDA 5HMSA 4E0CA 1FWWA 5DCBA 1P0NA 4AWSA 3THAA 1W5NA 4LOCA 1VHCA 5K4ZA 3MHFA 3PULA 4MFEA 3IIPA 5CZ0A 1ZAIA 2DJLA 3UY8A 2B7PA 1Q6RA 2V30A 3NQEA 4JY9A 5DY3A 2WJZA 3NO5A 3KXQA 5DY2A 2C3ZA 3TXVA 3EX3A 4L4LA 1IIHA 5FF2A 2XFWA 3R5EA 1VYPX 2EF9A 4LT9A 1TPC1 2I9EA 1I2PA 1FUYA 5F2MA 2V8ZA 2E5DA 2PC4A 1XDLA 3DFPA 5AB3A 2BTMA 4YCOA 3BGJA 4FXRA 3T44A 2V2CA 3C56A 4FF7A 4GUJA 4JTFA 1KM1A 1G4SA 1X7FA 5EPDA 1MSSA 1T0OA 2AQWA 1KM6A 4IPJA 2V82A 4ZQCA 3W9ZA 5BMXA 2Y7FA 5BW6A 3TSMA 3G24A 2VFHA 3DGRA 2W6RA 3TE9A 4QJ1A 2ZA1A 3T55A 2GVGA 2CLMA 2ZDRA 4IWWA 1H50A 3WJSA 2CZ5A 4GUGA 1IXNA 2NX3A 2RKXA 4NUWA 3ATZA 3KRZA 1Q6QA 4A2RA 3GDRA 5ABTA 5TBOA 2H3BA 3TQKA 4O1AA 4Z1BA 3RF9A 3GDLA 1OJXA 5LHEA 8TIMA 5EBUA 2DZSA 3FLUA 3W1QA 1IGSA 4BWLA 1KM4A 4ADTA 1WDWA 3EKLA 5I3GA 3H55A 1GTHA 2FDSA 3A24A 5F4WA 2ZRVA 1SZGA 3N14A 4N9DA 4EIVA 1A5SA 3GXPA 3DBPA 1KFJA 3C3NA 1GWJA 3MBDA 3S1UA 4JD4A 3MUXA 3NQ6A 4X3ZA 1PHQA 1GOXA 3AJXA 1KM3A 3TH6A 3W7MA 4LY8A 3FFSA 1OYBA 1F2JA 1U5JA 4JN6A 2PRHA 4O10A 1BWKA 5D2XA 5FEZA 4GC4A 3W7JA 1VCGA 3W76A 3W7GA 4UTKA 1YTEA 3TSDA 4I9AA 4UFLA 1JR1A 3P7YA 1LRTA 3P62A 5AHFA 1NAL1 1N8FA 1FDZA 2E6DA 2GUUA 3M5YA 3LCWA 2I1OA 1GYLA 3QMTA 1H51A 2A4AA 1RV8A 4WJEA 3G1AA 3IIXA 5IBXA 4HNUA 4RKAA 1TTJA 2ZYFA 1F76A 3TC7A 5DXXA 3GXNA 4I7WA 3NL5A 1EEPA 1KFEA 2Q3RA 3SGUA 3NM1A 1XBXA 2FTPA 5G2IA 3G1DA 3RU6A 2A0NA 4XKYB 4UFJA 4M6VA 3CHVA 1H63A 3P74A 4CCCA 5C54A 1JCXA 2ZTJA 5CG7A 4ZQRA 1W56A 3NQMA 4MIMA 3LHUA 4ORMA 4CQ8A 3NL6A 1NEYA 1PV8A 4HSOA 1J4EA 4PCFA 1FCQA 1I2NA 5AHMA 4RX0A 3TC6A 1FWRA 3TDFA 5I3HA 1ZNNA 3MP4A 2A7RA 4HNNA 3LV6A 4QQ3A 5K9DA 2FB2A 5D02A 2CLLA 3P8IA 3ABOA 3QMRA 1XM3A 3UZJA 1K7EA 4O52A 4NNCA 1DQWA 4JDBA 2ZTKA 1R2TA 3QC3A 4PH6A 4NX0A 1W3TA 4JTEA 1WV2A 1LP6A 1K8YA 4UTWC 3FKKA 3CB8A 4WZHA 2Y6ZA 1TQXA 1S5VA 4OHQA 4AHPA 3JR2A 2G96A 3NQ7A 1T8XA 3L67A 3TA6A 3LRLA 3QSRA 1ZENA 2NWRA 3GX9A 3EWBX 3BK0A 4MYAA 4HNVA 2WNQA 2A7PA 4EF9A 3E0IA 3P61A 1K8ZA 3C2VA 1VYSX 1OFAA 1KFCA 3QH2A 4IMDA 4LVDA 1RD5A 1T96A 2P1FA 4NNAA 2XN2A 2YGYA 5L6UA 4EVZA 4WX2A 2AAMA 1OABA 2J27A 1H7NA 2E77A 5D38A 3SSJA 1SO4A 4JIQA 4O53A 4NQ1A 5CSRA 3WJYA 4LS0A 2HSAA 3TX9A 1B4KA 3H54A 3PUOA 2J9ZA 1KA9F 4NZFA 3W1LA 4Q4KA 5LNVA 3UWVA 3GNDA 2C15A 2VFIA 4JS3A 4LS2A 3NL3A 4K8HA 4DBDA 1V7YA 3OBKA 3M1ZA 3M43A 5BOOA 4POCA 3LERA 2E6AA 1OFPA 1Q6OA 3W7CA 4BR1A 2FFCA 4U28A 3HQ1A 4E2DA 5C55A 4DQWA 3DHDA 3UWWA 3QJAA 2CLIA 1D9EA 4JR5A 5HNRA 3WK3A 3UXAA 5BRBA 3U2OA 2VFEA 2ZZ1A 4UTTC 5F1UA 1RZMA 1K3UA 2YSWA 3G18A 4AH7A 3QZEA 1G69A 3BGGA 3KHJA 4LV9A 1O5KA 2ZA2A 2HMCA 4QAIA 5BMWA 4UTMA 3EXSA 3LHZA 5I3FA 5F2GA 3B0UX 1B57A 1MZHA 2RHGA 7TIMA 1CW2A 2WKJA 2DZWA 2GOUA 4Z08A 2BZNA 3E9AA 3W2JA 5DBUA 2NXIA 1AMKA 3A5VA 2DZUA 4K6AA 3I65A 2QCGA 3BV4A 4WXYA 1G7VA 5KZMA 4FNSA 4JYEA 1SW3A 4I7UA 5KZDA 3O1NA 3IIZA 1LRNA 1TV5A 2CZFA 1W37A 1NVMA 2FPTA 2J9XA 3PB0A 1K03A 3N2MA 3EX1A 1LLZA 3I6RA 1FCUA 2Y85A 3NQVA 3KVMA 4PTNA 3S6DA 4AVFA 3PSWA 1JUKA 3IIOA 3M5VA 3QEZA 4IMEA 1ZAHA 3S8HA 2JGYA 5HQEA 1IXOA 2QF7A 4LVFA 4O14A 3CEPA 1ME7A 3SFKA 2WQPA 1VZWA 2NUYA 3QPYA 4FX7A 4ZQMA 5FESA 3IGSA 3E96A 3M44A 4CLMA 2QJIA 4OGZA 3T78A 1OG0A 1D3GA 3L21A 4QISA 4LS1A 5I3IA 4EWND 4ZL1A 2Q8ZA 1F74A 5LNUA 1QR7A 3W2LA 1K8XA 1W5QA 4A22A 2OZ0A 5G4WA 5J5DA 1ME9A 3TV8A 3L5MA 3T7VA 3ABSA 3RLVA 4KFNA 3NQ2A 3N9SA 1OX5A 5D03A 1PS9A 2FIQA 4UMAA 2HS6A 1WOAA 3W73A 1SW7A 4K38A 4N2YA 3BG9A 3C8FA 4PFMA 4CNNA 3NPXA 4LUIA 1WOBA 3JRKA 3MI6A 4LTSA 2Z6IA 2RDTA 1L6YA 4KWVA 3KVKA 3A22A 1GPWA 3E49A 1EUNA 3SGZA 1JJKA 3MHUA 5AHIA 4O0ZA 4DPPA 3PG8A 1QNVA 4KWWA 3LGEA 4PC8A 3PY2A 5HULA 4IMCA 1E51A 3TJXA 1H7OA 3TXZA 1F73A 1B9BA 3I7RA 5AHEA 1FWSA 1I2OA 3SJ3A 5D09A 1VJIA 2W79A 2VC6A 3BLEA 5LGXA 4WY0F 4UTHA 3GDKA 3L65A 5CGQA 1DJNA 4Z0JA 1LDCA 1ML1A 3GB6A 1SPQA 4MYXA 2GQ8A 3R12A 5AYXA 1XDMA 1GG0A 2DZXA 4OU1A 3I7QA 3FKRA 1S3HA 2A21A 3VI2A 1KTBA 1S5TA 5G2HA 4NJKA 1FXPA 1X6UA 1GG1A 3MP5A 4RLIA 1EA0A 1OK4A 1IF2A 4B5NA 1UBSA 4DO6A 1NSJA 3W75A 5AHNA 1QO5A 3W1XA 3W7IA 1YYAA 3S5YA 4IPIA 3UPWA 1DHPA 3W22A 1IIGA 3N9RA 4OT7A 4NNBA 1GJPA 4O15A 1P4CA 5DN1A 4DBEA 4FB7A 5FEPA 3W7NA 5F2IA 3O8AA 4MOZA 1H61A 3FA5A 3TAKA 4CCEA 3QFEA 1KM0A 1QOPA 3TFCA 3R8RA 3LLDA 1PCKA 2F7FA 3MO7A 2X1RA 3DFSA 3QPZA 1SR9A 3TU9A 3EXTA 4FX6M 3LDVA 1JCLA 4K36A 4ZMGA 2Q8LA 2Q3OA 2CLEA 5DCDA 1I8JA 