2CLFA

Tryptophan synthase in complex with n-(4'-trifluoromethoxybenzoyl)-2- amino-1-ethylphosphate (f6) - highf6 complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
268
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 97
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2clfA00
2E77A 3W71A 2V82A 3H53A 4K36A 3HGOA 4JTGA 2ZFAA 1DKWA 4FNTA 1AMKA 2JK2A 4P61A 3BO9A 1EP3A 3P62A 2TYSA 3RNDA 4UTLA 3CIXA 3WK1A 4UTKA 2I9EA 2FIQA 3A5FA 3GAKA 3QMSA 2KZHA 3TROA 2QUTA 3W1UA 1DJQA 3CPRA 3GLCA 2W6RA 4E2DA 1N8FA 3NNTA 2QCLA 3TQVA 3W7PA 4XWUA 1NF7A 1IXOA 2ISVA 3HG5A 2VKZG 4NNAA 1XUUA 1TJPA 2ATMA 2YGYA 3RK8A 5KZDA 3NDOA 5HWMA 4HNVA 4NQ1A 1TTPA 4JYDA 4O0ZA 4HT3A 3BK0A 5CGQA 4Y9AA 4FNQA 3WJYA 5K9XA 1YXYA 4DF2A 1MEWA 4Z1DA 4ZQMA 2Y63A 3P74A 3B06A 3T55A 3NO5A 2GQAA 3OVRA 4R53A 1KTNA 3C2EA 4A22A 1K02A 1OABA 3IIXA 2F84A 4M19A 3G1YA 5I3KA 2ZBTA 4QQ3A 3S5ZA 3CIWA 1ZFJA 1TMHA 1LYXA 3NQ6A 3RLUA 2JGQA 3W7JA 1WXJA 1OK4A 4O52A 4JDYA 3LCLA 1ZENA 1QR7A 3BW4A 5CPNA 4RXGA 4EF9A 4S1FA 4O0KA 5CSRA 2Y6ZA 4R7JA 2Z0IA 3P8IA 2ZYFA 4LVGA 2Y7EA 4PODA 3WJSA 1NF0A 2RDTA 4LVAA 4RV8A 4TMCA 2DZTA 5HJLA 1WV2A 3TK7A 2NWRA 2Q8LA 2Y89A 1NFBA 1JCNA 3WK0A 3PF3A 3NQCA 3EXTA 2CW6A 3I7SA 1A5BA 5DXXA 3O8AA 3TU9A 3IIOA 3GX9A 4A21A 3LX9A 3TSBA 1KFCA 4HSNA 4PH6A 1LP6A 2ZZ1A 4YCOA 1OF8A 3NL3A 1KTBA 1H60A 1UCWA 2WNQA 4D2JA 3W86A 3DH7A 3KXQA 4H3DA 4UNLA 2JGYA 1EUNA 5CPLA 3NM1A 5K7JA 1MSSA 5FESA 4RKAA 5TBOA 4RXFA 1EX5A 1U83A 1EA0A 4K38A 1H7WA 4FX7A 2E68A 3T78A 5K9DA 2FPYA 3TE9A 1E51A 1VJIA 5EKYA 2YW3A 3IRDA 3QC3A 3W2MA 4O54A 2BXVA 4FEZA 3E0IA 4O10A 1SFJA 3W70A 4Z0JA 2A6NA 2BX7A 3TUUA 3NQFA 1C29A 3HGJA 1O95A 1OG0A 1F76A 3C52A 1WYIA 3SY5A 3ZR4A 3QYQA 1YDNA 3M5ZA 5LSMA 4AXKA 3OBKA 2FJKA 4IOTA 5DBUA 5D2TA 2F7FA 1LCOA 1RQHA 3HO8A 2YX0A 4QJ1A 1F05A 1VYSX 4IMCA 4PFMA 5DLCA 1PCKA 1ME8A 4LUIA 4OE7A 4DO6A 3BG5A 3LBCA 5I3FA 4G1KA 1Z48A 2QUUA 5AN7A 1SW0A 1QO2A 3MI2A 5D32A 5BRBA 4OHQA 1JCYA 3WJXA 5F2MA 3I7RA 3W2NA 1IGSA 3L0KA 4GJ1A 5G5IA 1ADOA 3CT7A 4UC5A 4POCA 4WUIA 4LOCA 1LZOA 1SW3A 3HG4A 1JR1A 3S0CA 3DGRA 1P5BA 3HOJA 2CLHA 2DJXA 4LTSA 2ZRVA 1L9WA 4OQVA 4Z08A 2B7QA 1Y0EA 1KM4A 3GK0A 2QCHA 3GIYA 2ALDA 3F4NA 3STFA 1VRDA 3M0ZA 2G97A 2EHHA 1B57A 3E96A 4UIOA 5HR6A 1X7FA 1LM1A 2OCZA 3OVQA 2FQIA 1QFEA 3IGSA 4Z1BA 3CWNA 3BGGA 2VFGA 3HF3A 1OYAA 1BKSA 5D2WA 5FF7A 5AC8A 3VCRA 1XDLA 4N9EA 5D33A 1MEIA 3C2RA 5BMXA 1K7XA 5F4XA 4GNJA 1K3UA 3EWBX 4JR5A 1JRBA 4M6VA 1OFOA 3NZ1A 3SFKA 4FXRA 3NYZA 3IIPA 4H4IA 1A5SA 4WOQA 4LRTA 2CZEA 3IEBA 2BTMA 4IQLA 2X30A 3U8GA 1LBFA 4CQ9A 2A6LA 3LTYA 1IXPA 4RLIA 1FWWA 4LC6A 2ZRUA 1KA9F 3P67A 4JTHA 1A5CA 3GXNA 4UTIA 3QZEA 4JY9A 4MYAA 4UTJA 3R2GA 1XM3A 1JJKA 4Y90A 1SO5A 2RH9A 2FTPA 2HTMA 2Q3RA 4MY1A 4RZ4A 4AHPA 3AO0A 5BOOA 1TREA 2TPSA 1JQVA 3FKRA 1IXQA 1H1YA 2Y88A 2WNZA 2YFNA 1FBAA 2C16A 5L9FA 1O60A 1DV7A 4NVTA 4IGHA 2ZRZA 3TA6A 2BZNA 4JIPA 3DENA 3INPA 3C2OA 3NM3A 1NVMA 3NEVA 3SJ3A 1YTKA 2YXGA 3GVGA 4U4MA 4ZMGA 4JXCA 3F03K 3HIJA 1DHPA 3N9RA 2C6QA 3LI0A 2ATSA 4N6EA 3W7NA 4MLRA 4EIVA 3ZWSA 1JQXA 1DOSA 2DZVA 4Q4KA 1MEHA 4M6QA 5AOUA 3DU0A 3GNNA 4JNMA 3TX9A 4WOZA 2E5BA 5K9CA 3LTSA 5DY2A 3ABSA 4JD4A 3CWOX 4OBTA 3W6YA 1S3HA 1TQJA 5FF2A 2H3DA 4S2BA 3THAA 5LNSA 1OFEA 1OVDA 4LS0A 3EXSA 5AC6A 2OZ0A 1VGAA 4FF7A 2J88A 4I7UA 3W7RA 1GEQA 5D2XA 3KVJA 3S5NA 2ZCGA 1TYGA 1P4CA 1WA3A 1OYBA 1GYNA 3UWQA 1SZGA 4Z0SA 1K7FA 3W7EA 5J5RA 1VLWA 3UPWA 3P5ZA 1I45A 4MZYA 1X1ZA 1CW2A 1FY6A 4MPQA 3TV8A 1D3HA 3WJZA 4DPPA 1AG1O 1JULA 2OMAA 3M7WA 5D30A 1ICQA 2ZZ7A 1SZEA 2PRHA 1R2TA 3PSWA 2I14A 2Z6IA 4MZ1A 3NL2A 1KV8A 3DFNA 5LHEA 2CZFA 4A2RA 1WDWA 4JDBA 1V7YA 3LRMA 3O16A 2TMDA 3EX6A 2JBMA 5F4WA 4BI5A 3TNOA 3JR2A 4UTUA 4IWWA 2CFFA 1Z42A 1SR9A 4JTIA 2B7PA 2FB2A 4QAIA 1OX5A 1D3GA 3RF9A 3W7LA 3C2FA 1I2RA 3FJLA 5D2VA 1YYAA 3M16A 4CNOA 4JEQA 4KFOA 4NJGA 2WSYA 3L2IA 4NT0A 1J4EA 3WK2A 1GVSA 3QSTA 4MUZA 1TPFA 5H91A 4FNRA 4CQ8A 1OFDA 2ZZ5A 1GWJA 1KFLA 3QQ1A 1G4PA 1TO3A 2WSQA 4XTDA 1TCDA 1TV7A 1ICSA 3MI3A 3IVTA 1IF2A 5IBXC 1R30A 1PE1A 1GG1A 4UCGA 4O13A 4NNCA 4DO5A 3GB6A 2V81A 3G8EA 3NQ8A 3EEGA 2OT0A 3OEXA 1Z41A 2VEPA 3LRLA 4UNKA 4JYFA 2B7NA 3FKKA 3P80A 1EUAA 4RZ6A 5EA9A 5KSWA 1FCBA 4FNPA 4N02A 3OVPA 5LNVA 3MP5A 1B9BA 4UFIA 3W7CA 1RR2A 4DF1A 3S42A 1QPOA 4O1CA 2V9DA 1GVFA 4LV4A 3SR7A 5C54A 3N34A 5AYZA 3LI1A 1EWDA 3G22A 3LHVA 4LWWA 4XZ9A 1TJRA 1F74A 2QCNA 4Z1AA 5LKYA 4FNUA 3QMTA 4I7VA 4AAJA 4CCCA 1Q6LA 1KM6A 3TAKA 3B4UA 1AW2A 1TIMA 4HKPA 3TJXA 1RQBA 4O50A 3UWVA 1F2JA 3R12A 3DI1A 1J5TA 4UTWA 4Q32A 5K4ZA 3QJAA 2PE4A 1PHWA 4LUJA 1W3IA 3TKFA 1VPXA 2VFEA 3W1XA 3HMJG 4U28A 3GDMA 1I4NA 3NQDA 1TB3A 2ZA2A 4ZQPA 3P7YA 1YXCA 1AL8A 3LCXA 2QAPA 2FLIA 3BPWA 5DBTA 3UXAA 3BV4A 4B5NA 4ZQNA 3MP3A 4AF0B 5AB3A 2G5WA 1I2QA 3QRHA 3CQ0A 2YFOA 1XCFA 1ZNNA 3KRZA 3PG9A 1ALDA 1QPNA 3H55A 5HWNA 3W1QA 1NAL1 1EIXA 1V5XA 5AYXA 3OA3A 1KM2A 3TH6A 1YADA 3P60A 4LC8A 4K39A 3O06A 3S5OA 1KM1A 1M6JA 3DKJA 1SFLA 2Y7FA 1L6WA 1SPQA 1OX4A 1F73A 2HS6A 3C61A 5AHEA 2YDAA 2R8WA 2DZSA 1VYRA 4ORMA 1F6KA 2FPVA 3B8DA 3M1ZA 3Q58A 4CNPA 1OJXA 4NX5A 