2CLFA

Tryptophan synthase in complex with n-(4'-trifluoromethoxybenzoyl)-2- amino-1-ethylphosphate (f6) - highf6 complex
Total Genus 97
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
97
sequence length
268
structure length
253
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASRA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 97
structure length 253
sequence length 268
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2clfA00
5F1VA 3HPZA 1ZNNA 2A21A 3G8RA 3W23A 4TR9A 3UXDA 4N6EA 2J9XA 1IF2A 1S5VA 1TV8A 2ZZ1A 4K6AA 3SI9A 4HNTA 4NXKA 2QJHA 3W76A 2ZRYA 2HTMA 5MHBA 3QSRA 4HIBA 2V2HA 1I2PA 4UTWC 1JUKA 4Z1BA 3GYEA 5HUOA 3EXSA 1QPNA 2RHGA 5CZ0A 4HHPA 1QPRA 2OZ0A 3P8IA 5CSRA 1EUNA 1S5TA 5CSSA 4UC5A 1WXJA 1GOXA 3DFPA 3W6YA 4LOCA 1VYRA 3TSMA 4Y9AA 5DCEA 2NUWA 3LRLA 3S6DA 4RR4A 4GUGA 4NJHA 3TSBA 2R14A 2X2GA 1OFQA 3HF3A 4JGDA 4MJMA 1WBHA 5BRBA 3UQNA 5TQLA 4NZFA 3BG9A 5LHFA 4NVTA 4JTLA 3OVQA 3UNDA 1TPUA 3LHVA 3NPWA 4LV9A 4S2BA 4M6QA 4IXXA 5FF0A 1XFBA 3TXVA 4MYXA 3EXTA 3HG2A 3LTYA 4GNJA 3PB0A 5J5DA 2KZHA 3QZEA 3L2IA 3B03A 1Q45A 3L68A 1GG0A 1W0MA 3QMTA 3LTSA 2TSYA 4Z1DA 2ISVA 4AEOA 3W72A 3CHVA 3H53A 3NO5A 2ZZ5A 2RH9A 4LC6A 3M16A 4ZL1A 1PS9A 3S5ZA 1SO4A 4JDYA 3O6CA 4TO8A 2QJIA 3LERA 5TBOA 1K7EA 1XBYA 4GUHA 1HL2A 4LU0A 5K3VA 3P61A 3M5YA 3GIYA 4ORMA 4O14A 4WJEA 3TKFA 3IRDA 4CQAA 1VYSX 3G1FA 5EY5A 3DI0A 4FX8A 1AK5A 1ME8A 1FCQA 1I4NA 3K30A 4M6PA 3EWUA 3NQAA 1P0KA 2XN1A 4OHQA 2OX1A 4YCOA 3TAOA 4AWTA 3FEMA 2YYUA 1WDWA 4QM1A 1KFLA 2DZPA 3BG3A 4FHAA 1TRIA 8TIMA 1R2SA 3OEXA 3THAA 3QFEA 3NG3A 4TMBA 3O06A 4R53A 1K8XA 4NNCA 4R34A 1JCNA 3L65A 1GG1A 3ANYA 2GVLA 3THQA 3LCGA 3LBMA 3QSTA 3C56A 3SJ3A 3N2MA 3OIXA 4UFJA 4BWLA 2NLIA 2FTPA 4PL1A 1W5MA 1EP2A 1K3UA 2QF7A 1KFBA 1ZENA 3TJLA 1XBVA 2EF9A 3UWYA 4FNPA 3PR2A 4QAIA 3W7RA 4ZQOA 3G1HA 5H2ZA 2E5CA 5FEZA 4XUGA 3UWQA 2Q8ZA 2BTMA 3RLVA 2ALDA 2ZZ3A 3USBA 1TTJA 1OYBA 1TQXA 4FF7A 1U83A 2PE4A 4O50A 3G1SA 5HR7A 1KW1A 4RJEA 5AHMA 3LV6A 2J6XA 1KFCA 1LOLA 1SZGA 1CI1A 1SZEA 2Y7FA 4JIQA 4O12A 5D2TA 4OBTA 3HO8A 2QCDB 1JUEA 3M5ZA 3NM1A 4MVAA 4YXGA 1EP3A 1XCFA 4XBSA 1A53A 4S1FA 1WQ5A 4AAJA 2RDWA 3TIMA 1Q6LA 2ISWA 3TSDA 5AHFA 5D38A 5L9FA 4UTKA 4K38A 4O13A 1H1YA 3ZWSA 1TO3A 1L6SA 2PRHA 3R13A 2DP3A 1FCUA 2RDTA 1NF0A 3GK0A 3L0NA 1GYNA 4MY8A 3M44A 4MFDA 4FIQA 4JX6A 1DOSA 3BGJA 4UNKA 3BPWA 1KLZA 3HG4A 1L6YA 3DZ1A 5LNUA 