2CLFA

Tryptophan synthase in complex with n-(4'-trifluoromethoxybenzoyl)-2- amino-1-ethylphosphate (f6) - highf6 complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
268
structure length
253
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 97
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2clfA00
4AHPA 1I8JA 3JS3A 1JVNA 3DH7A 2ZFAA 1GVFA 3A5FA 3BG5A 2RDWA 3NM3A 1RVGA 5C6MA 3NQ6A 2C13A 4MY1A 5C54A 5DY3A 4UMAA 1GVSA 4ORIA 4O4WA 1SW3A 2CW6A 4GRSA 2G96A 1OK6A 3LM7A 3JRKA 1OVDA 3NVTA 4DPPA 5K4ZA 1EP2A 4RKAA 5AC8A 4YCPA 1UJPA 3GKAA 5TQLA 2EKCA 3N14A 2GVLA 5AHLA 2ZZ2A 3S9YA 3VNDA 4B5NA 4A22A 2FFCA 1YPIA 3UWUA 4ZMGA 4Y8FA 2FPVA 2ZRZA 2A5HA 1H60A 5FI8A 3S8HA 4WJEA 3ZFHA 4A29A 1H1YA 2V30A 3B8DA 2B7NA 4O0KA 5D38A 4Q32A 5E93A 4LVAA 1X1ZA 2Y62A 4M7SA 3VCRA 4ALDA 3IIOA 1QPRA 2QUVA 3LHYA 3DFTA 2C15A 1W1ZA 4FNRA 1SQ7A 2DZXA 4AHOA 3QRHA 4AF0B 4M6PA 3UWVA 4TU1A 1NF7A 2XN2A 2J88A 2PE4A 3E96A 4A2SA 3W7KA 1JCJA 4NJGA 3W1LA 3G1XA 2ZRUA 1KBJA 4UMBA 1ICPA 1ZAIA 3W7PA 3AJXA 1C9DA 3NL3A 4GUIA 4UTIA 5D04C 2GUUA 1JRCA 3W1NA 2YFOA 3LHZA 3IIPA 3FYOA 4CCCA 4MY8A 4U28A 3W7GA 3JR2A 3M5YA 1VJIA 3TUUA 1LDCA 2Y7FA 3IRDA 1TTPA 3F4NA 2KZHA 3PG9A 4RJEA 4PEKA 4IWWA 2ABAA 3P82A 1EP3A 4WQ6A 2GPTA 1EP1A 3T40A 2CLHA 4JTGA 3NG3A 4LRTA 4N2YA 3W84A 1I2RA 4CNNA 1H50A 5KZEA 1XDMA 5A8GA 2R14A 3OVQA 4JTEA 3FEMA 1XUUA 4JDYA 3WK1A 1OX5A 4ZQOA 5LSMA 1QPQA 3G8EA 3TX9A 4X9SA 1I4NA 2OZ0A 3KXQA 3QSRA 1DQXA 2DU2A 1JJKA 4Z0SA 2VEMA 2EF9A 3MMTA 1H1ZA 1JUEA 1ICSA 1B3OA 2AAMA 4RK8A 3W1PA 3QPYA 3EWUA 1K03A 3TR2A 3C56A 3EWWA 4HN4A 2R94A 3UPBA 5U4NA 2EGZA 2FPYA 3GDMA 2H6RA 5DCDA 5AN7A 3A23A 4LU0A 5HUPA 4O1DA 5CPOA 2YPIA 2OT1A 1OFPA 1VHNA 3B04A 5D2WA 1O4UA 1TPVA 1LM1A 1U5JA 4FHAA 4NUWA 4AVFA 2Y7EA 4ORMA 3W71A 4BF9A 4L4MA 3GLCA 1W56A 4NXKA 1PE1A 3UWZA 3UXAA 1BEUA 3KRZA 3U6WA 3NL6A 1W5NA 2NXHA 1K7XA 1Q6QA 4DEFA 2CZ5A 1A5AA 3STFA 4NJJA 1YTKA 2VEIA 1ZJIA 1JUKA 5HJLA 4E0CA 1ZHAA 3B06A 4O28A 1J2WA 3TXVA 3BG3A 1VCVA 2PRMA 4DELA 3UWQA 3BK0A 1TREA 1GWJA 4ICNA 2Y7DA 1XUZA 3I7QA 2BTMA 4JX5A 3PBUA 1VRDA 5K9DA 2JKEA 5K4XA 3MP4A 5D05A 4LC6A 2I9EA 4WOQA 2QJIA 4XKYB 3NXFA 4XUGA 3UXDA 4GUJA 1N8FA 3W75A 1RQHA 4S2CA 6ALDA 4WY0A 4NVTA 1O95A 3Q2DA 3TV8A 1GOXA 4NZJA 4RCXA 1T99A 3PG8A 1O94A 1Q45A 4EWND 4QNEA 4QJ1A 4M6QA 5G5IA 4JS3A 1VYPX 1BKSA 1B57A 3W7HA 5C5YA 1E51A 4O1CA 1H7PA 3DKLA 1XI3A 5KTLA 5F2GA 5D03A 1VCFA 4UR8A 3LOTA 2CLFA 4TMCA 2QKFA 3NQEA 3BW2A 3I68A 4HNNA 2W6RA 2A7PA 2J9ZA 3HMJG 1SZNA 3EWBX 1OX4B 4R53A 1WX0A 3P67A 3QC3A 3IIZA 1SZFA 3DHDA 1HUVA 4WY0F 3LERA 3LCIA 1G67A 1DBTA 2JK2A 3O6DA 2F84A 3LI0A 2PC4A 3M7WA 2JKAA 4JTIA 1OFDA 1FWTA 1KV5A 2IQTA 2WOQA 3R8RA 1ICQA 2ABBA 1YADA 1KFBA 2WNQA 2RDTA 1N7KA 2QCGA 6TIMA 3T55A 5BNKA 3L0GA 5DBTA 1A50A 5F4WA 2VXNA 4S1FA 5BW6A 3LRKA 3ABQA 4PODA 2Y88A 1K8YA 5I3KA 4P2VA 5LGZA 3PR2A 1K8ZA 3NYZA 5KSWA 4S2BA 3W6YA 3WJSA 3NQ2A 4GUGA 4DBDA 5LNSA 1FXPA 1QOQA 5D2TA 4JEQA 1C29A 2VKZG 4UCGA 5HR7A 4O8RA 1L6YA 1YYAA 5DLCA 3IGSA 3YPIA 4XQ6A 1G4EA 3TROA 3GZ3A 3NR0A 2VOMA 1LRNA 1EEPA 3HPXA 5BOOA 2ALDA 3M9YA 2ZZ7A 5G2HA 1PHWA 3PUDA 1D3GA 1PV8A 1DQWA 1CX9A 2VENA 4AAJA 2Y89A 2OCZA 5LZLA 3RMJA 1L2UA 3W74A 1F6KA 2DZWA 4WX2A 3LCGA 3W3OA 2YR1A 5KITA 4RZ4A 1OYAA 3UD6A 3K30A 3KOFA 2E09A 1DL3A 2A85A 3WJWA 3R12A 3LCLA 4Z08A 1YDVA 3CLMA 1FCBA 2VFFA 3EB2A 5AYZA 3SECA 1LZOA 1EUAA 3TW7A 3B03A 4ZL1A 3W83A 3KFTA 2Q8LA 1KFJA 3V75A 3KHJA 5F2LA 1L6WA 5D30A 2PRHA 2ZZ1A 4XBKA 2V2DA 4NQ1A 2VFHA 2B0MA 3P60A 2QCDA 1SFLA 1TSIA 2GJNA 3LHWA 3NL5A 2NV1A 2YW3A 2YSWA 4LW7A 1G4TA 1ONRA 3HF3A 3I65A 1K02A 2ZA1A 4H4IA 1F2JA 3QF0A 5CPLA 4HT3A 4OHQA 3OA3A 5AOUA 1U83A 4DF2A 2ZZ5A 1MSSA 4FNQA 4RXGA 1TPC1 3THAA 2Y85A 1LP6A 3CIWA 5F1UA 2ZTKA 3SI9A 4EVZA 3HGRA 2WSQA 3MUXA 4GBUA 2QCEA 3O6CA 3USBA 3EKZA 4EIVA 3PBVA 4IMDA 3MWAA 3L67A 1KFKA 4OV4A 1JQVA 2JBMA 4IMFA 1A5BA 3NQCA 3MHFA 2Y70A 3DGRA 3W2NA 4GNJA 4RV8A 3QW3A 3EX3A 3TSDA 3MI2A 4HPJA 2QCMA 1KLYA 4N6EA 1OK4A 2J27A 3T44A 5AFDA 3NNTA 5EY5A 1W3NA 2VEPA 1J4EA 1WV2A 1G7VA 3I6RA 4QAIA 2X1RA 4IQLA 4UNLA 4LS0A 2FPTA 1W31A 5HNRA 3WK0A 5FF7A 1ZFJA 4LTSA 3G3DA 3CHVA 3L68A 1GPWA 3MBFA 4GC4A 3HGJA 3SJ3A 2QDGA 4FIRA 3ABSA 3UZ5A 5AC6A 3C2VA 4OT7A 4JR5A 3O8AA 4GWEA 3TQ0A 4BI7A 1TCDA 1XFBA 3N19B 2TPSA 3LXBA 4QIUA 3NDOA 5F2IA 4JTFA 1TPFA 4NNCA 2CZDA 4O52A 2QF7A 3G1VA 1KW1A 5K9XA 2RFGA 4K39A 3S6DA 3EWYA 2QR6A 3G24A 4HNVA 4YCOA 4BWLC 3M6YA 3L0NA 4AWSA 1RR2A 2BWGA 3AO0A 1FWWA 5IM51 1M6JA 1X6UA 3FIGA 5DXXA 1OF8A 3ABOA 1FDZA 4UFLA 2HMCA 3LBMA 3STGA 4CQ8A 2W79A 1TIMA 5AHIA 3W1QA 3F4WA 1IXNA 2H3BA 1JRBA 2FIQA 3FJLA 3DI1A 3C3NA 3L5MA 1NVMA 4LOCA 3P74A 3MBDA 1S3HA 4IX0A 1XL9A 2A6NA 2BSLA 3EXSA 3P5ZA 1QNVA 5HWJA 1PVNA 1QO5A 1YDNA 3NA8A 1GYNA 2Z0IA 3OG3A 4PL2A 1AL8A 2B7OA 2FB2A 3G8RA 3LTSA 1N55A 2H8XA 2HTMA 4HIBA 2ZA2A 1YPFA 3GXPA 2A1YA 5AHEA 1H7NA 4IXXA 4ONVA 2C6QA 3W73A 3W7NA 1GVRA 4U4MA 4UC5A 5AC7A 3QW4B 3QMSA 1LLZA 5CZ0A 3A22A 1AW5A 1NEYA 4ZQPA 4O1AA 2JGQA 2V82A 4FNTA 3GDRA 1H7OA 4DO5A 1SW7A 2CLOA 1FCQA 1H7XA 3HJZA 2ZDRA 3BLEA 5AHNA 3W07A 1UB3A 3PS7A 2YGYA 