1W8SA 2NLIA 4QITA 3V1PA 3PB2A 4UTWC 1TPDA 1I2NA 4ZL1A 1WOBA 2VEKA 1YLVA 3TXZA 1FDZA 4LS1A 3T7VA 1KFBA 4HNNA 3L9CA 2QJGA 1FWSA 4QIUA 1B4KA 3ELFA 3VNDA 4WY0A 3DAQA 1G6CA 2CZ5A 2ZDRA 1GTEA 2DZPA 3KVKA 3UQNA 3U2OA 4TO8A 1XKYA 2V0TA 3N3MA 4XUGA 4CNNA 1AW1A 4IMEA 4Y8FA 1H7XA 2NX9A 3TC6A 4IXHA 5MHBA 1KBIA 4JX4A 4MJZA 1RV8A 1R46A 3FFSA 4PCFA 4YWIA 3EB2A 2GUUA 5CKSA 2Z1BA 5C55A 4O1BA 3QW4B 5G2IA 1XC4A 1F7BA 1JCXA 3C8FA 4ZVJA 1VHNA 4IUOA 1W5QA 3LGEA 2EGZA 2YR1A 1VYPX 4WQ6A 7TIMA 3UNDA 2QCMA 3SGUA 4O1AA 4N9BA 5CZSA 5HUPA 3VE9A 1L6YA 2ZQ0A 3LB0A 2DZXA 2AAMA 1SU5A 1TPB1 1JUBA 2ZZ2A 1HG3A 6ALDA 3GYEA 5E0KA 3L0GA 1ZY9A 2VFFA 3CC1A 3R5EA 2WNNA 3V75A 2WJZA 1H62A 4GWEA 4HNTA 5BW6A 4O57A 2CLIA 3N2XA 4O53A 4GUFA 3DBPA 4O15A 1GG0A 4TR9A 2A7NA 4RK8A 3UYCA 5DXYA 4FNSA 2X1RA 3G3MA 5EYWA 5CPOA 3KHJA 4A3UA 1L2UA 1FCVA 1TRDA 4N9DA 5D04C 3BG3A 1I2OA 1XBVA 4JIQA 3W9ZA 3HG2A 3S1XA 3L5LA 2BWGA 1Q6OA 3U6WA 3S1WA 5ABTA 1BWKA 3HGSA 2EAWA 1X6UA 3B04A 4UTMA 1FDYA 3G1HA 1XL9A 2V30A 4UUIA 1M7PA 1X1OA 1QPRA 3NOEA 3A21A 5LHFA 1A50A 3W7DA 1LOLA 5AHFA 4O8RA 4MY9A 3CB8A 3PUOA 1NEYA 5I3HA 4MFDA 2C18A 8TIMA 3W2LA 3IGXA 3NPUA 3ZS4A 3S1VA 1G4SA 3SECA 3SGZA 3LRKA 3O07A 1G7VA 5AHMA 5U4NA 1LOSA 3JRKA 3W1MA 4GUIA 3P81A 4AMAA 5FEPA 3FLUA 3M5XA 1EEPA 1ZAIA 3KRSA 4MY8A 3ANYA 1EP2A 1OHLA 3HBLA 2DZUA 2FFCA 1YDVA 3GNDA 2WOQA 5I3GA 2DP3A 1NSJA 3NR0A 3LHWA 1G69A 1ZAHA 3ATZA 3LCHA 3FA5A 1W1ZA 3QFEA 1FX6A 3DFSA 5L6UA 3LXBA 3DXIA 2YSWA 3TCEA 2G95A 5AHIA 3PR2A 4O4WA 4MFEA 1DBTA 3GDLA 4RCXA 5HR7A 3KRUA 2ZTKA 4EVZA 5GVJA 1SQ7A 4MZ8A 2V5LA 4I7WA 5G4EA 5E1QA 4FO4A 3VFLA 4GE8A 4YLWA 4MYXA 5AHNA 3K30A 1FWTA 1T0OA 2PURA 2A7PA 4GRSA 1MXSA 2Z2UA 2NXGA 3G1DA 4JTLA 4JTTA 1LBMA 1M7OA 4JY8A 5KTLA 1FXPA 5HUOA 5IM51 3S9YA 2Q3OA 1H51A 5FF4A 2VENA 2R91A 3NPXA 1TPH1 5K2ZA 2ISWA 5C2XA 4O16A 4HHPA 5DN1A 5E93A 3W1PA 4IMFA 4RR4A 2HMCA 3EX3A 2R14A 2H8ZA 1TTIA 2E6FA 4JS3A 1OF6A 2YPIA 3I68A 5FF0A 2GPTA 3B03A 3DI0A 4DQWA 1IIGA 4WXYA 3G0UA 1VCFA 3G0SA 2H3BA 3LOTA 2A4AA 2E6AA 3NZRA 4X3ZA 1KLZA 1OX4B 1YPFA 5G4WA 3G24A 1W37A 3L0NA 3KVMA 4K37A 3HPZA 4UFMA 3C0JA 3NL6A 5LNWA 4PL1A 1ME9A 4QNWA 1PV8A 3W7OA 3PM6A 2GVGA 5D37A 4MLJA 1R2RA 3HPXA 1PHQA 3W76A 3M44A 1JVNA 4WY0F 4HIBA 3SIZA 2CU0A 1RPXA 5G1TA 1PS9A 1ZHAA 2ZRWA 4N4QA 2ZRXA 5FEXA 1JUKA 3D0CA 3STGA 2W0UA 2XN0A 1OK6A 3DFOA 3FOKA 4GC4A 3W1TA 2ZZ3A 1W5OA 2AGKA 1VLIA 3LBMA 2B7OA 1AL7A 3PWAA 4JX5A 2NWSA 4WD0A 3TSDA 4FIQA 2J24A 3NPVA 3YPIA 4EOUA 2V8ZA 4AWUA 1JCLA 4LY8A 2HSAA 1QAPA 2NXIA 2BSLA 4A29A 5A5WA 3L68A 3SW6A 3W83A 1FWRA 2DZWA 2Y70A 3DFPA 3FJ6A 3NQEA 3TAOA 3MBDA 3FYPA 1PVNA 1QOPA 2V2CA 4IPIA 2FPTA 1LBLA 1SW7A 2RDUA 4Z1CA 2NUYA 2QDHA 4NJIA 5IBXA 1UASA 4AHQA 4IPJA 4QSHA 1C8VA 3RFAA 4IX0A 5I3JA 3GKAA 2BLEA 3TFCA 1GJPA 3DFQA 5F2IA 1VC4A 1DORA 1FUYA 3R13A 3C2VA 5D09A 1ML1A 1VCGA 3NAVA 1O5KA 2E1DA 2QJIA 5F2LA 3RU6A 1GVOA 3M5YA 3M5VA 3L5AA 3IVUA 1VS1A 1OFPA 2A21A 3SI9A 3GDTA 4YXGA 1K7EA 3G3DA 1QDSA 3BLIA 4JTUA 1OFBA 4N9CA 3PG8A 4M7TA 1O94A 3NQ2A 2J9ZA 3TSMA 2C19A 2Z6JA 3IIZA 2ZA1A 1WOAA 3SSJA 1P0KA 3LERA 4C1LA 4JTEA 4YL2A 2PRMA 4O14A 6TIMA 1XBXA 5HINA 2Q8ZA 3MJYA 3UZJA 3QSRA 4KFPA 5KMYA 1QOQA 3QPZA 2G96A 1W54A 1C9DA 1VCVA 3CEUA 2PRLA 1KLYA 3WFAA 1RD5A 1UJPA 3UY8A 4DELA 4UMCA 4ZQOA 3W73A 4YCPA 3BARA 4LVBA 3M47A 1THFD 4OT7A 3P61A 3MHFA 3FYOA 4NJKA 4UMAA 3AJXA 4EWND 2QCEA 4OV9A 1SO4A 3NQAA 4L4MA 3ATYA 4FXSA 1W0MA 3NQMA 5HWJA 1GYLA 4UFLA 3NA8A 3B05A 1KFEA 2QCDA 2VFDA 2NV1A 4XTIA 5CSSA 4HPXA 3BVJA 5H2ZA 1HL2A 4E0CA 3CLMA 1O5XA 5KINA 2VXNA 2UV8G 4FB7A 1W5PA 2YCEA 2P10A 3GAYA 1OFAA 1I2PA 4GXMA 4E2BA 5EL1A 4BFAA 1FQ0A 4NZFA 4X22A 4BI7A 1FCUA 1H7NA 4JX6A 1A5AA 2X1TA 4UTHA 1ZCOA 1Q3NA 5LGZA 1N7KA 2EPHA 3ABQA 3W3OA 5KZEA 5EMUA 2NX1A 1UBSA 2IQTA 1T96A 3O05A 5G1YA 2OX1A 4NJJA 1TTJA 4ADSA 2QDGA 2A5HA 1XXXA 3EKZA 2QCFA 1HUVA 3B0PA 1W5MA 3EXRA 1N55A 1H7PA 3GR8A 2X1SA 3BLFA 3UWWA 1DVJA 3PS7A 1H1ZA 3UY7A 2ZRYA 2OJPA 1ONRA 3GDRA 3G1VA 3MP4A 1KM3A 1TPEA 4X2RA 2R94A 3B0VC 4FX8A 3UWUA 3W74A 5C6MA 3TMLA 1TPUA 3NXFA 3STEA 1ICPA 2WQPA 4O1DA 2CLKA 4XKYA 4AVFA 3F1QA 3G18A 5D38A 5K3VA 4IXXA 2TRSA 4XBSA 2GJNA 1CI1A 4ORIA 3S6DA 3GDKA 5CZ0A 3RLVA 3W7IA 2C13A 1LRQA 5K4XA 2FB3A 3T4CA 2XN2A 1P0NA 2CZDA 4O12A 4OU1A 2A2IA 1FXQA 4OGZA 2GVJA 4ADTA 4WJEA 4MJMA 1W5NA 2Y61A 1LORA 4GUGA 3TIMA 4BWLC 3FS2A 4QNEA 1QCWA 4HNUA 3C3NA 1U5JA 3W22A 5G2HA 4H6KA 1UB3A 1BEUA 4FX6M 4M7SA 1GT8A 3PSVA 3VE7A 2RKXA 2QCCA 2YW4A 1HFBA 1GZGA 3LM7A 2I1OA 2WV8A 1YDOA 4XQ6A 3F4WA 2B0MA 1LRNA 1I8JA 4Q33A 3RMJA 4P2VA 4ADUA 3W75A 3W88A 3TMQA 4JTSA 1WBHA 3TQ0A 1VR6A 4LVDA 2ZZ6A 5HMSA 1ZJIA 1L6SA 1XUZA 2YYUA 4TMBA 5F4SA 3R8RA 4ONVA 3KFTA 3EX2A 3OG3A 2Y7DA 4M5PA 4O17A 3PUDA 3W7MA 3G0XA 2A1YA 2GQ9A 3E12A 3PBYA 4KWVA 2CLEA 3QM3A 1EPXA 3M43A 3ZFHA 3FIGA 3LHZA 3JS3A 2GOUA 5TIMA 3IIVA 1P1XA 3L67A 1HO4A 3W87A 4GUJA 4O4VA 2NUWA 1RQEA 4UFHA 3EWUA 3LLDA 4K8HA 1XI3A 3W2KA 3HB9A 1AW5A 4PL2A 5TQLA 3W7QA 1T99A 1KTCA 3QQ0A 2E6YA 2O7SA 4CLMA 3W85A 3LLFA 3QH2A 4LRSA 3S1UA 2V5BA 5BNKA 3IV3A 1IXNA 2QKFA 4UXDA 1RZMA 3W1LA 4FIRA 