2CLEA

Tryptophan synthase in complex with n-(4'-trifluoromethoxybenzoyl)-2- amino-1-ethylphosphate (f6) - lowf6 complex
Total Genus 95
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
95
sequence length
266
structure length
251
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 95
structure length 251
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cleA00
4JTUA 1WBHA 3M47A 2BXVA 3NVTA 1VZWA 3W7LA 3R2GA 2NX9A 4U4MA 3IGXA 5BRBA 4NJHA 4AB4A 3C2OA 3W84A 3LHWA 1LBLA 5EA9A 3W2KA 1BWLA 3TDFA 1TTQA 3F4NA 3P61A 4KFPA 1GZGA 5AC8A 2ZA3A 3EX2A 4FXRA 4UFJA 4MUZA 4E38A 3FJLA 5KINA 5HR6A 1FX6A 1I45A 2Z6JA 4WY0F 1LP6A 1S3HA 4ZVJA 4BI6A 4LRSA 2HSAA 3F1QA 3TC7A 5DXYA 2FIQA 1WDWA 5I3HA 1FQ0A 2WSYA 5DCEA 3NQDA 2ZZ5A 5AHEA 3DFPA 2ZRWA 1ONRA 3QQ1A 4OHQA 1FDYA 3W9ZA 1S5VA 1I2OA 2CU0A 3M9YA 4DF0A 1VLWA 3S1XA 2HS6A 1GVOA 3L5AA 3HOJA 4POCA 1H7XA 4N6EA 2NWRA 2X1SA 4E2BA 8TIMA 3LHZA 5GVJA 1S5WA 3LLFA 4ORMA 5CPMA 3JR2A 1BEUA 5C54A 1KTNA 1V7YA 3MYOA 2WO5A 3W1MA 3N2XA 3NQMA 1LRQA 3EXSA 4BWLA 2V2HA 3GK0A 3EWWA 2GQ9A 4S2CA 2CZ5A 1EB3A 1FXQA 2QAFA 2QUTA 2RDTA 1W54A 1QO5A 1W56A 2BWGA 1AK5A 4WZHA 1XBZA 5L6UA 3PG8A 3PF3A 3QPYA 3W2LA 1EX5A 3NNTA 5F4XA 4LRTA 4R33A 3DZ1A 4A29A 3C6CA 5LHFA 1H7RA 4RR4A 2ALDA 2ZZ6A 1LORA 2FPTA 1YTEA 2E77A 4UTWC 2RKXA 3W7IA 4UTLA 4O14A 5TIMA 2ZCGA 3W2MA 2BLEA 1XL9A 3H55A 1JJKA 1NAL1 3G24A 5HR7A 1N7KA 3T7VA 3NL6A 4GJ1A 1F7BA 3ANYA 2G96A 3G1HA 3BGGA 5DLCA 3B4UA 3PSWA 3TFCA 1QNVA 1TJPA 4HIBA 5EMUA 3NAVA 4Q33A 2C1HA 3C2VA 5AC7A 1KTBA 3GX9A 2V9DA 3W7EA 1XC4A 5LHEA 3WJZA 4L4MA 3FS2A 2X16A 1DBTA 3DXIA 4TX9A 1IGSA 5LNVA 2TYSA 4LWWA 3FA5A 3TE9A 1TCDA 2NX1A 4PA8A 1L6SA 1XM3A 1L2UA 2C16A 2DJLA 4LVDA 4CLMA 3DFTA 2C18A 4JX6A 1P0KA 2H90A 4BFAA 3BW2A 2RH9A 1DQWA 3M5VA 4IQLA 5AYXA 3W86A 5AOUA 4UUIA 2F84A 1UCWA 3M6YA 1JCJA 3IV3A 3G0UA 4L4LA 1A53A 3P80A 2Z0IA 3S5NA 1RPXA 3L66A 1LOSA 1OYCA 3DFOA 3UY8A 1XBYA 2ZTKA 1W5NA 5CGQA 1D9EA 3VKJA 5I3JA 2Y61A 5G2HA 1Q6OA 2RHGA 2WKJA 4RZ5A 5CZ0A 1P4CA 4QITA 4UTWA 4PL1A 1EEPA 1W3IA 5D2YA 4NZJA 1TO3A 3V75A 5KMYA 3S8HA 3R12A 1TRIA 3TIMA 4JNMA 5AHLA 3WK1A 4YCPA 2J27A 1PIIA 3LTSA 4A2SA 3C56A 4JTLA 1BKSA 4ZQRA 4CNOA 2JKEA 3KFTA 1H7OA 3HG3A 1IF2A 3I7QA 1H62A 1U83A 3GDKA 2YDAA 1OJXA 1VQTA 5AC6A 3W75A 3GNDA 1ZALA 3MMTA 4RXGA 3AJXA 1SZFA 4EF9A 5BW6A 1TJRA 4H6KA 4LU0A 1Q6RA 2CZDA 4MZ1A 4ZQOA 4O10A 3PC0A 1IXOA 3N34A 4UFMA 5I3GA 1AW2A 4JTFA 5CZJA 4FNQA 1X7FA 5LNRA 4GXMA 3UWQA 3W87A 1KBIA 4O1AA 4EIVA 4O53A 4N6FA 1LLWA 1TQXA 2QEZA 3DAQA 5EPDA 1UJPA 7TIMA 4O4WA 3WK2A 3LTPA 2E5BA 1O5KA 5A5WA 1T8XA 2TRSA 1NVMA 2Y7DA 2PE4A 4MZYA 5AHMA 1GG1A 2HMCA 1GEQA 1I2NA 4QM1A 1JQXA 1F05A 4RKAA 2UV8G 2PCQA 2NZLA 3IVTA 4NZFA 2VEKA 3IGSA 2QKFA 1TPDA 2ZZ7A 1CI1A 2QUVA 3TH6A 1R46A 3LXCA 2B0MA 2QCGA 4ZQCA 1YXDA 3S0CA 5MHBA 2J9YA 1LDCA 3BLFA 3UNDA 5A8GA 3LCIA 3S1VA 1OX4A 3T4CA 1QOPA 2C0AA 4UFIA 4UFLA 2CLLA 4AXKA 4ZL1A 1ZAIA 1JUBA 5KSWA 4MYXA 5TBOA 4YMZA 1AL7A 4YLWA 3L5MA 4O50A 1EP1A 5HUOA 3W07A 3W73A 3EEGA 5FEXA 3OBKA 3DU0A 4AF0B 3TSBA 3EXRA 3HF3A 4CQ9A 4TIMA 5FEPA 1DKWA 2ATSA 2CLHA 4R7JA 3DENA 3HGJA 5CPNA 1JULA 1TPWA 4AHOA 4Q32A 4FNPA 5FF2A 3TR2A 1WA3A 5D30A 4AAJA 2Y6ZA 2DZWA 5AFDA 2V82A 1G69A 1ZENA 2ABAA 2ZRZA 3TCEA 1ME7A 3H53A 4DO4A 4GUFA 5C6MA 4E2DA 1FCVA 4Y9AA 3QFEA 1W5QA 5TQLA 3MHFA 4GNJA 1THFD 4EVZA 3LV5A 3SGZA 2ISWA 4GWEA 1FY6A 3QSRA 1PL9A 1TIMA 4M6PA 1KV8A 1FDJA 4CNPA 2CLEA 2QCMA 4RXFA 1H7PA 3E9AA 3PS7A 3GR7A 2YCEA 3PUEA 1TREA 3RLUA 2FB2A 3G1AA 2P1FA 1H61A 5F2GA 3UY7A 2W79A 3WJXA 3W1TA 2E1DA 5HNRA 2J6XA 4MKNA 1ML1A 3GDLA 4UTMA 1YPIA 3BK0A 4NX0A 4UNLA 1RVGA 4M7TA 1DL3A 5DELA 5FI8A 1NF0A 3G1SA 4FHAA 2QJIA 5LNSA 2NV1A 2OMAA 2NWSA 2VFGA 3D0CA 3LCGA 3M5XA 3IIPA 2Q3OA 1YPFA 3P7YA 2QCHA 4FNRA 1XBVA 1L6WA 2FPVA 2J88A 3UPBA 1KM4A 4IX0A 3PM6A 4NXSA 3MYPA 1G6CA 4UTJA 1JVNA 3NPUA 5D2WA 1LZOA 1LLZA 2TPSA 4IX2A 4OE7A 3SIZA 3P8JA 3W7OA 3W72A 3NQCA 1ME9A 1PVNA 2Y70A 5AHNA 4NXKA 4BI7A 4O0KA 2A6NA 2QCDB 4IUOA 4X2RA 3IIXA 3SGUA 4CCDA 1YYAA 1VPXA 3G18A 1FCBA 1K7EA 1SFLA 2I9EA 3NR0A 3IIVA 3W70A 3PBUA 4UMCA 4IXHA 2PRLA 1E51A 2A7NA 2ZYFA 3IIOA 1SSGA 3FYOA 1QWGA 3LHUA 3SY5A 2YW3A 2FFCA 2BZNA 1QAPA 1ZNNA 3LM7A 4OGZA 2YYTA 4M19A 1BTMA 4PH6A 3IIZA 5ABTA 3BG5A 3QMSA 3O16A 2E6DA 2VFEA 5DCBA 3P5ZA 1QR7A 3QZEA 1OFEA 5FESA 1WYIA 1OYAA 1K3UA 2J9ZA 3LRLA 1Z41A 4Z1BA 3G1VA 1YXYA 3NXFA 1QPQA 1WOBA 2YFOA 3GKAA 1YDOA 4QAIA 2Y63A 3WK0A 3NPWA 4WQ6A 4LNYA 2YW4A 1MO0A 4JEQA 4O54A 1TSIA 5LGXA 4ZMGA 4UMBA 4MY8A 4NJIA 4I7VA 3U6WA 3Q58A 1GYNA 1JCXA 2CLFA 1KFBA 1F6PA 4LV9A 2GJNA 5C2XA 4LVGA 1JRBA 3QRHA 4YL2A 3GDMA 3W1UA 4FX6M 3K30A 4RCXA 2H8ZA 3Q94A 1F5ZA 2WSRA 2NUXA 3STEA 1TPVA 1TQJA 3SI9A 4LVAA 3KVJA 3GNNA 3NG3A 3O6YX 4A3UA 1KW1A 3UYCA 3KX6A 3W7DA 1ALDA 3BLIA 3BV4A 4JY9A 2EKCA 4UNKA 4C1LA 1M6JA 1SW0A 3CC1A 1GTEA 3L0GA 5F2MA 4MFEA 1B4EA 3CU2A 3QEZA 3B0PA 4NJKA 3S9YA 3W1QA 1PE1A 2CWNA 6ALDA 4OT7A 3OHIA 4JYFA 2JKPA 1W37A 1TV7A 1W8SA 3B8DA 2O7SA 3TJXA 4AH7A 3TNOA 3KRSA 3QW3A 1QCWA 3P67A 1LBMA 3P60A 1YADA 3HG4A 2OX1A 1P0NA 3GLCA 2JGYA 1JUKA 2EGZA 2RDWA 4UXDA 