4JTGA 2A4AA 4JYFA 3VI2A 3NQMA 1VS1A 2W79A 5DBUA 5I3IA 2OMAA 4JX5A 1MZHA 3GDMA 4Z1CA 4NXSA 3PC0A 1W31A 4M5PA 4JR5A 5AHLA 4MJZA 4DXVA 3L5MA 5F2MA 1LRTA 4FO4A 1EWDA 1F73A 3P7YA 4ADUA 4GRSA 1OK6A 1QAPA 1I2QA 2V9DA 3F1QA 3HGOA 2V30A 2BZNA 4H6KA 1SW7A 5AFDA 2VELA 5LSMA 5K9XA 3FJLA 2CLIA 4JTEA 4K39A 5DXXA 1N55A 3RMJA 4LVBA 2CLOA 1GVRA 3S1UA 3LDVA 1VC4A 4RLIA 4J9JA 3JR2A 1B4KA 3QH2A 4NT0A 4QNEA 3UWWA 2CZEA 4GXMA 3KXQA 3NPXA 4BK9A 3HGRA 5E1QA 1OFRA 1W3TA 1D3GA 2VEIA 2Y7EA 3FFSA 3B05A 3S0CA 5AN7A 3HGSA 4Q32A 1TV5A 5HQEA 3EWBX 1PHWA 2C15A 4KKXA 2PURA 2QCHA 4XBKA 2E6AA 4IJBA 1I45A 1SZFA 3QW4B 1OX5A 1K8ZA 3B04A 3TQKA 2J24A 1W3NA 3CEPA 3IEBA 3W2LA 3LB0A 3W88A 3M5VA 3BGGA 4LUJA 1VJIA 3S9YA 3KX6A 5U7SA 3L0GA 2DJXA 1L9WA 4L4MA 3IV3A 3QYQA 4JIPA 1G7UA 3HB9A 3T7VA 2CU0A 2IQTA 4UXDA 2GOUA 2WQPA 3G1XA 1ZHAA 4UUIA 3BV4A 3PUOA 1A50A 5G1TA 1JJKA 4PA8A 1SFLA 3TCEA 1MO0A 3LM7A 2O7QA 1PL9A 5J5RA 3GXNA 4JTHA 4Y90A 5CG7A 1C8VA 2V2CA 4AHPA 4MYAA 1VPXA 2TMDA 4O18A 1KBJA 3F03K 3NL5A 1W1ZA 1YDOA 1F05A 5D33A 1HTIA 3G0UA 1W56A 3LCXA 3NNTA 4C1KA 5KSWA 3C3NA 3GLCA 3QC3A 3G1YA 3NR0A 3P67A 3KRSA 3SIZA 5CKSA 1UBSA 5K2ZA 2QKFA 4KWVA 1I8JA 1MXSA 4IX2A 3LTPA 4TIMA 1TPEA 4O1DA 3B06A 1WA3A 4ML9A 5FEXA 4LTSA 4MIMA 3OVRA 5G1YA 1UJPA 4BWLC 1K7FA 2Z2UA 2NX3A 1QCWA 5DBTA 3TA6A 3TDFA 1B3OA 5CPLA 5E0KA 1H7RA 2QCLA 3OA3A 3P84A 3L21A 2ZYFA 1YDNA 3NVTA 5LKYA 3W70A 2GVJA 1QO5A 2AQWA 3CPRA 3U6WA 3LGEA 3C8FA 1IXOA 1FX6A 2DZTA 3TU9A 5AC6A 4YLWA 1X8FA 2Y85A 5G2IA 2YPIA 3EKZA 4KFNA 1DV7A 1RR2A 5LNSA 4TU1A 1TV7A 2HMCA 3SW6A 5FEPA 4EF9A 4O0ZA 4EWND 1Y0EA 3LI1A 2G95A 3VE9A 3L9CA 3EB2A 1XUUA 1W3IA 5D2WA 3LX9A 4L4LA 1QDSA 2CZ5A 2JGQA 1LRQA 5I3JA 1GPWA 4E2BA 1GT8A 5K9DA 5FF4A 4FB7A 1GVOA 2OT1A 3CM4A 3MJYA 1ICPA 4PH6A 3S5YA 4O1CA 1OF6A 5G2HA 3W2JA 5AHEA 3BLFA 2VFEA 1ZAHA 1EX5A 1UCWA 4EIVA 3LHTA 3EX3A 2V82A 2VFGA 5CPOA 1H63A 5AC8A 1N8FA 3QQ0A 3O05A 3LHZA 1WV2A 1J2WA 1LP6A 1YLVA 1LBFA 1DJNA 3KVJA 4ZMGA 3QMRA 1AW2A 1FUYA 3N3MA 4IOTA 5CGQA 3MP4A 3KVLA 3RU6A 1M5WA 3UWUA 4LT9A 3MBFA 3WK3A 1LOQA 2YDAA 4KFPA 2JGYA 1W5OA 3C2EA 3MYOA 1G4PA 3SY5A 3IGUA 4JDBA 1O94A 3NL6A 5G2WA 1XL9A 3DU0A 3W2UA 1XBZA 4UNLA 4UMBA 3V75A 5H91A 3W1PA 3I65A 1FWNA 2H3DA 2QR6A 3W71A 3PY2A 2BSLA 3L66A 4UTTA 4MLJA 1O95A 4DBEA 3S8HA 5LNVA 2J27A 1HFBA 2QCCA 1YTDA 2ZRZA 1LOSA 3M6YA 1FCVA 1XDMA 3DENA 4QISA 4N4QA 5D2VA 3TR2A 4JNMA 3R89A 3TW7A 3P80A 