4OWGA 1LOQA 3DHDA 1TSIA 5AHLA 4I9AA 4ZZ9A 4W9TA 3LCFA 5LZLA 1FCQA 2DJLA 5CG7A 4HN4A 4X9SA 5T26A 1PIIA 4CCDA 4CCEA 2RHGA 4LT9A 4DBDA 3O63A 3TFXA 2Y85A 3LCWA 3W23A 1JCMP 1Q6RA 3KOFA 1VH7A 4JYEA 4DO4A 3M6YA 1H63A 1B3OA 3B0UX 1CX9A 3HPSA 4WZHA 5FI8A 5LNRA 2J9XA 1J2WA 1Q6QA 3LXAA 4DF0A 3W72A 4DXVA 1H61A 3W1NA 2VELA 1UUMA 2E09A 3CM4A 3O6CA 1H5YA 1H50A 3W7KA 3USBA 5KITA 1FWNA 1K8YA 3NQGA 1R2SA 4JTFA 4AB4A 4C1KA 4BR1A 1XBYA 4L4LA 1H7OA 1KW1A 2C3ZA 4WX2A 3E49A 2WKJA 2QR6A 1T8XA 4JTJA 3W2UA 3G1SA 1GQNA 2NV2A 4JGDA 4IJBA 3NG3A 1WAUA 2QEZA 2VEIA 4LVFA 1OFRA 3PVFA 5D05A 1PCWA 4J9JA 4DBEA 1KFKA 4NX0A 1XDMA 2JKPA 4MVAA 3A24A 1OYCA 4LS2A 2Y7GA 1AK5A 2QCDB 4CQAA 5LNUA 2CWNA 1TTQA 1G67A 2WO5A 3IVSA 2XN1A 3O6DA 3BLEA 2YYTA 1XBZA 2NUXA 2FDSA 3DZ1A 3W7HA 5AFDA 3P84A 2E5DA 2O7QA 5D02A 3HJZA 5D2YA 5FEZA 2E6DA 1UUOA 5FF3A 1TQXA 1TRIA 5C5YA 5AYYA 3A22A 1OX6A 3VKJA 5DCBA 2GVLA 2XFWA 2J9YA 3WK3A 4ML9A 5KZMA 3EWYA 3W1RA 3GXTA 4AEOA 1QMLA 4PC8A 3NQ7A 1BTMA 3W07A 2CLFA 4ALDA 3GR7A 2A7RA 1ZAJA 5EPDA 4PTNA 3P82A 4LW7A 3S8HA 2AQWA 1K8ZA 2CLOA 5EY5A 4QISA 1TV8A 1SZNA 2P0OA 4TX9A 4ICNA 4Y6GA 3UPBA 3NVTA 3LCIA 3DKLA 3SZ8A 2EF9A 2W79A 1BWLA 1IIHA 2V2HA 3GKFA 1MO0A 1X8FA 1EP1A 4JN6A 4UR8A 1SZFA 2C0AA 1KM0A 1SSDA 3BW3A 3HGRA 4XKYB 3TQKA 4BI6A 3EX4A 3VI2A 1DJNA 4NU7A 4K7VA 3N2MA 2VFHA 3P5YA 1O4UA 1Z44A 3PBVA 1A53A 3UWZA 3TJLA 1YXDA 3H54A 2V2DA 4LNYA 4NXKA 3NL5A 2ZA3A 3A5VA 4JICA 3I7QA 3N73A 5I3IA 2P1FA 1KM5A 3CU2A 2X2GA 1KV5A 1LDCA 4AH7A 4LU0A 3MO7A 1GOXA 3BGJA 3KX6A 4K6AA 5FEWA 3HQ1A 1K03A 1QO5A 1W56A 3A9IA 4AF0A 3EWXA 4RJEA 3PAJA 4O28A 2H8XA 1FDJA 1G4TA 2ABAA 3G1AA 5U7SA 2NX3A 3BG9A 2LLEA 3TW6A 1DQXA 4ZQCA 3PULA 1HTIA 2VFIA 3O1NA 1W3TA 3MUXA 1TPC1 1PL9A 1ME7A 3LDVA 2JKAA 4EF8A 4AHOA 1GVRA 2RDWA 4MKNA 4QM1A 4RZ5A 1YPIA 1RVGA 3EKLA 3W1AA 5J5DA 2PCQA 3QPYA 4A2SA 4IX2A 3LHYA 4GUHA 4NZJA 3W84A 2ABBA 2H90A 1VHCA 1YTDA 3R89A 4TIMA 4UMBA 1B4EA 2HS8A 4HSOA 2JKEA 2Y62A 5A8GA 2WSRA 4K7YA 4UR7A 2PC4A 3TR2A 3L21A 4KKXA 1WX0A 3LV5A 3S5YA 4WY0B 5AC7A 2QCGA 2TSYA 3IGUA 2VEMA 3TXVA 2CLMA 3MYOA 3TW7A 3KVLA 4M6PA 3M41A 3MHGA 1XFBA 4DPQA 1LTDA 3TC7A 3BW2A 3I65A 1R47A 3Q94A 1JRCA 1S5VA 4N2YA 4DEFA 3MI6A 3ZWTA 3G8RA 3PB0A 4UTTA 1JCJA 3N9SA 5HQEA 2QUVA 1WQ5A 2E5CA 3CEPA 1W31A 3G1XA 4K8EA 5BMWA 3NPWA 3P8JA 3GZ3A 4MIMA 4OV4A 3DFTA 3DHFA 1G7UA 3LHUA 1Q45A 2WPBA 4NXSA 3EWZA 1W3NA 4PEKA 4UFJA 3A23A 2RFGA 2A85A 4FHAA 3LV6A 2C15A 5HNRA 3NGJA 4YMZA 1K8XA 2DU2A 3MW7A 4NUWA 3E9AA 4AWTA 1QWGA 4GBUA 2X16A 4RX0A 1YTEA 3PUEA 3C56A 3L65A 3QW3A 4PA8A 5EBUA 3W7GA 4LV9A 2GJLA 5G2WA 4WXZA 1QPQA 5F2GA 4O18A 1KFJA 2X1UA 4KWWA 1VZWA 3C6CA 5F1UA 3FEMA 5F1VA 4UFKA 5D03A 2QF7A 3UZ5A 2C1HA 3LCGA 4Y96A 4R34A 3CHVA 3CTLA 2J6XA 5CZTA 2H6RA 3HG3A 3I6RA 4O19A 3T40A 1ZALA 4GFSA 3EX1A 3MYPA 2A0NA 3THQA 1SO6A 1LLZA 1LRTA 3PBWA 4IMDA 2C14A 3O6YX 4S2CA 1GTHA 1SUXA 4UTTC 1SSGA 4TU1A 1OFQA 3ABRA 3LHTA 4XBKA 3W2JA 1LLWA 3T44A 3WJWA 1WBJA 4BK9A 5LGXA 4R33A 1QNVA 1SO3A 2ZZ4A 3MBFA 3Q37A 4KFNA 1F6PA 4N6FA 1DL3A 3MHUA 5DELA 3NQVA 4JTKA 2EKCA 3LXCA 2DORA 3MWAA 4O11A 3EWWA 1DQWA 3PC0A 1TPWA 4AWSA 2ZTJA 1KBJA 5DCEA 1MZHA 2YZRA 1S5WA 2ISSA 3MMTA 2QAFA 3L5MA 3UD6A 1D9EA 4NNBA 1G4EA 4BWLA 5CZJA 3C4UA 1TV5A 3LTPA 4HPJA 3OHIA 3G1FA 4ZQRA 1LROA 3KAOA 3M9YA 5SWUA 1HO1A 3QEZA 2NXHA 3STCA 1TPVA 2VOMA 1M5WA 3N14A 4MOZA 2B4GA 2J27A 2OT1A 3UWYA 4E38A 1EB3A 3TDFA 2VC6A 2GQ8A 1GPWA 4N4PA 1JUEA 4NJHA 1EWEA 1S5TA 5DY3A 3N19B 5CPMA 3OIXA 3PY2A 3UXDA 5HULA 5DCDA 4BF9A 3O15A 3Q2DA 2CLLA 4IMGA 3GXPA 2QJHA 2D73A 3PBUA 1VQTA 2NZLA 1GVQA 3QMRA 1H7RA 3QF0A 3E02A 1F5ZA 3L66A 3ABOA
chains in the Genus database with same CATH superfamily
3AHXA 3IV8A 3AIEA 1UP2A 3TJ4A 1JDEA 3GTFA 1Z69A 4P61A 2TYSA 1HKVA 2PDCA 3WK1A 2WMKA 3CQKA 2FIQA 3L4WA 1Z6KA 1DJQA 4GCXA 3CPRA 3EZ4A 3PPGA 2W6RA 4E2DA 3BCDA 4PMRA 1N8FA 3NNTA 2NT1A 4B5UA 3KOYA 3W7PA 4W87A 5M17A 4AZ5A 2VKZG 3WLIA 2HXTA 1TJPA 4X2PA 3RK8A 5KZDA 4D8AA 4AFYA 4NQ1A 1IZJA 3PJTA 2I5IA 4O0ZA 1DE6A 3NCOA 2PDFA 5A6JA 3R79A 3DESA 5C9RA 3WJYA 4Z1DA 1TUXA 2IQ0A 1YMYA 3P74A 1ISVA 3WL0A 4R53A 4MADA 1KTNA 3C2EA 1UR9A 1K02A 3PTDA 2AMGA 3CB3A 5IFTA 1UA3A 3G1YA 2ZBTA 4QQ3A 3WNNA 1TMHA 1LYXA 3RLUA 4OVXA 4XSLA 5I23A 3W7JA 1NARA 2XG9A 3IUIA 3LEPA 3EOSA 1QR7A 3OLGA 1C8YA 3FA3A 5CPNA 1M9HA 2QF8A 3IJIA 4B5XA 4ZB2A 4B91A 1EIBA 1EOKA 2Y7EA 4PCSA 3WJSA 4CU7A 3GY1A 1XLEA 4EPKA 1EO7A 5HJLA 3UCDA 1EGZA 3DX5A 3A3HA 3HV9A 3NQCA 3R0DA 1BSIA 5DXXA 4L1GA 2YDSA 3SCSA 3LENA 2UY4A 3MMUA 4JHZA 4R9OA 3H12A 3TSBA 4D6CA 2VP8A 1UCWA 3DH7A 1EDQA 3GNXA 4D72A 3CZGA 2YL6A 3F4CA 2JGYA 3JUGA 1YBQA 1EDTA 3VOCA 1DJYA 1VIZA 3U2CA 2E3ZA 4AIBA 1M65A 1EX5A 1U83A 3P14A 2XIMA 2YA2A 2INFA 2X8RA 2ZXDA 1H7WA 4FX7A 1X1NA 2E68A 5M3WA 1BKHA 1E51A 5GNZA 2YW3A 1J6PA 4JTDA 1ZLPA 1SFJA 2ZUVA 2A6NA 1UPPA 3VC5A 3TUUA 3NQFA 3HGJA 4D6GA 1F76A 3URNA 5DF0A 3NYDA 3II1A 2VUYA 3UXKA 1GHSA 1NP0A 3N12A 1SVDA 1YKWA 1PIFA 3FXGA 3B9NA 1LCOA 2QHAA 4B4HA 3L4ZA 1F05A 4IMCA 2P76A 3BE7A 2WMHA 1PCKA 1ME8A 4OE7A 4DO6A 3LBCA 5I3FA 1PKYA 3KTXA 5JMUA 1IR2A 3MI2A 5D32A 4KCWA 