5E93A 1AG1O 1JR1A 4X22A 1G7VA 1SO6A 4H4IA 3WJYA 4FX8A 4YWIA 1KFKA 2PRMA 4Y6GA 3AO0A 2ZZ2A 4XBSA 4DXVA 1QOQA 3UWWA 1AL8A 2WV8A 3LBMA 2H6RA 1PHWA 2V8ZA 1H1YA 3HO8A 4FIQA 2QDHA 1TTJA 3TMQA 2GQAA 3TQVA 5SWUA 4RZ4A 4YCOA 2YPIA 4LV4A 5G5IA 3MP4A 4DPQA 4NQ1A 1K8ZA 3G3MA 5HULA 1OFBA 1KFCA 3R8RA 3VI2A 4ADUA 3CIWA 1EPXA 3W7GA 3JRKA 3DKJA 3TUUA 4K36A 5CPLA 5I3IA 1TPB1 4CQAA 2DZSA 3S1UA 2V81A 3YPIA 3P84A 1HUVA 4MLRA 2Q8LA 2H3DA 1MEWA 3O15A 1RQBA 1M5WA 4Z1AA 3I65A 5L9FA 2JKAA 1K03A 1WX0A 3W7JA 3C61A 3W7PA 3M41A 1A5CA 5HWNA 3HGOA 4AVFA 2E6FA 2Y7EA 4MLJA 4K7YA 1RQEA 3FYPA 1MSSA 4P61A 3W76A 2ZBTA 5G1TA 4QIUA 1X1OA 2A21A 4LS0A 3B0VC 3VNDA 4AF0A 3W3OA 3QSTA 5K7JA 1KTCA 5G1YA 1NFBA 3UZ5A 2ZZ4A 3W22A 3RK8A 2FTPA 1DV7A 1RZMA 4ORIA 3CT7A 1GTHA 1XBXA 3NQ2A 1R47A 1KA9F 3FJ6A 2DZXA 4TO8A 1H1ZA 2YZRA 3N2MA 4JYDA 1SW7A 3W1NA 3ATZA 1H51A 2O7QA 1J2WA 3NYZA 4LC6A 3W71A 3A24A 5AYZA 3L21A 1KLZA 1X1ZA 2JK2A 4JDYA 1DHPA 1WBJA 5E0KA 4MJZA 2W0UA 1OF8A 3TA6A 1A50A 3LX9A 3TX9A 1G4EA 3HPXA 4HPJA 2VFDA 4XKYA 1XKYA 2ISVA 4MIMA 3C3NA 4O18A 1ICQA 3HB9A 3BVJA 3G0SA 3N14A 3W88A 1UUMA 2XFWA 2ZDRA 5IM51 4KFOA 2OCZA 4UR8A 1ME8A 2YSWA 4UR7A 3S5ZA 5DN1A 4RZ6A 3TROA 1ADOA 5K9CA 3IGUA 1G67A 3P5YA 3NL3A 2NLIA 3B05A 4A2RA 2C13A 3W7HA 1ICSA 3TW7A 1Z48A 3PBYA 4KKXA 1M7PA 2A4AA 3ABRA 3UPWA 5KZDA 1LTDA 3DFNA 4OV4A 1KFJA 2ABBA 4FIRA 2BSLA 3GAYA 5CG7A 3V1PA 2C19A 1MEHA 3DFQA 1QPRA 1U5JA 2ZZ3A 1T0OA 3G22A 5F2IA 3FIGA 4KFNA 1G7UA 4MVAA 3ZR4A 1RV8A 5KZEA 2C14A 4FO4A 4MFDA 2JGQA 1FWTA 1YTKA 1I4NA 3M7WA 4AMAA 1R30A 3UWZA 2FQIA 1FXPA 5BOOA 3FEMA 1HTIA 1H5YA 2Q3RA 3NO5A 3KOFA 4RLIA 2Q8ZA 2W6RA 4FNTA 5J5DA 4JICA 3ELFA 4BK9A 4HN4A 1G4TA 1OK4A 4FNSA 1C29A 2ATMA 4EOUA 3CM4A 3CIXA 1GPWA 2WOQA 2QCDA 2QCFA 4LUJA 2ZA2A 5E1QA 1GWJA 1QMLA 1H7WA 3NL2A 4NU7A 5CPOA 5HMSA 1XCFA 2R8WA 2V5BA 1A5BA 2GVLA 3TMLA 2VOMA 3LCFA 2C3ZA 1SZGA 4IGHA 3TQ0A 5CZSA 3N9RA 1CX9A 2Y89A 5F2LA 1TB3A 3NQAA 1W0MA 1D3HA 1Z42A 4JYEA 1FWSA 1D3GA 1I2PA 4R53A 1ZJIA 1KV5A 2DZVA 4I7WA 4ZQMA 3INPA 1PS9A 2QCNA 1VGAA 4K8HA 4O13A 4QSHA 3HJZA 3NGJA 3OVQA 4IMDA 4IMEA 3NA8A 4WUIA 4PFMA 3UD6A 4O8RA 4MY1A 1KBJA 2OJPA 3I68A 1F73A 2Y88A 4PC8A 3L5LA 5F4WA 1OX5A 1KM3A 5AHFA 1OYBA 1W5PA 2WQPA 2AGKA 2CW6A 2ZA1A 1AW1A 3MHGA 3CWOX 3CHVA 3W7KA 5G4EA 1KM5A 4EWND 1V5XA 5D33A 3LCXA 4P2VA 5AB3A 1Y0EA 3HIJA 4DF2A 2PRHA 4XWUA 2VFIA 3DBPA 3KVMA 2P0OA 4LS1A 4O16A 1PV8A 2ZFAA 1LOLA 1LCOA 3TU9A 1Q3NA 1YTDA 5CSRA 1YDNA 1K8YA 2QCEA 3ZWTA 5EY5A 1MXSA 1X6UA 3ABSA 3I6RA 3W7NA 2XN2A 2A2IA 4JTIA 1IXNA 3CB8A 1HL2A 3BO9A 1QDSA 3BLEA 2DZTA 3VCRA 4UC5A 4JN6A 1ZY9A 3G1DA 3W2NA 3TXZA 4XKYB 2DZUA 4JDBA 3DFSA 3RLVA 4XTDA 2EPHA 4DELA 2QUUA 4HSNA 3NM1A 5FF7A 2X30A 3EWBX 1HO1A 3C52A 2NV2A 3LHYA 3HPZA 4BI5A 1DQXA 1W5OA 1WV2A 3S42A 2OT1A 5D2VA 4O15A 3C2FA 3W7CA 4ZQPA 3GDTA 5K2ZA 1C8VA 3N19B 3IEBA 3LERA 4PL2A 1C9DA 1QPOA 3QQ0A 5F4SA 2E09A 3H54A 3M0ZA 3W7MA 1S5TA 1VCFA 3MWAA 1OFRA 4NNBA 3NQEA 1TPFA 4JX5A 3F4WA 1IIHA 2A85A 4JXCA 4TR9A 3LRKA 2NX3A 2VEPA 3KRUA 5IBXC 3W1AA 2D73A 2A6LA 3FOKA 3E49A 1I8JA 3G8RA 3W74A 3B03A 3RF9A 1W3TA 3TW6A 1N55A 1UB3A 2CLIA 4XQ6A 3PULA 3KXQA 5DCDA 2YGYA 1SUXA 3O05A 2YYUA 4IPIA 5DY3A 1JCMP 2YR1A 1SU5A 1IXQA 3STFA 3MBFA 3P62A 2G5WA 2JBMA 2V2CA 2CFFA 1N8FA 1OFQA 2Y7GA 3G8EA 1XXXA 3S6DA 5LSMA 1OF6A 4HNUA 3RFAA 4WD0A 3QPZA 3GYEA 2VFFA 4LC8A 2E6AA 5LZLA 1UASA 1WQ5A 5LKYA 1GYLA 2A5HA 3LI1A 4RX0A 4K8EA 3KAOA 5DBUA 4WY0A 1CW2A 1QO2A 4IMFA 4N9DA 3SECA 1K7FA 3TQKA 4NJJA 2ZQ0A 2RDUA 2A1YA 5FEWA 3GXNA 3S5YA 1PCKA 3E02A 4M7SA 3SSJA 3LB0A 3PAJA 1EUAA 3BW4A 2C15A 2QCLA 3SJ3A 3SR7A 2B4GA 3THQA 4AWTA 3ABQA 3L0KA 1B3OA 2J9XA 4QQ3A 1TMHA 3W2JA 2HS8A 2ZRVA 1GVQA 4HPXA 3GZ3A 3PY2A 4O12A 1VYRA 2H8XA 1SO5A 2VFHA 4TU1A 3WJSA 1O94A 1SPQA 4X9SA 4JX4A 3HGRA 4K39A 1G4SA 5D09A 4UMAA 4HNTA 1VYPX 2A7RA 3W23A 2X1TA 1FDZA 4UTIA 5U4NA 4O57A 3T44A 3PSVA 3L65A 1JRCA 3HBLA 3W7QA 4A22A 3LOTA 3NOEA 2KZHA 1KFEA 1IXPA 3UQNA 1B9BA 4W9TA 4N02A 1PHQA 3PB0A 3LHVA 1OX6A 4RV8A 3W1XA 3TAKA 3EKLA 4OV9A 3CTLA 4G1KA 5G2IA 4AHQA 4C1KA 4NUWA 1OHLA 1ZAHA 5C55A 3M1ZA 1XDLA 1ICPA 2H3BA 1L6YA 3U2OA 5K4ZA 2E5DA 4MOZA 4OQVA 1YXCA 2WJZA 1W5MA 3TC6A 3HQ1A 4FXSA 3DI1A 2X1RA 3DI0A 3L68A 1HO4A 1TTPA 2CLOA 3EKZA 4NJGA 1Z44A 3N3MA 1XFBA 1JCYA 3MI3A 4GFSA 4O1BA 2LLEA 3MO7A 1TPH1 3EWUA 3QC3A 1SZEA 3WFAA 3P82A 3RU6A 1LRNA 2QCCA 2YFNA 3JS3A 1LYXA 2DP3A 1Q6QA 3R5EA 2J24A 4IOTA 2GPTA 3P74A 3U8GA 2AAMA 5EBUA 5D37A 2G95A 2V30A 4QJ1A 2DU2A 2ZRUA 3WK3A 1EWEA 1EA0A 3PBVA 1O60A 1JCNA 3QH2A 4HSOA 1RD5A 5G4WA 5HWJA 5C5YA 2VEMA 3NL5A 1YDVA 5KITA 1ZFJA 1BWKA 2V2DA 3VE7A 2XN0A 4JTEA 3PG9A 3Q37A 3CLMA 3OVRA 3PUDA 1F6KA 3NQGA 3P81A 3TKFA 4JD4A 4O1DA 4LUIA 1F74A 5DY2A 4UFHA 3CPRA 4DQWA 2VKZG 1WAUA 4NNCA 1KFLA 4O0ZA 5FF4A 1XUUA 3C4UA 4U28A 1K7XA 2PC4A 3G0XA 5H2ZA 4PCFA 1VC4A 2TMDA 1SFJA 4Z08A 5K9XA 3UZJA 4MPQA 3DHDA 1TPC1 4NNAA 3A22A 4XTIA 4O11A 1VS1A 2VXNA 1W1ZA 4N2YA 3OA3A 2FLIA 3HMJG 4O28A 4UIOA 4WY0B 4UCGA 4O19A 3SZ8A 3QW4B 3USBA 3NQ8A 5HINA 2QF7A 4HHPA 3A5FA 4DO5A 3NZ1A 1P5BA 4IMGA 1O4UA 2WPBA 3RMJA 5D02A 3NQ6A 2V5LA 1OVDA 