1ZAHA 1Z42A 5AB3A 3DFSA 3LLDA 3N34A 2CZFA 3W88A 1R2RA 4N9DA 2ZCGA 3M5VA 3Q94A 3FKRA 3L2IA 3WK3A 3N9RA 4M19A 1WYIA 3NZ1A 3HIJA 1C8VA 4LY8A 4POCA 3H55A 1W8SA 3HOJA 5HWNA 2GVJA 2XFWA 3C8FA 5TBOA 4N02A 3KVJA 3O07A 3DFPA 2NWRA 2Q3RA 1P0NA 2ZRVA 4JY8A 3N9SA 4NX5A 4JX6A 3DFNA 3RLVA 1AMKA 1IXQA 1M5WA 4C1LA 2HS8A 3W7RA 4LUIA 5H2ZA 1MO0A 2YXGA 1PCWA 5LNVA 3W1UA 4OE7A 2Y63A 3OEXA 5F1VA 1OFRA 1JCNA 1S5WA 3QQ1A 3A24A 1KTBA 3FLUA 3SFKA 1XKYA 1B9BA 1DKWA 3TH6A 5CSRA 4IJBA 4QM1A 3SR7A 3W2MA 3W85A 4BFAA 3PB0A 4TMBA 4QNWA 3S5NA 3WJYA 4PL1A 4MZYA 3PBYA 2C0AA 8TIMA 4N9EA 1UCWA 3UY7A 2VFEA 3Q58A 4Q4KA 4IMGA 4ZQCA 3DU0A 5G4EA 3WK2A 3GDKA 2NLIA 4N4QA 2P1FA 4ZVJA 3CIXA 4AHQA 3VE7A 2QAFA 1R2SA 5CPMA 4EF8A 2JKPA 1JULA 5KMYA 5EYWA 3OVPA 1JR1A 1WQ5A 1JCMP 3OBKA 3QMRA 3INPA 2PCQA 1QR7A 3LB0A 4E2BA 5E0KA 2V9DA 3I7SA 5DCEA 4UTKA 3EWZA 3NQFA 5LKYA 1ZNNA 3M5XA 1H63A 1DOSA 2YYUA 3MW7A 2X16A 1MEHA 2ATMA 4TX9A 1SW0A 2QEZA 3F1QA 3PVFA 5AHMA 1VLWA 1TTIA 4Y90A 1Z41A 4JDBA 2DORA 3CTLA 3MJYA 2Q3OA 1VCGA 3ZS4A 2Z1BA 3UQNA 3TXZA 1DJNA 1OFEA 3GX9A 4IMEA 1XM3A 3HGOA 4EF9A 4WUIA 1QFEA 3IGXA 3BO9A 3GYEA 5G2WA 1OX4A 1IGSA 1NF0A 2NX1A 2C16A 4FNSA 1QMLA 4PA8A 5FEPA 1V5XA 1AG1O 5D37A 5CZSA 1FWNA 3W1RA 1VQTA 4HPXA 5IBXA 3NQ8A 3E49A 1F73A 1SR9A 3TQVA 5FF0A 1KBIA 2NWSA 4TIMA 3UZJA 3BLFA 3M5ZA 3L21A 3LCWA 1DVJA 1IIHA 2RKXA 1Q6RA 5LGXA 4HNTA 1NFBA 3R2GA 2NZLA 5LHFA 4O13A 3O6YX 1EWEA 3G1AA 3EX1A 2NUWA 3LHUA 5IBXC 2Z6JA 3IIVA 1GYLA 2G97A 2FDSA 1W5PA 2QDHA 3MHUA 1QPNA 4Z1DA 4I7VA 2JGYA 3KRUA 3LGEA 4JX4A 3TFXA 2WNNA 3P84A 4JYDA 3DXIA 1LOLA 5HULA 3SSJA 4AB4A 1OF6A 3TAOA 1IXOA 1P4CA 2FTPA 2ZYFA 2DZSA 1CW2A 1KV8A 2FJKA 5KZDA 1LBFA 1TPUA 3W7MA 1LROA 1SO5A 2QJGA 3H54A 5K3VA 3PUEA 4DO4A 3QQ0A 4N9CA 4CCEA 3IVUA 2Y7GA 4JTKA 3C4UA 4PC8A 4DO6A 4MJMA 5FEWA 2BX7A 1SU5A 4LVBA 5D2YA 1DORA 5G4WA 3C0JA 3LRLA 1YTDA 1TRIA 3RU6A 4YMZA 4UMCA 3M44A 4XBSA 3RFAA 1G4PA 3U8GA 1IF2A 2BXVA 3TNOA 1XBYA 3TIMA 3EXRA 4KFNA 4Z1AA 2ZTJA 4HNUA 2DZUA 3UWWA 1JCYA 4JTHA 2V0TA 4UTHA 1VHCA 4K7YA 1TO3A 4GUFA 4JYEA 1O60A 1WBJA 4A2RA 5HINA 5U7SA 1VYRA 3NQAA 5I3GA 4C1KA 4LV9A 1K7EA 4JNMA 4X22A 4RR4A 1KFCA 4CQ9A 5FEXA 1TV7A 1KFLA 2V8ZA 4UTLA 1EA0A 1SFJA 5LHEA 3L0KA 3R89A 2DZPA 4G1KA 3TMQA 3BLIA 4LT9A 1OFBA 3FS2A 2C1HA 4R33A 2NXIA 4WY0B 2W0UA 3NPUA 3DENA 3G1DA 1W5QA 1HO4A 4WZHA 5J5DA 4X3ZA 2B7QA 1FQ0A 3G22A 4KFPA 3LCHA 3M43A 4H6KA 4IMCA 2ZZ6A 2XN0A 4I7UA 5I3JA 2OT0A 1FXQA 1TPDA 3KVLA 4KKXA 4ZZ9A 4R7JA 4JXCA 4DF0A 1T96A 1BWLA 1W37A 3VKJA 1XXXA 1G69A 4D2JA 3NQGA 3W86A 5HMSA 1ME9A 2I1OA 2E68A 5F2MA 1Q3NA 1K3UA 2ZQ0A 4IX2A 1HG3A 3VE9A 4MVAA 2V2HA 1TQXA 4XTDA 3RK8A 3W2KA 4K38A 4FNPA 4UTWA 1Q6OA 4KWVA 1F05A 1FDYA 4O10A 3E9AA 1WOBA 5DELA 3L5LA 1TTJA 3NPXA 3F03K 5CGQA 1D3HA 4WXZA 1LRTA 1TMHA 5FF2A 3ELFA 3GNDA 3IV3A 1JCLA 3S42A 3I7RA 1WAUA 4Z1CA 4UTWC 3NAVA 1GVOA 5F4SA 3E02A 2NUYA 5D02A 3EKLA 4AWTA 2H90A 1I2PA 1WA3A 1I2OA 5EL1A 3KVMA 5T26A 1F76A 1ADOA 2WPBA 1TRDA 2Y6ZA 3UY8A 4CNPA 1H7RA 1QWGA 4DXVA 2X1UA 4QISA 4Q33A 3FYPA 3EX6A 2QCNA 3LHVA 4JICA 3L66A 1OYCA 4MOZA 3QEZA 3W1TA 1V7YA 2NV2A 2WSRA 5BRBA 1FWSA 3FKKA 3GXTA 4LVFA 4UFMA 4R34A 5D2XA 5EMUA 3UYCA 2NX3A 1THFD 1AW1A 1PS9A 4MFEA 3B0UX 3W87A 3ABRA 1B4KA 3A5VA 3P81A 4O57A 2Q8ZA 1OX6A 4JTTA 4HHPA 1MEIA 2TMDA 4TR9A 4K8EA 4KFOA 3GR8A 2A21A 4RXFA 1W0MA 3TU9A 3R5EA 4UNKA 3W7JA 3TDFA 1A5SA 4BWLA 1UUMA 2FB3A 2ZBTA 3C2RA 4LVGA 4H3DA 3O06A 4NZFA 1L6SA 2ZA3A 3TSMA 4LNYA 3HGSA 3W2JA 3HG4A 1JCXA 1I45A 1KA9F 2VFIA 3G0UA 3W2LA 4NNAA 5C2XA 4MJZA 2CLMA 1GVQA 2EPHA 4WD0A 2D73A 3ATYA 4FX6M 3LDVA 1EIXA 5FESA 2GQ9A 3PULA 4K37A 4OBTA 1H62A 1RPXA 2QCLA 4N6FA 1R2TA 1FY6A 2CZEA 1F74A 3P62A 2YDAA 3PM6A 2ISWA 4A3UA 1ZENA 3LTPA 2CWNA 1SZGA 1TPEA 1VZWA 1W3TA 4NT0A 3NQVA 2RDUA 1GG0A 1GEQA 3LCFA 1T8XA 4UIOA 5G1TA 3PY2A 1VS1A 4M7TA 1R47A 2HS6A 1IIGA 2Y61A 3SGZA 3A9IA 1LOSA 1YDOA 1ZALA 2X1SA 3SY5A 4JN6A 3L5AA 3DI0A 3G1FA 5I3FA 3TKFA 1SSDA 3B05A 3LXCA 3IIXA 3CQ0A 3W1XA 4GXMA 4K8HA 4LUJA 1P1XA 1HFBA 1FBAA 4AF0A 3TC6A 5HUOA 3LV5A 1S5TA 3G18A 1QDSA 4TO8A 3PWAA 5AYYA 1OFOA 2BZNA 2GJLA 2H3DA 2CLKA 3BARA 4AMAA 3HPSA 3PSVA 1WXJA 2CLLA 5I3IA 1UASA 2B4GA 3G1YA 3SGUA 5D09A 3DBPA 2DZVA 4YWIA 3TJLA 4Z0JA 4CQAA 1PCKA 2UV8G 2R8WA 4K6AA 3LCXA 1FCUA 3SZ8A 1K7FA 4E38A 3P5YA 1AK5A 4DQWA 3QYQA 4A21A 2OX1A 3GDTA 3CM4A 2I14A 2QCHA 1QOPA 2PRLA 1KTCA 1XBVA 1AW2A 3O15A 1SPQA 1XDLA 1Z44A 4JIQA 4MUZA 4E2DA 3LBCA 3P7YA 2V81A 3E0IA 3P8IA 2DZTA 4JTJA 2WO5A 1QPOA 3W7LA 3T78A 1LOQA 3QFEA 1MXSA 1OHLA 1TPB1 3STCA 3A21A 3G1HA 3WJZA 1FX6A 1KFEA 2WV8A 3CB8A 4BK9A 2O7SA 1W5OA 1KM4A 3S1UA 4NNBA 4PH6A 1VH7A 3BG9A 1AL7A 3HBLA 2TSYA 1W3IA 2NX9A 4YLWA 3PC0A 1RZMA 3FOKA 4JGDA 4JY9A 3W72A 3G0SA 3WJXA 1KM6A 3DKJA 3O05A 2OMAA 1TJPA 1WBHA 1ME8A 3FFSA 4UFHA 4LVDA 1GTEA 2E1DA 4UTUA 2VFDA 4JTLA 1GT8A 1QCWA 4MYXA 3IEBA 5EA9A 1W5MA 5FF3A 4Z1BA 3DHFA 4DPQA 1EWDA 1XBXA 1A5CA 5D33A 2ZZ4A 3MP5A 3PB2A 3O63A 5DN1A 1YXYA 3W9ZA 3Q37A 3R13A 4OU1A 2YYTA 2ZRYA 4AH7A 5CPNA 1TB3A 2B7PA 1PL9A 4Y9AA 2G95A 2J9YA 3QJAA 3GAKA 4CNOA 3EX2A 1GQNA 3CEUA 2RHGA 2QCCA 