2W3ZA 1U1JA 4HMCA 1XLCA 4C6CA 3WJXA 3S2JA 3I7RA 3OTRA 3L0KA 1OCQA 4POCA 6PTDA 1CGVA 1UC4A 1P5BA 2Z26A 4F40A 2GVYA 1UKPA 1YNQA 1CENA 2EHHA 5RUBA 1V7AA 1X7FA 1XV8A 2OCZA 1AQMA 5LYRA 1TE6A 1QFEA 2E8YA 1E6PA 4ZR8A 2OGJA 3AWOA 5A6BD 4NAFB 4Z2HA 5KETA 3NO1A 1OYAA 5D2WA 1GOOA 5AC8A 1V51A 2X41A 5AY7A 3NTYA 5D33A 5BMXA 2PWEA 1ZP3A 4BEQA 4AD2A 4DUWA 3WNKA 1UD3A 4M6VA 5C8BB 3JW7A 4P8UA 4PMJA 4FXRA 1FFRA 4LYRA 4S3KA 1A5SA 4M24A 4LRTA 4AX7A 1MQQA 3WQ4A 3IEBA 3WFLA 1Y7VA 5HPOA 4YHGA 4IQLA 2X30A 3U8GA 3KBNA 2GGEA 3T05A 4CQ9A 1TZZA 3P0WA 3GE7A 5EFFA 1FWWA 4NL1A 2ZRUA 1UA7A 3WLKX 1A5CA 3GXNA 5FACA 1ZJBA 1XM3A 5HNTA 1JJKA 3WH6A 4PTXA 2FFIA 2FTPA 3WBYA 5BOOA 1XS2A 1I0DA 2Y88A 4CKQA 1Z8AA 4GINA 4DJFC 2J8FA 4H6RA 3RO8A 1DV7A 3CASA 5I09A 3ZLFA 3TA6A 3L4XA 1Q6FA 4DN1A 3C2OA 1VPYA 1NVMA 4U10A 3L4VA 4IP4A 1OB0A 1E9LA 4N7QA 4ZA0A 4ZMGA 1W1A1 3F03K 1DTNA 1AH3A 3OLDA 1P0EA 4NAEB 1TWSA 2C6QA 3TLQA 3LI0A 3ZWSA 2PPGA 1DJZA 4IG2B 2V38A 1UIOA 4JNMA 3F5JA 4WOZA 3PJXA 4C7FA 2XIOA 3QKEA 4RPPA 2E5BA 3URQA 3B0XA 3VTRA 4W84A 3THCA 1UWIA 3CWOX 4N0RA 2I16A 3W6YA 3PPHA 5J04A 1AH4A 1TQJA 3SY8A 3THAA 1OFEA 3VILA 1TZ7A 5B7YA 5AC6A 3R4IA 2R1MA 5IDIA 3U5YA 4ERIA 4I7UA 3W7RA 5E6YA 3BUVA 1BD0A 4C6IA 4PUEA 1CXIA 1A5UA 3P5ZA 5CC3A 2WVTA 4HU4A 3TV8A 4DWSC 1AG1O 1JULA 2OMAA 3QC0A 1ICQA 4XO6A 1SZEA 2PRHA 3VNKA 2BDQA 3TOYA 3PSWA 2Z6IA 1UZDA 1CXKA 1KV8A 3DFNA 1CGXA 5DFAA 3B9AA 4JDBA 4IIGA 1V7YA 3TONA 5D9MA 5EMLA 3QLDA 1X97A 4BI5A 4B3KA 4UTUA 4IWWA 2CFFA 4LUTB 4S3CA 5H6HA 3GHSA 4IQEA 4JTIA 2XPKA 4S3GA 3RF9A 1I2RA 3BANA 1WPCA 2GLKA 3FJLA 3M16A 1QNSA 4CNOA 4KFOA 4XX6A 2I17A 2PD9A 3L2IA 3WK2A 1BLIA 3UERA 1ADSA 4AIEA 2VWSA 5E0FA 6REQB 1CLKA 3RXZA 1HKIA 3BSMA 1G4PA 2XIQA 2WSQA 3SGGA 3UZYA 3IVTA 3NOYA 3CT2A 1SMAA 5HBFA 2J79A 1XYFA 4UCGA 3AZSA 1NFPA 4NKCA 2J8GA 2WLZA 1XLDA 5HXMA 2CESA 4DZIA 3EEGA 3FY1A 5HATA 2Z28A 2FHBA 2X40A 1ODUA 3FKKA 1YPXA 1EUAA 4RZ6A 4AYGA 1GONA 1FCBA 3A13A 3OVPA 3VAVA 3MP5A 2A3EA 3FHAA 4MAVA 1JZ5A 5D9PA 3DDMA 2Z27A 1QHPA 5C54A 3N34A 1FP8A 3I3DA 2PLMA 1TV2A 2DSWA 4LWWA 1TJRA 3OIHA 4Z2LA 1AJ0A 1L6FA 3QMTA 4I7VA 1RSCA 3OGSA 2P3ZA 4J2MA 5XINA 4QCEA 1S46A 1KM6A 2CBVA 1O66A 1AW2A 2ACQA 4ZB5A 2QXWA 5A2AA 3UWVA 1F2JA 3V36A 3DI1A 4UTWA 5K4ZA 3H21A 1FWDC 4LUJA 1W3IA 4FLQA 3H70A 3TKFA 2RUSA 3UVAA 3CL7A 4F0HA 1H5VA 1BVWA 2VFEA 3WQ8A 3HMJG 5A8OA 2PDKA 4U28A 3GDMA 3NQDA 3OLEA 2ZA2A 3LQLA 3DHPA 1REQA 4P8WA 1LWIA 2Q02A 4LF2A 4LCQA 3NJ3A 4J27A 3BV4A 3RX2A 4B5NA 3N18A 2PDPA 3MP3A 3UP8A 2G5WA 1NQ6A 1N8IA 2YFOA 1DIDA 2HV5A 1GOQA 3H55A 2IMRA 5CC7A 5HWNA 7REQA 5CBIA 4QSFA 1CEOA 4Y8EA 5GJPA 1EIXA 3MVTA 4U3AA 3P60A 1BYCA 1KM1A 1M6JA 3PFRA 1SFLA 2BOFX 3WLSA 3ZT5A 2EEXA 5HJXA 1LL7A 2YDAA 3NDZA 3HURA 1Y5VA 4LB4A 1F6KA 4LBRA 4L9ZA 3E2SA 3M7SA 1OJXA 2VZTA 4PSRA 1W9DM 2V3DA 5FOOA 3WQDA 1LQ2A 5JIWA 1YLVA 1PIGA 1FDZA 1K70A 4LS1A 4QX4A 3H2NA 4HYWA 1B4KA 5J8LA 3VNDA 2BG5A 4HYVA 3ITOA 2DZPA 3U2OA 4WR3A 5HDRA 4H01A 2HK1A 4CNNA 4XUYA 4IMEA 1PZ3A 3AHYA 2O9PA 2ZUNA 4LUSB 3TC6A 3MTWA 1A5KC 4IXHA 4DLMA 1RV8A 3FFSA 4HU0A 2KX9A 3M4HA 2Y24A 1TX0A 3COTA 2BY3A 1C8XA 5ABFA 1AUSL 1F7BA 4U3CA 1JCXA 3ICJA 1W5QA 5JBEA 2YCKX 4YU1A 2DGAA 2YR1A 4Z1YA 1KCXA 1Q2RA 3VE9A 1DJHA 4PTVA 4B5VA 2DZXA 4C6NA 1TPB1 1HG3A 5DT5A 1F61A 3L0GA 1E1CB 3TYCA 4J28A 1ZY9A 2VFFA 3CC1A 3DG7A 3R5EA 3V75A 2IPJA 2WJZA 5CAKA 8RUCA 2AGTA 1ZSXA 4O53A 1F3EA 1OD0A 4GUFA 3BGAA 3DBPA 2FMNA 4RK8A 2GDVA 3CV7A 4FNSA 6CGTA 2X1RA 3KHJA 4PTDA 1FCVA 1WDSA 1XBVA 1EPVA 4UTFA 3W9ZA 3HG2A 5BXTA 3ABZA 3L5LA 2EAWA 1X6UA 2PP3A 4HP5A 3B04A 3RM4A 4UTMA 3G1HA 3K4WA 2PGEA 4UUIA 3W7DA 5AHFA 2V5DA 4H7ZA 2C8NA 1DTUA 1NEYA 2PDYA 1UP3A 2C18A 3Q45A 3W2LA 2VEGA 3ZS4A 3EEZA 3G1RA 5T8GA 3SECA 3U48A 4S3JA 1G7VA 1PWMA 2CZVA 5U4NA 1JGMA 3JRKA 1UC5A 4R27A 3P81A 5FEPA 3FLUA 1S5MA 3AOFA 2E40A 1XIGA 3HBLA 2DZUA 1RH9A 2Q71A 5I3GA 1BGGA 2DP3A 4ZGYA 4MSSA 1NSJA 3NR0A 3LHWA 4DXXA 2WMJA 3ATZA 1ZJHA 1LF1A 3A9BA 3DFSA 3GIQA 3TCEA 3PR2A 1AJZA 4O4WA 3H4WA 3RDKA 3DEQA 4RDZA 5HR7A 4Y9MA 3T4WA 1K9TA 3FN9A 4I7WA 4U2ZA 3VKKA 3RCMA 3CHDA 3WUBA 3PZNA 3R58A 3WELA 3M46A 4CCZA 3G1DA 4JTLA 1OCJA 5DX7A 3S9YA 4HMDA 3N11A 2VQTA 5ECVA 2PDLA 2BV9A 4C6KA 1F4HA 1UH3A 4NI8A 3UR7A 2W61A 4W7WA 4IJCA 3URAA 4LEQA 2BNJA 5D9NA 3EX3A 1GJWA 2H8ZA 1BPLB 3ZR5A 3BMWA 3ARSA 4O1EA 3O7UA 4XD5A 5FF0A 3N29A 2GPTA 1AQHA 1KGWA 1IIGA 3UR5A 5HQLA 3V18A 3OJGA 3FGCB 3LG3A 4K37A 4WK9A 1SYTA 3HPZA 2INEA 1FHDA 1ME9A 4JZ5A 4DZAA 3ZJ6A 1GOWA 1HJSA 3SSZA 3EGJA 3H24A 5D37A 1R2RA 2GWGA 1J10A 1PHQA 4TUFA 3W76A 2WC7A 4C6EA 1PS9A 4DYEA 2ZRWA 3D0CA 3STGA 4GZEA 1OK6A 4QLKA 4HA4A 2WVVB 3W1TA 4ZEPA 2QPUA 3LZ5A 1QW7A 3LBMA 1V6YA 4RNHA 2B7OA 3NFUA 3PWAA 4JX5A 2CETA 2NWSA 3PAOA 3YPIA 2DIEA 4KEMA 2DVXA 4M1RA 2HSAA 3W4RA 1UJQA 2EPKX 2NXIA 1GHRA 3SW6A 3H7RA 3EAUA 1FWRA 3DFPA 3NQEA 1OT2A 2BY1A 1NTHA 2V2CA 2R82A 4H8VA 1YBQB 5ABEA 1GORA 4HN8A 1WKYA 1SW7A 2RDUA 4C6OA 4Z1CA 2QDHA 4NJIA 5IBXA 3VA8A 1UASA 3TQPA 1GUVA 3UWEA 4QSHA 4DI8A 3VOJA 1C3FA 1C8VA 4A8NA 4HK5A 1S2UA 3RFAA 3UJRA 5I3JA 2BLEA 3TFCA 1FUYA 3RN6A 2Y8KA 4M0XA 5D09A 3NAVA 