5TIMA 1IXQA 1VCFA 3EX6A 3TK7A 2V5BA 4AHOA 3CWNA 1YXDA 3LHVA 1EP3A 1OFOA 1Z44A 2H90A 2C16A 3PBUA 1F6PA 3O06A 1TTQA 4JTLA 5AYZA 1W5PA 3ZWSA 3P84A 3P67A 4G1KA 1HFBA 2Y7DA 4UTUA 1UUMA 3N3MA 5SWUA 1GZGA 2PCQA 4GUIA 1Z42A 4MUZA 1J2WA 3NM3A 5C5YA 3C2OA 3B03A 4RV8A 1LTDA 3UWUA 5EYWA 3HG4A 1QWGA 3R13A 1MEWA 1SW0A 3IEBA 2A6LA 5FEWA 3ABQA 5LNSA 2EKCA 4DF0A 4C1KA 1LBFA 1XBZA 3NR0A 3RNDA 4C1LA 4XKYA 5FEXA 4A21A 2XN0A 4H3DA 3LHYA 3B04A 3L68A 4UXDA 5FF3A 5KZEA 2BXVA 5G1TA 3UXDA 3W70A 3NQCA 4BFAA 1O4UA 2C0AA 3M5XA 4PL2A 1J5TA 4LVGA 1RQEA 3HB9A 4KKXA 3R89A 2RH9A 1QPQA 1TTIA 1JCJA 3N19B 3PUEA 3EWXA 1SZFA 4QNWA 3OVRA 2BLEA 4NXSA 1K02A 4UR7A 5BNKA 4ORIA 4KFOA 2VKZG 3UWYA 3CLMA 3W1MA 3QW3A 1KBJA 3L0GA 3NQ8A 1HTIA 4RZ4A 2HTMA 1H7WA 3W88A 2A7NA 4GJ1A 1XBYA 3DFNA 3NQGA 3C2FA 4GBUA 4IJBA 2Y7GA 3PVFA 1L6WA 4UR8A 1RQBA 3INPA 3BLIA 3TFXA 4DF2A 3LCFA 3BW3A 3OHIA 1RR2A 1LCOA 1H7XA 2VEMA 1NF7A 5EKYA 3HPSA 5F4XA 4LRTA 3W2KA 3W86A 4O13A 4MY1A 3HG2A 3RK8A 1FWNA 2OMAA 1AL8A 1X1OA 3LX9A 3L5AA 1QPNA 1H1ZA 3ZS4A 2G5WA 3CM4A 4O12A 2P0OA 2ZRYA 1TTPA 3PAJA 4OV4A 3VE9A 2CU0A 1AW5A 4O18A 4X9SA 3THQA 1W3IA 4CNPA 1A5AA 4YL2A 4TR9A 5KMYA 3LV5A 4MJZA 4NXKA 1I2QA 2BWGA 1O5XA 4O17A 1K7FA 2C13A 4IX2A 2Y61A 2ZBTA 4O1BA 4HN4A 2WSQA 4AF0B 3I7SA 6TIMA 1TMHA 1P5BA 3G0SA 2ZFAA 5I3JA 5CPMA 4GWEA 4NZJA 1H7RA 4K7YA 4WUIA 4RR4A 3HPXA 1U83A 2EPHA 2ATMA 4H6KA 3VCRA 4MLJA 1L2UA 3VNDA 4RK8A 3RLUA 4O50A 4NJIA 1MXSA 3MWAA 1TJPA 3IGUA 3LXCA 3MYPA 3TCEA 2YW4A 3VFLA 2ZRUA 4BI6A 4N9BA 4AAJA 3B0VC 4LVBA 3HGRA 2ZRWA 3EB2A 5AC8A 2B0MA 5LSMA 4TX9A 1JCMP 3NPVA 3KVLA 2QAPA 3LBCA 2ISSA 2RDUA 3IVTA 4UC5A 4UTLA 4IQLA 4ADSA 3S1WA 1OFRA 2VOMA 3P80A 1CI1A 1JCYA 4GUHA 1Y0EA 3E02A 3KX6A 2QCFA 3CIXA 3BLFA 1H60A 1ICQA 3FS2A 4UTWA 1FBAA 4JTUA 4UFHA 3OIXA 4GUFA 2J9YA 3TMLA 3V75A 4MY9A 3HGOA 3C2EA 2AGKA 1JVNA 2V9DA 1R2SA 3W74A 1JUBA 2V0TA 3NXFA 4MFDA 1JULA 1G4EA 2PRMA 2QR6A 4FNQA 3DHFA 3LTYA 3STCA 1TJRA 3BVJA 4BK9A 3W87A 4TMBA 1EWDA 4OV9A 3W7LA 1FWTA 1SFJA 5D32A 4NU7A 1JRBA 4YWIA 1XUZA 2VFDA 3SR7A 2YXGA 2X1UA 3O63A 3W1NA 2YYTA 3FEMA 4RZ5A 3HIJA 1Q3NA 1TO3A 1FCBA 1VR6A 4N6FA 5H2ZA 3LI1A 2E68A 5G4EA 4O11A 5AC7A 2VELA 1GQNA 1JCNA 1M7OA 2DJXA 2R94A 5DLCA 1XBVA 2R91A 1LOLA 4GE8A 4FIRA 1GT8A 3NPWA 5T26A 5F2LA 4KFPA 4N4QA 2ZRZA 5FF4A 3CTLA 1DL3A 3LI0A 4O19A 4GNJA 3KOFA 2H8XA 1BWLA 3CT7A 2GQ9A 1FCVA 4JIPA 3P5ZA 5IM51 2TRSA 3VE7A 1G6CA 5D2WA 1XXXA 3G0UA 1QOQA 1FY6A 2B7QA 1I2RA 2QEZA 1XL9A 3RMJA 1XUUA 3NYZA 5F1VA 4A3UA 1FDJA 4UTTA 1MEIA 3W2UA 4NJGA 1OFDA 4IOTA 2JKAA 2DP3A 3M0ZA 3FYPA 1Z41A 3PS7A 2QJHA 3M47A 3PUDA 2PE4A 1B4EA 1AK5A 1ZFJA 4QNEA 1TQJA 1TPUA 1WYIA 4LWWA 4WY0B 5FF7A 4IUOA 4UCGA 1SZNA 5HWNA 4HPJA 4R33A 2ISVA 3GDMA 4CQ9A 1W1ZA 3W7QA 4MZ1A 1SU5A 2Z6JA 1DV7A 3L9CA 3W2MA 3W1AA 4DXVA 3S1VA 1SUXA 3W1PA 1UCWA 6ALDA 3W6YA 3Q2DA 3W2NA 1XCFA 2QUTA 2V2HA 4DEFA 4JX4A 3CPRA 2QCDA 3W7KA 1VCVA 1DBTA 3LRKA 4AWUA 1KM5A 3STGA 4OQVA 2X1TA 3V1PA 2NXHA 4ZZ9A 3F4NA 4ICNA 3GAYA 4Q32A 3GNNA 3HPZA 3MI2A 3DFTA 4NVTA 2WSYA 3SZ8A 1GVSA 2WNNA 2NWSA 2WO5A 5K9CA 3GZ3A 1C8VA 1F5ZA 3NAVA 1P0KA 2JKEA 3O6YX 2BSLA 1LZOA 4FXSA 2Z0IA 1A5CA 3O16A 2Y7EA 4WOQA 3W85A 4QIUA 4UFIA 4P61A 5D33A 4PA8A 3HMJG 1TPVA 2QJGA 3P60A 3FIGA 4TU1A 4PEKA 3LHTA 5HR6A 2B7OA 3GLCA 1AW2A 4FHAA 3LTSA 1ADOA 5LKYA 4UFMA 2D73A 4MZYA 4O4VA 1TRDA 5G2WA 3UZ5A 1OYCA 3NEVA
chains in the Genus database with same CATH superfamily
2PC8A 4IQJA 1OC6A 2WW5A 3SI9A 3W28A 3V7PA 1UD8A 4KCUA 2CFFA 1HZYA 1KKOA 3CZJA 4BKNA 2JGQA 4A6GA 4JIHA 5HJLA 5C71A 4PRRA 4CQBA 4DUXA 1TELA 1Z7AA 4JKMA 5IDZA 1HN1A 4YTUA 4ENLA 5C2XA 1I45A 1CWYA 3AS3A 3KAOA 1BPLB 2G95A 3DU0A 4M7TA 2H3DA 4UR9A 3VOFA 1AD4A 7CGTA 1IZJA 1CEOA 1P0DA 4MJMA 5HOSA 1TYGA 2Y8KA 1IT0A 3B97A 1RJRA 2XZ7A 3CIVA 4WDXA 2DT2A 2VYOA 4MHBA 5K4XA 4XBSA 1XG4A 2FGZA 4UTFA 1QO2A 3ARZA 4XIMA 3SEPA 4HNTA 3BXWA 1TE1A 3KVJA 3UNDA 4AD0A 1OFBA 3IIVA 1X1ZA 2XGZA 3VDBA 2A3CA 4Y96A 4LCRA 4EPEC 4G9PA 3VDGA 3CEUA 1W1YA 4Z2IA 1LQAA 5CAKA 2GQAA 4DI8A 1W1IE 3UD6A 4IGHA 5U7SA 1FHDA 3K4DA 1RQHA 1KO0A 3B9AA 2HWGA 1M5WA 5HNUA 4KW2A 5D2VA 5KTLA 1DJQA 1V6XA 1QI3A 4HOXA 4XWUA 4XQ6A 4YXGA 4LU0A 2ZUSA 1PYMA 3MPGA 8XIAA 3JZEA 2CBJA 2FFIA 3T2QA 4E38A 4OZOA 3NZPA 1W3HA 4TMCA 3QOKA 4DAFA 1G9HA 1ODUA 4W7UA 1DKWA 1TUXA 3NDZA 3BG5A 3W1UA 2SFPA 4HT3A 