2YGYA 2HS6A 5HULA 4FNUA 4OT7A 1OX6A 6ALDA 3PG9A 3GVGA 4UTJA 4FIRA 4H4IA 4O52A 1ZJIA 3NXFA 2ZCGA 3G24A 1VR6A 4WY0B 5I3HA 4HT3A 4FNSA 1TTQA 1J4EA 1M7PA 4Z0JA 2F7FA 3M43A 2GPTA 5F4WA 3W75A 4O1AA 5HUPA 3BK0A 4AMAA 5HNRA 1IIHA 3W7IA 2CLEA 2JBMA 5HR6A 4GBUA 3VCRA 1M7OA 2P0OA 3BW2A 4P2VA 4CQ9A 2VC6A 1H60A 2NV2A 4RZ4A 2C14A 4WZHA 2GUUA 4LW7A 1OFBA 3T4CA 3G1VA 4ADTA 1QOPA 3EX2A 3PAJA 3MP3A 1A5BA 1OF8A 3FYOA 4NX5A 3NQGA 3UPBA 3OG3A 2RDUA 4UR7A 2VFHA 1W37A 3NL3A 4LS2A 1PVNA 1XDLA 4GUIA 2W6RA 4N9DA 3LXAA 3UPWA 4XTDA 1QNVA 1WOAA 3TV8A 1UUMA 2OT0A 4OQVA 3AJXA 1F6KA 3RF9A 5D03A 3PUDA 1O5KA 4LUIA 2PRLA 1RQEA 4M19A 3T40A 2QJGA 2C16A 1TSIA 1BWKA 1V5XA 3PBYA 1YXYA 3S5NA 3LBCA 3FOKA 5SWUA 1NAL1 2JKAA 5DCBA 1BTMA 3HGJA 1H7OA 4ZVJA 3IIOA 2ZRVA 3DAQA 4WD0A 1H7WA 4HPJA 1NF7A 4W9TA 1XBXA 3M9YA 4IMEA 1R2RA 4DELA 2B7NA 1FWSA 2CLFA 2CWNA 1G7VA 1G4SA 5D32A 5F2GA 2Y88A 4O57A 2E6YA 3W7KA 1AL8A 2YX0A 3DH7A 5FF3A 1HO1A 2X16A 4LNYA 3KFTA 3GKFA 3IVSA 5FF2A 2E09A 2VFDA 1ICSA 2OCZA 5FI8A 2WOQA 1ZY9A 3N14A 4K7VA 3W7EA 3OHIA 3W1MA 5I3FA 3STFA 3R8RA 5CZTA 3G1AA 3LRKA 5DY2A 2ZDRA 2B7QA 3W1TA 5KZMA 4ADSA 1KM3A 1JCJA 3TC7A 3LI0A 4O19A 2XN2A 1P4CA 2DZUA 2YW4A 1TPVA 4IQLA 2WSQA 3DKLA 3I7SA 1SZNA 5IBXA 3TH6A 3Q2DA 3GX9A 2ZA3A 5BOOA 2I14A 3WJSA 4AB4A 3ABOA 3U8GA 3C61A 4RX0A 4DF1A 2OJPA 3G18A 3EX1A 3W3OA 1OFPA 2V2DA 3S5OA 3NQ8A 2FJKA 4RK8A 4QITA 3PVFA 4Z08A 1FWWA 3O07A 3ATZA 2GJNA 4QSHA 3NQDA 1KTCA 3HMJG 2CLHA 1QO2A 4A2RA 4HNNA 3EWYA 4N9CA 4MY1A 4K37A 4CQ8A 1OJXA 4KFOA 3HG3A 4Z0SA 1GWJA 4BI7A 1LLWA 3BVJA 3S42A 3A21A 3LRMA 4XWUA 5ABTA 6TIMA 1GYLA 2CFFA 3T78A 1W5NA 1AG1O 3PWAA 1Z42A 4JS3A 4OV4A 1LORA 2ZZ7A 3Q94A 1KM0A 3W7DA 1L6WA 3CEUA 3GNDA 3FJ6A 4UFHA 4JTJA 4PFMA 4A22A 2NUYA 2R8WA 4OGZA 2ZA2A 5BMXA 4GUFA 4IX0A 5C5YA 1Q6OA 1JQVA 1OABA 3MP5A 4TX9A 3W1NA 3W74A 4O53A 4N4PA 3TW6A 1TQJA 4UTTC 2NUXA 2J9YA 3O63A 4C1LA 4BI5A 1B4EA 4RCXA 4H3DA 3NQVA 4R7JA 5F4XA 4WXZA 3PS7A 4DQWA 5KINA 2E5BA 3B0UX 1JR1A 2DU2A 1H51A 4TMCA 3TUUA 4NJIA 4O54A 4RXGA 3BLIA 3O15A 4ZQCA 5AB3A 2GQAA 1ZAIA 3DKJA 4MZYA 3L5AA 3SGZA 4GC4A 4NJJA 1PCKA 1AW5A 1VHCA 2ATMA 3D0CA 4AXKA 1DJQA 3MHFA 3RK8A 1H1ZA 5HWNA 2E6DA 2FQIA 1LRNA 4FEZA 4G1KA 1TB3A 3PBUA 3WJWA 2FPTA 3PM6A 1LTDA 1S3HA 3B4UA 2Z6IA 4IXHA 4NX0A 3EWWA 2Q3OA 3W7GA 4WY0A 3KVMA 3TQVA 3P8JA 4M7SA 4POCA 4LVAA 3B0PA 1NSJA 4EVZA 4O28A 3PB2A 2P10A 1GTEA 1EP1A 3W9ZA 2ZRUA 3BW4A 