5G1YA 2G5WA 1LLWA 3CU2A 1JUBA 3STEA 1YXDA 4XKYA 3ZR4A 3N73A 3QSTA 3QZEA 2QJHA 3BW4A 1BTMA 3BPWA 5L6UA 5H91A 1SO4A 1MEWA 5BMXA 4O19A 2E6FA 5G2IA 1UBSA 2EHHA 3NQDA 1ZY9A 3SW6A 4IOTA 4CLMA 2J6XA 4FNUA 4W9TA 2C19A 1RQEA 3KX6A 3HO8A 4ML9A 3U2OA 3W76A 5K9CA 3W7DA 1DJQA 1EPXA 2V5BA 4GE8A 4FX8A 3W7CA 4UR7A 3NEVA 1PIIA 4DF1A 4BR1A 4WXYA 4OV9A 3TSBA 3NPVA 1KM0A 1F6PA 2ISVA 3LXAA 2E6YA 3DAQA 3HB9A 3TW6A 1R30A 1MZHA 4NXSA 3UWYA 3OIXA 4NU7A 3UPWA 4EOUA 4YL2A 4M5PA 5ABTA 2BLEA 2E5DA 3HG3A 3NM1A 4ZQMA 1KM3A 4MZ1A 4XWUA 1KTNA 3GK0A 1Y0EA 4O1BA 2P0OA 1VLIA 4UFKA 1SUXA 3W7OA 3CWNA 1O5XA 1T0OA 2OJPA 3TJXA 3EEGA 3B0VC 4MLRA 3RLUA 3GVGA 5CSSA 3D0CA 3N3MA 1DV7A 2P10A 2NXGA 3W7QA 4UFIA 4RX0A 1EB3A 1W54A 3E12A 1XCFA 1ZCOA 3CWOX 3B4UA 5LNRA 3HQ1A 3C52A 4IGHA 1VPXA 1YTEA 4X2RA 4ADTA 2C14A 2F7FA 2RH9A 4M6VA 2XN1A 4LWWA 1Z48A 5MHBA 3W22A 3TA6A 3VFLA 4N9BA 3W7EA 1LORA 2VEKA 2DJXA 4FXSA 1UUOA 3CPRA 3DFQA 4XZ9A 1VR6A 5C55A 2GVGA 3IGUA 5GVJA 4O4VA 3UNDA 3FJ6A 2C18A 1TPWA 1FCVA 3CEPA 3B0PA 2LLEA 3EXTA 5FF4A 4O15A 5FEZA 5CZTA 1KM2A 1GTHA 2X30A 3TE9A 4I9AA 2EAWA 1SO3A 2QAPA 4RZ5A 4Y96A 3NOEA 3M1ZA 4FB7A 1ALDA 3CT7A 3TC7A 3C2OA 2DJLA 1H61A 5D2VA 3GKFA 2DP3A 1EUNA 2PURA 3EX4A 3TK7A 4QQ3A 1EX5A 1KM5A 3O1NA 1XBZA 3L65A 5AHFA 2VELA 3M47A 1OFAA 3T7VA 1LRQA 1TPH1 3W1AA 3S1VA 2A4AA 3TQKA 1X8FA 2YW4A 3IVTA 2WQPA 4O0ZA 3RNDA 1CI1A 3RF9A 2HSAA 4JD4A 3S1WA 5J5RA 2CLIA 3GAYA 1K8XA 4OGZA 3S5OA 3HPZA 5SWUA 1LYXA 1QO2A 4JTUA 3DFOA 4BI5A 1QAPA 1X1OA 3LRMA 4UTTA 3LLFA 3PBWA 2X2GA 4LC8A 1Q6LA 4JYFA 4LS1A 4P61A 4N4PA 2WSYA 4LRSA 4MYAA 1F7BA 2GQAA 2YCEA 3M41A 5EKYA 3VI2A 4UFJA 2QUTA 3M16A 3W70A 3TFCA 5TIMA 3MI3A 1LBMA 2J24A 4UTTC 2A2IA 5DCBA 1NAL1 1VYSX 3MYOA 2ISSA 3HG2A 1RD5A 1PHQA 4HKPA 4NX0A 1SSGA 5DY2A 1OYBA 1OABA 1X7FA 1GJPA 2FQIA 3GXNA 1HO1A 4PCFA 3GDLA 4FXRA 4MY9A 4PTNA 3LI1A 3C6CA 2YZRA 5BMWA 2VFGA 4HSOA 3GNNA 4O14A 4IPIA 4YXGA 4OQVA 3TMLA 3MO7A 3LHTA 3G0XA 3BVJA 2GQ8A 4LV4A 3MP3A 2A6LA 2WKJA 5L9FA 3BV4A 3S1XA 3MHGA 1VC4A 1TV5A 1HL2A 3IVSA 4LS2A 1S5VA 1OFQA 2QCFA 3TAKA 4I7WA 1KLZA 3QH2A 4AEOA 2TYSA 2R91A 3BGJA 4NJIA 2AGKA 1BWKA 4UUIA 4FO4A 2GOUA 3KRSA 3S0CA 2J9XA 2WNZA 4MPQA 1OG0A 3P80A 5HQEA 2CU0A 1GG1A 4RZ6A 2E6AA 1JQXA 3ZWSA 4AXKA 1FWRA 3MI6A 1G7UA 3NL2A 1ML1A 4O11A 3LV6A 1LBLA 4O16A 2E77A 7TIMA 2E6DA 1J5TA 5CKSA 1P0KA 3NO5A 3N2MA 3T4CA 1GZGA 4O54A 1SO6A 1ZAJA 3NPWA 4FF7A 5LNWA 4O53A 4FIQA 3S5YA 5HR6A 5LNUA 2TRSA 4XTIA 4AWUA 1WDWA 4HSNA 4UXDA 3OHIA 1HTIA 4KWWA 3QPZA 3W23A 3PAJA 1LTDA 3SIZA 4J9JA 3H53A 4UTMA 5K2ZA 1IXPA 3W7IA 3OVRA 4FEZA 3G3MA 5HWMA 2O7QA 2FLIA 4RLIA 2A0NA 3NQMA 1TYGA 1DHPA 5D32A 5KZMA 3ZWTA 3QM3A 3ATZA 4GUHA 1L9WA 4IPJA 4MZ8A 3NZRA 2A7NA 4GFSA 3KAOA 4NJKA 3W1MA 3QMTA 4O18A 4K7VA 4QSHA 2QCDB 2CLEA 2ATSA 1XC4A 2VC6A 1D9EA 4JTSA 3PUOA 1P5BA 1KM1A 4OWGA 5E1QA 3NQ7A 1B4EA 3C61A 2E5BA 3O16A 3MYPA 4CCDA 2YFNA 4DBEA 4MIMA 3N2XA 1I2QA 2V2CA 3C2FA 1H5YA 2CFFA 3FA5A 4K36A 4GJ1A 4Y6GA 1SZEA 4ADSA 1G4SA 1TTQA 3KVKA 5I3HA 3GR7A 1FDJA 4FX7A 3G1SA 1TV8A 3P61A 2YX0A 2AQWA 4ZQNA 4QITA 2X1TA 2Z2UA 4MFDA 1YXCA 1H7WA 4WOZA 4L4LA 1VGAA 5A5WA 1NSJA 3TCEA 1TQJA 3WFAA 5KINA 4ZQRA 2E5CA 2A7RA 1WOAA 4MKNA 3EWXA 5CG7A 2WJZA 4NJHA 5DBUA 4JIPA 4PFMA 4BI6A 1ME7A 2C3ZA 3LX9A 5EBUA 3DZ1A 2H8ZA 3M0ZA 5AYXA 1YLVA 3GB6A 2Z6IA 4IXHA 1F5ZA 3V1PA 1M7OA 2QUUA 3ANYA 1LCOA 3P8JA 1TJRA 1A53A 2NUXA 3PF3A 3L9CA 2ZRWA 1RV8A 2ZZ3A 3C2EA 4UTJA 1M7PA 1I2NA 1OJXA 3GIYA 3THQA 4ADUA 5CZJA 1R46A 3HG5A 4O12A 1FUYA 1O5KA 5F4XA 3LTYA 3BGGA 3CC1A 1G6CA 2ZRXA 1RQBA 5K7JA 5DXYA 2V5LA 3NGJA 3PSWA 3W2UA 3BW3A 4IUOA 4MLJA 1H51A 4O17A 4O50A 5EPDA 3S5ZA
chains in the Genus database with same CATH superfamily
3B0YA 3JS3A 1F3EA 1UWQA 3BURA 4DYJA 4ERGA 4MY1A 3AISA 4UMAA 1TWWA 1GVSA 2YDSA 3VIIA 4GPNA 2CW6A 1OK6A 3LM7A 2F6KA 3JRKA 3LG3A 1RCXB 2EKCA 3A4XA 2J7BA 2GVLA 2O4MA 4AZ5A 4JFSA 1ZPTA 3DESA 1DJXA 1NWRA 3ITVA 4G6CA 3SQLA 2FFCA 3AMDA 3S8HA 5JMUA 2QIWA 5D38A 1UD5A 4GH1A 3WBWA 2QDDA 5LXXA 3LHYA 2GL5A 3DFTA 5C2GA 1W1ZA 4FNRA 1IR2A 1PWLA 2V3GA 3LQGA 5EMKA 1DTUA 4HMDA 1K9EA 2PLJA 2PE4A 4E2OA 4A2SA 1UIOA 2FFIA 3S2LA 1FWAC 3M0IA 3TWAA 1R3QA 4PB4A 2J13A 5TAOA 3W1LA 2R6OA 4R3UA 4B91A 3WQ8A 5HQLA 3G1XA 4UMBA 1GQIA 3QC0A 2QPUA 1ZAIA 1CB7B 3W7PA 1XYFA 1A5LC 4GVHA 1OY0A 3WFZA 1TJ1A 2ASHA 2QV5A 4UTIA 3WEMA 1JRCA 4XIAA 1UQYA 1EJXC 3HN3A 4MKVA 3L4TA 3BZGA 3JR2A 2VP8A 4W7UA 3TUUA 4ENLA 3PG9A 3BTNA 1FFQA 4PEKA 3V0TA 2ABAA 1ZBCA 1MVYA 4OIFA 3NUKA 5HAOA 3SN0A 4JTGA 3N2CA 4N2YA 2W66A 3W82A 3W84A 4RZBA 3ITOA 3OVQA 5BXPA 1CYGA 1XUUA 4O0QA 1OX5A 3QV6A 1OINA 4H04A 4Q7IA 1A5MC 3BMXA 1ECEA 3WUFA 4GCAA 1XCXA 3QSRA 3PTMA 5DFAA 3SO7A 1H1ZA 1ICSA 1S2TA 4RK8A 1VBGA 1Y5VA 2GSJA 2FHBA 3QPYA 4PGLA 2FZNA 3TR2A 1RBAA 3MMWA 4HN4A 3TWBA 3VGEA 3WEZA 1EL3A 1C7SA 1U1JA 2EGZA 3AXMA 4QE5A 4W5UA 2ZE0A 1GOIA 2FVLA 1JL8A 4BQ3A 1HXJA 3WQCA 5HNNA 3VDCA 1KGUA 3EMQA 3VPLA 1O4UA 3TYZA 3LA4A 4FHAA 4B5WA 2C7FA 2Y7EA 4ORMA 4Y9NA 1GCYA 4I5UA 4ZXLA 4YVXA 3VNZA 3GLCA 4H8VA 6PTDA 4DI8A 4L5ZA 2QNEA 1K7XA 1P0DA 4KIEA 1EJRC 1KRMA 4NJJA 4C5ZA 2Z24A 5HJLA 