2DT1A 4Y9AA 2JKPA 1VGAA 4LALA 2F84A 3S83A 4L61A 1A5UA 2PLCA 2C91A 1XINA 2V81A 3HF3A 1W3KA 2FGBA 1XF0A 1OQFA 1BG4A 1EFZA 2CLOA 1V6VA 3N25A 4MAVA 3EB4A 4V2XA 2R1MA 2XN1A 3PBWA 1EJWC 2OO0A 1XPYA 4PTWA 1TV8A 1WKYA 1DJXA 4Q4RA 1NP2A 4DBSA 2NXGA 3UQNA 1F8MA 1UR3M 4BI7A 1HGWA 4GFIA 1PVNA 2XVLA 3ANVA 2Q09A 4MUPA 3VMPA 1YDVA 4K1GA 4XZBA 3FYOA 3A47A 3I6TA 3P3BA 3ZYZA 3C6CA 5T9CE 3I6EA 2XIMA 1RBOB 2E40A 3W83A 2XIOA 3CV1A 4DM2A 2OB3A 2BDQA 3S5ZA 3M0XA 4AWTA 3UG5A 1E3ZA 4ASTA 2FLIA 3W7HA 4RDYA 4GRSA 1OB0A 3ZVHA 3C86A 3G1VA 3VKJA 4O28A 4Q8WA 3H7RA 1KTCA 4A4AA 2OFJA 1AW1A 2PGEA 1QI4A 1LLWA 1OGGA 3II1A 2E3ZA 3ELFA 2ZX6A 3BAXA 4IG2A 4JQ2A 5CPLA 4US6A 5D8WA 2C6QA 4IFKA 4D8ZA 3R2GA 4I7VA 2GFTA 5JIWA 2ZZ6A 3QF0A 1D2KA 4Y6GA 1H62A 4D6JA 3LBMA 2XWDA 2GVJA 2GJNA 3RN6A 3G22A 4S2CA 1P0EA 3G1SA 1OC7A 1EP2A 4H7VA 4HA3A 2J7EA 4IMFA 3TJLA 2PRLA 3ES8A 2OLSA 3FJLA 3AIBA 1A5OC 2H9AA 3HG5A 5CJMA 5T9BG 3UJFA 2FJUB 2PGFA 2E6YA 3AO0A 4OBTA 1E43A 1SVDA 2ZZ2A 3VIHA 2CZDA 4Z17A 4OJYA 4CCDA 4NRSA 4TXEA 3Q94A 3N4FA 1Q6EA 1S2AA 4WQ6A 1XLCA 3GTNA 3WFAA 4P8UA 1VRDA 2QUVA 3VD3A 4XAGA 2D22A 3U9IA 3MMWA 4NJHA 5KEZA 4CNOA 3FJ4A 1EJUC 2PDYA 3WQ8A 3GXTA 4U5KA 3TYZA 3NDYA 3AS0A 3OOQA 1KKRA 3ZOAA 2PLMA 1OX4B 3H4XA 2A6NA 5DFAA 3VX0A 2VZSA 1A5NC 3T4CA 1I9CB 2FZBA 5E0KA 1GOWA 4J5NA 3MSRA 4J3ZA 5FF0A 1F3TA 2V69A 2XH7A 3NG3A 1J0IA 5I3KA 5KINA 3WLRA 5I77A 1HKVA 3DI0A 3G8EA 1W5MA 2VR2A 3PZVA 5BXPA 1ZALA 3AXKA 1ZB5A 1VB9A 3B8TA 2QMJA 3MI3A 4ZB5A 2WVVA 5A95A 4JTHA 1IQ8A 4NX5A 4RJEA 3N2BA 3R11A 4LYKA 3TLQA 1LWHA 3EA2A 3LM3A 1HVXA 3GTIA 1I6NA 1NOWA 3UW6A 3GC5A 3N6JA 3CQIA 1JQXA 1PTGA 1MUCA 2NLIA 2VFFA 3UJSA 2UY4A 3BJFA 2WHMA 2X7WA 2P10A 1C3FA 1KBIA 3GNPA 3SQSA 2W0UA 3U3HA 2JIWA 3MKVA 1YTKA 1ZJIA 4JYDA 2JEPA 4NAFA 3TUUA 5IBXC 4WOZA 2VR4A 2IPFA 1FHVA 5I09A 4A3QA 3C3UA 1SFSA 4UTIA 3W3OA 3W7RA 3L4XA 1ME8A 1WQ5A 3FXYA 3WUGA 1TV7A 2VX5A 4M6PA 3ZJKA 2YCEA 2QV4A 1FKWA 2FPVA 4ZXLA 3IAPA 3LCHA 3T6CA 4WLCA 3WLIA 4O54A 3KCJA 1AUSL 1B3XA 4IX0A 4RXGA 1P0BA 1N7KA 2BY1A 2WSPA 2DZAA 3P6LA 3V3WA 3A23A 3H21A 5D04C 3GUWA 4RNIA 1C29A 2YX0A 1WB0A 2D2GA 3W00A 1JPDX 4HPNA 3QRHA 1SO5A 3EX4A 3PZQA 7A3HA 3T81A 2YDAA 1TPDA 4X22A 1TA3B 4JTSA 1S5NA 4XZLX 4EOUA 3E5BA 4HZ6A 4C6LA 1JYVA 4AIUA 1YDOA 1F05A 3D47A 3JS3A 4JX6A 3FAXA 4QHRA 2E9LA 4IM4A 5LYRA 4ZENA 4XAFA 2JK2A 4M8UA 4IGSA 1XH1A 5HMEA 1QNRA 3OP2A 1ESWA 2J88A 2IQDA 1JF5A 1JCTA 3MCNA 5A6AA 2BGNE 5CLWA 3PPHA 2OCZA 3QKEA 1EGMA 2Y2WA 4ZB0A 2HJPA 3SDOA 5KITA 3HGJA 3OEXA 3NIYA 3A3HA 3PB2A 4YVXA 3R79A 1U1HA 2ZZ4A 1UASA 5AECA 2YCJA 1YDNA 1R2RA 3A13A 4H2CA 3KRUA 2DGAA 1MRQA 3B0PA 1E4LA 2HXUA 2RJHA 1XRSA 3WK0A 3WQCA 3EDJA 3H24A 4IQDA 3U7BA 4GHRA 1X8FA 1IXPA 4R34A 3CWOX 5BWAA 3GXIA 1UJPA 3QQ0A 3G3MA 2NUXA 1RJQA 1M6JA 2C14A 3NNTA 1EA9C 2QPXA 2XHYA 2X1SA 1PL9A 1OC5A 4QX4A 5FAJA 4O1DA 1JPIA 4GQQA 4WR3A 4XZHA 3HOJA 3WQFA 1CDGA 3DENA 1EJRC 4FR6A 4JNMA 5M17A 4DVOA 3FGCA 4WCJA 3UA3A 4KESA 1C8YA 1MEHA 2ZUTA 5DQPA 1W6TA 1U30A 3WMCA 3U4FA 4CQAA 3BC9A 1R47A 1ZP3A 2GJLA 3G8RA 3ID7A 1VHNA 4Q4SA 3OB8A 4JTJA 4F66A 5LZLA 4HVXA 2GJXA 2PURA 1VLWA 3PANA 4W7VA 4NI3A 2VEPA 3T40A 2TYSA 1GVOA 4K8EA 2VZVA 1WAUA 5DELA 4AEOA 1KTNA 2QCCA 1OWQA 1OGBA 2D2OA 1VFMA 3U4AA 2Z27A 3IUDA 1ALDA 4Q7IA 3VX1A 3T0DA 2OLAA 2PDNA 1MRAA 2ISWA 4MVAA 1UH3A 3W7PA 4KCTA 3NL2A 1X39A 2YZRA 4HYRA 2E25A 2WMHA 5CPOA 4BQ5A 2J8TA 4NILA 1VP5A 1S2VA 3S5NA 1A4MA 2OEKA 4J35A 2FZMA 1UWRA 2ZKMX 3MMTA 3VOHA 3IARA 1Z8AA 3CBWA 1SZEA 2YDSA 3LGGA 3CU2A 4OWGA 1KRMA 4DPQA 1FKXA 1SJCA 4H9TA 1TVPA 4AEEA 2MUCA 1EJVC 3LXBA 3UG3A 3PM6A 1EX5A 3ISIX 3L4WA 4LEQA 1A80A 1QHPA 2J7DA 1P7TB 4TIMA 1PHWA 3AC0A 1R30A 2CLFA 1QPRA 1XCXA 1DTNA 5FSEC 1XH0A 3LCLA 1CPUA 2ZRXA 5A8PA 1NWSA 2PF8A 3TAOA 1MZRA 3IJ9A 3VXGA 2D23A 3CV2A 2O7QA 3F4WA 3EKZA 1H7PA 4UWMA 3PC0A 1DWIM 3WFZA 4XD4A 2NQJA 3BQ5A 4O0QA 5GQBA 3QPEA 4KEVA 1QW8A 1MXGA 4ZR8A 1UIOA 4K37A 3CAVA 1TX2A 3WQOA 5DCBA 3GXFA 4AWSA 4LOCA 1VHCA 3MHFA 3PULA 5CZ0A 2RGMA 1ZAIA 2WJDA 2B7PA 4DNMA 1Q6RA 4JTDA 2V30A 3NO5A 3KXQA 4QCEA 1GPFA 5DY2A 3AS2A 4QFUA 2PU1A 4B9ZA 1E3XA 1TR1A 2I9EA 1XYCA 1GZJA 2V8ZA 4UB9A 3KLKA 5AVHA 2PC4A 1B9ZA 3DFPA 2BTMA 2INEA 1Q65A 4LAOA 3C56A 2QULA 1KM1A 2O92A 1X7FA 1XCWA 3N18A 4EX4A 2WLYA 1GQLA 1T0OA 4IPJA 2V82A 4YWSA 1CZ1A 3W6LA 5BMXA 4YTRA 4QDWA 1XP3A 3K8KA 