3UY8A 5LHEA 1OVDA 4FNQA 4Y8FA 2G96A 2DORA 1T8XA 3W1QA 2WNNA 5IM51 2QCEA 2X1RA 2XN0A 3GAYA 4AHOA 1MEHA 4GUJA 2EAWA 5C54A 4N02A 3TNOA 1BEUA 3MUXA 1K03A 2HSAA 3RFAA 3HPSA 1EIXA 1LBMA 3Q37A 3GDLA 3W7PA 4MOZA 2YFOA 4AWSA 4DPQA 3NA8A 5EA9A 5EKYA 2B0MA 3CB8A 3M5XA 1VGAA 4LS0A 3OVPA 1EPXA 4UTUA 3ABSA 1QR7A 4FX6M 4YL2A 2WV8A 1TTPA 3QRHA 1VLWA 4GE8A 1W5QA 3GDRA 2ZZ4A 1SU5A 5IBXC 3FA5A 4GWEA 4Y96A 5K4XA 1YYAA 5A8GA 1WYIA 1BKSA 2YXGA 2CLMA 2E5DA 3TX9A 2A5HA 4AVFA 2WSRA 2V5BA 1ME9A 5FESA 4CNPA 1F6PA 3CT7A 3I6RA 2CZDA 2X1UA 5HJLA 1AL7A 3O1NA 3NZRA 4MZ8A 3BW3A 2V81A 3ATYA 1SPQA 2FFCA 5G5IA 3S1XA 4LY8A 4ZQRA 1O4UA 2W0UA 2C0AA 1XUZA 2EKCA 2E68A 3W1LA 1JCXA 1KM6A 3B8DA 2H3BA 3DFOA 2VEKA 1TMHA 2AAMA 3C0JA 4BR1A 3N9SA 3GXTA 3DXIA 1D9EA 3GDTA 3M7WA 3W2KA 4LV4A 5F2IA 1TPDA 3FLUA 5AYYA 2FIQA 4RZ6A 1OYAA 1F5ZA 4JN6A 4X3ZA 1GTHA 4DO6A 5D30A 3NQCA 3HBLA 1IIGA 4OU1A 3UZJA 3IGSA 3W7MA 5LNRA 1P1XA 1GJPA 2C6QA 5KZEA 5KITA 5CZJA 1O60A 4X22A 1KLYA 4CCEA 1TPWA 1G4TA 2ZTKA 3PSWA 2YFNA 1JCYA 3ABRA 3E0IA 3P60A 3RLUA 3PBVA 1FCBA 4XZ9A 4N2YA 1F74A 1G4EA 3O6DA 1H7NA 4WXYA 4K8HA 1SR9A 3PG8A 3G1DA 2QAPA 4WOQA 4JD4A 1SSDA 4IMDA 4NNBA 3L5LA 2FB3A 3CC1A 4O4VA 1LCOA 2I9EA 3P81A 4JTKA 1H61A 3QJAA 1VLIA 3O8AA 4UMAA 4OV9A 3TE9A 2QDHA 3W7NA 2A85A 2WKJA 4JTUA 1JRBA 2PCQA 4UTWA 3W7HA 1H7XA 3T55A 2FDSA 1T0OA 1X1OA 1KA9F 3P82A 4IWWA 4FNTA 1LLZA 4QQ3A 4IMCA 3N2XA 4IMFA 5E93A 5LZLA 3IIXA 1W8SA 3QW3A 4E38A 4NQ1A 3DFNA 3LHYA 2R94A 3C2FA 1A5SA 4JTIA 4E0CA 3QEZA 3LCWA 3U2OA 4QNWA 1JQXA 1EUAA 1OX4B 4I9AA 2PC4A 1SW3A 5K7JA 1TCDA 4PODA 4UTLA 5D02A 1IXNA 1H7PA 3LHUA 3TAKA 3KHJA 2GQ9A 3DFSA 4A2SA 1YADA 4PC8A 2JKPA 3KOFA 1ICQA 2RKXA 1FDZA 1ZAJA 3MHUA 1L2UA 1EEPA 3CWNA 3STGA 2QCDA 1DQWA 2J88A 5KTLA 3MO7A 1O5XA 2NV1A 2CZFA 3GDKA 3QPYA 5DCDA 3W22A 2Z0IA 2QAFA 2QUTA 2DZWA 3S1VA 3KRUA 2QEZA 1NVMA 2A0NA 5CPNA 1FBAA 5FEWA 2QCMA 1P0NA 3MW7A 1F76A 1SO5A 4K8EA 1WOBA 1OFOA 1YDVA 4D2JA 1YXCA 4LC8A 4AF0A 2NXGA 1UB3A 3W7OA 1FWRA 5BNKA 1G69A 4I7VA 5I3GA 4LWWA 5AC7A 1SW0A 5LGXA 4PL2A 1JRCA 1KV5A 1YTKA 4N6FA 1E51A 3PF3A 1CX9A 3BG5A 1IXPA 3UWVA 3NGJA 4NU7A 2BWGA 3CQ0A 3W7LA 1WBJA 4BF9A 2DZSA 3W73A 2X30A 1EWEA 4X2RA 4DEFA 5FF7A 3MI3A 3LLDA 1TPFA 4AWUA 3JRKA 2Y61A 1WX0A 2TRSA 4DBDA 4AHQA 3WK1A 1F7BA 3O6YX 3JS3A 3EXRA 2QCGA 2VENA 5I3KA 3SFKA 4Q4KA 1OFAA 4RXFA 3TFCA 3W2MA 3L67A 1V7YA 1OFDA 1AMKA 3UD6A 1QPQA 3TQ0A 2CLLA 