1O5KA 4CQBA 4HHHA 3M5VA 4D8LA 3I6TA 4DJDC 2VO5A 3BLIA 4N9CA 4GVIA 1GOMA 1ZBWA 1Q5MA 1XCWA 2J9ZA 3ITVA 2C19A 4J3TA 3D47A 1P0KA 1A3XA 4C1LA 3ZMRA 4OECA 4RE4A 2PRMA 4J1OA 3PHAA 3VDCA 6TIMA 1PB0A 1XBXA 3MJYA 5HINA 3UZJA 4DAFA 3QSRA 4IIEA 3PZQA 1RCQA 5KMYA 1QOQA 3CAQA 1E6NA 3ZZ1A 3VD5A 2WMIB 2DT0A 2PRLA 3WFAA 5CCZA 4UMCA 4ZQOA 3QZAA 1B3VA 2OWWA 5HMEA 1UWQA 1VJZA 1TA3A 3EA2A 3NZGA 4OT7A 1J2BA 3P61A 1HJVA 5C9ZA 3C0QA 4GY1A 4UMAA 2QCEA 3TYEA 3AUOA 4ACYA 4UFLA 2V3GA 1UD2A 3NA8A 5BU6A 5REQB 3OHMB 3LGGA 1EC8A 2NV1A 5IHRA 1HL2A 1O5XA 3T81A 5KINA 2VXNA 4FB7A 3D5HA 3GAYA 1OFAA 4GXMA 4Q7BA 1OWQA 1DJIA 3FV9A 1FOBA 1J8VA 1FCUA 3TCSA 1N7KA 2EPHA 5KZEA 2NX1A 3PZGA 1UP0A 2BHUA 5C2CA 3B8IA 4JHMA 2E28A 5G1YA 3WYZA 4F8XA 3TC3A 3ONCA 4ADSA 1NWSA 1UWSA 2QDGA 2PDMA 4U5IA 5CPQA 3GR8A 5ABHA 4JNYA 1IEQA 4GZ7A 1DVJA 3PS7A 3TN5A 1H1ZA 1ONRA 3GDRA 4KCTA 3B0VC 1TPUA 2OKTA 3T09A 2WQPA 4O1DA 2CLKA 4XKYA 1W1B1 3BAXA 3WQWA 4YWSA 3G18A 4REQA 5K3VA 3OZMA 2XVGA 1P48A 4GKTA 5CZ0A 3W7IA 2FVLA 5K4XA 1J0YA 3BSHA 3M6DA 1HZYA 5C2GA 2WJDA 3NSMA 4KCVA 4ADTA 3W29A 4QE4A 4M6UA 4ZXLA 2Y61A 3TIMA 3FS2A 4H9ZA 4QNEA 1QCWA 2F6XA 1ONEA 5G2HA 1VD6A 1XH0A 2Z4GA 3S9ZA 3LN3A 1R9YA 4CD7A 2RKXA 1IT7A 3LM7A 2OWXA 3RMJA 2I7GA 4P2VA 2F8QA 3VIOA 4F48A 4QXIA 1ITCA 3W88A 3MJMA 3CPGA 1J96A 5I0DA 5HANA 4UBPC 2O9RA 2JF6A 2I56A 2HVOA 1VR6A 4HCHA 5M2FX 1Q8JA 1KC7A 3FCPA 5F4SA 4C6FA 1CLVA 1QRQA 3BURA 3WH5A 1EZWA 3AI0A 3S2LA 2Y7DA 4M5PA 4ROQA 4PGLA 1IEIA 3ZFHA 3UJSA 3GTNA 4GQGA 2GOUA 2YL8A 1ZCCA 1KWKA 3WF3A 4O4VA 3CUFA 4QE5A 2VX4A 4QRNA 2R24A 1Q7MA 1XRSA 2WM1A 3MKCA 3N9KA 3W00A 1KTCA 1G5AA 2E6YA 4M80A 3QH2A 3S1UA 1QI3A 4JQ4A 4U5KA 5BNKA 1IXNA 4ZFMA 4HPHA 1R3SA 1D8CA 2XH4A 1OINA 3W1LA 3ABXA 2QJJA 4FR1A 1QI0A 1KRBC 5AHLA 4ZZ9A 1A5NC 4W9TA 1FCQA 3CQJA 4X9SA 1HP5A 2FTYA 2FYMA 4HYRA 5CGTA 3KCJA 2PP1A 2Y85A 3LCWA 4I5RA 1JCMP 1Q6RA 1YE4A 1K9EA 2NT0A 1B3OA 1RUSA 3HPSA 2DZBA 3R6IA 5FI8A 4PMDA 3RITA 4MNLA 1UQZA 1MW3A 4HK6A 1Q6QA 3F5LA 3ES8A 5CEWA 1H61A 2NV9A 3CM4A 5A1AA 3LSCA 1QJWA 2NSOA 2WWCA 4QR6A 4BR1A 1XBYA 4L4LA 2Z2AA 4WX2A 2JIEA 4QCFA 4K3ZA 1X8CA 5HMDA 1GQNA 2NV2A 4V1YA 4JGDA 1Y8BA 3VGGA 3S83A 1LL6A 1WDDA 1KFKA 1X39A 3GU9A 2OSXA 2YCLB 4PRWA 1OYCA 3BQ6A 4UQCA 3T2QA 4Z42C 3T1GA 4XZMX 1G67A 1QNQA 2XN1A 3O6DA 4UQ9A 2YYTA 1W1VA 1M3UA 1PJ9A 2P5NA 4A3QA 5I02A 3W7HA 3P84A 2E5DA 5D02A 3HJZA 3H8AA 3WG6A 1RA5A 5FEZA 4QS6A 1TRIA 1MVYA 1UOZA 3GDBA 2GVLA 2J9YA 4ML9A 3RJYA 5KZMA 4UR9A 3N15A 1J6OA 3GHUA 1G9HA 3NQ7A 4MGGA 4S38A 3WUEA 5CXPA 4P7OA 4YHEA 2PDXA 2GSJA 1TV8A 4G56A 1XIHA 2XH0A 1P43A 3VMOA 4ICNA 4Y6GA 1NJJA 4EP8C 3LCIA 5GNYA 3B40A 2EF9A 2W79A 4PUUA 2BVTA 3GKFA 3H23A 2HQAA 3IJQA 1SSDA 4NHVA 4CD4A 2AL2A 1LG1A 4BI6A 3ZIZA 3CLWA 1DXFA 1V3IA 3EYPA 1QUMA 3T07A 2DT3A 1ITUA 1Z44A 3UJFA 4B3ZA 1A53A 3SFWA 4NXKA 4JICA 4WJXA 3IAPA 1ZGDA 5I3IA 1KM5A 3AHVA 3KL3A 3BGJA 1H0GA 3HQ1A 3PJUA 3PNZA 4XO7A 4KRZA 1BF2A 1E1EA 3BLDA 3B97A 2ZVIA 4PMNA 2YB4A 3TW6A 1AVAA 1UPMB 1RJPA 2VR4A 3PULA 3NUKA 3O1NA 1UWRA 4MKVA 2XIIA 1HJXA 3B9OA 1PL9A 1ME7A 3LDVA 2JKAA 5AVHA 4KW2A 3LMYA 1W2PA 5DMNA 5I77A 3MZNA 4RZ5A 4J3WA 4EXQA 3W1AA 4G8TA 3FYYA 3QPYA 1CXHA 4IX2A 3W84A 2ABBA 2H90A 2OEKA 1O1HA 4TIMA 2ZC8A 5A8GA 2PC4A 3TR2A 3L12A 3VIPA 1EQPA 3EWCA 3LV5A 4ZENA 3M07A 2VEMA 4IT1A 1IEVA 4C5YA 4GLEA 3M41A 1XFBA 1V0MA 1ZBCA 3I65A 1R47A 1JRCA 1S5VA 4DEFA 3WO8A 5B80A 4Q4OA 2GGIA 1MDRA 1CB2A 5HQEA 3SCUA 2O56A 3AYTA 1WQ5A 1KXQA 3CEPA 1W31A 5BMWA 3NPWA 4GPNA 1B30A 1WDPA 5JH2A 3DFTA 4ZO6A 1Q66A 2DT1A 2VGBA 4H41A 3MPGA 4NXSA 2Y5JA 2RFGA 4YNGA 2C15A 5HNRA 4YMZA 2DU2A 3E9AA 1PKLA 1CXFA 4A3HA 4RNIA 3CPUA 4PA8A 1R6WA 5CGMA 3K1GA 3LLXA 3EDJA 3ZVHA 4GYPC 4UFKA 1XGZA 3M0HA 4GJIA 5D03A 1HXJA 3HU7A 3LCGA 4Y96A 4AEEA 3THUA 2VTFA 2HPIA 5HOSA 4P7LA 2H6RA 2E4TA 3AYSA 1IT8A 1ZALA 4H9VA 3EX1A 4R7OA 2PU0A 3AIRA 1OFQA 2WNWA 4Q8VA 1X98A 1ISZA 5FSDC 2ZZ4A 2RAGA 3MBFA 4QJ4B 4JTKA 2PDQA 2EKCA 4GH1A 5D9OA 3SUSA 4O11A 3N17A 4GXWA 3H26A 4LANA 1X6NA 4BA0A 2YZRA 1S5WA 2G3FA 3EOEA 4TOQA 3DG6A 2FTWA 2G4FA 4QDWA 1U1UA 5CZJA 2BVDA 4CD6A 3TTOA 3C4UA 1JXJA 5I2UA 1LROA 3RO6A 4AD5A 1JAKA 4FOJA 2NXHA 3KHDA 3STCA 4MUPA 4P8XA 3BOFA 2VC6A 5FD0A 4IHCA 2VQUA 3PY2A 5C7HA 5H8MA 1JYWA 4BF9A 1UZHA 1YNYA 2CLLA 3GXPA 4XZLX 4H6QA 3T6CA 2JALA 3AIQA 3VD4A 3QMRA 1F5ZA 4WEVX 3OZYA 3MMDA 5FCZA 4YIWA 3BQ5A 4TTGA 3WFZA 3HGOA 2ZFAA 4FNTA 2JK2A 1JIBA 3P62A 2WZTA 4LFYA 2HVNA 4UTKA 1Q85A 1XQKA 4W93A 1Z9AA 2KZHA 3DYPA 3RYSA 3W1UA 2VZSA 2Y2WA 1TE1A 2QNEA 4B9YA 2OLSA 1XSJA 3KDNA 3XIMA 3A64A 2ISVA 2PA6A 3K8KA 1GZ1A 3NDOA 2QQ6A 4DJED 4HNVA 1TTPA 4E3TA 4JYDA 4K1WA 3BJSA 2WZMA 3L23A 2WKLA 5CGQA 3NO3A 4P7NA 4Y9AA 4ATLA 3GYCA 4INFA 2OB3A 2Y63A 5PTDA 4CQCA 8CGTA 3OVRA 2GK1B 2E9MA 1MW0A 3KTCA 1Q4NX 3VM5A 2F84A 2GJXB 4M19A 4QAWA 5BZAA 3N04A 5I3KA 3CIWA 4GVFA 4WF7A 3WF0A 2JGQA 4DUXA 4CU8A 3AYVA 4O52A 4JDYA 2YZ5A 3LCLA 3BW4A 4EF9A 3DIPA 4S1FA 5CSRA 2Y6ZA 3P8IA 2ZYFA 1RP8A 3U0HA 1UMYA 2WZHA 1OY0A 4RV8A 4TMCA 3OYXA 1W9PA 1WV2A 3TK7A 1Q6DA 3F4VA 4DYJA 3EXTA 3VD9A 3CYJA 3O8AA 3TU9A 3GX9A 4MB3A 1ONWA 1KFCA 