4YVVA 3RG6A 3EMCA 2WBKA 1Q63A 1VRXA 2GK1B 2ZA1A 3T55A 2E8YA 1Q6GA 1EXPA 4J3WA 1YNPA 3SUTA 2PF0A 3WJSA 1IXNA 2PDLA 2H3BA 3FEQA 4C6CA 2IPJA 2OWWA 5EBUA 2DZSA 3WBEA 4GQ0A 5LA1A 4DRSA 2QVNA 3WELA 3WNOA 3H55A 1GTHA 3A24A 1QNSA 1OZQA 2ZRVA 2QQ6A 4DJDC 3FDGA 3AXHA 1HKIA 1A3HA 4X3ZA 1GOXA 3AJXA 4LY8A 1E1CA 1I1WA 1PWMA 3QR3A 1UC5A 1BWKA 5D2XA 4XAYA 5FEZA 4DIAA 1VCGA 4QG6A 1FWFC 2PGRA 3W76A 3CT2A 1FWGC 3P7YA 3VOIA 4I6KA 3P62A 3UXIA 3UT0A 2E6DA 4GY0A 3LCWA 4PTMA 1GYLA 1PX8A 3KWXA 2A4AA 3GO2A 1V3MA 4WJEA 3UXLA 5IBXA 3GXNA 3HQPA 3NL5A 1EEPA 4CNUA 1KCZA 4LANA 3SGUA 3VKKA 5M2FX 2FTPA 5G2IA 3SUWA 2A0NA 3BSMA 4PUNA 2IS7A 1ISWA 4CCCA 3RUBL 5C54A 1JCXA 2Y8UA 3SN4A 4QE5A 3NQMA 4MIMA 4B16A 3S2NA 4S3CA 4ORMA 4CQ8A 3BSGA 1PSCA 3MMUA 3DIPA 1FCQA 3TC6A 4V1XA 3EAUA 1YBQA 3MP4A 4HNNA 3BTNA 3E2RA 1YKWA 3MWCA 5K9DA 3CLWA 4U31A 3SN0A 3CMGA 4J3VA 4ZSUA 3P8IA 1UWAA 5BXRA 1XM3A 2QF8A 4G5DA 1CYGA 2NQZA 3EEZA 3GIQA 2QIIA 3E2SA 3FKKA 2G4FA 4XX6A 3VDHA 1NDYA 4TX6A 3THUA 4XSLA 4JCLA 1S5VA 4OHQA 3G6LA 2X2YA 3ONBA 3UZZA 3NQ7A 4FS9A 2A3LA 1S46A 3GX9A 2A3HA 3EWBX 5A69A 3POCA 2CWXA 2CC0A 3HV9A 2ZVRA 3CAWA 4D6EA 1VYSX 1ZU8A 3UG8A 5AC5A 4H8NA 3WYZA 5L6UA 2YGYA 3WNPA 4WX2A 4HNCA 1OABA 4IP5A 3RLGA 4HNOA 4JIQA 4L80A 4W87A 3COTA 5ABHA 3T4WA 3RR4A 1B4KA 3H54A 5FL1A 3VC5A 5C9UA 1H41A 2WLZA 4Q4KA 3UWVA 2WJFA 1VPQA 2C15A 3PZOA 2D0HA 3EZ4A 3OBKA 3M1ZA 2OGJA 4POCA 3LERA 5EB8A 3GYCA 2E6AA 4DJED 3HQ1A 4QROA 5C55A 5C8BB 1QI0A 3F7JA 3DHDA 4QG9A 2CLIA 4JR5A 2VFEA 4BQ3A 2YSWA 4HOZA 3BGGA 3IUIA 3SN1A 2A3AA 3FJNA 5BMWA 3EXSA 3ABXA 4KEMA 3W81A 2WKJA 4F9JA 3AIRA 5C7VA 2GOUA 4AD2A 3W2JA 3H2NA 2IUZA 4C60A 1DJHA 5IDIA 3I65A 3BV4A 5KZMA 4F48A 4I7UA 1AVAA 4Y9PA 3PZMA 1CGUA 3IIZA 1QHZA 4MJ4A 5FJUA 4C6QA 2F9RA 3N2MA 1BQCA 1W2VA 4WHBA 2PDXA 2Y85A 3LD5A 4PUWA 4AVFA 5AKQA 1PZ3A 1W9XA 3C0QA 3IIOA 3MT1A 1DXFA 1IZCA 3OW1A 1XDJA 1VIZA 4H6QA 5JBDA 2JGYA 4TQTA 3C5QA 1XIFA 3B8UA 3QPYA 4UQAA 2V3DA 5FESA 5GNXA 3E96A 3MO4A 4ROPA 2QJIA 1OG0A 1DYSA 2PWDA 2ANUA 1F74A 3W2LA 4D8LA 1W5QA 4IPPA 2OZ0A 5G4WA 5JMUA 3L5MA 3ABSA 4KFNA 1E4MM 3T05A 3TYBA 1CGTA 1PS9A 3WEMA 3GS6A 3ALFA 1XICA 1IZKA 2GYIA 1BYAA 2HS6A 3E74A 3LK6A 3GFYA 3H2AA 3BG9A 4CNNA 3NPXA 4LUIA 2YBTA 1TJ1A 4H04A 1PIGA 1UOZA 4NYUA 2RDTA 4L6OA 4KWVA 5D9PA 1JJKA 3MHUA 2PZNA 5AHIA 1MQRA 2NSXA 4O0ZA 3PG8A 3NVDA 2J7GA 2KAUC 1KFWA 4UQDA 2ONEA 3PY2A 3RYSA 4IMCA 4MTVA 1SYTA 3TJXA 1H7OA 1GJUA 4RE4A 4C6JA 2VNCA 3I7RA 3OYXA 1RP8A 3V36A 4UTHA 5TF0A 3GDKA 4Z0JA 1LDCA 3DHUA 4C6MA 1ML1A 1SPQA 4UQCA 2GQ8A 4JTAA 1E9ZB 5FCZA 3K8LA 3KHDA 3F2CA 1XDMA 4Q8UA 4LYQA 3I7QA 4IIGA 3H22A 1YE4A 4C6EA 1E6RA 1XRFA 1Q4NX 1S2UA 2WXDM 2ZVIA 1R5YA 3MA8A 1JDAA 1UP2A 1PDYA 1QO5A 3L23A 1KQYA 4IPIA 3UPWA 3W22A 4K2SA 1Z3NA 3N9RA 4OT7A 4NNBA 2PDIA 4W8LA 5DN1A 3DGBA 5A6LA 2ESCA 1PKLA 1UHVA 5F2IA 3PFMA 3WL1A 3AHXA 4MOZA 3BCFA 1H61A 1A47A 1KM0A 3LZ3A 3QC0A 3PWIA 3LLDA 2NQLA 4HYVA 1IWAA 3QPZA 1BVWA 1Q85A 4FX6M 3LDVA 1JCLA 3WLSA 2V63A 4ZMGA 3CHEA 1E0TA 5TIMA 4B3LA 4MWAB 2WC4A 3EX6A 1GJWA 3VIGA 1TVNA 3M0YA 1AODA 1EP3A 3GH4A 2H90A 2C16A 3GDBA 1E56A 2YOCA 1F6PA 3O06A 3VNJA 5AYZA 4PN2A 2OZ3A 3P84A 4MB1A 1UUMA 5DMNA 1GZGA 1BSIA 4GUIA 1B3ZA 1J2WA 1TCMA 1JGIA 1GOQA 3UWUA 2XVKA 3A4AA 3R13A 1MEWA 3IEBA 4DUWA 2Z1SA 3EWCA 2D24A 4DF0A 4F0LA 1S2WA 1E6XM 4MKVA 1XBZA 4O1EA 4A21A 2YCKX 4AIOA 4HHHA 4C7DA 1GVIA 2WMFA 4UXDA 2NQ5A 4JCMA 3W70A 1OT2A 1LF1A 3TZNA 3WD0A 5I23A 3CTTA 3WLNA 4PL2A 1BXNA 2GVEA 1J5TA 4F0HA 4PMDA 2R1LA 5FL0A 1QPQA 4LF2A 4PB5A 1JCJA 4AZHA 3PUEA 3EWXA 3GNOA 1Q7QA 3AHVA 4NXSA 4P7NA 1DIDA 3UESA 1W8GA 1KBJA 4P7QA 1H7WA 3W88A 3QR0A 3C2FA 3KEHA 4GBUA 2Y7GA 4P8WA 5E6YA 1P43A 1B3VA 3WLLA 4DJDA 4X2PA 9XIAA 1WAWA 5JXQA 4KQNA 3UWEA 4LNCA 3W2KA 4IMAA 4IT1A 4C91A 1O12A 5EMYA 1X1OA 3GVVA 4CU7A 1HKMA 4DYKA 1TE6A 4OV4A 1CB7B 1AW5A 1R8LA 1JF6A 4MJZA 4NXKA 4PSRA 4V27A 2ZBTA 4O1BA 1IT7A 4MPKA 3PTQA 4HN4A 3SADA 1YEYA 3G0SA 2ZFAA 5I3JA 4LSBA 5AC4A 4GWEA 1H7RA 1TWWA 2HPIA 4PUMA 3VNDA 4RK8A 3LPPA 1CGXA 4FSAA 3RLUA 3MWAA 3E3HA 2XUCA 3TCEA 3HQNA 3QZ6A 2YW4A 3VFLA 4BI6A 2WAGA 1J12A 4MDPA 3KCOA 3CZLA 2ZRWA 4TX9A 1JCMP 3VC6A 3KVLA 4Q22A 2QAPA 3HFYA 2OXNA 4WSHA 2RDUA 1XLFA 4UTLA 3BCDA 1OFRA 4NG3A 2VOMA 3PPGA 1CI1A 4GUHA 1Y0EA 2QCFA 1US0A 3BLFA 2UWFA 1WUFA 3OIXA 1XS2A 3CUFA 2EPLX 1PO9A 5G1MA 4MY9A 