5LNWA 4D2JA 3KRZA 3SFKA 6TIMA 2GUUA 2GVJA 3KHJA 1KM2A 1J5TA 1SQ7A 1I2RA 1NF7A 5FF3A 3LTYA 3VE9A 3ZS4A 5CZTA 5DBTA 3W7RA 1GQNA 4DO6A 5BMXA 4JTKA 1DORA 3NEVA 1JCLA 3G1FA 2ZTJA 2TSYA 1VHCA 1FCUA 4NVTA 3EWZA 4PEKA 5AN7A 5EYWA 4UTHA 1FWRA 1VHNA 2WNNA 2WSQA 4N4QA 2OT0A 2CZFA 4MJMA 4JIPA 3QJAA 5K4XA 1H50A 2EF9A 1L9WA 1B57A 4Q4KA 4YXGA 3O8AA 4CQ8A 4GBUA 5U7SA 4DBEA 1T99A 1SSDA 1VJIA 3EX6A 2ZZ1A 3TV8A 3GR8A 3NQFA 3LLDA 4R34A 3C2EA 1YLVA 2NXHA 3TSDA 1KM1A 3UWUA 1VCGA 2OZ0A 1QFEA 3EB2A 1SW3A 1OFOA 3SW6A 2A0NA 3CEUA 3TK7A 1KLYA 3QF0A 2ZRXA 4JIQA 4GUGA 3FFSA 1RQHA 3EXTA 4HNNA 4KWVA 3MBDA 2E5CA 1EP3A 4GE8A 3I7RA 1LM1A 4ONVA 2QJHA 1SO4A 3C2RA 2IQTA 2RFGA 5AYYA 2HTMA 3O6CA 3STGA 3UWVA 3DH7A 3L2IA 1EP2A 5H91A 4N9EA 4PTNA 3W6YA 3LDVA 2B7QA 3MI2A 3B04A 4FF7A 1TYGA 1H7NA 4FX7A 3GXTA 4BR1A 2P10A 4M6QA 1GVSA 1FWNA 4UTTC 3T40A 3ZFHA 4KWWA 1F2JA 2VEIA 4O4VA 1K8XA 4WXYA 3UWYA 4S1FA 1A5AA 1EUNA 4Z0JA 4N9CA 2XN1A 1W3NA 4IPJA 2VC6A 1DJQA 4MYAA 5D2TA 4DPPA 3MUXA 2BX7A 4XUGA 4M5PA 5HUPA 3TSMA 5HWMA 1JUEA 1X8FA 4HT3A 5F1VA 4ADSA 4HNVA 1RR2A 3NQVA 3LHTA 3QM3A 3A5VA 1XDMA 2GQ8A 3GKFA 4O52A 1SZNA 3O6DA 2X2GA 1OFDA 1DJNA 3A23A 3FLUA 4OU1A 2CZEA 4AWSA 1R2TA 2AQWA 3GXPA 3N73A 3S1WA 5KZMA 4LT9A 3L0NA 4ZQNA 2V0TA 3C8FA 3STCA 2FB3A 3L9CA 4O1CA 3B0UX 4NT0A 1FUYA 4AEOA 4K38A 2GVGA 5G2WA 4Y96A 2GJLA 4GC4A 3DKLA 2DORA 1TPEA 3T55A 5D03A 4XZ9A 4XBKA 4CCEA 1XI3A 1OG0A 3KVKA 4JTGA 1J4EA 2E6YA 2QDGA 1W31A 3R13A 1K02A 3BG9A 3UXAA 3LI0A 3Q2DA 4QNWA 4UTTA 4LW7A 4AWUA 1NSJA 4JTJA 3T78A 3MW7A 3LCHA 3A21A 3IVUA 3WJWA 4IJBA 2DZPA 2YXGA 3ATYA 2QJGA 2EAWA 5EKYA 5BMWA 3O06A 4OWGA 1SR9A 4UTUA 1QPNA 3R89A 4WJEA 3OVPA 3EWYA 4QISA 3OIXA 1TPUA 3M16A 2Y62A 1O5XA 5KTLA 2R91A 1IIGA 3IRDA 4Y8FA 3CEPA 2B7PA 2ISSA 4K7VA 4WOQA 3O1NA 5D2XA 1GJPA 4EF8A 2PURA 3DGRA 5CKSA 1H63A 4DF1A 4AHPA 5J5RA 5HQEA 4JTHA 2R14A 4JTTA 5D04C 2I14A 1O95A 1AW5A 1KM6A 1R2SA 2Z1BA 4JGDA 1TV8A 4Z1CA 4DEFA 1FCQA 4MZ8A 3GVGA 3O63A 4LVFA 3PBWA 4DBDA 4JTSA 3A9IA 3NM3A 4LOCA 4GRSA 4TMCA 3G1YA 4ML9A 2FPYA 2QAPA 4RK8A 3PUOA 3CQ0A 2WNZA 1XUZA 1DOSA 5I3FA 4QNEA 2A7PA 1GVRA 1B4KA 3W85A 3CWNA 1GVFA 4Y90A 2I1OA 3LRMA 1NEYA 3W1RA 3EX3A 1MEIA 3LV6A 3PWAA 4LY8A 3M5YA 4FB7A 1G4PA 2NUYA 1LRTA 4IMCA 1GG0A 3NDOA 5DXXA 4CNNA 5K9DA 3G1XA 5AHIA 3TJLA 4OBTA 3PVFA 2G97A 4FEZA 1ZCOA 1AMKA 4X3ZA 1R2RA 3F03K 3E96A 3TXVA 4MY9A 4LTSA 1A5SA 5EL1A 4K37A 1VH7A 3HG2A 1JQVA 4M6VA 3PR2A 4GUHA 4FNUA 3N9SA 5LGZA 4GUIA 1VRDA 3UXDA 3EX1A 5F1UA 1VCVA 4PODA 2GOUA 3GB6A 3LBCA 4N4PA 2VELA 3TFXA 3NPVA 3DHFA 3LXAA 1EIXA 1HFBA 3W2UA 4ADTA 1VYSX 5FEZA 4CCCA 3MHUA 1SO3A 5D32A 1LOQA 1KM0A 2WNQA 4TMBA 5LNUA 2NUWA 3FKKA 1OFPA 4IXXA 4J9JA 3E0IA 3E12A 3P8IA 2NXGA 4Z0SA 5FF0A 4JR5A 5D05A 4B5NA 1H60A 3VFLA 3BARA 1MZHA 1FWWA 2YX0A 4GUJA 1OABA 1VR6A 4WXZA 4H3DA 1I2QA 3MJYA 1OK6A 4WOZA 3HPSA 2QR6A 1HG3A 1UBSA 3IVSA 3HGSA 3THAA 4LS2A 3I7SA 1LROA 3QMRA 3BW3A 4UFKA 3NQ7A 4WX2A 3HG5A 2ZRYA 3W1LA 3TAOA 5IBXA 1GT8A 2Z2UA 1FBAA 3M43A 3B06A 3NZRA 3LXBA 1M7OA 1DVJA 3ABOA 5I3KA 4ICNA 3ZWSA 1ZHAA 1OX4B 3C0JA 1WXJA 1Q6LA 1Q45A 2CLMA 3M5ZA 4E0CA 4IWWA 3PB2A 1UUOA 3EX4A 3NPXA 4I9AA 1ZAJA 4N9BA 5CSSA 4O17A 4ALDA 3QYQA 3GAKA 3BG3A 3O07A 1VLIA 3FKRA 4JY8A 4Z1DA 1WOAA 4BF9A 4ZZ9A 2C6QA 1TTIA 2B7NA 3LGEA 3GDRA 3OEXA 4K6AA 3GIYA 3OG3A 4RJEA 3EWXA 3RNDA 1P1XA 4A21A 5T26A 3G3DA 3BGJA 2BTMA 3S5OA 2FJKA 1T96A 5HJLA 1PCWA 1TRDA 3W83A 2FDSA 3KVLA 2Y85A 4UTKA 5K3VA 3MP5A 2B7OA 3W1PA 3LCLA 2VENA 4HKPA 1EWDA 1GOXA 2NXIA 4S2BA 3M44A 2Y7FA 5BNKA 3LCWA 2F7FA 1TV5A 2R94A 3QMTA 4LVBA 5D38A 2Z6IA 3L67A 2DJXA 3MI6A 1F76A 4JS3A 2X1UA 1LBFA 2E68A 3BPWA 4NX5A 2EHHA 2CLKA 3MP3A 4BWLC 4I7UA 1OFAA
chains in the Genus database with same CATH superfamily
3WF0A 2XDFA 4JPGA 2PSNA 1WBHA 3M47A 3UCCA 1XD1A 1E71M 1XIFA 3W7LA 3R2GA 4U4MA 2PZ0A 3K13A 3W84A 2QUNA 5EA9A 1VB9A 4N42A 4C6MA 3P61A 1GZGA 4ZOBA 5AC8A 3PWIA 4A8LA 2ZXQA 3W02A 5B80A 3FJLA 5KINA 3GZAA 4YYFA 5HR6A 1S3HA 4ZVJA 2HSAA 2D3NA 3TC7A 5DXYA 2VZSA 1FQ0A 2QJMA 2WSYA 3NQDA 2PDBA 2V38A 1XPGA 3AIRA 3B4YA 4REQA 3OO2A 4GX8A 2CBVA 3B9OA 2YCIX 2XIOA 3W26A 3N04A 4OHQA 3VKAA 1NOFA 4GI9A 2EBNA 1S5VA 2Z26A 4CVUA 2DV0A 3S1XA 2ZUNA 3L5AA 3QHOA 2HK1A 3BQ6A 5GVJA 2R1KA 1B3XA 1BEUA 5C54A 1KBBA 3W1MA 5A6SA 3NQMA 3BMWA 3EXSA 5D8ZA 4Q8TA 2GQ9A 4AIOA 4I8DA 4H04A 3S46A 1UPMB 3CZGA 1BXBA 1OC6A 3GXIA 3RGTA 1A5OC 5FJPA 2J66A 1BYBA 4AIEA 1W54A 1ONXA 3HFTA 8A3HA 1W56A 5L6UA 1S2UA 3W2LA 1UZDA 5DX7A 3H12A 4R33A 3GS6A 1XLJA 2FJUB 4J3SA 2CLPA 3MV01 1S1PA 2RKXA 1CGVA 4O14A 5C8BB 2PDMA 4RE2A 3T7VA 3NL6A 4ZEPA 4GJ1A 2PWDA 4W84A 2OVLA 3PSWA 3S9ZA 3TFCA 1UP3A 5EMUA 3C2VA 4GJIA 5AC7A 1KTBA 3GX9A 4JIHA 4Q4QA 1XC4A 1W3LA 1P1MA 3WJZA 4AC7C 1T8QA 3FS2A 4AZGA 4ZSUA 2X16A 1DBTA 1IGSA 5LNVA 4S3EA 1REQA 3TE9A 1L2UA 4AZHA 3POHA 4LVDA 1LJYA 2C18A 2RH9A 3EDEA 1JFXA 4GQRA 2HXTA 3IUHA 1O5RA 1A53A 3R6IA 4X63A 1WDRA 1UD8A 4IP7A 4MWAC 1KBLA 5CGQA 2DT2A 1Q6OA 2WKJA 4GCXA 4DJDD 3UP8A 3IJ7A 2DSZA 2V63A 5FJOA 5KMYA 3S8HA 1QASA 3FXYA 1LQAA 1V79A 1CECA 5AHLA 3WK1A 3LU2A 2J27A 1PIIA 3WYZA 4KS0A 1BVWA 1M65A 