4HSNA 1HX0A 2DSKA 1A4MA 2ACUA 3TJIA 1ZJAA 3W86A 1D7FA 4H3DA 4F2TA 1TWWA 1TWZA 4IP7A 4LAZA 1V08A 4RXFA 2VCBA 4S23A 3MC5A 1Q13A 4TVCA 1UD6A 2W67A 4Q3MA 1B0IA 2EPNA 5K9DA 1EO5A 2G3IA 3TE9A 1VJIA 5EKYA 3QC3A 3B9DA 3PK7A 4M8UA 2OZ3A 4FEZA 4Z0JA 3ITTA 3B0YA 4J2PA 2C7FA 2F38A 3AAMA 2CPUA 1WYIA 4F66A 3POCA 3CMJA 3M5ZA 1E9IA 4JN8A 1U2YA 5LSMA 2J7EA 4AXKA 1QTWA 2PWDA 3H4XA 3WBAA 2VZUA 4H04A 1RQHA 3VX0A 5I3DA 4DB7A 3EB3A 5DLCA 3BCJA 1WDRA 1SJAA 4KIEA 1IR1A 1IZKA 2W62A 1SW0A 4CNSA 3F5KA 3ONBA 3A4AA 2W5FA 3KDOA 2DSUA 1P6BA 2A3CA 1GVYA 4PTMA 4OHQA 1JCYA 4V28A 1X6LA 3IARA 2CCRA 4UC5A 4ZXOA 4WUIA 1LZOA 4IISA 1POJA 4F0MA 4OTKA 1H1NA 2DJXA 1QU4A 2ZRVA 1L9WA 1XHGA 4OQVA 4Z08A 4JL1A 1KM4A 2QCHA 3GIYA 4QJ5B 2ALDA 3F4NA 4U31A 1UG6A 3EDDA 2VGGA 4UIOA 4WGXA 3BJFA 2FQIA 3IGSA 3UEQA 3APGA 4CGTA 2D22A 1W6TA 3T2PA 1BKSA 5GJNA 4LUYA 4FK9A 4N9EA 3U4FA 3G6LA 4TQTA 1V6TA 1K7XA 1HGWA 1FFQA 1K3UA 1DPMA 3EWBX 2XFFA 4JR5A 2ZE3A 4ZO7A 1MUMA 3AMDA 1FH8A 3NZ1A 4KEUA 1OGGA 3SFKA 3NYZA 4Q7NA 2VX6A 1ECEA 3PZTA 3PUGA 1JDDA 2BTMA 3T8LA 3MWCA 4PMQA 2D3NA 3LTYA 4LC6A 3WZ0E 1GKQA 4IIFA 3QZEA 4JY9A 4I9TA 4MYAA 3TNBA 5JBDA 2PSNA 4Y90A 2Q6ZA 5EGRA 2Q3RA 4MY1A 1G94A 1XRVA 2FZNA 4RZ4A 3K8LA 3R43A 4AHPA 3AO0A 1FWGC 3VD7A 2TPSA 4E5TA 3FKRA 1IXQA 2OZ8A 3LZ3A 3V3WA 4E2OA 1R85A 1P0DA 2ODOA 2V6AA 1R3TA 1K9DA 4JIPA 3INPA 2QJMA 1I75A 3CZJA 4GISA 2X05A 1E4IA 4B90A 3WH7A 4HOZA 5LA1A 2Q01A 2PAJA 1J0HA 4D6IA 5CSUA 3NURA 1F3WA 4AY1A 1DOSA 3SJNA 1PBGA 4Q4KA 1MEHA 3UF9A 3DU0A 3GNNA 2NQJA 3MMWA 4IQDA 5D8WA 2QJNA 1XIEA 4JBRA 3FK4A 4JD4A 4UZSA 2VUNA 3LPPA 5TNVA 2ZADA 4W5ZA 3AMKA 3WSUA 4S2BA 5LNSA 2XVNA 1OVDA 4HTYA 2NQLA 4DIAA 4LS0A 4XBJA 1JYVA 2OZ0A 2PF8A 2J88A 1GEQA 2ZCGA 1P4CA 1EX1A 3QV9A 1MRQA 4Z0SA 1K7FA 1CCWB 3W7EA 1V6XA 4GYKA 5J5RA 5CPTA 1DYSA 4LPCA 5C9WA 2OTDA 5CAHA 1RLDA 3MT1A 4D1IA 1NWUA 3KBJA 1QW9A 2P3EA 3M7WA 4AWEA 4PB4A 5IXEA 1R2TA 4ENLA 3SADA 1OIFA 3NL2A 1GKRA 4IFRA 4A2RA 1P6CA 3LRMA 3O16A 3EMCA 5A8NA 1EJTC 3AHTA 3WDRA 1Z42A 1SR9A 1S1PA 1HVQA 1GOKA 2XZ9A 2FB2A 3VNLA 4D71A 2JEQA 1FH7A 2XU2A 2QULA 2VL4A 4AXNA 2GVEA 1J4EA 3AHZA 1RPKA 2PP0A 1TPFA 5H91A 4FNRA 4UQBA 4L80A 3SRFA 3GXFA 3GW0A 3QQ1A 4IL0A 3U4AA 2VM8A 3SCTA 2PWVA 4Q6JA 1PE1A 2AQOA 1P6WA 4XD3A 3J7HA 2C91A 3U3HA 4B9ZA 3G8EA 3NQ8A 2ADAA 4QTGA 2OT0A 2PDUA 3OEXA 2VVNA 2V3FA 1DE5A 1SJBA 4J35A 3S4TA 4UNKA 4JYFA 1MNZA 3H2AA 3V0UA 1V8EA 2DT2A 4UB9A 3P80A 3CH0A 5EA9A 4N02A 2VC9A 1NQKA 4C7DA 4W5UA 1CPUA 4UFIA 3WLHA 1QPOA 1B1YA 2V67A 1XH1A 2FH6A 4BQ4A 4JQ3A 3G22A 4XZ9A 1F74A 1HVXA 1PDYA 5LKYA 4FNUA 2B31A 2CBJA 4FR6A 3DUGA 3PBGA 2BOGX 3TJXA 3R0KA 4HKPA 4O50A 3R12A 2YLLA 3QOKA 2BFGA 2PE4A 2QV4A 3G5EA 3AXKA 1XIDA 4Y9NA 3DGBA 3GW3A 4KBXA 1W9BM 1I4NA 1BXNA 4YTTA 1NM9A 4ZQPA 3SN0A 1YXCA 3KW3A 4NRSA 4H7VA 1H3GA 3SQLA 1UR4A 5A6LA 1PAMA 3WLPA 3BPWA 4V27A 4GQQA 4CU6A 1XCFA 4RDWA 1ZNNA 3AU6A 1B54A 4LAOA 4CD8A 3WD4A 1QPNA 4IUGA 5FJPA 1W9XA 4JPGA 3TTQA 1UOKA 1TV4A 3WQOA 4X63A 3VIHA 1S2VA 4BY3A 4BEUA 4K39A 3CO4A 3DKJA 3RHGA 2VDGA 2Y7FA 1I6NA 1SPQA 1F73A 2HS6A 3E0FA 2X0HA 3QHNA 2J7GA 3B8DA 1EHNA 3M1ZA 3Q58A 4CNPA 5BU9A 3A3WA 4F3HA 3GHRA 3PB2A 3N2CA 4UTWC 1H2JA 1TPDA 4LBUA 1I2NA 1NU5A 4Q4MA 4JFVA 1R3YA 2OOGA 5IRPA 4TXEA 2J78A 3T7VA 3S6OA 4OIFA 3L9CA 1QOXA 3ELFA 5A6AA 4I9JA 1PKMA 3DAQA 2BGNE 4Y9PA 4GNVA 2ZDRA 1GTEA 3KVKA 5JXQA 4TO8A 1XKYA 4QGCA 4LNCA 5DRIA 3GTIA 3EDFA 3KBMA 5GJMA 1AW1A 1XINA 4J3XA 3S47A 3APYA 2CHNA 3AYRA 4JX4A 5DMYA 4YVPA 2CNCA 2PLCA 3EB2A 2GUUA 2A3AA 2Z1BA 4JTCA 5C55A 5AZ0A 4LYQA 1CZ1A 4XZBA 1VHNA 1G01A 4KMQA 4ZOEA 1VYPX 2WBKA 9RUBA 4WQ6A 4PUJA 5CZSA 5HUPA 4AZCB 3VZYA 1L6YA 2ZQ0A 2AAMA 2ZZ2A 3UESA 3C0SA 2W4XA 6ALDA 1U5VA 5E0KA 3UCQA 4Q8NA 3NIYA 4QROA 3GBDA 2WW5A 1KBKA 1H62A 3VGDA 3EMZA 5BW6A 3GFYA 4O15A 1JZ8A 4C91A 1BAGA 1YE6A 4N9DA 3AIVA 3QBUA 4CEXC 1L6GA 1JGIA 4JIQA 3FVMA 3ZLHA 1MNSA 3S1XA 1XIFA 2BWGA 3QFWA 3BMVA 3RM8A 1XL9A 3PZMA 5BWFA 1TWDA 2V30A 1QXLA 1TG7A 1M7PA 4MKSA 1Q63A 1QPRA 2CBUA 4AEFA 3NOEA 1DEDA 3A21A 1A50A 5H8PA 1LOLA 4I3GA 1J01A 1F4AA 3CB8A 3PUOA 2AAAA 1W1IE 1MXDA 5I3HA 1T8QA 3NPUA 1V3JA 1R38A 2DVUA 3S1VA 1J18A 1FWBC 4ACZB 3AIBA 4K8GA 1XIBA 1PSCA 4E4PA 3GZAA 1EFZA 3SGZA 3O07A 1QHZA 5CJNA 3WLMA 5AHMA 1QPKA 3URBA 1XLFA 3GWQA 3AMLA 3WLTA 1ZAIA 4MDOA 2D0GA 4MY8A 1AH0A 1L8NA 4NG3A 1YDVA 3GNDA 4DBWA 1JNEA 1TKKA 4DJFA 1JDFA 1ZAHA 4XIAA 1JPIA 1NDVA 2WBGA 4OKDA 3LXBA 5L6UA 1M1BA 5FJUA 4HVXA 4PYSA 1DBTA 1A49A 4XD6A 2E7FA 3WENA 2BBFA 2EKGA 2XFYA 4IGNA 5A69A 1F8MA 4ILSA 1JI2A 1XLJA 4IIHA 4FO4A 3VFLA 4GE8A 4YLWA 2PURA 2A7PA 5LIKX 3IGHX 5DEZA 2WANA 1LBMA 1UR0A 1FXPA 2P88A 5HUOA 3BMXA 2Q3OA 4QHRA 2YL9A 3NPXA 1KCZA 4L5ZA 4B16A 2RGLA 2WYSA 5C2XA 4D9PA 3PANA 4LY4A 1W1TA 2VDHA 3W1PA 4IMFA 4OJYA 1EGVA 5GPRA 3HTWA 4HOXA 1TTIA 2E6FA 4JS3A 1OF6A 3ENLA 2YCJA 3I68A 3LY0A 3DI0A 3M0YA 2WJEA 3C8NA 2H3BA 4DUVA 1HN1A 2J62A 2A4AA 3NZRA 3KL5A 1OX4B 1YPFA 4ZE5A 1OIMA 3KVMA 4GGHA 1TIWA 3NL6A 4WLCA 3T2OA 5LNWA 1WXYA 1UWTA 3CK5A 4IMAA 2VX7A 1RBAA 4H9UA 4NZCA 4JKKA 3AIWA 2G41A 3GXMA 3M44A 2PDHA 3F7JA 1GQIA 4HIBA 1ITQA 1ZHAA 3PZOA 