3CZKA 3E0LA 3ANUA 5BU9A 2VHLA 4EAMA 4HP5A 4AW7A 2HK1A 1W1A1 1JULA 1A0EA 2O55A 4FNQA 4B3ZA 3QR1A 3LTYA 1TJRA 3BVJA 3LSCA 2W61A 4OV9A 4GXPA 3GQYA 4NU7A 2VFDA 3WQVA 2YXGA 2X1UA 4GOAA 3O63A 2YYTA 3FEMA 4JBRA 5DX7A 3HIJA 1FCBA 1VR6A 4NAEB 3UJRA 4O11A 5XIMA 2VELA 5I5RA 2O9PA 3IJDA 1JCNA 1M7OA 2DJXA 2GJRA 2OU4A 2R94A 1F3WA 4I8YA 2QT3A 4DLMA 1UWQA 2BVTA 3M0IA 3KUMA 1ZS2A 4KFPA 2XWEA 3CTLA 4H9YA 4O19A 3TCSA 7PTDA 3KOFA 1QPKA 1XWYA 4YIWA 1RPKA 3N2OA 2OSWA 1FCVA 1JNDA 5IM51 2TRSA 4LAKA 4ZFCA 1G6CA 5D2WA 1XXXA 4MDOA 2ZWYA 2EO7A 3BMVA 3RO8A 4CKQA 1FY6A 2B7QA 1I2RA 2QPUA 1R3SA 2HVOA 2QEZA 3DC0A 4HSHA 4B90A 1Q6FA 1XUUA 1POKA 6CGTA 4A3UA 5D4YA 2RUSA 5BOEA 4IOTA 1Z41A 1KXVA 1JI1A 2ZXQA 1WCGA 3ZR6A 4CD6A 4MGGA 2J75A 4AVOA 1ZBCA 3GG0A 5FF7A 3C2YA 3A4WA 5TD4A 2HE8A 4HPJA 4KWSA 4CQ9A 3W7QA 3AYTA 4MZ1A 3P0WA 2WZIA 3QTPA 3L9CA 4GX8A 4DXVA 1FHLA 2GSJA 1BRLA 6ALDA 3CWHA 4AY8A 2NLYA 2PSNA 1RH9A 3HN3A 3N29A 1EPVA 5FJJA 4ZE5A 1ISVA 3CPRA 3K5XA 1R7AA 2X1TA 1EO7A 2C8NA 1C8XA 4Q7NA 2WSYA 4G8TA 4RDZA 3RLHA 1K9EA 2WO5A 5K9CA 4BF5A 1BF6A 4GI4A 3B8VA 2XVGA 1C8VA 1XISA 1V4YA 3V0UA 1OBAA 2BSLA 4RNFA 1Y5VA 3KL5A 4W5UA 3VGBA 4DWDA 1L6GA 3EA1A 4DXXA 4WOQA 3T0AA 3BUVA 4QIUA 2AQVA 1PKNA 4P61A 4QAWA 3MUZ1 3FIGA 4H00A 3LPOA 1AW2A 4FHAA 5BZAA 3LLXA 4KBXA 4O4VA 1EF2A 2J24A 1CT5A 3PG9A 1X38A 2PWFA 4R27A 1UWSA 5A8NA 4L4PA 1EUAA 3T2OA 3SW6A 2BNJA 3R4IA 4UFKA 5AN7A 3MANA 3M7SA 2BODX 1ONWA 1KM2A 1UJQA 1G5AA 1WDQA 2GVLA 3L0NA 2NV9A 2JF6A 1ZTVA 8XIMA 4OFCA 3TJ4A 5BU6A 4BQ4A 2WPBA 1V7AA 4KMQA 1RAKA 4JTKA 3N34A 4G7FA 2CETA 3MU7A 3SGGA 1PBGA 2NV2A 3QY8A 4ZQOA 1JXJA 4Q8MA 1PJ9A 1E5NA 3DUGA 3NVTA 3E2QA 4P7RA 3HG3A 1KBLA 3OLGA 1XGDA 3HA1A 3RRXA 4XUYA 3SCPA 1UR2A 2YCLB 1UMYA 5LGZA 4DHGA 3WH8A 2WNWA 4HTBA 5HWJA 4JEQA 1RLCL 1TPH1 4B3KA 3LMZA 4C7FA 3T0BA 3TYUA 1JZ8A 2GK1A 1HNYA 1GCYA 1UWTA 3N15A 5AFDA 2PDGA 4Y2WA 3U6WA 2EHHA 2OYMA 3E5PA 3P8JA 5CJ5A 1WXZA 3V5FA 4CCZA 4L6HA 3PZIA 3ZQ9A 2YB4A 2DORA 5A6BD 2RFGA 5DMYA 3GG8A 4DWSB 3VILA 1JYXA 1UZDA 3K2GA 1WX0A 2BOEX 3P2VA 1NFBA 1THFD 1MFVA 4A2SA 1YXYA 3AU2A 4I5UA 1W3NA 4ICCX 3R94A 2LLEA 3M07A 1HXJA 5ECVA 1MW2A 4QM1A 2I7GA 1A5MC 1CCWB 3EOLA 4XVDA 1WPCA 2BS9A 3M4HA 2FZ8A 1KW1A 4CU6A 3S42A 2BP1A 2CLHA 4PCNA 2YCIX 3LCGA 4K3ZA 3G1XA 4M6QA 2FJKA 1EF3A 4D2JA 2C1HA 3L2IA 3BGAA 4JYFA 4XIAA 4GI6A 2YPIA 3L5LA 2CYGA 2VDHA 4AVNA 1NY1A 1HQTA 4DY1A 4O16A 1SMDA 1C7TA 3EXRA 4I5RA 3V18A 3VD4A 1V0KA 3U2EA 1TV4A 1W0MA 4ML9A 3GVWA 3PBYA 4XUGA 5I00A 1EYWA 5F4SA 5JBEA 2E28A 1K9FA 3KBJA 3LGDA 3S9YA 5EFFA 4S1FA 4M24A 2PP1A 1SR0A 4UNKA 4XTDA 2OG9A 3A64A 3W29A 3BG3A 4DX3A 1OG6A 1REQA 3BAKA 4NZ3A 4A3YA 3PZUA 4RPQA 4WGXA 2WZHA 5K2ZA 2PA6A 4F9DA 3N2XA 3O6DA 5CCZA 1QDSA 4AY7A 3UCQA 5BXTA 1F3EA 3VKAA 5E70A 4NF7A 1VJSA 4O4WA 5DBTA 3W53A 2ZUWA 2VXNA 4KCWA 4BS0A 3KS5A 2PWEA 3CJPA 1B90A 3KP1A 3HZ3A 2V38A 1R3VA 2VZOA 1UH2A 3BW4A 4ZTXA 3R10A 1P1XA 1OYAA 2R1KA 1E0WA 3M7WA 4M7SA 3SCQA 2CW6A 4MAZA 1EJSC 4JTIA 1QAPA 2YXOA 3O6CA 1QMLA 5AZ0A 3A3XA 4S2BA 1W1PA 5FA5A 1S3TC 3GY1A 1JYNA 4TUFA 5JIPA 3V0SA 3KRSA 2HK0A 3S2JA 4EKJA 2GUBA 2Q8XA 3D0CA 4QS5A 3S4TA 4GIRA 4Y8FA 1J11A 3S3GA 3CV7A 4JN7A 1W32A 5CGMA 1QNQA 3YPIA 2A85A 3HURA 4LF1A 4LX4A 1X7IA 3WD1A 4ROQA 4PEEA 3TTYA 4FA3A 4J3XA 1JZ4A 4Q8TA 1XIEA 2JBMA 5A94A 2BY2A 3UA4A 5DO8A 3C4UA 5FJRA 3ZR4A 3WUBA 3UNTA 3HGSA 3VZXA 2BVDA 3ARXA 2E1DA 1M04A 4LV4A 3WKZA 4Y90A 1G67A 4Q7BA 1TREA 3V35A 5LIXX 4XD3A 4JGDA 2O9TA 3OVGA 2QKFA 4RW3A 2CHRA 3K46A 1HUVA 3R58A 4GKLA 2WCAA 3RPDA 2FQIA 3UPBA 3MP3A 1EXBA 2J7FA 3DKJA 1UWIA 4EWJA 5H8UA 3QQ1A 2Y89A 4AQLA 1TPWA 3IVUA 1V8EA 5I02A 2ZZ7A 3HO8A 3EMZA 4JHZA 1KFLA 4WSKA 2Z28A 4PTDA 3BPWA 4KEUA 3MKCA 3PWAA 3K1GA 3QYQA 4DJEC 1SJDA 5CZSA 3WO8A 3FA3A 3STEA 3UR8A 4PMJA 3PPCA 2PEVA 4AMCA 3GR7A 3Q37A 4OVXA 3T07A 5LIYX 4XBKA 4A3RA 5LNWA 2XM2A 3OZYA 1GW1A 1Z48A 4KRUA 2W66A 3CL6A 4AIBA 1SO3A 4GIEA 1RP9A 2BV9A 2ZCGA 3ITYA 3NZRA 2QDEA 4PTVA 2PDKA 1N55A 4XAPA 2DIEA 1TRIA 4LFYA 5HR7A 3LXAA 1XSKA 1UKSA 1QJWA 3RX3A 2V67A 1E72M 1TZ7A 2YR1A 2VVSA 3PFRA 3NXLA 4H9MA 3NOEA 1CGYA 1KGXA 3PAOA 2ZZ3A 2DU2A 3AJ7A 1HL9A 2QPSA 1UD2A 5HXMA 4KH2A 1VJZA 2VC5A 1EP1A 4L65A 4AY1A 1U22A 2JALA 2BGQA 1D3HA 4N9EA 2V3GA 3CAKA 4ZVJA 1M03A 4HIBA 2ZX8A 1XIHA 3UFYA 1CLXA 1ODZA 5FJOA 3GYEA 2QCLA 4KWUA 2FGLA 5EFDA 2ZIDA 2VZUA 