2Y89A 4KWWA 3GR8A 4ZQMA 2GJLA 3SGUA 4JYEA 4A21A 3EX4A 1SO3A 2CW6A 3R2GA 4CCCA 3STEA 3BO9A 2NX1A 4NNAA 1R2TA 4U4MA 4MKNA 5G4WA 2BLEA 2WNZA 2YYTA 3NQ6A 3CIWA 2H6RA 1J5TA 1P5BA 4O0KA 1GQNA 2B4GA 4LVFA 2ZQ0A 3W7CA 2V8ZA 3N9RA 1G6CA 1W54A 1R30A 1PHQA 3M41A 3PSVA 2VFIA 3A24A 3TFXA 2Y70A 5C6MA 2H8XA 4XKYB 1DVJA 4P61A 4HNUA 2FLIA 2FPYA 3NQEA 1A5AA 5KZDA 2Y62A 5AYXA 5T26A 2V5LA 3G22A 3HOJA 4DF2A 3HJZA 1YPIA 1ONRA 3LCLA 3A5FA 2YW3A 3TROA 1JCMP 4E2DA 3ZFHA 2X1TA 3W7JA 1Z48A 4GFSA 2B7OA 2Y7GA 3E9AA 2ZTJA 2DZVA 4MPQA 4I7WA 3NZ1A 2A7PA 3CIXA 3W07A 2GVGA 4AH7A 7TIMA 1KTBA 5L6UA 3LCFA 4Z1AA 3H54A 2VEMA 4K36A 5DXYA 1GVQA 3G0SA 4DPPA 4DF0A 1HO4A 3IVTA 4UIOA 3N19B 1RQHA 1FY6A 1SO6A 5G4EA 1NEYA 1VRDA 1KBIA 3ZWTA 4WUIA 3TMLA 2VXNA 4O17A 3O16A 1XI3A 4ALDA 4EOUA 1C9DA 3EX6A 3LXBA 4HSOA 4UR8A 3UYCA 2ZZ2A 3P5YA 3GXPA 1DHPA 2NXHA 2ZRXA 3MYPA 1YPFA 4LVGA 2QDGA 3QM3A 2ZBTA 1LROA 1GVSA 3UXAA 1KM1A 1GVFA 2C3ZA 5LNWA 4O8RA 5EL1A 3N73A 2EGZA 2BX7A 3G3MA 3DFQA 2EHHA 3CU2A 2QUUA 2DJLA 3F4NA 3LCIA 3G3DA 2ZA1A 1TIMA 3W2NA 4Q33A 4R33A 2LLEA 3SR7A 3GR7A 5CZSA 3UZ5A 2ZRWA 1QPOA 4JY8A 4WY0F 1FQ0A 1TTIA 3TK7A 3ZS4A 3GZ3A 1PCWA 5HWMA 1MEWA 3C2RA 1VYPX 4IGHA 4A29A 1I2NA 3NQFA 1JVNA 1HG3A 4YMZA 2NWSA 3FKRA 2JKEA 2ISSA 3KAOA 2B7PA 3HIJA 3KRZA 1THFD 5D2YA 1VCFA 5EYWA 2C1HA 2TYSA 2Y63A 5U4NA 4ORIA 2NZLA 3NL2A 3I7QA 3MMTA 2E6FA 2RFGA 1SSGA 3NM3A 3W84A 4ICNA 1LZOA 1PIIA 4GJ1A 5C2XA 2ZFAA 2WJZA 1YTEA 1H62A 4ONVA 4O1BA 5LGZA 1OFEA 2A7NA 1TPH1 1OG0A 3SZ8A 4OE7A 3TMQA 3VKJA 3SECA 3LOTA 3G0XA 1BWLA 3C52A 3F4WA 1C29A 3WK0A 4CNNA 4QJ1A 2WSYA 3DHDA 3QF0A 2PRMA 3TJXA 5F4SA 3NDOA 1IGSA 2ABAA 4JEQA 4LRTA 1LM1A 3W83A 2E77A 1FXQA 1RVGA 3MI2A 4Y6GA 3LV5A 5EPDA 3IVUA 2GQ8A 4NJKA 3NPVA 4I7UA 3WJXA 3W85A 2Z6JA 3FS2A 4JTTA 3DHFA 3H55A 4RV8A 2E1DA 4HSNA 1DBTA 3WJYA 2HS8A 3LLFA 5BMWA 5D2XA 4K7YA 4M6VA 3SSJA 4IUOA 3HG5A 5GVJA 3I68A 1TPC1 4DO5A 1KTNA 1I2RA 2C18A 3DGRA 5AOUA 3FIGA 4MY9A 2WO5A 1W5PA 3GB6A 1TJPA 2WNQA 2C19A 3DFTA 1RZMA 3VNDA 3TXZA 1KM2A 1X1ZA 2ZZ6A 3BARA 4JYDA 3WFAA 3RNDA 2O7SA 2H8ZA 4FXRA 5CPMA 5D09A 3KVKA 3IGXA 3MI6A 1ZCOA 2ABBA 2DZXA 1LDCA 3EWXA 4JICA 4PCFA 3E49A 2VEPA 1FDYA 2Q3RA 1PE1A 4O15A 3W87A 1N7KA 4CNOA 1R46A 1DKWA 3W7QA 2UV8G 4N9EA 1VCVA 1KFJA 1K02A 2H90A 4QIUA 3HQ1A 3NPUA 5DN1A 3CTLA 4FXSA 1WAUA 1FXPA 2JK2A 4FX7A 3NEVA 3P62A 3M47A 1DORA 3DI1A 4M7TA 4XQ6A 4WX2A 1G67A 1MSSA 4UFLA 4NJGA 