2QZRA 5FEXA 1Q7ZA 1JUKA 2W0UA 2XN0A 2SFPA 1A3WA 2PUZA 2TAAA 3DFOA 1S2AA 2Z7GA 3KLKA 4GC4A 1W5OA 2PDIA 4ASTA 1HKKA 3SEPA 3WF1A 3R10A 3DOPA 2PDGA 1OZMA 2ZX8A 3AUJA 3NPVA 4EOUA 2V8ZA 3AZTA 2DUXA 1BGAA 2BSLA 3L68A 3W83A 1KBLA 1CLXA 1YQ2A 6TAAA 2Y70A 1B9ZA 3E0WA 3OYZA 2OR2A 3S46A 2D2OA 2EBNA 3IRSA 4AHQA 4IPJA 4JN7A 1V0NA 3WKZA 2I57A 1HJWA 3GKAA 1FHUA 3UJ2A 3C2VA 1RVKA 3KZSA 1WUEA 1P7TB 1HL9A 1GVOA 5F2LA 4ZSUA 3L5AA 3RLGA 3SI9A 3SCRA 6XIAA 3W6LA 2BXYA 3G3DA 3ISIX 2PWHA 4Z2GA 3FDGA 3PJWA 3PG8A 4M7TA 1O94A 3S1GA 1RD6A 3TSMA 3RR1A 4G5DA 2ZA1A 2XGIA 5AYBA 1WOAA 1MQRA 4MG4A 3SSJA 3LERA 1XKJA 3BJTA 4ES4A 4C1NA 4YL2A 4O14A 2Q8ZA 1MDLA 2G96A 4GO9A 3CEUA 2GGJA 3GH5A 1KLYA 1UIPA 1UJPA 1B90A 5CLTA 3GC2A 3ME3A 3W73A 3H6OA 1LQAA 3BARA 4W88A 3LBOA 1THFD 1H11A 3MHFA 2RGMA 4NJKA 1JZ3A 4QJ3B 2OYKA 2PDJA 4L4MA 4FXSA 4X61A 1GYLA 4OFCA 2J66A 3EMQA 2VFDA 5C9UA 4XTIA 1QHOA 4OBRA 5H2ZA 4GIEA 4O0QA 1XYBA 2YB1A 2P10A 2ZX9A 4E2BA 1UQYA 4FALA 5MKGA 1FQ0A 4X22A 4WKAA 3AICA 5EMYA 4MWAB 2VCCA 4F2BA 2WSKA 4UTHA 1ZCOA 4G1NA 4L6DA 4QLLA 2UY2A 2R1PA 5I5RA 1TJ0A 3F2CA 3O05A 4NJJA 2DW7A 3EKZA 4GI8A 1V02E 3KL0A 3APTA 3HA1A 1D3CA 1W5MA 4PCTA 1UH2A 1N55A 1XD1A 1H7PA 3I10A 3UWWA 2W9MA 3VNZA 2PODA 5AYIA 1CGYA 3F4DA 2OJPA 3SIMA 3ZVIA 2REQB 2R94A 4YN5A 3UWUA 4E3VA 1BRLA 5C6MA 3TMLA 3NXFA 3NDYA 3STEA 1FWIC 4HPNA 1ZQ5A 2TRSA 3BCFA 4XBSA 2IPGA 4ORIA 5T9BG 3S6DA 1MYRA 3HPAA 4HPGA 4IICA 3QV6A 1EBHA 3T4CA 2ESCA 4GXPA 4OU1A 3BXWA 3CV6A 3UA4A 4Q4SA 1GVIA 4R9XA 2WZEA 4WSJA 4PUNA 4PUMA 1JD9A 1I1XA 3ARWA 4EAYA 4HNUA 3C3NA 1U5JA 3W22A 1R3WA 1UB3A 1BEUA 3ARVA 4FX6M 4M7SA 2ZUWA 1WB0A 1GT8A 4J3ZA 1XWYA 2QCCA 4E8DA 4MB4A 3HFTA 1XG4A 3F4WA 1LRNA 3GO2A 3ITGA 1EOMA 4JFWA 4ADUA 3W75A 1TJ2A 3U9IA 3B8SA 4IH3A 3SBFA 4JTSA 3D3AA 2YDQA 4AD0A 3SDOA 2OQYA 1IWPA 1HKMA 2ZZ6A 1GPFA 3DECA 4RUBA 4WSHA 4AZIA 4S3FA 1ZJIA 1XUZA 2YYUA 4DXKA 2Y8VA 1ZS2A 1TMLA 3EX2A 7TAAA 2A1YA 4OOZA 2GQ9A 3E12A 3PBYA 3RU8X 4F0LA 1KQYA 3WLOA 1EPXA 3FIGA 3JS3A 5TIMA 3IIVA 3W87A 4D6JA 4GUJA 1RQEA 4UFHA 3LLDA 4K8HA 3W2KA 3WQCA 1V02A 3H2EA 1AW5A 1EJUC 5TQLA 1J93A 4WRHA 4GIAA 3C3UA 1IV8A 2V5BA 3IV3A 1W1PA 3V1HA 4AVNA 1DHKA 3VZZA 3SCOA 2CXGA 2DZAA 4XK2A 4RZBA 3RCYA 3ZQ9A 1LWJA 3NSXA 1TSIA 3FVDA 1JYNA 3LCFA 2FH8A 3M0KA 3AXHA 5T26A 4CCEA 2OEMA 3O63A 3TFXA 4ZFCA 2XSAA 2ZWZA 2DDXA 1J0ZA 2XGZA 4DO4A 4KF1A 3B0UX 1CX9A 3EOOA 1DWIM 1VENA 4BQ3A 4CVWA 3W25A 4KCUA 1U1HA 4DF0A 4IL2A 1UD4A 2WHJA 2CEQA 4I9MA 1PX3A 4HTBA 1UUMA 2E09A 3O6CA 1EA9C 2ISDA 3RCNA 5JH1A 1K77A 3VIIA 3ZJKA 2H9AA 3HV8A 3VGHA 4C1KA 4C6PA 1CXEA 2Y5EA 3UR8A 4PCPA 2XH2A 1KW1A 1VB9A 2J7BA 2QR6A 4IZGA 3BOLA 3WQVA 2OX4A 5CBJA 4IJBA 3CUIA 1XG3A 1WAUA 1EZ2A 1WCGA 1PCWA 3WBEA 3VABA 3QY8A 2JKPA 1WO2A 3NGFA 1AK5A 5FJJA 2QCDB 5LNUA 2CWNA 3LSBA 1JXKA 2PLKA 4Y9OA 2WO5A 3IVSA 3CV2A 1PTAA 2NUXA 3CJPA 3RMEA 2ZDSA 2CHRA 3R8GA 2WVSA 5AFDA 3GG8A 2ON3A 5BXPA 3ALGA 1UUOA 1O7AA 1TQXA 2P0IA 5C5YA 5AYYA 3A22A 4GQBA 5DCBA 3ITYA 3VKJA 3VX1A 3EWYA 3GXTA 3DC0A 2PMQA 3N6HA 3ZXWA 4PC8A 1BTMA 3W07A 2XINA 1O68A 4ALDA 1A3HA 1XIIA 1W8GA 2QLYA 3VDHA 2VJXA 3P82A 4LW7A 5HAOA 2AQWA 1K8ZA 3ARZA 2DVTA 3CUHA 3EPOA 3ARXA 4R88A 1X8FA 1DIKA 4JN6A 4UR8A 4NILA 1KM0A 2CBIA 3EX4A 3VI2A 3DCPA 4NU7A 1K1DA 3WN6A 1ZTVA 1O5RA 4J7RA 3PBVA 3WMCA 1YXDA 4G9PA 4LNYA 3WDIA 3I7QA 1MW2A 2J13A 3FW6A 3N73A 1UUQA 3WL1A 2VD9A 2P1FA 3CU2A 4X0NA 2X2GA 1KV5A 1LDCA 4P8VA 1GOXA 1NDYA 3KX6A 1OG6A 2PGFA 4Q8OA 2PBOA 3A9IA 4L61A 3ARPA 4RJEA 4J3SA 4O28A 1FDJA 4PEEA 1G4TA 3XISA 3KM8A 5U7SA 2NX3A 2LLEA 1DQXA 4IFOA 1O12A 3TYUA 3MUXA 3KCOA 4DY1A 3QR1A 4EF8A 4AHOA 1GVRA 2IXUA 1KKRA 3SUWA 1DIEA 1XLHA 3EKLA 2PCQA 9XIAA 4ZOAA 4NZJA 1VF8A 1VHCA 4S3BA 1AMYA 1YTDA 5FKYA 2WHMA 3A6OA 2XGBA 4UMBA 1E4LA 1MXGA 2WSRA 3WQGA 1ZPTA 2HVMA 1GZJA 4Q4PA 5LXEA 1WX0A 2TSYA 3N25A 3N2OA 4DM2A 2CLMA 3MYOA 3MVIA 3IJ7A 4M6PA 4V15A 3PZIA 2ICSA 3BW2A 3VKDA 3W02A 3PN8A 3Q65A 4N2YA 3CH9A 1M41A 3USZA 4NZ1A 4UTTA 3KTSA 3N9SA 4GI4A 5D4YA 2E5CA 1TR9A 3G1XA 5EMJA 1UROA 4BZYA 3NEHA 4MIMA 4OV4A 1G7UA 3ES7A 2WPBA 2VHLA 1BQCA 4L6HA 1L8PA 1W3NA 4PEKA 3K46A 3LV6A 3NGJA 1K8XA 4L1WA 3O9NA 2ZWYA 3OQEA 1VBGA 4AWTA 1XPGA 4GBUA 2X16A 4RX0A 1MFVA 4ZOBA 3PUEA 3L65A 1BYAA 3QW3A 1GQJA 7A3HA 4GFIA 1PEZA 3QQWA 5EBUA 2D69A 4ERAA 1OGSA 3L4YA 1NOFA 2J74A 2GJLA 2JIWA 2DQWA 2X1UA 1VZWA 4GABA 5F1UA 4YYFA 1E71M 2QF7A 2C1HA 4UWMA 4R34A 5TAOA 3CTLA 4TTUA 1UWAA 2ZUUA 4O19A 3T40A 4ZODA 1WAWA 2A0NA 4FA3A 1SO6A 3T0TA 4HQVA 2MUCA 1LLZA 3GH7A 4XZHA 3PBWA 2C14A 1C7SA 3GG7A 1SUXA 2TODA 3QHOA 4TU1A 3CS2A 2QIWA 3LHTA 1DQUA 2WKGA 1LLWA 3T44A 5E70A 4R33A 1QNVA 4ICMA 1EF3A 3QY6A 1KR0A 3NQVA 2BY0A 4QG9A 3SQSA 1T41A 3KEHA 5DANA 3ID7A 3B8WA 4PRTA 1C90A 3MANA 1OCBA 3PZVA 3PC0A 3SCQA 2OYMA 4J3VA 5DCEA 4DNHA 3MMTA 4PE8A 3IK4A 2QAFA 4NNBA 1RLCL 4PN2A 3OHIA 3G1FA 1O6IA 1YIXA 3M9YA 5SWUA 3EPNA 3JU2A 3UG4A 1M5WA 3N14A 4M82A 1EB3A 4HJFA 1JFXA 3QGAC 4N4PA 2PC8A 3PWIA 3LPFA 1EWEA 4DJFD 1S5TA 1KD0A 5I06A 4Z2JA 2XIBA 5E6ZA 4PB5A 1PO9A 1KRAC 1VP5A 2NZLA 3E02A 1V3KA 3N6JA 3ABOA 2E77A 2V82A 2P8CA 1ONXA 3BLLA 4JTGA 1A0DA 