3CUJA 2OSYA 1OF8A 5DT5A 3PR2A 1H1YA 2YJQA 4L1GA 3SCWA 1ZLPA 3ITOA 2W62A 4IICA 1CENA 3EEGA 3AALA 5A2AA 1EGVA 4F0RA 3TC3A 2UV8G 2J79A 3EX2A 3NDOA 1FP8A 2AMGA 2QCNA 1NQ6A 1ONXA 2VEKA 4UIOA 3B0YA 1DTUA 3KOXA 4W5ZA 1PPIA 4QSFA 3WQ4A 4LC8A 2C19A 2ZX7A 1UQYA 3SM0A 2PTWA 3QMSA 2G50A 3UR5A 3T09A 3DAQA 2ZOXA 2DIJA 5DCEA 4WF7A 4NKCA 4O8RA 1H49A 3DG3A 2YL5A 2GPTA 2H6RA 2P8CA 1EYEA 4DWSC 3N6HA 2BX7A 1FWBC 2Y70A 4N02A 4PODA 3C61A 1EB3A 3AMKA 1NTHA 5GNZA 3WLTA 1KR0A 1SZRA 5EA9A 1IWBA 4NZ5A 3S2MA 4H83A 2DZPA 3SUUA 3E12A 4K39A 4MY8A 1EDQA 4JTRA 2WM1A 1D7KA 1LUCB 3SIMA 4MPQA 4TTUA 1PDZA 1B3OA 4LUSB 1FX6A 3BOXA 2WC3A 3I10A 2GGGA 5D2TA 3W7OA 1LORA 2GDUA 1HP5A 1FH7A 1R46A 1T5AA 1OF6A 5G1YA 1G4TA 3FK4A 4AU0A 2Z4GA 3ZFHA 4Q4OA 2PTDA 2X2GA 4NJJA 1GOKA 2CEQA 3BJTA 1PKYA 3KWSA 3UWQA 4AZGA 2EGZA 3ZXWA 3R0DA 2OX1A 3M0MA 3I3DA 3BARA 1M7PA 2HRWA 4RNHA 3OZMA 3WDHA 4J2MA 3RFAA 1RD6A 4I6VA 2HDJA 3DZ1A 2FVMA 4WRHA 1B3YA 1KLYA 1QK0A 3ATYA 4CU8A 4ADUA 2XM1A 4QJ3B 2YBUA 1SFTA 3CUIA 3ZLFA 1YNQA 3B8IA 3J7HA 3F5KA 3M64A 4D6IA 4L56A 5M1TA 4IPLA 3USBA 1TZ9A 4PMOA 4I9JA 1JDCA 3OHMB 1W91A 4MJ2A 3KCLA 4W84A 2ZXAA 4B91A 3GXMA 1QFEA 3BZGA 1VBGA 4OUIA 2QCDB 2VEIA 3XIMA 1CGVA 1MVYA 2OLHA 1UD4A 4AB4A 4BZYA 3CIWA 3GTXA 3LM7A 1SGJA 3UGVA 3OGVA 4ZO9A 5CBJA 4Q8OA 1OFQA 3STPA 3EDKA 1ZPTA 3VNYA 2INZA 3QKZA 4NT0A 4PMXA 1GEQA 4C6IA 4JFWA 4L6DA 2TPSA 3VVGA 2XIQA 3N73A 1OY0A 4DF1A 4Q33A 3MYOA 4FX8A 3MCMA 2WVSA 2VRQA 1C90A 3CMJA 1QT1A 1ONRA 2XFRA 1SMAA 3LNPA 1K7XA 3TKFA 1RVGA 4X0VA 2J66A 1GYNA 4C1NA 1WNOA 1OFEA 1S5WA 4ES4A 3OQEA 4B5XA 1FWWA 1UG6A 1UW9A 3THAA 3W24A 1W5NA 2PZ0A 2J6VA 3QY7A 1XLGA 3IIPA 3AHYA 2AOSA 3NTYA 1RY8A 5HAOA 4JY9A 2WJZA 4GY1A 3DYPA 2C3ZA 2ZC8A 3EX3A 4L4LA 1IIHA 3BMWA 1R9YA 1K4HA 4PUDA 1VYPX 2EF9A 1XDLA 4KF1A 3BGJA 4FXRA 3B9NA 2J77A 4FF7A 1V08A 2FZ9A 4B9YA 4G1NA 5HJXA 1UUQA 3ARPA 3F4CA 2Y7FA 3G24A 4FXJA 1EQCA 4L5ZA 3LZ5A 4ZEPA 2XISA 4CNSA 2FVLA 4H8UA 3TJIA 4IWWA 3R0UA 1B1YA 5LXXA 2RKXA 4NUWA 1NJJA 4J3SA 4MWAE 3KRZA 4A05A 2IPWA 5FJTA 3GDRA 3CZ8A 1V0MA 3TQKA 1F61A 4D6HA 8TIMA 3PNUA 2UY3A 3GU9A 2ZUVA 3FCPA 4R9OA 3MUIA 3EOUA 2VGIA 1O5QA 1KM4A 1R85A 3DOPA 4HPGA 3SY1A 2FDSA 3SY8A 3N14A 1QBAA 3ARYA 1JGMA 1A5SA 1FFRA 3GXPA 3DBPA 1KFJA 1X6LA 3S1UA 4FOKA 4JD4A 1E6SM 3MUXA 1UZ4A 3NQ6A 2W4XA 1KM3A 3MUY1 3OGSA 3W7MA 3AU6A 4DJEA 3QZAA 2YA2A 4ZXOA 1V6UA 1R0MA 4O10A 1AJ2A 1XLHA 1WKFA 2D0FA 3W7GA 3A12A 1J96A 4I9AA 3TSDA 2YLAA 3GHUA 1FDZA 2GUUA 1QI5A 3SRDA 2WKLA 5FAGA 3XISA 2OX4A 3M0KA 4YYFA 3IIXA 4HNUA 1XSJA 5FD0A 1F76A 5DXXA 1GEHA 1J0KA 2Q3RA 3AICA 4IGMA 3EDDA 4XKYB 4UFJA 2XIBA 1E9IA 1BVNP 1H63A 4UCFA 4J27A 3P74A 2WC7A 3HU7A 2ZTJA 4ZQRA 3K8MA 1RK5A 3FYYA 1Z69A 4MMWA 4H9XA 3UJEA 3NL6A 5D9OA 3QV7A 3DFYA 4JHMA 3ITTA 4QLKA 1I2NA 3K4WA 3TDFA 3VNIA 1K9DA 2A7RA 3FN9A 9XIMA 2CLLA 3WQPA 1T7LA 2ZXDA 4I9TA 4DM1A 3W82A 2ZUUA 2CBUA 3ARUA 4H7ZA 4JDBA 4E8CA 2REQA 2GUYA 4JKKA 4GYKA 3W27A 3BSHA 1J0YA 1W3TA 4JTEA 5CC7A 3GWQA 4GD0A 3WF2A 4X9YA 4UTWC 4KS0A 4BCEA 4P8XA 1QRQA 2Y6ZA 2BOFX 2DT0A 3LRLA 3CHCA 2C0HA 2NWRA 1HKWA 7ENLA 6PTDA 3P61A 1K8ZA 4JQ1A 5A2BA 3MZNA 1OFAA 3QH2A 4GVIA 3RU8X 1T96A 1OD8A 3WNNA 4GH1A 1H7NA 5D38A 1XD1A 5CSRA 2YCLA 3MVIA 2HSAA 2WZMA 3PUOA 1TIWA 5J8LA 4U3AA 2X05A 2D3NA 2CXGA 2DVTA 2VFIA 4JS3A 1QWKA 2PTZA 2FYMA 4UNIA 1CXIA 2W92A 4A8RA 5D9MA 3AFBA 5BYWA 1Q6OA 4E2DA 2FFCA 4U28A 2IKGA 4DQWA 1PX4A 3OBEA 4DWSA 3V5OA 3QJAA 1U5VA 3C0LA 1XLEA 3LBOA 3FHQA 5HNRA 5A6JA 3U2OA 2ADAA 5F1UA 2A3BA 1K3UA 3G18A 3QZEA 4U3CA 4H6RA 3NEHA 2XTKA 2ZA2A 4UTMA 1XKJA 5I3FA 3B0UX 1B57A 3PUGA 2G0WA 1AZ2A 4CN6A 2RHGA 7TIMA 2DZWA 4Z08A 3VOCA 4AYGA 2VD9A 3A5VA 2DZUA 3T08A 1QUMA 2QCGA 3UETA 4WXYA 1G7VA 3BQ6A 3D3AA 4JYEA 1SW3A 3CZGA 3VOJA 3A6OA 3OQ8A 2J9XA 3PB0A 4IQEA 2DSKA 1FCUA 3I6RA 2ASHA 5C70A 4PTNA 1R3WA 5CH9A 1JUKA 1AH0A 1NFGA 3L4ZA 4IMEA 4PYSA 1ZAHA 1E71M 5IOBA 1I60A 1S1PA 4O14A 1ME7A 3SFKA 3SJNA 1XR2A 3H12A 3WEOA 2HEJA 5I3DA 4LS1A 3RR1A 3GM8A 2DVUA 2J8GA 4S3BA 4EWND 2Q8ZA 5LNUA 3VKCA 5J5DA 1ME9A 3H7VA 2PD5A 4IIHA 2FIQA 4MG4A 4I90A 4P5UA 4J3TA 1SW7A 3BOFA 1DXEA 4K38A 4AIEA 3LS9A 1LL4A 1SJBA 3ORWA 3JRKA 3MI6A 4LTSA 2ACUA 1AQHA 3CO8A 2HCVA 3F5JA 1UZHA 2Y0FA 3H6OA 4H9VA 4M3PA 3SGZA 4HBKA 3T2PA 3AZTA 4PUJA 1RHCA 4S3KA 3QBUA 3N9KA 4PC8A 5HULA 2P50A 3E6EA 3VPLA 1E51A 2Y5JA 5CZKA 