4A2SA 4JTLA 1J79A 3L4UA 1MYRA 1O1ZA 2RGMA 4IFKA 4FLRA 4LALA 2QPSA 1IHIA 3HTWA 3KFTA 4US6A 4GABA 2VX4A 2G3IA 2GQ3A 2QULA 1F4AA 1H62A 1U83A 3GDKA 3GVVA 1EFZA 1A4LA 2O9RA 1DJYA 5AKQA 5AC6A 1NQKA 3AJXA 5BW6A 1UKQA 4HNCA 2CZDA 5CXPA 2HROA 4MZ1A 3DIPA 3PC0A 3GIPA 3N34A 5I3GA 3EMZA 1US2A 1AW2A 4JTFA 3OJGA 3USZA 5LNRA 4GXMA 3KTSA 3B8SA 1H0IA 4I8YA 1KBIA 1Y8BA 2FHCA 2REQA 3GM8A 3WD2A 4C6EA 5EPDA 2ODOA 4LBSA 1UJPA 2FZ9A 4O4WA 2E5BA 1WZMA 5A5WA 1GG1A 3MANA 3ARYA 1JQXA 2UV8G 4BF7A 4NZFA 2CEQA 5H8PA 3H2CA 2ZZ7A 1CI1A 4Y8EA 4LNCA 1R46A 1U5VA 2B0MA 5MHBA 1LDCA 5GNYA 3BLFA 1Y7VA 3KWXA 4B91A 3LCIA 3S1VA 1OZMA 1OX4A 3VNLA 3APTA 1M68A 4UFIA 2E9BA 3GH7A 2E8ZA 1ONEA 1CB7B 4D6EA 1UR0A 2YZ5A 2PI6A 3KL5A 5KSWA 1ZJHA 4OUIA 1RY8A 1KXTA 3W73A 5LA1A 1FH7A 3DU0A 1WB0A 1E56A 4ZO6A 3IS4A 3CZJA 1SM9A 4KIRA 2W62A 1DEDA 5FJUA 5CPNA 4D8ZA 4Q32A 2QDEA 4MHBA 2DZWA 4AEEA 5GJNA 1ZENA 1SJDA 5DMMA 3E38A 3K1GA 1ME7A 3DYPA 1FWFC 1FCVA 1L8NA 5LXEA 3BCFA 4F2BA 4GNJA 4W87A 4TVDA 3OHMB 4GGBA 3WLQA 4MJ4A 3R58A 1ZBCA 1FY6A 5C9XA 3U5UA 1JPMA 3QSRA 1IE7C 4DZHA 3LD5A 3OGVA 4JTRA 2WM1A 3GY1A 1Z8AA 3O0FA 2WVUA 1H7PA 1S5MA 4G7EB 3E9AA 2F2HA 3VC5A 1V3MA 1EL3A 1TREA 3RLUA 3WDQA 4PBFA 2P1FA 1T40A 2D1ZA 2W79A 3AMKA 3WJXA 1U2YA 4DYEA 3S6OA 2E1DA 3FCPA 3IPWA 4MKNA 2NSOA 5D9OA 1YW1A 4ICCX 1W3KA 2R1LA 2VL4A 3BK0A 4UNLA 3VYLA 1IV8A 5FI8A 4EP8C 4E4PA 2PWVA 3GC5A 4MB3A 3D0CA 3JUGA 1WNOA 3GQYA 3KBSA 1OQFA 3DFHA 5C70A 2OOGA 2OSWA 2QPXA 5I79A 4GYFA 4QR6A 4YPJA 2FFIA 1J0HA 2J88A 3UPBA 1KM4A 3UR2A 5I09A 4IX0A 3PM6A 3MYPA 1JVNA 3NPUA 3WIJA 4C5YA 3PZGA 4HHLA 3PZ9A 2OLSA 3SIZA 3DG7A 3P8JA 3VM5A 5D9PA 3SB0A 2Y70A 4U3AA 4BI7A 2GOKA 3WY1A 3SGUA 4L65A 2Z00A 1Q5MA 3UBPC 3PUGA 2BVYA 2DT3A 4NASA 1K7EA 3THCA 2I9EA 3CMFA 3U57A 4HTYA 4QJ5B 3WLTA 1XPYA 3PZTA 4JQ1A 3AS2A 5I2UA 1EKOA 3C0LA 4Q4PA 4CD5A 1QTWA 1QWGA 5REQB 1EBGA 2BZNA 3CL8A 1YBQA 1QAPA 2D2OA 2AQOA 1UH2A 1GJUA 4OGZA 2YYTA 4M19A 1XG3A 1BTMA 2WMHA 3BLOA 2PWGA 5DT5A 3QV8A 4UQAA 5DCBA 3SJNA 5CEWA 3QZEA 4EPDC 3OLIA 3RR4A 1I1WA 1XLGA 1XLIA 3NGFA 3WH9A 3NXFA 1RLCL 3GKAA 2Y63A 4CVWA 2YW4A 3TTQA 1A3XA 3M0MA 4G9PA 3H2AA 1TSIA 4ZMGA 1YNQA 4NJIA 4I7VA 3U6WA 4QEHA 4HJWA 2X0SA 4LV9A 4LVGA 3QRHA 4YL2A 3HMCA 4W8AA 4FX6M 4AEFA 4HYWA 3Q94A 1J0ZA 3KL3A 3K1DA 1RBLA 4L5ZA 4HTBA 2ZXBA 3SI9A 3UG8A 4LVAA 3NG3A 3GNNA 3O6YX 1KW1A 3KX6A 5A95A 2WB5A 1Q8AA 3EOEA 4JY9A 3SCNA 3BC9A 2GVYA 3EBVA 4NYUA 3P0WA 3CC1A 2O9OA 3R11A 3H2EA 1B4EA 1OGSA 3B0PA 3S9YA 3W1QA 4JFSA 2CWNA 3PZOA 1YNYA 1WDQA 1WCGA 2QIIA 3W4RA 2WW5A 2E3ZA 1LBMA 3P60A 1YADA 2W4XA 3W38A 3HG4A 4ZO7A 2OX1A 2RDWA 5E93A 4JBRA 3ZOAA 4X22A 3V0TA 1XFCA 1SO6A 4H4IA 2VO5A 7XIMA 2QJJA 5JIPA 2WZMA 2H6RA 3WQOA 2ZVIA 3HO8A 1G0CA 2QIWA 1TTJA 1KD0A 3HQOA 2GQAA 2H9AB 2WCGA 5SWUA 1GOMA 4YCOA 4BY3A 4DPQA 4DWSB 5AVNA 1CGYA 3R8RA 3KOZA 1EPXA 4DUWA 2Y8VA 4B9YA 3LM3A 4NAFA 3DKJA 4AZCB 2V81A 4YTTA 3NZQA 1MEWA 2PF0A 3N3TA 4S3BA 3SY8A 4L9YA 1RQBA 1M5WA 4Z1AA 3T0CA 1EC7A 5L9FA 3I3DA 1VPYA 3W7PA 4HMEA 1VFUA 5HWNA 3FYYA 3HGOA 3VK5A 2E6FA 4H7VA 2XG9A 1IEXA 3B8VA 1RQEA 1NELA 3GUGA 3FYPA 2FZNA 1UOZA 1X1OA 3CBWA 2A21A 1TA3A 4LS0A 5HK4A 3W3OA 5K7JA 1K9TA 1I1XA 2OQYA 5LIUX 3HURA 3UZ5A 3KHDA 3RK8A 1XHGA 2FTPA 2VZOA 3IV8A 3IAQA 1GTHA 2QS8A 3H2MA 4WGHA 4HCHA 3VD5A 3W1NA 2L5HA 3RO6A 2O7QA 3TP4A 3A13A 3H21A 1U33A 3SCVA 3E6EA 5AYZA 1KLZA 3L21A 1K9FA 4JDYA 3QTGA 4ZOEA 3AHVA 1MZRA 1A50A 2HWGA 3TX9A 1E9IA 3W6MA 2VFDA 3R0DA 4PMNA 2WK2A 1VPQA 1J11A 1UUMA 2UBPC 4G1NA 2NSXA 4CEUC 3S9IA 1YIXA 4B92A 2DSWA 3S5ZA 3DC8A 4F40A 3V3WA 4XISA 2DH2A 1VFMA 5DN1A 1E70M 1NU5A 2PLMA 4XKMA 1J6OA 2PAJA 3TROA 3IGUA 5I77A 2YL5A 2PBOA 1G67A 4XAZA 3KZPA 3ITOA 1B30A 1DJHA 2ZKMX 3B05A 4B5WA 4D6JA 1XYBA 3W7HA 1JNDA 1ICSA 3AXKA 3TW7A 3PBYA 4KKXA 2A4AA 2VWSA 1D2KA 2D2GA 3GAYA 1TUXA 4QJ3B 4LEQA 1MEHA 1E9ZB 3DFQA 1QPRA 3SCWA 4PCTA 3UJRA 3G22A 5F2IA 5EMYA 5BWFA 4ASTA 1Z7AA 3VIJA 1G7UA 1RV8A 5KZEA 3ZM8A 3WO8A 3ZQ9A 3VKBA 4R27A 1FWTA 1FP8A 4RW5A 1V51A 3UWZA 4NRRA 2BVWA 1FXPA 3GXMA 3KW3A 3NO5A 1EZ2A 2OTDA 2Q8ZA 2W6RA 2J74A 4JICA 3WLNA 2EPOA 1G4TA 1T41A 1OK4A 2W67A 1C29A 2ATMA 1UOKA 3CIXA 1TWIA 1WKDA 1Z89A 2QCDA 4LUJA 1EQCA 2IMRA 5E1QA 1HJUA 2WC4A 5CPOA 5HMSA 1BXNA 2XH0A 4MWAA 3TMLA 2DUAA 1B54A 3TQ0A 4RE0A 4YHEA 4QFUA 1AQHA 1TB3A 1D3HA 3AYSA 3WLRA 2DZVA 3INPA 3WLPA 2J7GA 3HJZA 3NA8A 4WUIA 3UD6A 3ZR6A 4NL1A 5HNTA 3I68A 4HPGA 2HNEA 4PC8A 5A8PA 3L5LA 1OX5A 4GI4A 3UGRA 2WQPA 1AW1A 5G4EA 1KM5A 4EWND 4IH3A 1NTHA 3WQWA 2ZX9A 3HIJA 1FWBC 5HA7A 3KVMA 4ZXOA 1P0BA 3UG3A 5G1MA 2BXYA 2G3NA 3CUZA 1YDNA 1K8YA 2DEPA 2PDUA 5EY5A 3I6RA 1E9LA 4JTIA 1P48A 3PTMA 4ZB2A 1QDSA 4MB1A 1DXFA 3SEPA 5FSDC 4XBJA 4XKYB 3QGAC 1JIBA 3DFSA 1AH0A 1CZ1A 2BXZA 2PTWA 2WC7A 1PDYA 1PIGA 5FF7A 4MNLA 4HSHA 1TVPA 4LEFA 3S42A 2XHYA 5D2VA 3HPAA 3C2FA 3GDTA 5K2ZA 3N19B 1I6NA 3ZMRA 1HXJA 2OKTA 3LERA 4PL2A 1J5SA 1C9DA 1QPOA 4WKHA 3ITLA 1TV3A 1S5TA 3CO4A 1TPFA 1IIHA 3GTIA 2A85A 4JXCA 5J04A 5BXPA 4F4RA 4K1WA 3TN6A 2A6LA 3FW6A 3G8RA 4HMNA 4J2MA 3RF9A 1YX1A 3PULA 2YGYA 1SUXA 2BY2A 3CWHA 3O05A 2G3FA 4UZUA 2ACSA 3STFA 2HVOA 1KR0A 