2IXUA 2E1WA 3B06A 1E0UA 2F2HA 2OG9A 4O28A 4IP4A 2AQVA 2PRMA 4ZE5A 3GBEA 3GW3A 1XUZA 2DW7A 3PBUA 4HGXA 5K4XA 4PUJA 3MP4A 5D05A 3IJ6A 2I9EA 4KCVA 4ZTXA 3NXFA 3RRXA 1WKEA 1CLXA 4PMZA 2QT3A 3W75A 5HPOA 4EXQA 4WY0A 1O95A 5CEWA 3AS3A 3PG8A 3GNPA 4QJ1A 5G5IA 4JS3A 4GZIA 3LPGA 1XI3A 5KTLA 1XFCA 2V5KA 1VCFA 3LOTA 2CLFA 2GGIA 4TMCA 2Z4GA 3FY1A 3BW2A 3BAJA 3I68A 2W6RA 4JTQA 1MWOA 1LQ0A 1OX4B 1QUMA 3IIZA 2CESA 1HUVA 3ORWA 1DBTA 4AIUA 2F84A 1WDSA 3E38A 1UPMB 4IGNA 2IQTA 2QJNA 2CHOA 4A4AA 2FTYA 5ABFB 4S1FA 3WDPP 3CZGA 4D6EA 5I3KA 4Q4QA 3K46A 4WK9A 3FSTA 4UOQA 3E0FA 1K8ZA 3NYZA 2XFRA 3NQ2A 4DBDA 5LNSA 1FXPA 1QOQA 3QR3A 1E73M 1T6MA 1V3JA 1L6YA 2CYGA 4XAGA 2J78A 4F3HA 3R79A 5DLCA 1NWUA 3TROA 3GZ3A 2VOMA 3TTQA 1BF2A 5BOOA 2ALDA 3M9YA 3SCRA 2E7FA 3PUDA 2IMRA 1D3GA 1DWJM 1FHUA 1PV8A 1CX9A 2PDFA 2Y89A 4NI8A 4A05A 3RMJA 4GOAA 9XIAA 4QS6A 4WX2A 3W3OA 3SY8A 4AMCA 1T7LA 5DMLA 1XV8A 2WPGA 3R12A 3LCLA 3T07A 4E2VA 3GQYA 2EEXA 3EB2A 1JPIA 3SECA 1OIMA 4H6RA 3TW7A 4ZL1A 4RL3A 1A5OC 1RSCA 1A4LA 4NZ5A 2Y8KA 3KHJA 5F2LA 1KFWA 5D30A 4XBKA 1AFSA 3VZXA 4MNKA 2QCDA 4B2DD 3OBEA 4XZBA 1QK0A 4NZ4A 2YW3A 4S23A 1V0MA 3KLKA 1G4TA 3FW6A 1WDQA 1UP0A 1K02A 3QF0A 2QS8A 3N4FA 3H12A 4W5ZA 1U83A 2VC5A 4DF2A 4EP8C 1XLDA 3CLWA 5JUVA 4CD5A 4RXGA 1Q65A 4GCXA 3CUXA 1VFSA 3H22A 3CIWA 3SI9A 1R7AA 1QNOA 4GBUA 5AVNA 3QGAC 2QCEA 1TR9A 3EKZA 5CGTA 2IPWA 1BG4A 3PBVA 1V8EA 1FOBA 4L80A 1E9IA 1GOWA 2XVGA 3MHFA 3T05A 2EPMX 4WEVX 3DGRA 2V38A 4RV8A 3V35A 4HPJA 2ZVRA 3VILA 4ZB2A 4I90A 4PMUA 2PTWA 3FEQA 2FYMA 4QAIA 1A3XA 4PTWA 1W31A 5HNRA 1RP8A 4LB4A 5D8WA 4LTSA 4M51A 3IUDA 4PRTA 3DBNA 1EIBA 3TJ4A 2P3ZA 1LWJA 3VMPA 3UZ5A 1E6NA 1S46A 2BVTA 1Q85A 4JR5A 1KBKA 3GFYA 1DJYA 1TE6A 3TQ0A 2PF0A 2NVAA 4NZCA 5LA2A 3LXBA 3QHOA 3UG5A 3VXGA 1CXLA 3VZYA 3G1VA 3SB0A 2PAJA 5C9WA 5M3WA 1YMYA 3C0LA 1Q7QA 3EWYA 3CS2A 2J7EA 4DIAA 2QR6A 4RE3A 4YCOA 3M0HA 3VGHA 2PBGA 2WVSA 1FWWA 5IM51 2GVYA 3E2QA 2YL8A 3NZPA 1OSEA 1J18A 3E2RA 3LBMA 2J8TA 2W9MA 4J5NA 3W1QA 5EMYA 2H3BA 3QN3A 2FHFA 3KDNA 3CUJA 1M53A 3L5MA 3TN4A 1NVMA 4Q4RA 4LOCA 1S3HA 3G6MA 4IX0A 3A4JA 1J5SA 1XL9A 2A6NA 2BSLA 3H8AA 1RA5A 3P5ZA 3WZ0E 3JUGA 2QDEA 1V93A 1V3MA 2Z1WA 3NA8A 4PL2A 5DRIA 3SADA 3H2CA 1XDJA 2ZUUA 5IXEA 2HTMA 4HIBA 4W8LA 2HNHA 2ZA2A 1Q6EA 2Y2WA 3GH5A 4KRTA 5A2CA 5AHEA 4IXXA 2UWFA 2EPOA 1X7IA 3W73A 3I4KA 1GVRA 2XHYA 3O2LA 4UC5A 4XB3A 2ZADA 3MJMA 5A6BA 3R25A 1LLZA 1AW5A 4JBRA 4FNTA 3GDRA 1Z6KA 3M64A 2INFA 1SW7A 2CLOA 4WSHA 4M82A 2ZDRA 5A3HA 4NF7A 4AD1A 3W07A 1UB3A 3S2JA 1ZAHA 3APYA 5REQB 3W88A 4B92A 3AICA 3M5VA 4R7OA 3L2IA 3WK3A 3AJ7A 1I9CB 2NSXA 1C8VA 4POCA 1W8SA 2E40A 4D8ZA 1TWSA 3KRBA 3B9EA 3WD4A 4E4PA 3C8FA 2XJ7A 4N02A 3PTDA 1UPPA 2PUZA 2XM2A 3EOOA 1W9DM 1ITCA 2ZRVA 1HVQA 3OBAA 1JCTA 4NX5A 3KTCA 3N12A 1REQA 4FLSA 1IXQA 4C1LA 4F66A 2HS8A 3W7RA 3AIRA 1AQFA 2VCBA 1U33A 1JCNA 2WMJA 1F9CA 3CB3A 1DKWA 3TH6A 2PP1A 3AXHA 3OYXA 4PRWA 4QM1A 3W85A 1PDZA 4QNWA 4MZYA 2X40A 3PBYA 3GG7A 3KWXA 4N9EA 1H11A 3Q58A 4Q4KA 4RNHA 3KBMA 3OTRA 1KKOA 5IFPA 2NLIA 3THDA 5JBDA 4EPKA 1PWMA 4AHQA 3VE7A 2HK1A 1N8WA 2YBVA 1JR1A 1WQ5A 4PCNA 4E2BA 5DCEA 4HA3A 4XD5A 2BY2A 1P43A 3GXMA 1PB0A 1H63A 2OQLA 2QIIA 1DOSA 1XLBA 2X16A 1R9ZA 2WK2A 1VLWA 4JDBA 2DORA 4XX6A 3TXZA 1DJNA 1XM3A 3MTWA 1QNSA 1J0ZA 4HZ8A 4MM1A 4IFOA 3GNOA 4TVDA 1NF0A 2NX1A 1TV3A 3MMUA 1QMLA 3L4WA 1V5XA 3RGTA 3N6QA 3SCVA 1FWNA 1Z7AA 3W1RA 1VQTA 4HPXA 2CZVA 5B7YA 1XS2A 4D6FA 3L4VA 2IKJA 2VVNA 2V68A 1FH7A 1SR9A 4W8AA 3DDMA 2NWSA 3L21A 3LCWA 1DVJA 4E3VA 3AQUA 3WQ4A 5LGXA 4XAFA 1VIWA 3VMNA 2QUNA 1JNEA 4PMYA 3KCJA 4S3BA 5IBXC 1A3HA 2CIPA 1GYLA 4LFYA 4QCEA 4V1YA 4Z1DA 1HKMA 3KRUA 4LALA 4HCDA 3BLOA 4AQLA 2PCEA 1ITQA 5A8PA 4KQNA 5A6KA 4ZO8A 4MHBA 3IARA 3MUZ1 2XIMA 4JFVA 1MFVA 1W1A1 1P4CA 3NO1A 2FTPA 3EB4A 2ZYFA 1JXKA 1LBFA 5A69A 2UY3A 1LROA 5H8PA 1SO5A 3H54A 3PPGA 4KT2A 2YB1A 5MKGB 1N8IA 5BOEA 3PUEA 4U3CA 4N9CA 4CCEA 1BFNA 2Y7GA 4DAFA 3C4UA 4PC8A 5FEWA 2BX7A 1L2QA 4X9YA 1DORA 4AZHA 1WUEA 1EF2A 3F7JA 3ZLHA 4JNYA 4UMCA 1G4PA 4J3XA 3U8GA 1UR2A 4LH8A 2I5IA 1NOFA 5CLTA 4AIBA 1HJSA 4Z1AA 5BU9A 1OT1A 1XRVA 2DZUA 2V0TA 5E0CA 5FJUA 4LYKA 4GUFA 1O60A 2HE8A 2IQDA 5HINA 3SQSA 4LCRA 3NQAA 2GGEA 3RM4A 1K7EA 4JTDA 4IT1A 3CZJA 2VM8A 1EKOA 2WM0A 4C91A 4RR4A 2VX4A 3FHQA 4DUVA 4CU8A 1EC9A 3L0KA 3ITGA 1FWHC 3AIQA 3S2CA 3G2GA 4IM4A 3V5FA 4LT9A 1OFBA 3FS2A 2NXIA 2W0UA 4PZVA 1W3HA 5J5DA 1ZQ5A 2OB3A 4X3ZA 7CGTA 4Z2IA 4NYUA 4DJDC 5HNTA 4GI8A 1TV2A 3WNOA 4RDZA 2ZZ6A 4I7UA 2OT0A 2AOSA 1JD7A 1A0EA 3KVLA 5XINA 4R7JA 4JXCA 3WMBA 1T96A 4J3ZA 3TTSA 4DF0A 3M4HA 2PDKA 1XXXA 1POKA 3H4XA 2DH3A 8XIAA 4AEFA 2D3NA 1KXTA 2CNCA 1FTXA 1ME9A 3MUIA 3D47A 1NDZA 1C9WA 1Q3NA 3NYDA 3NZGA 2BHUA 1B3WA 2XISA 4XTDA 3WH7A 3RK8A 3AAMA 1UR4A 4K38A 4MWAA 4OBSA 3NOYA 1F05A 4XD6A 3B8VA 1QOXA 5CGQA 1QI4A 2EXOA 2IXVA 4DJEC 5ABEA 1LRTA 1I1XA 3ELFA 1A3WA 3Q67A 1XSJA 4MNMA 1LQ2A 2JF6A 3S42A 1HJWA 1GHRA 4GMEA 4HP5A 1GVOA 2WMGA 1CXHA 3E02A 2H90A 3KVMA 5T26A 1F76A 1JDDA 2Y6ZA 3UY8A 1H7RA 1QWGA 4OVXA 5PTDA 3UVIA 2C91A 4JQ4A 4QISA 3SUUA 5AZ1A 1BXNA 4L4PA 1WKYA 4FMVA 