4OIFA 1F73A 1B9BA 1I2OA 1RSCA 5I78A 2W79A 2VC6A 2WYSA 5LGXA 3WDPP 1DJNA 3ME3A 1XLKA 1OD0A 1E70M 4XO6A 4MYXA 1J2BA 1HJQA 3ZIZA 1JDEA 3R12A 4M56A 2V5CA 4OU1A 5D9NA 3EGJA 3CUZA 1UD6A 2IQ0A 1KTBA 1S5TA 5G2HA 4OUEA 3WH9A 3AZSA 3RMEA 3MP5A 4RLIA 1B54A 3VDCA 1NSJA 3ZVIA 4IFRA 4GNVA 3W7IA 4WIWA 5EMKA 1P4CA 3EWDA 2OTDA 4E4FA 3MY9A 4PCSA 3TAKA 3QFEA 3CL8A 3GH7A 4R9XA 3BV7A 2IKIA 1VFHA 2QV5A 2F7FA 3E0VA 1M7JA 3MO7A 1SR9A 3TU9A 1DWGM 3M6DA 3F4DA 1H1NA 3KBSA 3H7UA 2PPGA 4J28A 2Q3OA 4HTYA 5T8GA 5DCDA 4AXNA 3TK7A 2V5BA 3IK4A 4TVCA 3KOWA 1OFOA 1Z44A 4LQ1A 2PB1A 1FOBA 1TTQA 2VX6A 4WKHA 3LY0A 5CBIA 2XVPA 2DW7A 2DIKA 2Y7DA 3UEQA 3N3MA 3MB9A 4MUZA 4X0NA 1E6ZA 1LTDA 2EJ1A 5EYWA 3HG4A 1QWGA 2A6LA 1F9CA 5FEWA 2EKCA 1W3LA 3KZSA 3AI0A 1Q4WA 4M82A 4C1LA 1BXBA 5FEXA 2XN0A 4H3DA 3OIHA 1UWUA 4HPHA 5G1TA 3UXDA 3QV6A 3NQCA 3AMCA 2VUYA 4GQRA 3M5XA 1X8CA 1LLOA 1RQEA 4UZUA 2NQ9A 5DMLA 5MKGB 3A4XA 1O7AA 1J6OA 1CECA 3MVTA 3N19B 3JUGA 5CSYA 3LENA 3GVRA 3MDUA 1SZFA 4HOWA 5BNKA 1WE5A 4FOJA 3N12A 2VKZG 4B4HA 4DN1A 3CLMA 3W1MA 3IJQA 2PDWA 3QHMA 5REQB 1HTIA 1S38A 1XHGA 4RZ4A 2R1NA 3BICA 4GJ1A 1XBYA 3S2LA 3KL0A 1LJYA 1AH3A 3WBYA 3PN8A 1ZJAA 4JL2A 4JKLA 4S38A 1FWJC 3D46A 4H9ZA 2KX9A 4TV5A 4DF2A 3TFXA 1RR2A 1XYMA 1NF7A 3RXZA 1D7FA 3HPSA 1TZZA 1JDFA 1EDTA 1AD1A 4MY1A 3HG2A 1UPPA 1BAGA 1J01A 2EG8A 3PPFA 3RK8A 3TTEA 3WLKX 2OMAA 1WDDA 2W3ZA 1H1ZA 4AZCB 2G5WA 3CM4A 4O12A 3PAJA 1TTPA 2QUMA 1B30A 2CU0A 1I1XA 3N6QA 4CNPA 1MW1A 4YL2A 1LG2A 4ZOBA 4O17A 5FSDC 3ZLGA 2FZNA 2Y61A 2WSQA 4C5YA 4AF0B 2IXUA 5H1WA 1VFUA 1KCXA 1NDZA 2OYLA 4RR4A 2CLPA 3KZPA 3VCRA 3WG6A 1S2TA 4MLJA 4K68A 1EX1A 4NJIA 1GW9A 2E0PA 3IGHX 5I24A 5B7ZA 2ZRUA 5EU9A 3M46A 3CQHA 3B0VC 7TAAA 5AC8A 3EB2A 2F6XA 5LSMA 2V6AA 1UIPA 3LBCA 2D0GA 2ISSA 3I3EA 4UC5A 2ISDA 3MQTA 1JG9A 2D2HA 4OTKA 3TWAA 3T0TA 6XIAA 5BROA 3URNA 3FS2A 4UTWA 3U57A 4Z2HA 3TMLA 6TAAA 3V75A 2W9MA 3LUTA 1F4HA 3QOMA 3VIOA 3C2EA 4W88A 2Y5SA 1NM9A 1ZUAX 1JPKA 4OOZA 6REQA 3H23A 1VD6A 2DQXA 1R2SA 3W74A 5TAOA 3JU2A 3QQWA 1X1NA 5CPQA 2CERA 3S5SA 3B9DA 2PDPA 2PRMA 4CN4A 3DHFA 3STCA 3H2OA 3LN3A 3W87A 4TMBA 3IJIA 4GI8A 2VDGA 1EZWA 1JRBA 4YWIA 1DWAM 1DHKA 3WMBA 1WP6A 1Q3NA 3NSMA 2EQDA 2E68A 5G4EA 3UBPC 2PDQA 4GJIA 2DQWA 3ABZA 4ATLA 3CV6A 2O56A 1LOLA 3AMDA 4GE8A 4PCTA 1GT8A 3VYLA 3NPWA 2DSUA 5FF4A 5IHRA 4H9UA 4B5VA 1E6NA 4S3JA 4QTGA 4DUVA 3RPMA 3AWOA 1H5VA 3G0UA 5CQ1A 3WF1A 1CLVA 2VCBA 3OODA 4YTSA 3IPWA 1XL9A 4JAWA 1L2QA 2GQ3A 3RMJA 3NYZA 3WDJA 1E73M 4MNLA 2I57A 1OFDA 4LB4A 3M0ZA 4GISA 4HA0A 2OQHA 3PS7A 4PSPA 1B4EA 1JAKA 3BJSA 1JD7A 3IK2A 4JIEA 3GRIA 2CHOA 2PDJA 3QV9A 1RJPA 4LWWA 4GGBA 4QLJA 4UCGA 2VVNA 4R33A 3GDMA 3R8HA 3Q65A 1W1ZA 4IGNA 4YTTA 4UQEA 4OOUA 3SURA 1P6CA 1YRRA 2Z6JA 3ITXA 1ZGDA 4AG0A 1DIEA 3VGFA 4IL0A 3WQEA 3OA5A 3W6YA 2DZBA 2PLKA 4JX4A 5A6BA 2QCDA 5HANA 1DBTA 3LRKA 1DWFM 4GZJA 3WDIA 1QXLA 3STGA 3V1PA 4ZBCA 1AFSA 1R86A 1E0UA 1K6AA 2VD8A 1WKEA 4NVTA 3SZ8A 1GVSA 2AL2A 2WNNA 2PP3A 3VNZA 5E09A 3L2MA 2GLKA 2XU2A 3CB3A 4JNZA 3NAVA 4HK5A 3APYA 1UROA 2JKEA 1FWIC 4GABA 1LZOA 4FXSA 2Z0IA 1DPMA 2YA0A 1HF6A 1A5CA 3O16A 3HV8A 3G1RA 4Q8NA 3W85A 2DPEA 4AD4A 4UFIA 3WLQA 5D33A 4PA8A 3HMJG 3P60A 2W27A 2GZXA 4IIEA 2WVUA 5HR6A 3B9EA 3GLCA 2YA1A 1ADOA 1TWZA 2D73A 4MZYA 1HX0A 1TRDA 5G2WA 4IF2A 3NSNA 4MKSA 5HWMA 5C2CA 1GQIA 2VGFA 3O07A 1XPGA 3T9PA 3EWUA 2ZX5A 4YNGA 2DUAA 3M16A 2RJGA 4IHCA 4XTIA 4LJ3A 2Z2UA 4E4PA 2ZZ5A 5KZ6A 2YW3A 4W9TA 1GVFA 2V5LA 4ZOAA 1QATA 3W7DA 3TSBA 1A0DA 5AVNA 1XFCA 3ZSTA 4ZOEA 3TW7A 3LEPA 4JOMA 4H4IA 3GBDA 3MHGA 3CC1A 1A3XA 3B9OA 1IR2A 2FHCA 3UG4A 1YXCA 3GU1A 4A35A 2B4GA 1YLVA 1VFLA 4JTTA 3CAQA 4RDWA 4FPSA 1AQFA 2B31A 4Q6XA 4FLQA 3MDWA 1DQUA 1UKQA 2G97A 5HQLA 1I4NA 2PDBA 3VZYA 2H8ZA 5B80A 2BHUA 4GNKB 2VQTA 2ZXBA 4HMCA 1TG7A 2ACSA 4AYSA 3Q45A 2Z1BA 4MNMA 4HCLA 3W07A 1PE1A 1G4PA 3ITVA 3OJGA 1V03A 5J5RA 3GAKA 4ONVA 1JEZA 2WMIB 1UR4A 4DO4A 1A5BA 3G1FA 4LAUA 4YJ5A 1KLZA 1EJTC 2AAAA 4P7OA 3H4GA 4CD4A 3BLDA 1GOMA 2OPJA 4YLWA 1BG9A 3EOOA 1EOMA 3RHGA 1ICPA 1Q8AA 4Q8VA 4BI5A 3WN6A 2DH3A 4RDVA 4EXQA 5CZJA 2F38A 2PD9A 1W1B1 1I0DA 2XIIA 2Y63A 1Q8JA 2YKKA 1OX6A 9RUBA 2AKZA 4JY8A 3LTPA 5AZ1A 3LLFA 3BURA 4QEEA 3MBFA 1Q45A 2JQXA 4L9ZA 1BVZA 3GNXA 4UOZA 1SQ7A 4MWAD 4AX7A 2HE5A 4RNJA 4KGJA 1B2YA 3HM7A 4CQDA 1BTMA 1XV8A 3GDTA 4M6UA 1HVQA 1O94A 