3DBPA 3E02A 3A9IA 2NX9A 3VE7A 1Q6RA 1T96A 4IMGA 4CLMA 1H50A 2V0TA 2TPSA 1LYXA 4NUWA 1TYGA 3T44A 3C4UA 3QMSA 4DO4A 1S5WA 1IXQA 4EF8A 4JTSA 4U28A 3UY7A 5HMSA 3R5EA 4HNVA 3M1ZA 2A1YA 3C2OA 4MZ1A 3BLEA 4HPXA 1Q3NA 3HPXA 3NOEA 2WPBA 1B9BA 1ZALA 2Y7DA 3N34A 1GEQA 4UCGA 4B5NA 1KFKA 2FB2A 1FWTA 2YCEA 4HN4A 4UFIA 2A6LA 1D3HA 3CWOX 2QCFA 3PBWA 3W86A 2X1SA 2ATSA 5BW6A 1KFEA 4UTMA 2QCNA 3P5ZA 2Z1BA 2Y6ZA 1R47A 3MWAA 1Z41A 5F2LA 1RPXA 3FYPA 3NQ7A 5D37A 1VH7A 4JTFA 1XC4A 3CLMA 1A5CA 1ALDA 1QWGA 2XFWA 3NYZA 4UFKA 3YPIA 4WQ6A 3V1PA 4YWIA 3G8EA 4JX4A 3OBKA 2FPVA 3UWZA 3E12A 5TIMA 3W1UA 3IIPA 3NAVA 5AYZA 1I2OA 1VCGA 3L0KA 1LBLA 4UTIA 4LRSA 5C55A 3ABQA 2P1FA 4UFMA 1F2JA 5EBUA 3VFLA 3EWZA 2D73A 4AF0B 1KM5A 2Q8LA 4IPJA 5K4ZA 2AGKA 4XKYA 2A7RA 2R91A 4N9BA 1DQXA 3QPZA 3M0ZA 5DLCA 1YXDA 1XKYA 3P74A 3GKAA 4CCDA 4O11A 1JCLA 5HWJA 1KV8A 1KM4A 4O16A 4A3UA 4YCPA 1TREA 1VHNA 1X6UA 2NWRA 1FDJA 2EPHA 2CLKA 4RZ5A 4UTHA 1H5YA 4BFAA 2NXIA 5DELA 4S2CA 2A2IA 1MEIA 5K9CA 3W1RA 1QMLA 1SFJA 4FNRA 1X7FA 2YR1A 4XTIA 2VOMA 1NFBA 1TRDA 3B0VC 2G5WA 3Q58A 2YSWA 3EKLA 3WK2A 2QUVA 4BI6A 1U5JA 3FKKA 3MHGA 2YZRA 5KMYA 3QQ1A 1ME7A 1QFEA 3ZR4A 2F84A 1SUXA 4UMCA 3AO0A 1RD5A 2G97A 4JY9A 5AHIA 1DL3A 3W1AA 1ML1A 4MUZA 1OYCA 1VZWA 1T99A 3ELFA 5F1UA 3IIVA 3STCA 3W1XA 4OWGA 3EEGA 3GNNA 4HKPA 2C13A 3S1WA 2J9ZA 5EMUA 3GAKA 1XXXA 3NQ2A 4RKAA 1EA0A 3E96A 1RV8A 1QOQA 1HUVA 1ADOA 1GZGA 3R12A 5AHNA 1JUBA 1AW1A 1K8YA 4ZQNA 4O10A 4LS1A 3LXCA 3A22A 3PULA 4O4WA 3TC6A 1RQBA 3INPA 1UASA 2I1OA 3A23A 3LCHA 4LVDA 1VQTA 3I7RA 5D04C 1M6JA 4MFEA 2VFFA 1CW2A 1XM3A 5HINA 3A5VA 1ZFJA 3C2VA 4PTNA 4JXCA 4ZQPA 3IIZA 1PV8A 3C6CA 4ZZ9A 1Q6QA 4WOZA 1OX4A 3LHWA 1K7XA 4PEKA 2A6NA 1JULA 4X9SA 2VKZG 3MBDA 1OHLA 2BXVA 1SQ7A 1UUOA 4MLRA 5D05A 5A5WA 1OK4A 1TJRA 1Z44A 4IPIA 5DY3A 3PUEA 1B57A 3WJZA 4NZJA 1TPB1 1EB3A
chains in the Genus database with same CATH superfamily
4AVOA 1PBGA 3CNYA 4BEUA 4DUOA 3W23A 5M03A 1XX1A 1TE1A 2GQ3A 4NXKA 1Q8JA 3W76A 3OJGA 3ITGA 3WQ5A 3UXKA 4IIHA 2HTMA 5MHBA 4ZEPA 3QSRA 4LF1A 2V2HA 5MF5A 1JUKA 1GW1A 3BSMA 5HUOA 1E1CB 3M07A 4DLMA 1QPRA 1BFNA 3P8IA 3UJRA 4US5D 3WX7A 4NAFA 4IIFA 1S5TA 1TWZA 4F8XA 4ICMA 1R87A 1EZ2A 4Y9AA 1WKFA 5I06A 4CU8A 4NJHA 3TSBA 2X2GA 1OFQA 3HF3A 5BRBA 3RM4A 4NZFA 5CBBA 5D8WA 8XIMA 2HBXA 3OVQA 2V5CA 4X9YA 3H26A 2WVTA 2G3MA 1JXKA 3H4WA 2PP1A 4GIYA 4IXXA 4M6QA 1XFBA 4RE4A 3TXVA 4MYXA 