3LHVA 3L66A 4MOZA 5M5DA 3W1TA 3FVDA 1RAKA 2NV2A 2CBJA 4XSMA 1V02A 3GU2A 5H8MA 4CCZA 2TODA 1AW1A 2YCJA 1CB2A 1H5VA 3BCJA 1B4KA 3A5VA 1ZBWA 1S2VA 3BJTA 3AU6A 1R3VA 3FDGA 4TR9A 3OOQA 4KFOA 2BODX 3TU9A 3W7JA 3TDFA 1UUMA 2FB3A 4NZFA 2ZA3A 3TSMA 4LNYA 2W3ZA 1JCXA 1KA9F 1NM9A 2VFIA 4NNAA 1JDEA 4FR1A 3WNPA 4YS1A 4WD0A 3ATYA 2FZMA 4KCTA 4OKDA 5FESA 3PTKA 4OBTA 1H62A 4QDMA 1L6GA 2QCLA 2QGHA 1F74A 3P62A 5HMFA 5CCZA 3PM6A 1CCWB 2ISWA 4H8UA 2JALA 1UD8A 4NT0A 1GG0A 1QRQA 4MB4A 4DJED 2DSWA 2DSVA 3PY2A 4M7TA 3U5UA 2HQAA 1IIGA 2Y61A 4F0RA 3A9IA 4DNHA 4G56A 4J27A 3UZXA 1P1MA 4FPSA 1R3WA 2PMQA 2AKZA 3KZSA 3L5AA 3DI0A 3TKFA 1SSDA 3B05A 2Q09A 3IIXA 3HTWA 4DUWA 1E6PA 3W1XA 3OYZA 1U1HA 4GXMA 1P1XA 2OOGA 3TC6A 3LV5A 1HJXA 1S5TA 3CUHA 3PWAA 1OFOA 3NZQA 1Q8AA 1CLKA 4HJWA 1WXJA 1J2BA 3MCMA 4DWSC 3EA3A 3SGUA 3P6LA 5D09A 2JEQA 3WD3A 4CQAA 3BLDA 1KCLA 3OP2A 2A3LA 3SZ8A 3KBWA 5JQ9A 3CV6A 3CBWA 3CZEA 3NDYA 3OGRA 3QYQA 4H9TA 2PEVA 2BXZA 2QCHA 2PODA 2OZTA 1KTCA 4BHYA 5AECA 1XBVA 2CKRA 1S2AA 3S2NA 2EPNA 4LUYA 3GY1A 3K8LA 3ZT7A 4X63A 1AH4A 2VD8A 2V81A 3P8IA 4GY1A 1ZU8A 4I9TA 4LJ3A 3U4FA 3TYDA 1BGAA 3LGDA 2V67A 1MXSA 4QHRA 4CQCA 2DW6A 1QHZA 4D72A 2QJJA 4FLOA 4A35A 4GG9A 3M07A 1ECQA 1YBQA 2Q6ZA 3SBFA 2OSWA 3VUSA 4NNBA 2XIQA 4PH6A 1VH7A 3BG9A 2BY3A 4K2SA 1XLHA 3TYCA 4HA1A 2ISFA 5EB8A 3PC0A 3RAOA 4CNUA 3FOKA 1WKDA 1Z89A 4HOXA 2V5DA 1T41A 4RNFA 1ME8A 3FFSA 5I03A 1GW9A 1EYEA 3RCMA 4ZO9A 2O9TA 2YCLB 4JN7A 1QCWA 1G5AA 4BF5A 1J79A 4Z1BA 4JPGA 4LAMA 1ZTVA 4HJFA 3V4BA 3R43A 2QXWA 3NIYA 3OU8A 2ALRA 3KBJA 5FOOA 1YXYA 4GO9A 3U2ZA 3W9ZA 4OU1A 3WUEA 4AC1X 4AH7A 1POJA 4UQAA 1TB3A 1LG1A 1PL9A 4UBPC 4Y9AA 4H9ZA 3QJAA 4C6OA 4M3PA 3IJIA 1R5YA 2GDVA 1LLWA 4H9MA 1JUBA 1B3XA 3EDDA 2REQB 3ZR4A 3QZEA 2V5CA 2QJHA 2VL4A 1BTMA 3BPWA 3MU7A 1TUXA 1A49A 5BMXA 2B81A 3LSCA 3SW6A 1UWAA 1YKWA 2Z28A 3UBPC 4JL1A 4FNUA 3PZOA 5CH9A 2C19A 4J7RA 4JEJA 4ML9A 3U2OA 3W76A 2V5BA 3TEVA 3W7CA 1W6TA 1YNQA 4BR1A 4OV9A 4LB3A 1UKSA 3VKKA 2J6VA 4PBFA 1HL9A 3BANA 2W5FA 4M5PA 5BWFA 3NM1A 2VC7A 4ZQMA 1KM3A 3SCSA 4UFKA 1QK2A 2IPFA 4UQBA 1O5XA 3TJXA 1BRLA 1C3FA 5ABFA 3J7HA 4MLRA 3WH6A 3B9AA 1J6OA 3W7QA 1EB3A 3BAWA 3E12A 3KS6A 1BKHA 5LNRA 3VNMA 1SM9A 2DIEA 4IGHA 1M01A 3MA8A 3TOPA 1AODA 1OC6A 2RH9A 3FXGA 3WF3A 4N9BA 2ACRA 2VEKA 4AX6A 3RX2A 2UBPC 2EQDA 3PZMA 3QKEA 3ARRA 3DFQA 3IGUA 4A8IA 4C6KA 3VO0A 1JZ7A 5I02A 1TPWA 4LBRA 1J11A 1FCVA 2F9RA 4NRRA 5FF4A 2R1NA 1E15A 3BH4A 1NP2A 3MVIA 5FEZA 2PDHA 1S2CA 3OO2A 3BLPX 3W6MA 3M1ZA 4PFHA 1EXBA 2MUCA 4URIA 3WUGA 3AHXA 3TC7A 4B5VA 3C2OA 1H61A 4YHGA 1EUNA 3SY1A 3H7UA 2DZAA 3E0VA 3B40A 4HU8A 1QXLA 3O1NA 5FACA 5A6MA 3E0WA 4FZIA 2HJPA 1X8FA 3WL1A 1T8QA 1TWDA 1PX3A 3RF9A 2HSAA 2VGFA 1UD3A 3L12A 4NAFA 3HA1A 2CLIA 5HDRA 3K5XA 3GAYA 4G9PA 4H6EA 4W93A 1UKTA 5SWUA 1LYXA 1QO2A 4JTUA 4HOZA 1QAPA 3CUGA 4OJYA 3PBWA 4PYSA 4LC8A 1RK6A 4LS1A 3HPFA 2WSYA 3M0JA 4LPCA 1S5MA 2YXOA 3L4UA 1Q8JA 3VI2A 4OBRA 4XKMA 3MI3A 2J24A 3VOJA 3Q65A 3VU2A 4R5EA 2ISSA 3GSMA 3HG2A 4ZCWA 4NX0A 4PSRA 4LAUA 2VZVA 4E5TA 3W01A 1X7FA 3GH7A 1GJPA 3BC9A 1Q7ZA 3F4CA 2J8FA 5LXEA 3S2MA 3GXNA 1A47A 1JAKA 3LI1A 3BLLA 3CHCA 3VABA 4YXGA 3H2FA 4OQVA 1TWIA 2CKSA 3LHTA 4WDTA 2GQ8A 4U5KA 3IJDA 3MP3A 2ZKMX 2WBKA 1I1WA 3MHGA 1VC4A 1FWIC 3IVSA 2GZXA 4LS2A 2QCFA 2R91A 3BGJA 4FO4A 1ESWA 2GOUA 3KRSA 3MSRA 2H9AB 2J9XA 1P7TB 1GG1A 3EDJA 3VOGA 1ML1A 4O11A 1R9YA 3W81A 5M2FX 7TIMA 5CKSA 1GPFA 2DVTA 4REQA 3BXWA 1GZGA 1AH0A 3KBVA 4O54A 4MDOA 3QZ6A 4WGHA 4CQDA 3OZYA 4UQEA 2Q02A 5HATA 4HU3A 1F07A 2HV5A 5HQMA 2BG5A 1VPQA 2OWCA 4D1JA 1V6UA 1W9BM 2Y0FA 1HTIA 2CBUA 1I0BA 3ERPA 3VA8A 3MS8A 4KGLA 3LLXA 1MW1A 2WHJA 1C8XA 2WNWA 3CT2A 3NFUA 4RW5A 2DQXA 2XWEA 4MG4A 3GE7A 4FEZA 2HDJA 2XIBA 4AUBA 3UJ2A 8CGTA 3NQMA 1PKNA 1DHPA 2W62A 4DLMA 4IPJA 3LZ5A 4YN5A 1VFLA 3NZRA 4IH3A 3W1MA 5EU9A 4K7VA 3WUBA 2CLEA 1QI0A 2ATSA 3Q45A 4D8AA 3FVMA 4JTSA 1A4MA 4QLJA 5E1QA 1BF6A 1B4EA 3P0WA 3RG6A 4GLEA 1GKPA 2AMGA 4RDYA 4CCDA 2YFNA 1UMYA 1I2QA 3C2FA 4WCJA 4K36A 2B31A 3TC3A 1UR3M 3GR7A 4FX7A 2HK0A 1OG6A 3GD6A 4PUKA 4FALA 1XIHA 1TA3B 5REQA 5T8GA 3CAVA 3AC0A 1H7WA 4L4LA 1VGAA 3AXIA 5A5WA 1NSJA 3U5YA 1JDCA 3PZ9A 3TCEA 1QU4A 2A7RA 1XINA 1WOAA 1D8CA 4L6OA 3IJ8A 4M29A 4PFMA 4BI6A 1ME7A 5KETA 5AYXA 3DFYA 4CU7A 2Z6IA 4Y9OA 1F5ZA 1Z32X 3V1PA 1M7OA 2QUUA 3EA1A 3WELA 5CBIA 1TJRA 2NUXA 3MKKA 1ODUA 2GGGA 4UTJA 2VGIA 3WQDA 3THQA 4BEUA 4ADUA 5JIPA 2DDXA 3WG6A 1FUYA 1RD6A 2O9OA 3BGGA 1G6CA 4B5XA 3TN5A 2PWGA 2XDFA 3NGJA 3PSWA 2NVCA 5CC3A 2I56A 4IUOA 4O17A 4O50A 3R6IA 1JZ5A 3BDKA 4AHPA 3VOFA 1VBUA 3CWHA 4PTXA 4G7EB 3RO8A 2RDWA 1Z8AA 2HCVA 2V3DA 2C13A 1EJVC 5DY3A 3VVGA 3ZJ7A 3VDAA 2RJGA 4LAZA 2GUYA 4N42A 4HB7A 4GYPC 4BQ2A 3NVTA 3KP0A 2D0HA 1EP2A 3DG3A 3CAQA 3GKAA 1V79A 2D23A 2AKMA 4H9VA 3DUGA 3VNDA 4A22A 4H7VA 3CQJA 2FPVA 5FI8A 1KC7A 1H60A 4JIEA 4ZODA 4WJEA 4A29A 4GQGA 3B8DA 5CXPA 3R0DA 4O0KA 4LVAA 2E25A 5E6YA 3VCRA 3ARPA 3VNKA 4J3TA 4C6IA 4UCFA 3K1DA 4M80A 1DWAM 1NFPA 3V36A 4F4RA 3KOXA 4AHOA 4DWSB 2OX4A 4Q8NA 2BDQA 3UWVA 1NF7A 2J88A 3E96A 1MNZA 3W7KA 3KOWA 2HVOA 1JCJA 2WCSA 