5ECVA 2JBMA 3MUAA 5A6AA 5T8GA 2INFA 1WXZA 2Y7GA 5LSMA 3AXXA 4LC8A 2Z25A 3CHCA 4YJ5A 4Q6JA 5LKYA 5CJMA 1GYLA 2A5HA 5DBUA 1CW2A 4ZTXA 3U2EA 3TQKA 1GONA 1IT0A 2ICSA 4NKCA 2XJ7A 3CAKA 5AC4A 3PAOA 4NIRA 3W6LA 4N7QA 4IIFA 3EA1A 3LB0A 4AY7A 1EUAA 3UZWA 2C15A 3SJ3A 3ZYZA 5CJ5A 2IKIA 4EAMA 1FWEC 4R7OA 1B3OA 2J9XA 4AZ7A 1EO5A 2ZRVA 3MCNA 3W01A 1GVQA 4DWDA 4M24A 4PUEA 1TX2A 3PY2A 3LZ5A 1W8GA 2IKHA 3WJSA 5ABFA 3GBEA 4JX4A 4K39A 2ZE3A 1G4SA 1A0EA 5D09A 1YMYA 5CAKA 1GGOA 4P8WA 2XVPA 3LQGA 1UR2A 2YJQA 4UTIA 3VNZA 1MUWA 3Q4DA 1QBAA 1X98A 4Q8MA 3U5YA 2KZHA 1IXPA 1HKJA 4QDMA 4N02A 1PHQA 3QC0A 4AHQA 3ONBA 3CH9A 5DO8A 2W3ZA 4C1KA 4KRTA 1ZAHA 1CXEA 3T8LA 2HQAA 1XDLA 1P7TA 3U2OA 5K4ZA 2VZVA 3ISIX 2PZNA 1V3HA 4J28A 2CNCA 4FXSA 2X1RA 3DI0A 4LJ3A 2CLOA 5I02A 4NJGA 1JCYA 3QC3A 2LLEA 1TPH1 3IAPA 3VGHA 3QY6A 1C91A 4WKFA 2GJRA 1UG6A 2QJNA 3UYIA 1UYQA 2DT1A 2VC7A 3VGEA 4Z2HA 2ZRUA 4KEMA 4A3YA 3SCTA 2X40A 2IPFA 4ATLA 4K8GA 1GYMA 4C91A 1Q6CA 1F8MA 2JFEX 2R6OA 1BWKA 4B5XA 1YE6A 3F5JA 3ZIZA 2Z2AA 3P81A 1F74A 2YDQA 3TTYA 3CPRA 4WRHA 1WAUA 3WENA 3EMCA 4JIEA 2VI0A 3WEMA 2E7FA 3RCNA 1JZ8A 2YCLA 4PCFA 1VC4A 2TMDA 2AL1A 3CZKA 3DHDA 4R88A 3BLDA 3S4TA 3A22A 3G6LA 3T1GA 2AKMA 1O7AA 4O11A 5HNNA 3OZYA 1VS1A 4TTGA 4XD4A 1MVYA 3OA3A 4AD3A 1TZ7A 2X7VA 4O28A 4GNKB 4WY0B 4FLQA 2V67A 3HA1A 2QF7A 2WZEA 4Q7BA 4S38A 4UNIA 4A3QA 4CD7A 4D2JA 2QF8A 2GVJA 3KHJA 1XLKA 2E9LA 3QXBA 5BOFA 2G4FA 2GGJA 1GQNA 4BJHA 3K4AA 4C5ZA 4H6RA 5I07A 1I75A 2BBFA 1KXVA 4OZOA 5HDRA 4WR3A 3EWZA 4UTHA 1ADSA 4MF4A 1KXHA 4A8RA 1VHNA 4N0RA 2WNNA 4DUXA 2WSQA 2OT0A 4JIPA 1V3IA 4L9ZA 2Q71A 3WQEA 1L9WA 1B57A 4C90A 4ZXLA 4JKKA 3MCMA 4CQ8A 1OWQA 2CIPA 3WH5A 4GBUA 6XIMA 1C92A 4ZO9A 2WMGA 3LLDA 3VD3A 2NXHA 3V35A 1XW8A 3ZLHA 5AC5A 1CGWA 1QFEA 1R86A 3T0DA 1V6WA 2Y24A 2BOEX 1HKWA 4LYRA 4JIIX 2A0NA 3TLQA 1ZSXA 2OYMA 5FACA 3UWEA 1W1B1 2YCJA 4HNNA 2BVDA 5J8LA 3WSUA 3BOXA 1B9ZA 4KQNA 2CERA 4X9YA 4OIFA 3TR9A 4O1FA 3WBYA 4ONVA 2HE5A 1SO4A 2PGWA 4LXFA 1UWIA 3GTHA 2EPKX 3STGA 3UWVA 4GVFA 1HVQA 3AS0A 1CLVA 5H91A 1C8YA 3R8GA 3LDVA 5A6KA 4QP0A 1TYGA 1GJWA 3GXTA 4BR1A 1IT7A 4M6QA 2IPGA 1VBUA 4UTTC 3BICA 1NQ6A 4B2DD 5CZKA 1TVNA 4DY1A 1CXKA 5D2TA 4DPPA 3FGCB 3TSMA 3VGGA 4ADSA 4UQDA 1RR2A 1JDEA 3M0IA 4GYPA 1XYAA 4NILA 3LBOA 2C1GA 1XDMA 3KS5A 4GIRA 2GQ8A 2POZA 2J13A 2FYMA 2X2GA 5B7ZA 1OFDA 4IIEA 1DJNA 1NP0A 2J4GA 1N82A 2CZEA 3T81A 1PPIA 1R2TA 2AQWA 3N73A 3NSXA 1AQMA 1XGEA 4S39A 3VA8A 4J40A 3ARTA 3VIFA 3SAZA 4PSRA 4GX9A 3AJ7A 3E1F1 2ACQA 1PTDA 5DANA 4TX8A 3ZJ6A 1KCXA 3IJ9A 4AEOA 3O0KA 4NZ1A 3UG5A 5C0QA 5CC5A 4HN8A 3RN6A 4WDTA 2MANA 3DKLA 3T55A 5D03A 1MDLA 2PTDA 4H83A 5GQBA 4P7QA 2O92A 2NT1A 1D8CA 3WNLA 3PFRA 1W31A 3R13A 3UXAA 4JTJA 1UKSA 3LCHA 2J62A 3MMDA 5XINA 3IVUA 1F61A 3C0QA 2VT0A 4IJBA 1WZKA 3ATYA 3G6MA 2CC0A 1I0BA 1Y5VA 4PYSA 2YKKA 4ACZB 1SR9A 1T7LA 2OODA 4WJEA 1GVYA 3WMCA 4Q4RA 3AALA 2ONEA 3HV9A 4TV5A 2E1WA 4Q8OA 1EJVC 1XICA 4I5UA 2BODX 1UUQA 4L4OA 4WOQA 4H1ZA 5D2XA 4H00A 3DGRA 2O55A 3IJDA 3RPMA 2PB1A 1RA0A 4JTHA 4GOAA 7PTDA 2VVSA 1GZJA 5D04C 2I14A 1O95A 4PUNA 1VRXA 3PZVA 4F79A 3GVGA 1HL8A 3KCOA 3A9IA 4LOCA 4GRSA 2UWFA 2V5JA 2QAPA 3PUOA 3JZUA 1DOSA 3GC2A 1B4KA 3SDOA 3H70A 1L0PA 3N6QA 4WCJA 3QV6A 4LY8A 3R1ZA 4UOJA 4F8XA 5IFPA 3SQSA 3DECA 3MKCA 4XIAA 3NDOA 3BSMA 4CNNA 4MB4A 1NH6A 4BEUA 1ZGDA 3PVFA 3LYEA 3FA4A 1V93A 1R3VA 2ZVRA 3C2YA 5EL1A 5CLWA 3HG2A 4QE4A 3RCMA 3XISA 3K2GA 4GUIA 2I16A 3UXDA 1PWLA 4PODA 1KXQA 4C6FA 1DPMA 2GGHA 2OB3A 4HJFA 1W9XA 4N4PA 2VELA 4Z1YA 1DTNA 5FOOA 2DSUA 1BYCA 1IEWA 1OZQA 1GQKA 2VYOA 3W2UA 4ADTA 2QVNA 2AQVA 4JFWA 3WLOA 2WNQA 4KEVA 2GDVA 2NUWA 1UJQA 1BKHA 2PTXA 3R7MA 1QI4A 1L8PA 5BCAA 4JKLA 3VDHA 3BARA 1FWWA 3PJUA 1RVKA 3OLEA 4WXZA 1C7SA 1C90A 2QR6A 2F6UA 1HG3A 3HGSA 3THAA 3ORWA 4P8UA 1P6CA 1LROA 4V28A 4D6FA 3MVIA 3UW6A 1OSEA 3GBDA 2YL9A 2JIWA 3TAOA 1YHTA 4M3PA 1FBAA 3M43A 3NZRA 5A6BD 2Z1WA 1EBHA 1DVJA 2VCAA 2P53A 2OR2A 1ZHAA 4Z2IA 1UROA 3WH6A 1C8XA 3XIMA 1QVBA 1WXJA 1Q6LA 3PTKA 4E0CA 1UUOA 3EX4A 1PTGA 1XSJA 3QYQA 4K1GA 1FFQA 3PNZA 1M9HA 4JY8A 2FMNA 1WOAA 4IG2B 4BF9A 5DEZA 1PKYA 4V27A 2B7NA 5FAJA 3OEXA 3EWCA 4K6AA 3GIYA 2B81A 3EWXA 1P1XA 3N6JA 3PZMA 3BGJA 3VX0A 3B8IA 1TRDA 3MY9A 5I6SA 2Y85A 4UTKA 1UA7A 4INFA 1OCBA 3LCLA 2VENA 3FHAA 4JOMA 5JXQA 2NXIA 4WKAA 3M44A 4P8VA 3VOGA 2Y7FA 4HA0A 2I9UA 1F6YA 2R94A 3KM8A 3QMTA 4LVBA 3EAUA 1K8CA 2DJXA 1HJWA 3M0HA 1E0VA 1MXDA 4NI3A 2XSAA 1PX8A 1KCZA 4NX5A 3T09A 4JKMA 2OSXA 3U7VA 3AAMA 1OFAA 3BZGA 4JTUA 3LPGA 4JZ5A 2BXVA 3TWBA 1VZWA 2NX9A 1WKYA 2GJXA 3UR5A 1BWLA 2J75A 4F0SA 1Q85A 2ZA3A 4UFJA 5H1WA 4YS1A 3FNDA 3U3HA 3LLXA 4E38A 4IHCA 2WHJA 3BSGA 1I45A 1XRFA 3S2LA 1O5QA 4LRSA 4RDVA 4NZ5A 5I3DA 4QLLA 3N2BA 1EQPA 4FR6A 3U4FA 1E4IA 5AHEA 3DFPA 2ZRWA 1GVIA 4LB4A 4NI8A 1W3JA 3ARWA 3QQ1A 8XIAA 3C86A 1I2OA 2PU0A 4M51A 4IQEA 1ZP4A 1GVOA 2Z1XA 4AUBA 3VC6A 1BD0A 1H7XA 4QJ4B 2NWRA 3N2OA 3RX4A 4QS6A 3M0VA 3W00A 4C65A 3LLFA 4ORMA 3JR2A 3ECQA 1EJRC 1KTNA 1V7YA 1SYTA 2WO5A 4DM1A 1E4NA 1DJWA 1LRQA 2NQZA 5IXEA 4S2CA 1FXQA 3PPCA 4QG6A 1J2BA 2NQLA 3VKDA 2QUTA 4F2UA 1QO5A 1AK5A 