1J9YA 2PBOA 3S5OA 1XI3A 4ACZA 3DFOA 1RPXA 3R25A 4V28A 4NI8A 3VD9A 3SY5A 3KTXA 2QHAA 3ARRA 1Z6KA 2Y5EA 4GXMA 2FTYA 5E1QA 4AD5A 2VWTA 4GCXA 2I17A 3AIVA 4TVUA 1O95A 3OLEA 4ALDA 1K1DA 1CXHA 4FIQA 4CD5A 4GZEA 1V02E 1D3CA 4Q3MA 4IFOA 5A6MA 3M0LA 1DE5A 3VIPA 4AC7C 2BB0A 2OGYA 3P5YA 3PF3A 1KWKA 3GU2A 3FGCB 4J9JA 1MXDA 4AHQA 3KRBA 4XD5A 3K30A 2AKMA 3JZUA 5IFTA 3DN5A 3F1QA 4KRTA 3SCTA 1FFQA 5AC6A 4QITA 1VAHA 1TPB1 3SCRA 1CXFA 1LRQA 4QCFA 4X2RA 3CUGA 4PGLA 2EG7A 2E8ZA 3IGXA 3VIMA 3EWWA 3M0JA 5D2YA 1ZY9A 3TW6A 2Q6ZA 4JIIX 2DV0A 5HINA 1V77A 1OIMA 7XIMA 3B40A 2YYUA 2VX4A 4Q8QA 3W7EA 1KBKA 2Z7KA 2G8ZA 4JFSA 1KV5A 2PAJA 3NQDA 3VCCA 1VQTA 2BBFA 3TP4A 2OOGA 2WKGA 5LXEA 4D72A 5AHLA 1TPFA 4WK9A 5ENLA 3C2RA 3SCOA 1DORA 4FNTA 5ABFA 1MNSA 4WY0A 4Z2KA 1J8VA 4Z1DA 3BW2A 4F8XA 1NU5A 3OG3A 1W9PA 3A21A 2ALRA 1MW3A 3ERPA 5JQ9A 1J0HA 1OINA 3H53A 2XPKA 3D3FA 4HK7A 1A4LA 2HVNA 4JEJA 4X60A 4E2OA 5CPTA 3JVAA 3KW3A 1VBHA 4O0KA 2YXXA 2O4MA 5C2GA 1OADA 3CUXA 5ABEA 1KGWA 4Z1AA 3S46A 3VD7A 4MLRA 3MTWA 2RAGA 3SRFA 1BHGA 1W31A 3IJLA 2R82A 3ABRA 1XD0A 1UR0A 3AIEA 1A53A 2JEQA 1M41A 2G3MA 3WEZA 3TONA 2BGSA 2BFGA 1KBBA 4PBFA 1IWPA 2KZHA 3SCSA 4IJRA 2OT1A 2R9RA 2I5QA 3W84A 4FXFA 2VL4A 2VENA 1ICSA 2ZA3A 3DKLA 3W0KA 3NGJA 1M68A 3VCNA 4QJ5B 2A2IA 3TNBA 1TCDA 4WXZA 3PK7A 1JPHA 5E0FA 3VINA 4LCSA 2CZEA 1ITUA 2QIWA 1T6MA 3OA3A 1EC9A 1SFLA 4Z42C 4P2VA 5C6MA 2NV1A 3LOTA 3B4UA 3WF4A 4YYCA 2VRJA 3BO9A 2VX7A 4MZ8A 2G41A 4E5TA 1VEOA 3BMXA 3O0FA 1S2CA 1UC4A 4C6OA 3F4VA 2OT0A 3IVSA 3QW4B 3ITCA 1EQPA 2VR5A 2CPUA 3UCDA 1KV8A 3EWZA 4GO8A 1V5XA 2XH4A 2OWCA 4GZIA 3W01A 3LPGA 4QRNA 4GVGA 1F6YA 4XZ9A 2TMDA 3LQGA 4U2ZA 4Z2GA 1EKOA 1P6BA 1OHLA 3ZR5A 1XRTA 3FY1A 4BF7A 3W72A 2MANA 1WZLA 4IZGA 2XH0A 5TQLA 2RDWA 4IMGA 1GUVA 4GCAA 3PZ9A 3W37A 1MQPA 2W63A 3FSUA 4IUGA 2C18A 1MO0A 3KTCA 4YU1A 2VEGA 2Y88A 3KBNA 5GVJA 2GDQA 4HMEA 1ENUA 1QPOA 3GZAA 2B7NA 1X97A 5A3HA 3MC5A 4PMRA 1QHOA 3W1RA 5CKSA 2QJNA 2YFNA 4DYJA 5HMDA 5E93A 3VU2A 3ZZ1A 4LUTB 4CEUC 3I68A 1LG1A 1OVDA 3AWNA 1FWAC 3GTFA 4ZQNA 3A5FA 1VBUA 1DP0A 1VBRA 2QGHA 1V93A 4B4FA 4GLEA 3SIZA 4YCPA 2VFGA 1PIIA 3WDQA 1EEXA 1UKOA 3QLDA 3W25A 2XSAA 2DZTA 4JQ4A 1LOSA 4PMUA 1AG1O 2Y24A 4REQB 1GOOA 3CHFA 4NRRA 2Z24A 1F7BA 3AROA 1W17A 4DZHA 4PMYA 3FJ6A 1DWHM 3XINA 1OSEA 1U1JA 4JZ5A 3UWZA 2WM0A 1WXJA 3I4KA 4S23A 3B05A 1HP4A 5D37A 1FRBA 2X42A 3VAVA 1DOSA 2DFAA 4RUBA 1XLMA 1TV2A 2R8WA 3OGRA 4HHPA 5A6SA 3WK1A 3TEVA 3TIMA 1U5HA 3SUSA 1NDWA 3QM3A 4CQCA 4AMAA 3CQ0A 4QEHA 1UR9A 1HL8A 4YS1A 4MKNA 3WF3A 2CCRA 1YBQB 3AOFA 1VENA 2P0IA 3M5ZA 1VLIA 2POTA 4KIEA 4LNYA 3WLMA 3NA8A 2AQOA 1FQ0A 1NF0A 2FH6A 2QCEA 1VFTA 4DYEA 1JRCA 1LQ2A 1TPEA 3TMQA 5A8GA 3CQJA 4CN1A 4MB3A 2ACQA 4BF9A 2QUUA 3B4YA 2FVKA 5EGRA 3BANA 2X30A 3AIWA 3IACA 2Y62A 4W4QA 1KFKA 1NARA 5G4HC 2QCHA 1N8WA 1PWLA 3DFHA 4JICA 4EP8C 4LUJA 2BXYA 3GVGA 1DIOA 5MKGA 5E5CA 1XQLA 4ZGYA 2E67A 2DH2A 1JIBA 3TNOA 2DZVA 4J1OA 4HKPA 1ZCOA 1PUDA 4AXKA 4LYRA 4YN5A 5REQA 1FHUA 5K3VA 1G7UA 4O8AA 4G7EB 4ATDA 4GIYA 4EK7A 1YW1A 3RITA 1HO4A 2OKTA 4FNRA 1HL2A 3RGTA 3L4VA 1EIXA 2PI6A 2EPOA 1HG3A 1WBHA 3RM8A 2Z2AA 3KDOA 2X16A 4UUIA 5U4NA 3S1XA 3EOSA 1UA3A 2YFOA 1CXLA 1YHTA 1BKSA 4AZCA 5HQMA 2NSOA 5BXSA 1CNVA 3UY7A 4HA1A 2NT0A 2YL9A 3NGFA 1EIBA 4R88A 3PJUA 4DWSD 2WSRA 5L9FA 1JDDA 5HDRA 1CX9A 1PCWA 4AF0A 1KFBA 1GORA 4B5TA 2V3EA 2HROA 4JFVA 4W93A 4R7OA 4S3DA 2QDHA 4C6FA 3TTSA 3L0KA 1TJ0A 4LAMA 4B5UA 2J7BA 2IMRA 4EAYA 4GINA 4PFHA 1FWHC 2E4TA 1JZ2A 3ONCA 4Z0SA 9CGTA 4H8HA 4WD0A 4FEZA 1CBGA 4IXHA 3W23A 3P82A 4UMBA 2OZTA 2VGBA 1HIZA 3KE0A 3HJEA 3STFA 1E5JA 3VKBA 1OX4A 1M9HA 1PZ2A 1P48A 3UERA 4DZIA 5LNRA 3VIIA 3UXKA 5CZTA 1TB3A 1Q7ZA 1E1EA 3E2VA 4Y9NA 3B0XA 2V68A 5BCAA 2TODA 4LCQA 3GKAA 2V3FA 3BDKA 1SSDA 1UPMB 5HMSA 4E0CA 1E55A 2PWVA 4BA0A 1R87A 1P0NA 5K4ZA 1RBLA 3KOZA 1CXEA 3B8WA 3TYCA 2DJLA 2F8QA 4KPLA 3H2CA 1KXHA 2WHLA 2Q01A 5DY3A 4XO7A 3APTA 5FF2A 3ARSA 1B5TA 1TPC1 1I2PA 5F2MA 1BYDA 3CK5A 3LU2A 3BAWA 3IWPA 1TKKA 2V2CA 2CESA 1V6TA 1G4SA 2VP8A 5EPDA 1MSSA 1VEMA 3NYDA 1J10A 4QXIA 5A6TC 3W9ZA 2OEMA 4WKFA 2TAAA 1RVKA 5HNTA 1RCXB 2VFHA 2C1IA 2DSZA 4Y9MA 3DGRA 1MQQA 2OELA 4LBRA 3TE9A 3WNKA 2WMKA 4QJ1A 2CLMA 2ZDRA 3V1HA 2I5GA 2VT0A 1IR1A 1H50A 5MF5A 1OCJA 4GUGA 2NX3A 3ATZA 2QS8A 1Q6QA 5ABTA 5TBOA 3ZT5A 4O1AA 3RF9A 3KDNA