3E5BA 1AMKA 4KETA 3BO9A 1EP3A 4GKLA 3KCLA 2QMKA 3CIXA 3VKAA 1TVNA 3GIPA 3A5FA 4UNIA 1XICA 3TP4A 3TROA 1ESWA 3OO2A 2QUTA 2YIHA 3KS5A 5HA7A 4MDPA 4DNMA 4I5XA 1CGWA 2QCLA 4X60A 3V0SA 4XWUA 1NF7A 4HCLA 3HG5A 2HE8A 2UY5A 2C0HA 1U33A 4DWDA 1XGEA 3ZLGA 2YA1A 4PBGA 1V3HA 4HT3A 3G77A 3OG2A 2UBPC 4FNQA 4PBEA 3TW9A 4DF2A 1J12A 2VGIA 4MM1A 1D2KA 3B06A 4GIYA 3T55A 1EKOA 1MI3A 3NO5A 2X0YA 2GQAA 1KO0A 4A22A 4XZIA 4ZE4A 4YTSA 1JL8A 1OABA 4DWSD 1VFUA 1A5MC 1FA2A 3S5ZA 1ZFJA 1WXZA 3NQ6A 1LJYA 3K8MA 1OK4A 4IJRA 5BYWA 3CNYA 2G3MA 3KOXA 1ZENA 4AY8A 2O9TA 4NAEA 4BQ2A 6ENLA 2OSYA 2Z0IA 2EQDA 4DX3A 1YDYA 2ANUA 4IG2A 2DZTA 1W3LA 2B81A 3KLLA 2Y89A 1NFBA 3VO0A 2QUNA 1HGYA 3DG3A 2HCVA 1I9CB 3IIOA 4GY0A 2V63A 4C6DA 2WSPA 3LX9A 4I6VA 1E72M 1LP6A 3ORWA 3NL3A 1KTBA 3RAOA 2ZUTA 3LU2A 4HGXA 1E0VA 5KEZA 3QKZA 1EUNA 3TEVA 4UOZA 3NM1A 5K7JA 5JBFA 1MSSA 2HRWA 3AQUA 3MCNA 5A3HA 2JFEX 1EA0A 4K1GA 5TF0A 1R3RA 4J4KA 3A4XA 4PMVA 3PTKA 5FSEC 3MUIA 5I78A 3ARTA 1P0BA 3T78A 3WNMA 4F79A 4HU8A 3HQPA 4EE9A 4C6QA 1W9UA 3E0IA 3W70A 2BX7A 1UYQA 4CVUA 3BC9A 1OG0A 1M01A 3C52A 4QEHA 3QYQA 1R87A 4LUTA 4WIWA 3T08A 2YBUA 5CJ5A 2FJKA 2QUMA 1EJSC 4XAPA 3HO8A 4QJ1A 4GCAA 4AG0A 4AQLA 4BQ5A 1H49A 4S3DA 1MRAA 2WPGA 3W28A 2QUUA 4NZ5A 2X1IA 1QO2A 4F0SA 1EQCA 6REQA 3WCZA 5BRBA 2EXOA 4H00A 4WSKA 4PSPA 1XIMA 1GYMA 1AD4A 1E43A 1B3YA 3S0CA 1NELA 2V3EA 4MB5A 2CLHA 4LTSA 4IM4A 3AU2A 3KP0A 1WZLA 1Y0EA 3GK0A 4LAKA 1QNPA 3MDUA 1VRDA 3E0LA 3M0ZA 1B57A 1UWUA 3E96A 5HR6A 4PCNA 1LM1A 3OVQA 3IUDA 4GMEA 4AZGA 3WNPA 4URIA 3EKGA 3VUPA 4Z1BA 2VFGA 1HW6A 3DN5A 1ZBVA 5FF7A 3GC4A 1V3MA 1XDLA 1E6ZA 4L65A 1BRLB 1MEIA 2GDUA 3UCCA 3BAIA 5F4XA 4GNJA 4FOKA 3W81A 2P53A 3S2CA 4G7EA 1XW8A 2XH7A 3IIPA 1XFCA 2VMFA 4WOQA 3S6TA 2XWEA 2OG9A 2F9RA 4C7GA 1CGUA 3QV7A 3CUXA 2A6LA 2VZVA 4PRRA 1IXPA 4RLIA 4ZB0A 4QE1A 1KA9F 4JTHA 1QI4A 2D3LA 3UZXA 3B9EA 2BXZA 4UTJA 4AIOA 3O3RA 4DJEA 1SO5A 1VAHA 4MWAC 2PI6A 1TREA 3ITCA 3VNJA 3W27A 3WMBA 1C91A 1H1YA 2WNZA 3AS2A 2YFNA 3RPTA 1FBAA 1KB3A 3QTGA 4A05A 5AZ1A 1NDWA 1O60A 4NVTA 4IGHA 2ZRZA 4KRUA 2XVLA 3NEVA 4BHYA 1RCXB 1XPYA 2YXGA 4JQAA 4U4MA 3V5OA 4JXCA 3SN1A 4GYPA 4KGJA 3AISA 3N9RA 4MTVA 1VFHA 4TVDA 1VFSA 4KT2A 4M3PA 3ZJ8A 5AOUA 1TWIA 2YDRA 3HMCA 5M03A 4P5UA 1C7TA 5K9CA 3AMGA 1OT1A 1J5SA 5DY2A 3W38A 3UXLA 4XKMA 4E4FA 5DO8A 5C70A 4LUSA 2E9LA 3EXSA 4BCEA 1VGAA 4FF7A 3BAJA 2GZXA 3UGRA 3S5NA 1E6SM 4Q4RA 1WA3A 3HQNA 4R5EA 4G6CA 3UWQA 1SZGA 3N3TA 3ZM8A 2BVWA 1VLWA 2Z00A 3RUBL 1I45A 1ISWA 2DEPA 3M0VA 1X1ZA 1FY6A 4IPLA 4XVEA 3WQPA 4DBSA 2FGBA 1SM9A 3REQA 3N4EA 4F0RA 1W3KA 2NQZA 2V5KA 3OBEA 4HJWA 3B8VA 5D30A 4E2VA 2ZZ7A 3E2QA 3AZRA 3LNPA 1JZ4A 5CC6A 4XISA 4XZNX 1E1CA 5C0QA 2CZFA 4FXFA 1WDWA 4Q8TA 5LIWX 1BWVA 3M0MA 3BDKA 3S5SA 2JBMA 4HZ6A 1BVNP 3JR2A 5A6SA 3CL6A 3M0LA 2PEVA 2VR5A 2WJFA 4XAZA 4QAIA 1OX5A 3C2FA 1V6UA 3BWWA 2NVAA 4UQDA 3I6EA 2VRJA 5FAJA 2F61A 2WSYA 4LH8A 3O2LA 3VMNA 1A0EA 2HPMA 4FI4A 3BAYA 1E9ZB 3CWHA 3TZNA 2ZXAA 2PZNA 2ZZ5A 1KFLA 2PTWA 3GFXA 3TOPA 5JIPA 5HNUA 3WF2A 1MFUA 2XM1A 1E6XM 1TO3A 4JTRA 3MI3A 2WC3A 1IF2A 2BY2A 2FZBA 1R30A 1VBRA 1S2TA 5CJMA 2QV5A 1GG1A 4NNCA 3P2VA 4A35A 2QIIA 4GZJA 2V81A 1DWHM 4H8HA 3U57A 2Q8XA 2IUZA 3QGKC 1Z41A 4ZTYA 8XIMA 3L7RA 1US2A 3TYDA 4MWAD 2PWGA 3V5FA 1R3QA 1ZU8A 1B9BA 3W7CA 5DRCA 4YTRA 1RR2A 4DF1A 3CYVA 3S42A 1EC7A 4O1CA 4M56A 2EPMX 4H7CA 1GVFA 3ZSSA 1IE7C 3JZEA 5AYZA 1B3ZA 1RCOB 1XF0A 3RJXA 1EWDA 3OZOA 1JZ7A 2WK2A 3LHVA 4RDYA 4YVXA 3IANA 2YBVA 3JVAA 5EBAA 1Q6EA 3KP1A 1AQFA 1Q6LA 3TAKA 3B4UA 4DI9A 1PHWA 1PTGA 3C2YA 1VPXA 1PZ2A 3VCCA 3VMPA 1TB3A 3BAWA 4V2XA 4QEEA 2DV0A 1AL8A 1G1YA 2QAPA 2FLIA 5DBTA 1GJUA 4EKJA 3QRHA 3WLQA 1ALDA 3FXYA 6XIMA 1IYXA 2BMBA 5H8UA 3W1QA 2PLJA 1KM2A 3TWAA 3TH6A 4LC8A 3O06A 3FGCA 4YS1A 1L6WA 3C61A 1K4GA 4PUWA 1VBJA 5AHEA 4Q6XA 2W27A 2DZSA 4Z17A 3HM7A 4ORMA 3S2NA 4FSAA 1FHLA 1NP2A 2NLIA 4DJDD 2F2HA 3P3BA 2XZ7A 3O0FA 4ZL1A 4XZWA 3TXZA 1AFSA 4FF5A 3WD0A 4HNNA 1FWJC 3G6MA 5FJIA 4QIUA 4WHBA 2WVVA 4WY0A 3LS9A 1JZ2A 4EPBC 1US0A 1F3TA 2XSXA 3UQNA 5IHSA 3QGVA 2V0TA 3MUZ1 3FSTA 4XUGA 3SUUA 4LGXA 1H7XA 2FZDA 3AS0A 3AXIA 4LCSA 2HK0A 1XLAA 3UGVA 4PCFA 4YWIA 4E4UA 5M5DA 4RDVA 5LA2A 5CKSA 4M29A 2E25A 4O1BA 3QW4B 1XC4A 1FWCC 3SAZA 4IGSA 3C8FA 4W7VA 4IUOA 4H83A 3GG1A 7TIMA 3UNDA 2DQXA 3SGUA 1HNYA 4JIRA 4N9BA 2OODA 4G7FA 1SU5A 1JUBA 2WMFA 4AISA 2PD5A 3ANUA 4JIEA 5JUVA 4PTWA 3WMLA 2J75A 4JEJA 4K2SA 2WNNA 4C6BA 4GWEA 2CC0A 4HNTA 3N4AA 3N2XA 2XYLA 4HMEA 3G3MA 3TN6A 1PPIA 2D2GA 5CPOA 4A3UA 2QS8A 1H09A 1L2UA 1I60A 1TRDA 5D04C 3UG5A 2O55A 3G2GA 2ZXBA 2WMIA 2YLAA 4B5TA 3S1WA 4LXFA 4D6HA 3HGSA 1R0MA 3RM9A 5BRQA 1H41A 3GVWA 3P0XA 2I9UA 3GTHA 5LHFA 1KFWA 3IJ9A 4O8RA 4MY9A 1FWEC 5I07A 4EPEC 7CGTA 5REQA 8TIMA 4FZIA 1UR3M 1LL4A 2O4MA 4XIMA 3WBXA 7XIMA 2VNCA 2WHKA 3T0AA 4WKHA 4IF2A 3LRKA 4HA3A 3MB9A 1LOSA 5BXSA 3RILA 3E38A 3W1MA 5IDZA 3IPWA 4GUIA 5BCAA 1VFTA 4AC1X 2VURA 3M5XA 1EEPA 4PUKA 5CBBA 3ANYA 1EP2A 3QR3A 2FFCA 3FA4A 3CHCA 2G50A 1G69A 1DIOA 4GQ0A 1W1ZA 1FX6A 3VKBA 1GW1A 3NVDA 2O4QA 1JPMA 1KQZA 2XM2A 1PTDA 4RCXA 3D3FA 1XP3A 4GGBA