1H11A 2BY0A 2PI6A 5PTDA 2KZHA 3U57A 1TIWA 1GG0A 3LTSA 2TSYA 4Z1DA 1JF6A 4DAFA 2DEPA 9CGTA 2RH9A 4LC6A 4G7EA 2D2JA 2DSZA 3S5ZA 4JDYA 1WDRA 4TO8A 7ENLA 1JGMA 2QJIA 3LERA 5TBOA 4ACYA 1FH9A 4ACZA 4I5XA 1HL2A 1YEYA 4O14A 3RJXA 4GC3A 1AK5A 1EHNA 3K30A 3BAXA 4BJHA 2XN1A 2AL2B 2OX1A 2FMOA 4ZFMA 3FEMA 4RW3A 2DZPA 2J8FA 3GUGA 8TIMA 1WB0A 2YBTA 5CC3A 3R6IA 2YCJA 4RE3A 2EEXA 1GG1A 3C8NA 3WDQA 4Q8NA 5A95A 2GVLA 3DG6A 4E3VA 5E0CA 3SJ3A 2NLIA 1W5MA 1BKHA 3WBWA 2WZEA 4U3CA 1K3UA 2QF7A 1KFBA 2EF9A 5FEZA 5CJNA 5AYBA 2Q8ZA 3USBA 1EO5A 4JQAA 2C71A 2RJGA 1SJDA 4FF7A 2I5GA 4WHBA 4O50A 5E70A 1KW1A 3PPFA 5AHMA 2DQXA 3DG7A 3K4WA 1LOLA 1H3GA 4XZWA 4OBTA 3WENA 4CEXC 3WLQA 4S3GA 3MUIA 1YBQB 2IS7A 3FVDA 4Q8PA 3TIMA 4O13A 3ZWSA 1L6SA 4F0LA 3MUCA 2NQ9A 2PLMA 1NF0A 3L0NA 3GXDA 2D3LA 4H9UA 4C6LA 4JCLA 4JX6A 4GZ7A 3BGJA 5CEWA 5LNUA 5EGRA 4JTGA 1BPLB 2P76A 4JYFA 3VI2A 1L8PA 4C6CA 1Y5WA 3WL1A 4Z1CA 4NXSA 3VNIA 2OOFA 5BXTA 4MJZA 2D2OA 4DXVA 4FO4A 1F73A 4ADUA 2BDQA 4GRSA 1OK6A 3CPGA 3PFMA 2V9DA 3URAA 4ZSTA 4H6KA 3PK7A 1W1TA 5GJPA 1FA2A 2ALRA 4L1WA 4EK7A 3TCSA 3CUFA 3FJLA 3GXMA 4JTEA 1X7IA 4LUSB 1LT7A 4GKTA 1GVRA 3SURA 2R82A 1XWYA 5EMJA 2PTZA 1B4KA 3JR2A 3QGAC 4RZBA 1HL9A 2PSNA 5A8MA 2A3EA 3HGRA 5E1QA 5EMLA 6TAAA 1OG6A 4E8GA 4XD5A 3ARXA 3KOWA 1LL7A 4Q32A 3KBJA 2Z4GA 5AZ1A 3EWBX 3PZVA 1ZGDA 4XBKA 4EANA 3QW4B 2ZDSA 4MWAB 1YIXA 1W3NA 3LB0A 3M5VA 3BE7A 5D4YA 3EOSA 2GJXA 1PUDA 3KOZA 1TVNA 2XFRA 3TEVA 3WEOA 2F61A 2YB4A 1UG6A 2PEVA 4XZBA 4Q6XA 3WDIA 2VZUA 3WELA 2WCAA 2DVXA 4XVEA 2IUZA 4JIPA 4XV0A 2BGNE 2IQTA 2GOUA 3WL0A 3G1XA 2IQDA 4KIEA 1KBBA 1SFLA 1W32A 1EBHA 2O7QA 2FVLA 2PODA 5CG7A 3FX4A 3GWQA 1VPXA 2TMDA 2Y8VA 1GZ1A 3F03K 3NL5A 4C7DA 3HFYA 1W56A 4C1KA 2Z27A 1DP0A 3KUMA 1XYFA 3GLCA 1R38A 1UYQA 1E6XM 3K1GA 3KRSA 3U48A 3WQVA 4C6IA 2QGYA 5K2ZA 2V3EA 3A3HA 1I8JA 1AH0A 1HJWA 4UCFA 3MVIA 4IX2A 2VR5A 1EYEA 1B5TA 4LEQA 1M68A 1XFCA 3OZYA 3ZQ9A 4CN1A 5FEXA 2GJRA 4I9JA 1A5UA 2W9MA 1R3SA 3OVRA 5G1YA 5DT5A 3V16A 3TDFA 1QJWA 4H6EA 3CAWA 3PTDA 1W2PA 5FA5A 1I60A 1UPPA 1H7RA 1I1XA 3P84A 4GNVA 3BWWA 4UOQA 2Z1SA 1PZ0A 3W70A 2GVJA 3SCQA 4IQJA 2AQWA 3OZPA 3AI0A 1KR1A 1TJ0A 2Y85A 3A3WA 5G2IA 4C65A 1Q7ZA 1DV7A 1AODA 5LNSA 1VEMA 3TN4A 5CQ1A 1J5SA 5HNTA 5IRPA 4O0ZA 3LI1A 1FTXA 5D2WA 4RPQA 1H41A 4HNLA 1IEIA 2V63A 2CZ5A 1GPWA 2FH6A 1GT8A 4S3JA 5FF4A 3R1ZA 4WEVX 3RAOA 3CM4A 3MJYA 1ICPA 1O12A 4G5DA 5RUBA 