3VOFA 4ZOCA 3RYSA 1WUFA 3BDKA 1S1RA 5F4XA 3WNNA 2FVKA 4LRTA 1AJ0A 4IPPA 3VIPA 3QR1A 1YTEA 1U30A 3ITXA 3UXKA 3W7IA 4UTLA 4XIMA 5TIMA 2WKLA 2ZCGA 3W2MA 2BLEA 1XL9A 1A80A 1NAL1 2DZAA 3MZNA 3I6TA 3V7PA 3ANYA 2G96A 4EX4A 1HN1A 2AOSA 2ZADA 5DLCA 1L2QA 4MSSA 3B4UA 1QNVA 1QNSA 4AX7A 4HIBA 1VFHA 3GNPA 3VNIA 1KWKA 2C1HA 4D9PA 2P50A 5LHEA 3W28A 2OFJA 4DN1A 4PMJA 3FA5A 2XSXA 2ZXAA 1G01A 1L6SA 1XM3A 3G1RA 2C16A 2DJLA 1QNPA 2VJXA 4JX6A 1B3YA 1JI2A 1DQWA 4IQLA 1OIFA 5AYXA 4B16A 5HQLA 4FK9A 3SRKA 2F84A 1TWDA 1JCJA 3IV3A 3G0UA 4S3JA 4AW7A 2KAUC 5ECUA 3LG3A 4IL0A 1OYCA 3DOPA 4ZR8A 4RNHA 5JQ9A 1XBYA 4HZ6A 1W5NA 4EPKA 1D9EA 3VKJA 2Y61A 5G2HA 3MUIA 3ARRA 4IGMA 5CZ0A 3H23A 4UTWA 4PMOA 5D2YA 4NZJA 1TO3A 2WANA 3WH8A 3T6CA 3GXDA 3E0FA 1TRIA 3TIMA 3QLLA 4C60A 3CUXA 4AD5A 4IT1A 4JNMA 4W5UA 5A6JA 4YCPA 4HU0A 1FRBA 5EB8A 1EOMA 3II1A 2YOCA 1E5JA 4PTVA 2GK1B 5C2GA 3ID7A 1BG9A 3NOYA 3VDAA 4CU7A 4ES4A 1DTUA 2Q09A 1VQTA 3WUFA 3W75A 3AOFA 3CMGA 4PUWA 4DJEC 4H6KA 4LU0A 2XZ9A 3SBFA 4UFMA 1ISVA 2P76A 4FNQA 3CUIA 1TMQA 1VF8A 4R85A 2FH6A 4O1AA 1ZBVA 4N6FA 1LLWA 1XYFA 2DSVA 7TIMA 3LTPA 4G7FA 5JBDA 1O5KA 1UC5A 1T8XA 2TRSA 1NVMA 2BHZA 2PE4A 2HMCA 2PFHA 5C7HA 5E9AA 2VEKA 2EPNA 4U2YA 1VFOA 1TPDA 4Y9MA 3GTNA 2O4QA 1CB2A 4HVXA 4PB4A 2CHNA 4IM4A 3ANUA 2OWCA 1QT1A 4I9TA 3UNDA 3O7UA 1UHVA 1NDYA 2WWDA 1JG9A 2C0AA 3IGHX 4UFLA 4AXKA 3H7VA 4U10A 4WLCA 1VP5A 3WX7A 4MYXA 3HN3A 2HJPA 4NAEA 1JXJA 4J3VA 2PLCA 1QNOA 1EP1A 2Q8XA 3L4YA 1TX0A 4AF0B 3TSBA 3GD6A 4CQ9A 1Y5WA 5FEPA 1DKWA 3DENA 5E0FA 3UR8A 3PFMA 1WKFA 1JULA 2OOFA 3B97A 2DH3A 5FF2A 4FNPA 5D30A 4E2VA 3IACA 4CN1A 3RM8A 1G69A 2ABAA 1REQB 5C9RA 1VIWA 3H53A 4DO4A 4GUFA 3A4XA 4Y9AA 3QFEA 4W7WA 4DWSC 4J5NA 4AYSA 4US5D 1PSCA 2GL5A 3SGZA 5HPCA 4NYYA 2VC5A 1TIMA 1KV8A 4CNPA 3VOHA 2QCMA 1U5HA 1EYWA 1PX3A 2VURA 3GYCA 4G8TA 4PB3A 3GR7A 3C5QA 3RDKA 3PUEA 4BA0A 2FB2A 1H61A 2PA6A 2AMGA 2CKSA 2OEKA 4L1GA 3UY7A 5LIXX 5HNRA 3SCSA 3GHSA 4CNSA 4UTMA 3AC0A 1YPIA 2CPUA 4H8HA 2C91A 4M7TA 4IFKB 1NF0A 4DYKA 5EBAA 3CUJA 1Q6EA 3N17A 5LNSA 2MUCA 2NV1A 1MRAA 1J93A 2VFGA 1K4GA 4D6DA 3LCGA 1D7KA 1L6WA 3B0YA 3WD3A 1E6SM 2D69A 2PDHA 4ERAA 4NXSA 5BROA 1W9VA 1ZRQA 2REQB 5D2WA 1LLZA 1A4MA 3UFYA 1ME9A 1PVNA 4DZ5A 5EFDA 4E3VA 4NXKA 2VOTA 4MKVA 3BWWA 3P14A 4O0KA 2A6NA 3VUPA 4IUOA 3LPOA 3FVMA 3M0XA 1VPXA 1KKOA 1UZHA 4AZBA 3MKVA 3IIVA 3W70A 3H24A 4UMCA 4IXHA 1QUMA 2PRLA 5BU6A 3IIOA 2B31A 4BEQA 1HKMA 5E6ZA 3N4EA 4PH6A 3IIZA 2ISFA 3VKCA 3EDDA 2J6VA 1W9DM 2A3BA 2HXUA 3O16A 1QR7A 1BXCA 2BFGA 5FESA 1WYIA 1XIDA 5HBFA 1K3UA 3LN3A 3WQDA 1Z41A 1NY1A 2A3AA 2YFOA 3CL7A 1YDOA 4QAIA 2HV5A 3WK0A 3NPWA 2PDCA 4BQ5A 1MO0A 2BGSA 3IJQA 4AQLA 4JCLA 2OPJA 2XVNA 5LGXA 1IR2A 2PMQA 4H9UA 1V6YA 1A5KC 2CLFA 1KFBA 1WXYA 2EG8A 3QGVA 3AS1A 1JYXA 3K30A 2VHLA 3NO3A 4RCXA 2C8NA 2H8ZA 1QI3A 1ONWA 3STEA 1FWHC 4GFIA 4I5XA 3MT1A 3HV8A 4DI8A 5CBBA 4XAFA 3UZXA 2FTWA 2W5FA 2XISA 4C1LA 2BOGX 4LYQA 2OEJA 4MFEA 3CU2A 5F2MA 3GHTA 4OT7A 2NQHA 3OHIA 1W8SA 3B8DA 3KRSA 3T08A 3QW3A 2O0TA 3MA8A 3R25A 1EHAA 3KP1A 1P0NA 2JGYA 1J8VA 1AG1O 4O1EA 1XYCA 5D9NA 3CMJA 3AO0A 5CSYA 1M41A 1TWWA 2A3EA 1QOQA 3A64A 3LBMA 4ZGYA 5A1AA 1XP3A 2V8ZA 1H1YA 2QDHA 1UD2A 2HVNA 2PU1A 3URAA 4RZ4A 2X8RA 1NDVA 2WCSA 2YPIA 5G5IA 2D22A 1VFSA 3LEPA 1XV8A 3G3MA 4W89A 3W7GA 3W25A 2TAAA 3H2NA 3JU2A 4J3WA 4K36A 4GY7A 3RG6A 2WBKA 2XIIA 2DZSA 1RCXB 3S1UA 3YPIA 3MKKA 3QQWA 4MLRA 2Q8LA 2G0WA 3BMXA 3MCOA 1GKRA 4LQ1A 3JVAA 4LH8A 1C7TA 3TJ4A 3I65A 3W7JA 3M41A 1A5CA 4IZGA 2Y7EA 4MLJA 1M7JA 2FGZA 2BGQA 1OINA 5E5CA 3B0VC 2G3MA 3VNDA 2EQDA 1E1CA 3TYBA 1KTCA 5G1YA 2BY0A 4ZE4A 2ZZ4A 3FAWA 2DT0A 1RZMA 2XFYA 4ORIA 3CT7A 2ZUSA 1R47A 3FJ6A 3QHNA 3N4AA 2FZBA 3E2VA 4GIYA 4TO8A 2YZRA 1SW7A 4BHYA 1J2WA 3W71A 1L6GA 1BSLA 3A24A 1RA5A 2OZ8A 1E6ZA 4PUKA 3RUBL 5E0KA 5BZAA 2W0UA 1OF8A 5IHSA 1G4EA 4F0KA 2VC9A 2FH8A 1XKYA 3POCA 3K5XA 3WLMA 2ZUTA 1ME8A 2YSWA 3D5HA 4DB7A 5CC6A 3L4TA 4QEEA 3QOKA 3IJIA 1GKPA 1E43A 1W17A 4C6JA 5C9WA 2NLIA 4A2RA 4HPHA 3CPGA 1M7PA 2CWXA 3ABRA 3REQB 4OV4A 1GEHA 1KFJA 2ABBA 3BAXA 5CG7A 3V1PA 6REQB 2IPWA 1U5JA 4OBSA 4PE8A 2ZZ3A 1EDGA 1ECEA 2VR4A 3GNOA 3EOUA 1V0KA 4E8GA 3N13A 3F4VA 3N9KA 4W7VA 3FJNA 1UBPC 4YTRA 2QQ6A 1I4NA 5DT7A 4AMAA 4GINA 3KCLA 3GHRA 3FEMA 1CYGA 2GWNA 1H5YA 2Q3RA 3IJ8A 4RLIA 3RITA 3R94A 3U7BA 5J5DA 5FJTA 4PR4A 3P3BA 4HN4A 4EOUA 1PX4A 4JNZA 1LL4A 3URQA 2QCFA 4L80A 2EXOA 2OX4A 1GQIA 4EPBC 1XCFA 5IHRA 2V5BA 3FJ4A 2VOMA 3LCFA 5D9MA 2C3ZA 4IGHA 3BCJA 1DYSA 3H26A 5I5RA 1JDFA 1YQ2A 3BAWA 1Z42A 1FWSA 1UR3M 3IRSA 1XIIA 4U2ZA 1PS9A 1X1NA 1IR1A 1Q65A 4QSHA 1IYXA 3AIQA 3NGJA 4IMEA 4ZSTA 2X2YA 4AZIA 3HQPA 3V16A 1OCNA 3T4WA 3UXLA 4MY1A 1IWBA 1KBJA 1W3HA 2OJPA 3BQ5A 1F73A 1XH0A 3WBWA 4UR9A 5AHFA 1TA3B 3ALFA 3BL3A 2UY5A 5A6LA 1JDAA 5A8MA 1V5XA 2XFFA 2VMFA 4ZO8A 4GISA 4XWUA 3DBPA 2WHMA 4O16A 1LOLA 3AROA 3TU9A 4GBDA 4BKNA 1YTDA 3QY7A 3KL0A 3ZWTA 1MXSA 3W7NA 1MQPA 1RJRA 2WXDM 1IXNA 3COTA 3RX3A 4GYKA 1V4YA 4KW2A 5LA0A 1JZ7A 3AMLA 2OU4A 3RLGA 3D3FA 4JN6A 2EKGA 1ZY9A 2GLKA 4EXQA 1K70A 4JDBA 3RLVA 3L12A 2GFTA 4XTDA 1TZ9A 1K6AA 2QUUA 1UMYA 