3MCNA 1C8YA 3IS4A 1ICPA 3AJXA 4JHOA 3GWQA 3HQPA 2P53A 2GUUA 3AUJA 1D3CA 1GUVA 3PZGA 3LHZA 3IIPA 3FYOA 4CCCA 4U28A 3WNKA 2GJPA 3VIHA 3IRDA 1CBGA 4JL2A 2KZHA 3LBOA 3T0TA 4NASA 3NO3A 1EYWA 1IE7C 2XZ9A 3P82A 4WQ6A 1BPLB 3TNBA 1BLIA 3CIVA 1EZWA 2CLHA 1S1RA 2WKGA 3MZNA 4WIWA 4CNNA 1CECA 5KZEA 5LA0A 1CGVA 5A8GA 2R14A 4ML4A 3FEMA 1UKOA 4J40A 3WK1A 2XFYA 5A6BD 1F3WA 1QPQA 3DYPA 2JE8A 2OZ0A 2QQ6A 1ZUAX 4YWSA 4P8VA 3KXQA 1DQXA 1JJKA 2VEMA 3PZIA 1RCQA 3RXZA 2AAMA 5E0FA 4Q8UA 1J0IA 1TX0A 3CUZA 3C8NA 1A5UA 3C56A 4M56A 3W6LA 2BMBA 1MRQA 2DGAA 2YJQA 1CPUA 3V7PA 4MNJA 4MJ2A 2ACQA 3UR2A 5MKGA 2H6RA 4ATDA 4X60A 4LX4A 3IUIA 2WCGA 3SCNA 4AXNA 4Q4PA 1CXFA 1Y5WA 5CPOA 5GQBA 2OO6A 1TPVA 4S3KA 4M1BA 2QVNA 4I8YA 2GGJA 1EBGA 4E8CA 4PR4A 4GYKA 4L4MA 3SIMA 5E5CA 4KIRA 4EAMA 1PE1A 3KRZA 3NGFA 3U6WA 1OGBA 1W5NA 2HPMA 5FJOA 4QAWA 5CJNA 3CO8A 2CETA 2WZIA 2VQTA 4HPHA 2J7DA 1ZJIA 1JUKA 3WQFA 4E0CA 3QV8A 1SMAA 1VCVA 3MV01 3BAXA 1GWJA 2Y7DA 3O6AA 1I60A 3MZ2A 4JX5A 5K9DA 4KMQA 2X09A 1KKRA 3H26A 3QHMA 3CPUA 1LL4A 4XUGA 3UXDA 3CGTA 3PWGA 1RQHA 3JZEA 6ALDA 4NVTA 4F8XA 1Q45A 4EWND 1UZ4A 1MUMA 1MDLA 3W7HA 4QLKA 1QTWA 2QMJA 4D6IA 1H7PA 1JEZA 4YTQA 1K8CA 2Z2BA 5D03A 4C6FA 3GBDA 2QKFA 5GPRA 3NQEA 1O68A 4HNNA 5I2UA 3V3WA 2VWTA 4F2BA 3TW9A 3BJFA 2PWFA 3EWBX 1LQAA 3WF0A 1SZFA 2IS7A 4HMCA 4WY0F 3LCIA 5A6TC 1DXIA 3LI0A 5HJXA 1KV5A 7ODCA 3R8RA 1ICQA 1XWYA 1M7XA 1YADA 3RR1A 2RDTA 1JYNA 1N7KA 6TIMA 4EK7A 4YYFA 5DBTA 3T2OA 5BW6A 1JGIA 4ZO7A 1E0VA 3O0FA 3ARXA 1KRAC 2HVNA 5I23A 1W1TA 4GI6A 4EE9A 4S2BA 5KZ6A 3T8QA 4NG3A 1VP5A 4JEQA 3W02A 3E2SA 3RUBL 1VKFA 3W24A 1XIBA 3ARUA 2VI0A 4IHCA 3L7RA 2PFHA 1G4EA 2IUZA 1PTAA 3CASA 1JZ3A 1LRNA 2Y1HA 2EPKX 1DP0A 2VZUA 3E2VA 1XX1A 4GYJA 1JFXA 2QJMA 2PWUA 1RP9A 1SR0A 4HTYA 2EKGA 4LAKA 4YPJA 3W25A 1ISWA 1F6KA 3I3EA 4GH3A 1WZAA 1E3ZA 4AW7A 5KITA 4RZ4A 1OYAA 3K30A 2E09A 1FCBA 5I3DA 5AYZA 1LZOA 5C9UA 1SJAA 1LG2A 3KFTA 4H1ZA 1K4GA 3AIUA 3MY9A 3EDKA 2VHLA 1CDGA 1AD4A 2PRHA 3VNYA 5AKQA 5LIUX 1EC8A 3ZR6A 2NV1A 1XR2A 1H09A 1UD2A 3W28A 3QGKC 3CAKA 3I65A 4QGCA 1F2JA 5CPLA 4FNQA 3T81A 1VBJA 2ZOXA 5F1UA 3R94A 2D0GA 2DUZA 4PMXA 3REQB 5FJTA 4L9YA 1VFOA 2PGRA 3AOFA 3L67A 4OV4A 1JQVA 1C7TA 1A5BA 1EJ7L 2Z29A 3NQCA 3JZUA 4GNJA 2PC8A 3AYSA 3F2CA 3N2BA 1S38A 1OBAA 3GHRA 1KLYA 2R9RA 3B8IA 1OK4A 2J27A 1AJ2A 3T44A 1R85A 2VEPA 1J4EA 1WV2A 1G7VA 2FZ8A 9RUBA 2POTA 3I6RA 1TFVA 4IQLA 4X0VA 4LS0A 3BAYA 3S83A 1ZFJA 3H24A 3G3DA 5I06A 3LNMA 3L68A 4JHZA 1GPWA 1MQPA 3TN6A 1W9PA 1TX2A 2EO7A 4GC4A 1SJCA 1B9ZA 4EANA 5CG0A 1HKWA 3ABSA 4GI9A 3GU9A 3C2VA 5AC6A 4FK9A 3F4DA 3O8AA 3OIHA 4GWEA 4PUDA 1XFBA 5C9RA 4WKHA 4NNCA 4HVXA 5K9XA 2RFGA 2Y4SA 5T91A 1S2UA 2A3AA 3VCNA 1TV4A 1GGOA 3G24A 4HNVA 4PUUA 3WY1A 3IACA 1JXJA 2L5HA 2F61A 3SCUA 2BWGA 1QJWA 4QDPA 2W27A 3ABOA 1FDZA 1MMFA 1Q66A 4UFLA 1DXFA 2NLYA 3STGA 3WNMA 2W79A 5HOSA 3NVDA 2AL2B 4KEUA 4TXEA 3FJLA 4C65A 1YQ2A 4IICA 3AUOA 1MI3A 2D2JA 3MBDA 1AZ2A 4MWAD 3TYBA 4XBJA 1QNVA 2GLKA 4ZTYA 5CGMA 1PVNA 3UA4A 2PDXA 1M3UA 1UOKA 1C93A 3V18A 1AL8A 1DYSA 2FB2A 3G8RA 4IZGA 2NV9A 2OYMA 3CMGA 1H7NA 2C0HA 1XIEA 1WB0A 3CTTA 1AUSL 4AZGA 1YE6A 5AC7A 3QW4B 4DYKA 3O9NA 1EBHA 4O1AA 4MDPA 1H7OA 1C91A 1I6NA 1XIFA 4DO5A 4IL0A 1HKJA 1FCQA 1H7XA 3L4ZA 3PS7A 3KOYA 3MSYA 3DFSA 3LLDA 4PMOA 4WDXA 4AG0A 4CU6A 3N9RA 1WYIA 3NZ1A 2DT0A 2W92A 4LY8A 1IR1A 2VYOA 4HZ6A 2F6XA 2FJUB 5HWNA 4GINA 2AQOA 2VNCA 2FKPA 5CLWA 3MSGA 3KVJA 3NSXA 1GOMA 3K1GA 2VCCA 2Q3RA 3GC4A 3I6TA 2ODOA 5FCZA 3N9SA 1MW2A 2VRJA 4JX6A 3DFNA 1AMKA 1RCOB 5LNVA 3FV9A 4KRUA 3OEXA 1SFTA 1OFRA 4AU0A 2G8ZA 1A80A 3RU8X 1KTBA 1XKYA 3DERA 5GNZA 1SVDA 1KGXA 4IJRA 5CSRA 4IJBA 7PTDA 1JAEA 1QATA 2G4FA 4BFAA 3S5NA 3KOZA 4PL1A 1FHVA 3V5CA 4AISA 3QBUA 2ACUA 2F38A 3HFTA 4ZQCA 1GZJA 1JG9A 2DIKA 1DHKA 3DU0A 3WK2A 3WMCA 1DIKA 4WSJA 2VDHA 4ZVJA 1GOOA 1WXYA 1EOKA 2JKPA 1BXCA 2VMFA 3VTRA 1JULA 1G0CA 1B90A 5FL1A 1JCMP 3OBKA 4CD4A 4ACZB 3QMRA 3SFWA 3INPA 2GDUA 4M6UA 1IGWA 5E0KA 2V9DA 5LKYA 5D9MA 3AIWA 3UXIA 2VEGA 5A6JA 4GO8A 4XD3A 4LUTB 5CJ5A 1UR1A 5H8UA 2ATMA 4TX9A 4D1IA 3MC5A 1TTIA 4XUYA 4XVDA 2G37A 3GIPA 1Z41A 4D6HA 4C6CA 1QI2A 4C6BA 2Z1BA 4DLFA 1EF3A 2W91A 3HGOA 4EF9A 4WUIA 3R8HA 1CGWA 5HXMA 3MVTA 4HMEA 3GYEA 5G2WA 1IGSA 4MF4A 3VINA 1ZJBA 5CJMA 4DBWA 4FNSA 1OD0A 1AG1O 3XISA 4IIFA 5CZSA 5IOBA 4C90A 5IBXA 1YPXA 3E49A 3HV9A 5FA5A 4TTUA 1F73A 4W7WA 3H4GA 3TQVA 3AMKA 1KBIA 2RGLA 3WLSA 1EHAA 1O1ZA 3LMYA 2RKXA 4I8DA 1Q6RA 3CO4A 1U5VA 1NFBA 3KLLA 5LHFA 3IRSA 3C3UA 1US3A 2C71A 2G97A 4NP7A 2A3HA 4H8HA 2DIJA 3VGGA 1QPNA 4HPGA 4DXXA 2E8YA 3LGEA 1JGMA 3M46A 3ZXWA 1QHPA 4JYDA 4AC7C 4RV3A 1LOLA 5HULA 2NQ5A 1M41A 1W3KA 3SRHA 4AB4A 3TAOA 2GUBA 2IKIA 3GFZA 2DZSA 3AS1A 1CW2A 1KV8A 5KZDA 3W7MA 4IL2A 2PWHA 6XIMA 2QJGA 1QNRA 1E6XM 4DO4A 3IJQA 4S38A 5J8LA 3OGVA 3MV11 1UG6A 5G4WA 4R88A 1IT7A 1KWGA 4XV0A 2YB4A 4XBSA 3WD2A 4DZ5A 3RIKA 4KFNA 3OZMA 1Z69A 2BFGA 2H9AA 2V6AA 2O55A 3UWWA 4DXKA 3CV1A 3W27A 1P7TA 1TO3A 1WBJA 1D7FA 3E0LA 5U7SA 1AQMA 5I3GA 3THUA 4C1KA 6TAAA 3WCZA 1GVEA 1R8LA 5EMJA 1KFLA 1S39A 2V8ZA 4DJDA 1SFJA 4P7NA 4ZXOA 