3SQLA 3DBNA 2DGAA 2X30A 3EWBX 4HHHA 4J2PA 3B8UA 4QX4A 3W7CA 1YPXA 3FXGA 3RXZA 3IEBA 3VPLA 1X38A 3M0ZA 3R4IA 4XZNX 1VCFA 3VIGA 4QCFA 4NNBA 4DBWA 3F4WA 3LRKA 1XR2A 3SO7A 3KRUA 5IBXC 4QRNA 3E49A 4Y9NA 3W74A 2JQXA 3B03A 1W3TA 1UB3A 1HKIA 1DE6A 3KXQA 1IGWA 1PJ9A 1QHPA 5DCDA 3T0TA 1P43A 3DEQA 2X7WA 1EPVA 2WVTA 3VDBA 1HIZA 5DY3A 1R3SA 2YR1A 1R7OA 2G5WA 2V2CA 1N8FA 3G8EA 3ICJA 1YRRA 3WNPA 4LX4A 4HNUA 2WCAA 1PIFA 1Q4NX 3QPZA 3ALGA 3WQVA 2VGGA 3E0WA 4C6CA 2F2KA 2E6AA 5LZLA 4GD0A 4DUVA 3LI1A 3NTYA 3KAOA 4GK8A 4GI6A 3MQTA 2QMJA 4IMFA 1V0NA 1CGUA 1QU4A 2RDUA 2A1YA 1O6IA 3ZR5A 1PCKA 3AQUA 3SSJA 4YVPA 4H41A 3NSMA 1ODZA 2QCLA 4QXIA 3EDFA 1VBGA 3AIVA 3THQA 3K8LA 2Z7KA 3OU8A 3CAVA 1TMHA 3CV7A 3W2JA 4ATWA 3F2CA 4GH1A 1V0LA 1VYRA 1W1TA 2WVVA 2H8XA 2YDSA 2GWGA 3AFBA 1O94A 4X9SA 4FXJA 1UQYA 4WGXA 2WNWA 4Q8WA 4UMAA 4HNTA 1VYPX 3W23A 3ARQA 3EPOA 2C79A 5U4NA 4O57A 3T44A 3R43A 3PSVA 4HU4A 4RNJA 4W86A 3NOEA 1KFEA 3UQNA 4W9TA 3N15A 3S5SA 3LHVA 3W1XA 1DWGM 3F4CA 3WDRA 4IPNB 5ABGA 3CTLA 5M03A 2ASHA 2ON3A 4NUWA 3OTRA 3M1ZA 8CGTA 3TW9A 2HISA 2E5DA 4MOZA 4ZB5A 1KBKA 3WLIA 3KOWA 3FSUA 1W5MA 3HQ1A 2GGIA 3L68A 1TTPA 3N3MA 1SGJA 1W2PA 2TODA 4GFSA 4PMQA 1XLLA 4JQ3A 1SZEA 1G94A 3P82A 3RU6A 2QCCA 1ZUAX 4WHBA 3AHXA 1UW9A 1IEQA 1GORA 4AMCA 1Q66A 4IOTA 2IUZA 2XIBA 3S47A 1AFSA 2AAMA 3RJYA 2WJFA 1VFFA 2V30A 4QJ1A 1QRQA 4CNTA 5C2CA 5LIYX 3EA3A 2VQUA 4IF2A 4HSOA 2BHUA 1RD5A 1DHKA 5G4WA 3MUCA 1VBRA 4PTWA 1JPIA 1CTNA 4V1YA 1YDVA 2XIMA 5KITA 3CQKA 3BCDA 4XO6A 3SGGA 3WBAA 2DY3A 1W1PA 1MFUA 3ZVHA 1WAWA 4UFHA 4NNCA 4FAMA 1XUUA 3C4UA 1XGDA 4U28A 1OT2A 3CQIA 4JFUA 1JGIA 1SFJA 4Z08A 1MNZA 4MPQA 3D6NA 3OGSA 1OIMA 3F5LA 1EJWC 1TPC1 4NNAA 4AIBA 2IQDA 4CU6A 4HPNA 2O9PA 3E3HA 2QZRA 3W81A 2XH2A 2VXNA 4OBRA 3PHAA 1OBAA 3HMJG 2D2JA 3ONCA 3QW4B 2PDIA 4L9XA 3NQ8A 2PPGA 1H09A 5HINA 3N2CA 4DO5A 3NZ1A 3RMJA 3NQ6A 5C9ZA 1LG1A 4ICMA 3EB4A 2YXOA 3R10A 4I6VA 1CGTA 6TIMA 3VGBA 1AH3A 5ABHA 1UD4A 1KM2A 1AD1A 1SQ7A 4HOXA 1NF7A 3L4WA 4UQEA 3VE9A 2D20A 4S3AA 5CZTA 5DBTA 3UA3A 3W7RA 4DO6A 5BMXA 3LK6A 2WSPA 4JTKA 4IIDA 2ZTJA 3DYMA 1AH4A 3U48A 3PZNA 4OJYA 1V3KA 1O66A 1FCUA 4PEKA 3S2CA 3MSGA 1FWRA 2Z1VA 1TE6A 3GR4A 3S2MA 1QJWA 3KBWA 1VAHA 1S3TC 1J0JA 2J7BA 3CL6A 3QJAA 1LUCA 1PZ2A 5HATA 5M2FX 4Q4KA 4YXGA 4QG8A 3VD7A 5U7SA 4DBEA 1T99A 5BYWA 3NQFA 3C2EA 3T0AA 1YLVA 3TSDA 1VCGA 4LYPA 4DJFA 2OZ0A 2RDXA 2ZUWA 1P0DA 4UB9A 1K9EA 3SW6A 1UA3A 1GOWA 1KLYA 3GW0A 1WP6A 5EGRA 3MBDA 1EC9A 2D0FA 3VCCA 3I7RA 3TYAA 1VBHA 2V68A 4HBKA 1LM1A 3BXWA 3C2RA 1NWUA 2RFGA 4WDUA 3PTDA 4RL3A 1PB0A 2D0HA 3L2IA 1EP2A 3A3HA 1DWJM 2Y1HA 4N9EA 1RSCA 4PTNA 3B04A 3SUWA 1E6QM 4LF1A 5CPQA 3TWAA 1H7NA 2P10A 1FWNA 1TG7A 4KWWA 1F2JA 2G50A 3WDJA 1O1HA 4S1FA 4N9CA 4IPJA 2Q01A 3TOPA 4M5PA 1PZ0A 1LWHA 1P0EA 4Y9OA 3QM3A 1FA2A 2E25A 1XYMA 3KOXA 4HU3A 4PMRA 4O52A 2AAAA 3EKGA 3O6DA 3AICA 2FZDA 2PODA 4LFYA 1DE5A 4JTQA 1CCWB 1VKFA 2QV5A 2QLYA 4XX6A 4ZQNA 3C8FA 4XZWA 2XGZA 3OBAA 5HMEA 3GO2A 2FB3A 2X1IA 1EXPA 1ISZA 4NT0A 2QHAA 3BTNA 5BRQA 1CNVA 3B0XA 1XH1A 4GC4A 3KDOA 2DORA 7A3HA 4XZ9A 3W82A 1KB3A 2GUYA 1E72M 1ZPTA 3IK4A 1DWHM 4JTGA 3WQCA 3WMSA 2QDGA 4JNYA 1Q6FA 4QQUA 5T9CE 3LI0A 3Q2DA 4QNWA 4CN4A 4LW7A 4AWUA 1NSJA 3KOYA 3VOCA 1MW1A 2HDJA 1UD3A 5H6HA 3PWGA 3F4DA 1XD0A 3AHZA 3F7JA 1QPNA 1LQ2A 1VEOA 5E6YA 2VD9A 1PXGA 4QISA 2P88A 3BV7A 1TCMA 4GH3A 4B4HA 2R91A 1IIGA 3BSHA 2PLJA 3IRDA 2PDNA 3CEPA 2B7PA 2ISSA 4K7VA 4HOZA 2CXGA 3CQJA 2WZIA 1GJPA 4EF8A 1UR4A 3LS9A 5CKSA 4M8UA 4DF1A 1ZJBA 4P7NA 5J5RA 5HQEA 2QNEA 3UZYA 2R1PA 1JPDX 1R2SA 2Z1BA 4JGDA 1TV8A 3KBMA 2DSKA 4LVFA 3T2PA 3PBWA 4DJDA 1A0DA 4JTSA 3NM3A 2NVAA 1BYAA 2HBXA 2WNZA 1FWAC 1HX0A 8XIMA 2A7PA 3MMWA 1UZ1A 4Y90A 3LRMA 4C6NA 2AL2B 3WUEA 3LV6A 3PWAA 1R5YA 7TAAA 4YN5A 1E5NA 1RCQA 2CBJA 1G4PA 3AZSA 1EDQA 1MQRA 1F4HA 2VWTA 3VZZA 3JW7A 4TVUA 3G1XA 3VDGA 4O8AA 4B4FA 4OBTA 2G97A 4FEZA 1IZKA 2OQHA 1A5LC 1H2JA 4HNOA 3E96A 3TXVA 4PULA 4MY9A 4LTSA 1A5SA 2BY3A 1JQVA 5E0CA 3N9SA 1XLEA 2F8QA 3E2QA 3EX1A 1LF1A 1JXKA 3GB6A 4DZIA 3LBCA 5FKYA 2W9MA 3SADA 4PTDA 1UQZA 1K4HA 1HFBA 4G2DA 1O68A 3UJSA 5FEZA 4PUMA 4CCCA 4R3UA 1LOQA 4PN2A 1SJAA 5LNUA 1OFPA 4IXXA 4J9JA 3E0IA 3E12A 4FP1A 3FDKA 2NXGA 3P8IA 4CQDA 4B5NA 1H60A 2YX0A 1T6MA 5H8MA 4E6MA 1VR6A 5HOSA 3THUA 1QNRA 1UWRA 4WOZA 1A5NC 3IVSA 3UXIA 3BE7A 4LS2A 1XISA 3GFYA 5C71A 1DIDA 3UJ2A 1JFHA 2YA0A 1UKPA 2UY4A 1ZL1A 1WPCA 2R24A 2P5NA 2ZRYA 1EEXA 5IBXA 3BZJA 3RPDA 2X0YA 3LXBA 3CGTA 3ABOA 1V08A 1R3QA 1H5VA 1WDDA 4DLFA 2VGBA 4IWWA 3PB2A 4PRWA 4QAWA 3NPXA 4N9BA 4O17A 4ALDA 3RAOA 3GAKA 2PBGA 3O07A 2E4TA 3FKRA 1XG4A 5A94A 2KX9A 3GDRA 4FSAA 4RDWA 1QNQA 1GVEA 3TN3A 4RJEA 4QGCA 4A21A 3NDYA 2BTMA 3S5OA 5HJLA 1HQTA 1OD0A 3CUFA 3SM0A 3W83A 3E0LA 2XPKA 5K3VA 4L56A 3WUGA 3WDIA 1KRCC 4BF5A 1GOXA 1TFVA 4H8VA 1NOUA 4JTCA 1EJUC 2YDRA 1S2TA 1OY0A 3ZSTA 1OC7A 1TV5A 4H2HA 2DIKA 1BGAA 5EMLA 3TEVA 4DXXA 3L67A 1PEZA 5DRCA 2X1UA 2F61A 3R0KA 4CD4A 3U2ZA 3IUDA 2CETA 4LUTB 6PTDA 4DNMA 3WQ8A 3QGKC 4FPSA 3TZNA 3WBXA 3NVTA 1QHOA 4KT2A 4F66A 4AISA 5BRBA 4GXPA 3WF4A 3LHWA 3OODA 1LBLA 3TDFA 3GG8A 