1OB0A 3GU1A 4DWDA 3M7SA 3BAIA 2C1HA 4R33A 1AVAA 3NPUA 3LEPA 4IFKB 1HO4A 4LUSB 1XG4A 1OCBA 4BS0A 2GSEA 2WMIB 1JPHA 3G22A 4LYRA 3M43A 2Q01A 3N1AA 1G01A 3V0SA 3CHEA 2VVSA 4R27A 1DQUA 4HNCA 1TPDA 4ZZ9A 2NQZA 1QT1A 1XLAA 3WLRA 1W37A 2XUCA 4JIRA 3VKJA 1MRAA 4D2JA 1O6IA 3W86A 3EOEA 3WSUA 3IGHX 2OGJA 1MXGA 1W1VA 4AZ7A 4E8DA 2I1OA 1DIEA 3ARVA 4O1FA 2E68A 5F2MA 1K3UA 4R85A 4GQQA 4Q22A 1E1EA 2UY2A 2FGZA 1XISA 4Q4OA 3VE9A 3RLGA 2G3NA 1J0KA 1QNPA 3BSGA 2OSXA 2XM1A 2CXEA 4FNPA 1Q6OA 1HKIA 1E0XA 1FDYA 3E9AA 1AZ1A 2V3EA 5C9ZA 3L5LA 1F8MA 1OM0A 3B97A 1TTJA 4A3RA 3AZRA 1E72M 5FF2A 5LIKX 4UTWC 1TA3A 3NQBA 3NAVA 4F0SA 5D02A 3EKLA 2QV4A 4XAYA 4AWTA 4E8GA 1WA3A 4GVIA 5EL1A 3CZLA 4W88A 2WPBA 1TRDA 1D2KA 3KCLA 4CNPA 3KL3A 1DE6A 4Q33A 3R0UA 4PUNA 2DZBA 1IZCA 3QEZA 3RX3A 3ZR5A 3PWIA 1V7YA 3F5LA 3RCYA 4UR9A 5BRBA 1FWSA 1LT7A 3GXTA 3MKCA 4R34A 1FWBC 4PCTA 4ATWA 1LJYA 1PS9A 4AEEA 3ZQ9A 3B0UX 3FK4A 4PUEA 4ICMA 4KS0A 2OR2A 4TQTA 3PTQA 3UJEA 1X96A 5IDIA 5IDZA 4FLQA 1R38A 3GR8A 1OT2A 4DAIA 1OGGA 4UNKA 3QVQA 4BWLA 2ZBTA 2RDXA 3C2RA 4LVGA 5LIYX 3M6DA 3G0UA 2WMKA 4G7EA 2EPLX 4PMNA 2FH8A 4GIRA 1GVQA 1V6WA 2D73A 3WQOA 3LDVA 4D6CA 2GQ9A 3PULA 4KBXA 3K2GA 1PIFA 2DVXA 4N6FA 2QMKA 4A3UA 1ZENA 3LTPA 2OELA 1VZWA 1PBGA 4MWAE 3NQVA 1GKRA 1XRSA 4AY8A 1T8XA 4UIOA 1BYCA 1XHGA 4EKJA 3AS0A 4W85A 1JYWA 2MNRA 1V03A 1NH6A 3SGZA 4NAEB 4M1RA 1LOSA 1QASA 3HZ3A 1NARA 1YDOA 2X1SA 2WWCA 4JN6A 5EMLA 4YVPA 2YIHA 4V28A 1TE1A 3LPOA 3T08A 3GTXA 2PLCA 1CENA 1ISZA 3CQ0A 4DWSA 1E9ZB 4W4QA 4LUJA 1WPCA 2FZ9A 1NDVA 4LQ1A 1J0JA 2XGBA 3QY6A 1HKVA 1V02E 4YWIA 4OUEA 3DG7A 1PCKA 3LU2A 1CGTA 4US5A 1FCUA 5EBAA 1XSKA 4E38A 1AK5A 4DQWA 4A21A 2OX1A 3CM4A 1QPKA 8RUCA 2ACSA 4J28A 2YA1A 3VUPA 3S4TA 2PDGA 4R9OA 1A5KC 1OCQA 2HBXA 2UZ9A 2YL9A 3WBEA 4HHHA 1Z44A 3D6NA 3IJ9A 2FGLA 2WZEA 3N04A 3WMSA 4A8LA 1LOQA 3QFEA 3AS2A 2VRQA 1LL6A 1TPB1 1OWQA 3LY0A 4NILA 2ON3A 3A21A 3C86A 1VPYA 4CEUC 1R0MA 2O7SA 4H9YA 3SQMA 4QXIA 1W9VA 1CWYA 3QLDA 4HYRA 2NX9A 4Q7NA 4ZSUA 4DX3A 1V6VA 1KGWA 3WJXA 3DKJA 2OMAA 4F79A 1X38A 4UFHA 2DV0A 2W67A 4PB5A 4UTUA 4JCLA 3UEQA 3RR4A 1GT8A 1ONEA 3L23A 3IEBA 4NY2A 5A6LA 2BB0A 1KBBA 3DHFA 1WXZA 3VIJA 3VDBA 2XGZA 1EWDA 1YNPA 1YIXA 2ZZ4A 2YBUA 4ZENA 1PZ1A 3PB2A 4WR3A 3O63A 4GZ7A 5DN1A 4NKCA 2ZRYA 1V08A 3WQEA 2A3CA 2DUAA 2DSZA 4CNOA 4QRNA 3UA3A 3EX2A 3GDBA 4QDWA 2QCCA 3CU2A 1YXDA 4BQ4A 2NVDA 5C9XA 3N73A 1P6WA 4C6PA 4HZMA 3QSTA 3BW4A 1VFUA 5L6UA 5H91A 3B8WA 4QQUA 1SO4A 4U3AA 1ZBVA 4O19A 4G2DA 3H2EA 1ZY9A 4IOTA 1WZMA 3QQWA 3VIKA 3AMGA 3KUMA 5DMNA 3ZZ1A 4KERA 1DJQA 3NEVA 1PIIA 4DF1A 1MDRA 4WXYA 1OQFA 1XLLA 1Y5XA 2WZHA 3MWCA 4GQRA 2YCKX 1KM0A 1F6PA 2E6YA 2CHNA 3S9IA 3HB9A 1HKKA 1PUDA 1JZ8A 4NU7A 1P6CA 5ABTA 3R58A 2BLEA 2E5DA 3HG3A 5E9XA 5GJMA 1KTNA 3GK0A 1RK5A 4O1BA 1HGYA 1LWIA 3OJGA 3B0VC 3RLUA 5CSSA 3N3MA 3G5EA 2RJHA 3WF4A 2NXGA 4RX0A 3I6EA 2PDYA 1XCFA 4GK8A 3C52A 4MPKA 1VPXA 1W91A 4X2RA 5AYIA 4ADTA 2F7FA 2XN1A 1BGGA 1Z48A 3RITA 3TA6A 3SN1A 3VFLA 1LORA 3UR5A 2DJXA 4A8NA 3MDUA 3F2BA 1HIZA 5CAHA 4FXSA 5IHSA 4XZ9A 5GVJA 1JF5A 4MAZA 4AY1A 4NZ3A 3CEPA 3EXTA 4O15A 5CZTA 3ITTA 1KM2A 3TE9A 3KTXA 5B7ZA 2EAWA 1SO3A 1V6YA 3BCFA 4IQDA 4Y96A 4A3QA 8A3HA 1FP8A 3KM8A 4K1WA 4LEQA 4PE8A 2VDIA 3HJEA 2BOFX 2DPEA 2PURA 3EX4A 2VX7A 3TLQA 4UWMA 4MAVA 1XBZA 4ZA0A 1DJGA 4P7OA 3W1AA 3S1VA 3QY7A 2A4AA 1GONA 4O0ZA 3RNDA 4XAPA 4L7ZA 1W17A 3P2VA 1S1PA 4KCUA 3UNTA 3BUVA 1K8XA 3S5OA 3HPZA 1XSIA 3CUFA 4BI5A 5KEZA 1ONXA 1X1OA 1Z3NA 3LLFA 1TJ0A 2E9LA 3GH4A 1Q2SA 3SUTA 3MO4A 4N4PA 1YNYA 4LRSA 1F7BA 2VQUA 3EA2A 2YCEA 3M41A 4J3UA 2YKKA 3CL7A 5EKYA 5C7VA 1XH0A 3XIMA 4LNCA 3TFCA 5TIMA 1QBAA 3T0DA 1LBMA 1UP2A 2INEA 4PRRA 4UTTC 3REQA 2A2IA 4V2XA 1AH3A 1PHQA 4HKPA 2VD9A 5BWAA 2OXNA 4K8GA 3DYMA 4YYCA 1Q6DA 3WLOA 3C6CA 2YZRA 5BMWA 3GNNA 3T2PA 3F4VA 3QYSA 4LV4A 3WF1A 1E55A 1IEXA 2VC9A 2WKJA 2BS9A 4K68A 5L9FA 4QCFA 2ICSA 3TAKA 1JZ4A 1KLZA 4LBSA 1V3LA 2R1MA 1BWKA 4AYGA 2QZRA 3QKZA 4C7GA 3A3WA 3KL5A 5HMDA 1SYTA 1CGXA 1QWKA 1Q4NX 2CU0A 3RDKA 1UD6A 3CZKA 2J79A 1TZZA 2E6AA 1JQXA 2SFPA 4DI9A 3MI6A 1EXPA 1G7UA 3LV6A 4ZO6A 2E77A 4W84A 1J5TA 4AIOA 4DJFA 4IMAA 2XU2A 3ICJA 3SJNA 4J3VA 3LM3A 4AFYA 1IEQA 3NXLA 5D9NA 4FIQA 5DT7A 4B5UA 2TRSA 2OPJA 1PZ3A 4AWUA 4BCEA 3MDWA 1WDWA 4HSNA 4L64A 1XYMA 4IIBA 3OHIA 4KWWA 3W23A 4DUXA 3PAJA 2CBIA 4S3DA 1LTDA 3VM7A 4LXFA 2FTWA 3ZLGA 4UTMA 1YEYA 4HA4A 5K2ZA 3W7IA 3OVRA 1HJUA 3G3MA 3LSBA 1F3XA 2A0NA 2BNJA 3U3HA 2QPXA 3I3DA 1FHDA 2CPUA 3ZWTA 1KRCC 4GUHA 1L9WA 4MZ8A 2A7NA 4GFSA 4WHBA 4O18A 4QJ5B 5JH1A 2PDIA 2QCDB 3IV8A 1PXGA 4QBXA 1XG3A 1XC4A 4EAYA 3PUOA 1E43A 3LMZA 1P5BA 5ENLA 3SUVA 3NQ7A 2HPIA 1RLDA 4H6QA 3C61A 2E5BA 4BQ5A 1LL7A 4KRZA 2V2CA 3GG0A 4GJ1A 4ADSA 1E4LA 2G3IA 1TTQA 5I3HA 4XSLA 1R3SA 4GQBA 3G1SA 4PTDA 1F3TA 4LCSA 1YXCA 4WOZA 3M0VA 5KINA 2J62A 1JI1A 1HZYA 2XG9A 3PN8A 3Q4DA 2PDMA 1ZGDA 2J7FA 4MKNA 4CGTA 3MT1A 2WJZA 3L4XA 3GC2A 3WQ5A 3DZ1A 1VFTA 3M0ZA 1VEPA 4IQEA 1RH9A 4RE4A 1W3JA 5CBJA 4B15A 3VDHA 3PF3A 2YA0A 1MZRA 1A53A 4F0MA 3VKAA 2GVEA 3L9CA 3S1GA 4GC3A 4KW2A 4Q8OA 3OQ8A 1M7PA 2VWSA 5CZJA 2WQDA 