3QHMA 1M01A 3CUHA 1JF6A 3ZJKA 5HAOA 3EX2A 4FXRA 1R9YA 4WSJA 5BOEA 3DHUA 1NOWA 3EPNA 3VNJA 3QY8A 2Z6JA 4WY0F 3S83A 3ZZ1A 1LP6A 4BI6A 2X42A 3QKEA 3F1QA 5CBJA 1E4LA 3MB9A 1V03A 2XH7A 1WDWA 1JYNA 1BLIA 1XLHA 2ZZ5A 1PTAA 2GJPA 2PD5A 4EWJA 4NF7A 3A3WA 1E3XA 1ONRA 4Y2WA 1W91A 3EA2A 2XM1A 3W9ZA 1UPPA 2CU0A 3M9YA 5BWAA 4DF0A 1VLWA 4POCA 2PC8A 1XIMA 2QPUA 3CQHA 1XIEA 4E2BA 3LHZA 4M56A 3UJEA 1BQGA 3MYOA 4D8LA 3VIOA 4BWLA 2V2HA 1U1UA 3EWWA 4KMQA 2CZ5A 3RIKA 1BF6A 4B5UA 7ENLA 4IQJA 4AVOA 4ZTYA 2BWGA 4Q8UA 4B3LA 3AIEA 3PF3A 4ACZA 4E4FA 2E28A 3NWRA 3DZ1A 4F9DA 4A29A 3C6CA 1DXIA 2ALDA 4EXAA 4HA1A 2FPTA 3UU0A 2PDJA 1FWIC 2QW5A 3G24A 1F3XA 3NO1A 1QBBA 1N7KA 1FH9A 1F7BA 3D46A 3G1HA 3T2OA 4H6QA 3BUVA 4E8DA 5HANA 2I17A 4HK5A 1WZAA 1TJPA 3NAVA 3M64A 1HVXA 2V3DA 1DQUA 3OB8A 4L6OA 3THDA 4Q8QA 4L4MA 2Z7GA 2VDHA 3DXIA 2Y2WA 4TX9A 3WLJA 2Z29A 5CBIA 1TCDA 2NX1A 2W63A 1EIBA 4H9YA 3GTFA 3KRBA 3WF1A 5C7VA 1P0KA 1W6TA 1AUSL 3LPFA 3M5VA 3W86A 5AOUA 4UUIA 1QW7A 3DX5A 4Q4SA 3PPFA 3N6HA 1LT8A 3CNYA 3L66A 3WELA 4C6DA 1NDZA 1XLDA 2F38A 2XM2A 5JBEA 2IKJA 4F0HA 2RHGA 4U3CA 1P4CA 4QITA 3KEHA 3VOIA 1I60A 1EEPA 4A8NA 1E6XM 5CC7A 3V75A 1KNWA 3R12A 2GJXB 3M7SA 9RUBA 1H1NA 1FWGC 4WJXA 2E40A 4ZQRA 6CGTA 4JFTA 4CNOA 1UMLA 4MMWA 4A3HA 4P5UA 4WEVX 3HG3A 2XYLA 1IF2A 3CXOA 1OJXA 4GC3A 2VD8A 3WN6A 1LWJA 3BJSA 3AU2A 1NIUA 1XKJA 4EF9A 1TJRA 1Q6RA 4ZQOA 1AA1B 1IXOA 1JPKA 1XIGA 3SRHA 1EGVA 5CZJA 1X7FA 3UWQA 4P8XA 2OO0A 1E0TA 3BANA 4K68A 1TQXA 1R6WA 2V3EA 3WK2A 1XQKA 3GNXA 2WZTA 4MB5A 5AHMA 4MZYA 1GEQA 2JF6A 4RKAA 2PCQA 5GJMA 4ZODA 1TE1A 4Q4OA 3VIHA 4X2PA 1NWTA 3IVTA 3L7RA 3MSYA 2QKFA 4QROA 1RK6A 1E0WA 2UZ9A 3QZ6A 3TH6A 1F07A 3GXFA 2QCGA 4ZQCA 3S0CA 2CXEA 4CUCA 1QW8A 2J9YA 2YCKX 4F9JA 4IPLA 5A8GA 3WEOA 1DWIM 1QOPA 3AXIA 1A5MC 5I7GA 2CLLA 4ZL1A 4FOUA 3FHQA 1JUBA 3E74A 1BTCA 2ZUVA 5E70A 3GUWA 2IS7A 1S39A 1CLKA 2CKRA 2DVXA 1AL7A 1EYEA 4YLWA 3L5MA 4O50A 5HUOA 1A3WA 3EEGA 5FEXA 1HJVA 3OBKA 4M81A 2OSYA 4TIMA 1RJQA 3OLDA 4LUSA 2CLHA 1KRMA 1Z9AA 4C1NA 4FOKA 2EJAA 5TAOA 4R7JA 3VMOA 4IP5A 4AHOA 4DUOA 1UH4A 5IRPA 1WA3A 4KPLA 4D8AA 4AAJA 7REQA 5AFDA 4WSHA 3SN4A 1E6PA 4J3TA 2V82A 2PDYA 2BNJA 2ZRZA 5EU9A 3M07A 2VX5A 4W8LA 1X7IA 3WF2A 4DNHA 5C6MA 3ITYA 4E2DA 3T8QA 5BXSA 3A3XA 1W5QA 5TQLA 4HOWA 4TV6A 3BOFA 4MKSA 4C7FA 4ZA0A 3LV5A 2ISWA 4GWEA 4HB7A 1XLCA 4XZMX 1UP2A 1PL9A 2XSBA 3BLKA 4U31A 2CLEA 3UNTA 1Q7MA 3PANA 3WUBA 3N25A 2YCEA 3NURA 2GSEA 1BSIA 2GSHA 1JNEA 3W1TA 2J6XA 2PDQA 3UT0A 1ML1A 4TTUA 2UY2A 1DJIA 1XIHA 1GK8A 2I5GA 1DL3A 4W4QA 2CYGA 4DXKA 3G1SA 4S3CA 2QJIA 4M0XA 3GVWA 3ENLA 1KRBC 3ABXA 1ZBWA 1PAMA 4H9MA 2Q3OA 1Q2SA 2J7DA 4HGXA 2WQDA 1XBVA 2YXXA 2WMIA 4MTVA 4TXEA 5RUBA 2TPSA 1SMAA 3TJIA 4OE7A 3TYZA 3NIYA 3W72A 3NQCA 3EB3A 2DPEA 4C6KA 3IIXA 4CCDA 4PMDA 4RNIA 4PTMA 2WJEA 4ZB0A 1CT5A 2R1MA 1JDCA 3LSBA 2Z24A 4KGLA 2VUNA 3TONA 2VVNA 4OECA 4M82A 4CNUA 4Z2JA 3SY5A 4OVXA 1FH8A 2FFCA 4AZ5A 2WKGA 1SR0A 2BP1A 5EFFA 2D3LA 3A4JA 3LM7A 1S2AA 4FI4A 4MJ2A 3U0HA 3AI0A 4KH2A 3TN5A 4S3DA 4DX3A 3BG5A 1FVPA 3QMSA 1BRLA 3EMQA 2E6DA 2VFEA 1EJTC 3RILA 1H41A 4EXBA 2OYLA 1OYAA 2J9ZA 3LRLA 4Z1BA 3OQ8A 3DERA 3G1VA 1YXYA 4GY1A 3TYCA 2OGYA 4B3KA 1GNXA 5HJXA 4WQ6A 2EPLX 4RDZA 4LNYA 3IK2A 4O54A 4LCQA 1IWAA 2VCBA 4L4PA 3RRXA 4B5TA 3UEQA 4D6IA 2A3CA 5DF0A 3I4EA 4MY8A 1FP9A 3Q58A 5GPRA 1JCXA 3AHYA 5C2XA 3T2QA 1KQYA 3W1UA 5M5DA 1AD4A 2WLZA 2CZVA 3F2DA 1OCQA 3OGRA 1F5ZA 3FDGA 2VNCA 4IFOA 4RE4A 2WZHA 3AMGA 4DJFD 1A49A 1TPVA 2PP1A 1TQJA 3WFZA 3K4WA 4A3UA 1XX1A 3W7DA 1ALDA 3CUGA 4GY0A 1VENA 1QI5A 5A2CA 3TVAA 2FKPA 2OG9A 3UESA 1M6JA 1GTEA 1AMYA 3QEZA 4NJKA 4BQ4A 6ALDA 2JKPA 3WLLA 1W37A 1JEZA 2O7SA 4C6PA 3TNOA 3GWQA 4NZCA 3ARSA 3P67A 1R7AA 5A6MA 2GK1A 1E0UA 4FALA 3CO8A 3PP7A 5A8QA 1JUKA 2OEMA 2Z4GA 1AODA 1G7VA 4JTDA 3WJYA 4FX8A 4YWIA 1KFKA 2V3FA 3AMDA 5A2AA 4Y6GA 2J8FA 2ZZ2A 1ENUA 4DXVA 1LL7A 3QYSA 3UWWA 5A2BA 2WM0A 2HK0A 4MNKA 3MSDA 1J96A 4HZ7A 4JIRA 3ABZA 3DFYA 1OFBA 1KFCA 3RJXA 4TVCA 4ADUA 2VCCA 3CIWA 3PBGA 1SFTA 3DG6A 5I3IA 1TPB1 5FL0A 5C9UA 2IPJA 1HUVA 3BH4A 4P7OA 4YTSA 1G9HA 2H3DA 4LAUA 3U9IA 2VP8A 4JHMA 2JKAA 1WX0A 3MV11 3LMYA 3AWOA 5CGTA 4AVFA 4TOQA 4FZIA 4XZBA 4CQCA 4K7YA 4H8UA 4P61A 2ZBTA 4QIUA 1R8LA 3P93A 4AF0A 1KO0A 3QSTA 2NT0A 3UVIA 3D47A 4QCEA 5FJJA 3W22A 1DV7A 1JZ5A 4D6CA 3H4WA 1XBXA 3WD0A 4TUFA 3N12A 2R1NA 1U1JA 1KA9F 2NQ9A 5FSEC 2DZXA 4PMZA 3ZLGA 3W24A 1A3HA 4JYDA 5FCZA 2NVDA 3HPFA 4Z17A 4LC6A 1EZWA 3VGDA 3OZMA 2JK2A 1X1ZA 1DHPA 1WBJA 1FWJC 3CH0A 4MAZA 4MJZA 3DCPA 1WO2A 3NYDA 2XIQA 2PDGA 1B3VA 1JZ3A 1F3WA 2EO7A 4O18A 1VD6A 2ISVA 1ICQA 1EJ7L 3G0SA 3N14A 2XFWA 2P8BA 2ZDRA 5A6TC 3RM4A 4NZ3A 1VEPA 3DHPA 4Q7NA 2GDUA 3ZT6A 3SCPA 1M04A 2OWWA 5DMYA 4M29A 4DIAA 1QW9A 3P5YA 2PTYA 5KEZA 3NL3A 3VCNA 2C13A 5LIKX 2PWUA 3RX2A 4KCWA 5KZDA 1LTDA 4FIRA 1C93A 4DI9A 4GQQA 2C19A 4P7RA 5FAGA 2W91A 1S2WA 4UCFA 5FJIA 1NP2A 3RLHA 4MVAA 1E1FA 3ZR4A 2C14A 3APYA 2J79A 1WE5A 1MRQA 5HJYA 4GHRA 3KWSA 4C6LA 1R30A 5BOOA 1CXLA 3VX1A 3SUVA 4BK9A 3M0JA 4FNSA 2OKOA 3VMPA 3VGFA 4HA3A 2WHLA 5XIAA 3B3DA 4GZJA 2WMKA 3NZPA 2A3LA 5AECA 1QMLA