4GISA 1VFMA 5F4XA 1HP5A 3CC1A 3ABXA 1VENA 4W89A 4L1GA 1OC5A 2Z2AA 2A3EA 3W2UA 1XD0A 3BW3A 4C1NB 5EPDA 4GYPA 3HPAA 3UG8A 1I8JA 1XH2A 3MUAA 3DH7A 2ZFAA 1GVFA 2E8ZA 2XIJA 3BG5A 2D22A 1RVGA 3SAZA 4ERAA 5C6MA 3LD5A 5C54A 2BGQA 2C1IA 4ORIA 4B4HA 1SW3A 4GRSA 3HQOA 2G96A 4KWUA 4MADA 4JFUA 2D2GA 4D6GA 4DPPA 4RKAA 3OLIA 3OG2A 4YCPA 3GM8A 5AHLA 3UG4A 5AC4A 2R1PA 2GJXB 1W2PA 4R7WA 4Y8FA 2A5HA 3VMOA 4ROPA 1H1YA 2VZSA 2B7NA 3C2YA 4NIRA 3WQVA 2DUXA 1GQJA 1TMQA 2XIIA 2Y62A 4LUTA 3A3XA 4ALDA 3IIOA 3AXXA 2WSKA 2QUVA 2C15A 1SQ7A 1WNOA 3RM9A 1EHNA 4AF0B 4K3ZA 1B2YA 2PDQA 1DWFM 1ZS2A 4CN6A 3ALFA 4H2HA 4NJGA 1RXOB 5D8ZA 4Y8EA 1YW1A 1UC5A 1KBJA 4TV5A 2WMFA 3T0AA 4AZBA 5D04C 3W1NA 1IEWA 3ARWA 3W7GA 3K8KA 3COTA 1XGDA 1LDCA 6A3HA 1GVYA 3WLIA 4RJEA 2Q71A 3FA4A 2FDMA 1EP3A 2GPTA 5EFFA 2W63A 1EP1A 1E0WA 3NG3A 2PDJA 1I2RA 1H50A 1QBBA 4JTEA 4JDYA 4ZQOA 5LSMA 3WLTA 1TELA 1NQ6A 4X9SA 1ADDA 1I4NA 1NDWA 1DJZA 3W00A 3GHTA 1IT8A 1F4AA 2DU2A 4Z0SA 1MQRA 2EF9A 3A9BA 3UP8A 4ZB0A 3BV7A 3EWUA 4HCLA 1K03A 3EWWA 1X39A 3UPBA 1WE5A 1ITUA 5DCDA 2WHLA 2VUYA 5HUPA 1VEOA 3B04A 3EB3A 1OFPA 2CHRA 3RMEA 3R10A 1B3YA 4KEVA 1U5JA 1UQZA 4I3GA 1BSIA 1QVBA 2QULA 4NUWA 4AVFA 3W71A 4Z2GA 2XH7A 3NTYA 3K4WA 2PSNA 5DT5A 5CSUA 1W56A 1AQHA 2I57A 3UWZA 3UXAA 3BAKA 3NL6A 3SCPA 4JKMA 2NXHA 1Q6QA 2GOKA 1A5AA 4C60A 2VX5A 1RJQA 1G1YA 3BG3A 4RW3A 4XISA 3UWQA 3BK0A 3AHYA 2CERA 4ICNA 1QNQA 3OLEA 5J04A 1U30A 3N29A 2PD5A 1UUQA 2GWGA 4LC6A 7ENLA 2QJIA 1UW9A 4XKYB 2BVDA 1N2VA 4GUJA 1M65A 5CPQA 2NQ9A 4F9JA 5I5RA 1GQLA 4NZJA 1O94A 2XVNA 4QNEA 4M6QA 1VYPX 4LUSA 3U0HA 1BKSA 4TUFA 1E51A 2WMIA 4O1CA 3DKLA 2BVWA 3TQPA 3E1F1 2PDUA 4UR8A 2PA6A 3WDHA 5FAGA 2I5GA 4TOQA 2A7PA 2J9ZA 2D20A 1SZNA 3W26A 2PD9A 3LZ3A 3QC3A 5JBFA 3DHDA 1IYXA 1V77A 1G67A 5BOFA 2ZX6A 2JK2A 2GWNA 2PC4A 3VIPA 1ZL1A 3XINA 2WOQA 1JI2A 1KFBA 2WNQA 3V5OA 5BNKA 3ZSTA 3L0GA 3VX1A 1EEXA 5F4WA 1EOMA 2VXNA 3LRKA 1P48A 4YU1A 4PODA 1BVZA 3ARTA 1Q63A 4L6HA 4XZWA 4TVUA 3B4YA 2J66A 4P2VA 3PR2A 3EPOA 1XYBA 5A8OA 2PLKA 5KSWA 4GUGA 4GX9A 1DJWA 1P0BA 4GVFA 1C29A 7REQA 3ARSA 1OIFA 1Q6CA 4O8RA 1PKMA 1YYAA 3KBNA 2XGIA 4JIHA 3IGSA 1V3KA 3ALGA 1EPVA 3NR0A 1EEPA 2ZZ7A 1R3YA 2WJEA 2JIWA 1PHWA 3S5SA 4U33A 4GJIA 2VENA 4AAJA 1B5TA 3GTNA 3B9DA 1L2UA 1KCZA 1H0GA 3E3HA 4GIYA 3H2MA 1NELA 1Z9AA 1EZ2A 1G9HA 3KOFA 4I6KA 2A85A 3WJWA 5D9PA 4Z08A 1YDVA 2I17A 3WH9A 4A3YA 1W1IE 2VFFA 4MMWA 4WJ8A 4Z2LA 1EUAA 3KS5A 1BYDA 5AVHA 3WN6A 3UFYA 1E4IA 3W83A 2Q8LA 3WDJA 1PYMA 3VGBA 2ZZ1A 3AXKA 3N18A 2V2DA 4NQ1A 2ZWYA 3PUGA 2VFHA 2B0MA 3P60A 4ZBCA 2QW5A 4ZSTA 1TSIA 3LHWA 2UY5A 1YDYA 3NL5A 3AFBA 2YSWA 5EFDA 4LW7A 3FJNA 4ZOEA 1ONRA 1B3ZA 5BXRA 4H4IA 1JDFA 2NT1A 3OA3A 2Z1KA 5AOUA 3WBAA 3ITLA 4RPQA 2X0HA 3TTOA 3OODA 1TPC1 1F4HA 2XYLA 3EWCA 5CZKA 1JIBA 2INZA 3ITYA 1LP6A 1CIUA 4X61A 4EVZA 4RE0A 3O6CA 3WBXA 4NAEA 2PDWA 4EIVA 1NY1A 3MWAA 3DX5A 3QR0A 3UYIA 1KFKA 5BU6A 5E6ZA 1CLVA 1NU5A 2JBMA 1FWFC 4IMFA 3T0CA 1R6WA 4DBSA 3W2NA 4P8UA 3QW3A 2J8GA 3TSDA 1QI5A 3CV7A 5AFDA 1TR1A 3NNTA 1IZKA 4WKAA 3GXIA 2HE5A 1OGSA 1KNWA 1ZRQA 4DJDD 4UNLA 4YIWA 2FPTA 2VDGA 1RVKA 4UZUA 3V16A 3WK0A 3OGSA 2PTXA 5FF7A 4OZOA 2VGGA 2XZ7A 3MBFA 3QLLA 4LCQA 2JQXA 3T6CA 2QDGA 1UROA 1EQCA 4FIRA 5A1AA 4OT7A 3WLQA 3M0YA 4BI7A 1TCDA 1KBLA 3N19B 5DO8A 2TPSA 2C8NA 2CZDA 5G4HC 2QF7A 3AROA 3WDQA 4HHLA 1Q5MA 1IWBA 1BQGA 4NYYA 1RUSA 5JIWA 3R7MA 4HNLA 2WC3A 4BWLC 3M6YA 3L0NA 2OWWA 1RR2A 3AO0A 3OHMB 1X6UA 2X41A 3FIGA 5DXXA 1JZ2A 1NJJA 5LIWX 4U2YA 4ZR8A 5D4YA 3WDRA 1TIMA 5AHIA 4PMJA 4RNJA 1Q2RA 1IXNA 1JRBA 1RBLA 3IJLA 3C3NA 3TTEA 1U2YA 4H19A 3P74A 2JFEX 3FX4A 3VNJA 1F6YA 5ABHA 5HWJA 1QO5A 1YDNA 4IPPA 4JQ3A 3EDEA 4G5DA 2Z0IA 3OG3A 1E1CB 3HM7A 2HEJA 3SCWA 3ARYA 2WB5A 1NIUA 2B7OA 2BOGX 3LTSA 2CLPA 2H8XA 3GXPA 2A1YA 4I9JA 3W7NA 1T40A 4H9UA 4U4MA 3VD7A 2OVLA 4IPLA 3A22A 1O5QA 2YCIX 4MKSA 1V0KA 1H0IA 1KD0A 5BROA 2P8CA 4PTMA 3FGCB 4LF2A 1TMLA 2HROA 3LS9A 4GVGA 3K8MA 1EGMA 4Q6JA 3NDZA 5AHNA 2IKHA 2YGYA 1HNYA 1Z42A 1P6BA 3N34A 5BYWA 1WUFA 2CZFA 1R2RA 4WKFA 3Q94A 1M03A 5BRPA 4M19A 1TCMA 3HIJA 3ME3A 1FKWA 2VR2A 3JW7A 2XVPA 3KZPA 4QG6A 2XFWA 5TBOA 4GABA 3EEZA 1K70A 4QR6A 3O07A 1DTNA 2NWRA 1P0NA 3H2AA 4C6QA 1R9XA 4JY8A 3N17A 2ZX7A 2GK1B 3RLVA 3LN3A 5FSEC 4LUIA 4TV6A 5H2ZA 1XYCA 3KHDA 4IUGA 1PCWA 4CD8A 4OE7A 2Y63A 5F1VA 2WSPA 3DYOA 2VR5A 3QQ1A 3A24A 2WHKA 3FLUA 3B8UA 3SFKA 1UWUA 3VX0A 2WYSA 5I79A 3KCOA 3TP4A 1E9LA 3PFRA 3PB0A 4TMBA 2PBOA 4ZOCA 3SGGA 8TIMA 1NWSA 1UCWA 3UY7A 1BD0A 3GDKA 4OECA 2Y5JA 2VEFA 4HN8A 4DWSD 4H7ZA 5CPTA 3CIXA 3W29A 1W8GA 2EJ1A 4Z42C 1V7AA 2QAFA 1R2SA 4EF8A 3UR7A 4XZIA 6ENLA 3OVPA 3IAPA 5AYBA 4CVUA 1XCWA 2FVKA 3QOKA 1QR7A 3LB0A 3I7SA 2RGMA 4UTKA 3NQFA 4QG8A 3GFXA 4HK5A 3AWNA 3CHFA 1YBQB 1ZNNA 1UC4A 4US5D 4XIMA 2YYUA 3S6TA 3MW7A 1SW0A 3PVFA 2ZC1A 5DRCA 4Y90A 3TLLA 5AC5A 2Q3OA 5FSDC 2I9UA 1HGWA 2VZTA 1O12A 1OFEA 3GX9A 3CPGA 1AJZA 2D69A 4DZAA 1B30A 4IIHA 1OX4A 5HK4A 3W38A 3WLMA 5FEPA 5D37A 4DO7A 3S9ZA 3PAOA 1V3HA 5FF0A 1EH9A 5CAKA 3CMJA 3QY8A 3UU0A 2BHYA 1RJRA 3M5ZA 4LYQA 4HNTA 3GVQA 3R2GA 3B0XA 3O6YX 1CXIA 1EWEA