4O1CA 1YBQA 3ONBA 1OF6A 5G2HA 1EX5A 1UCWA 1XLKA 1XRVA 2XISA 1W17A 1H63A 2O4MA 3B9EA 5HMDA 3C0LA 1LP6A 1L8NA 4W8BA 2XH7A 2ZUVA 5CGQA 3KVLA 3V5CA 3A13A 4I6VA 1A4LA 1NQ6A 4LT9A 3THUA 3MSGA 6ENLA 5CJ5A 4KFPA 1A5LC 2JGYA 3MYOA 1EZWA 4D8ZA 1G4PA 3SY5A 4C7GA 3NL6A 1XL9A 3S83A 1AZ2A 4UNLA 4UMBA 1XR2A 1NTHA 1CPUA 3I65A 4JFTA 1TJ2A 2E25A 3PY2A 4UTTA 1GOIA 3BXWA 4XSLA 5LNVA 4URIA 3BJSA 1HQTA 3WBXA 2QCCA 4UR9A 1JIBA 3DENA 3RCYA 1LQ0A 5D2VA 4JNMA 3WLOA 4NKCA 3K8LA 3TW7A 4HYVA 5HULA 4OT7A 1OX6A 4MSSA 4XO7A 3C2YA 4GOAA 1DJWA 1IE7C 1IHIA 2ZCGA 4WY0B 2VMFA 3VVGA 1CDGA 3L12A 4QJ5B 4FNSA 4Q8OA 1J4EA 4QS6A 4Z0JA 4MNKA 3VK5A 5F4WA 5HNRA 2DSKA 5A2BA 3CZKA 3VYLA 4GBUA 3VCRA 3E0VA 4L9YA 4XZHA 2P0OA 2R24A 1YPXA 1DWGM 2WAGA 4XZMX 4WZHA 7A3HA 3DC8A 4FP1A 3OP2A 4RDVA 3FK4A 3VKKA 3VAVA 1M65A 4MWAA 1A5BA 1OF8A 4DHGA 1P7TB 1OWQA 2ZX7A 3NQGA 1R6WA 3S6OA 2YB1A 2ZXAA 4UR7A 3NL3A 2WMJA 4NSBA 3R7MA 1V6YA 3TJIA 3WFZA 1XDLA 1PZ3A 1EDQA 4N9DA 2BHUA 2VQUA 5HPOA 1IEVA 3KZPA 3ANVA 3AJXA 4DNHA 4IM4A 5D03A 3PUDA 4LUIA 3OIHA 4EE9A 3AS2A 4H9MA 1XLJA 4M19A 3T40A 1NM9A 4J35A 2QUNA 3VDGA 3S47A 2BS9A 1EJUC 4AZ6A 5DCBA 4A8IA 5E5CA 5A2CA 3A4XA 2ZRVA 4JFUA 1E6SM 4RE0A 4MB5A 4HPJA 3GM8A 4F0MA 1R2RA 1HT6A 1U22A 2VR4A 3WLJA 2DY3A 1RA5A 3GHTA 2Y88A 4GVFA 3DH7A 4JAWA 2CXGA 1TV4A 3DN5A 5FF2A 3GHUA 2VFDA 2XSAA 2EJ1A 2OCZA 3N14A 1ZY9A 4HHHA 1UOZA 3OHIA 4V2XA 3WMCA 1V03A 1Q6CA 4JL2A 3W1TA 2WCGA 1P6BA 3KP1A 1T40A 2BXZA 1V0MA 1UC4A 3RXZA 4O19A 2DW6A 4K68A 5FKYA 4YTSA 4IQLA 3DKLA 5IBXA 2JEQA 5ABGA 2Y8KA 5BOOA 2I14A 3U8GA 1A49A 3EX1A 5HA7A 3S5OA 5EB8A 3GTIA 1Q85A 3COTA 3VM5A 2CITA 3JW7A 2V5DA 1AQFA 4PMQA 3HMJG 1AFSA 1XIEA 4D6FA 4NI8A 4TXEA 4GVIA 1U1JA 3EWYA 4CQ8A 4ZO6A 2RGMA 3HG3A 3VMOA 3FHAA 4BI7A 3IJ6A 3IJLA 3ICJA 4HMNA 5GNXA 4LNCA 4XWUA 5ABTA 3I6EA 3T78A 1W5NA 5HQLA 1IEXA 1LORA 3HU7A 3R11A 4ZO8A 1KM0A 1L6WA 3GNDA 4AD5A 4JTJA 1FHLA 2HCVA 2NUYA 2R8WA 2X8RA 3H2EA 4GQQA 1E6ZA 3RX3A 3F5LA 4QX4A 1UIPA 1JQVA 1OABA 4GFIA 1U5HA 3TW6A 1TQJA 2NUXA 3BZGA 4C1LA 5DO8A 4FK9A 1B4EA 3IUHA 1CZ1A 3WYZA 1MFUA 4R7JA 1NDWA 2YL5A 4R5EA 1JR1A 4LUYA 1H51A 1ZBCA 4DNMA 4KGJA 3GIPA 2J4GA 4RXGA 4WSJA 4C6NA 2GQAA 1ZAIA 3DKJA 3U5YA 1TE6A 2OLSA 1E43A 4TTUA 5DMLA 1PCKA 1VHCA 3B40A 4AXKA 1DJQA 4HTBA 5T8GA 3UETA 1SJBA 4B92A 3LBOA 4H9YA 4G1KA 1BLIA 1FOBA 2Z6IA 4NX0A 4WY0A 5C7HA 1B90A 2IPFA 4JKKA 4LVAA 3N2TA 3AOFA 3A12A 1LT8A 4HCHA 3RGTA 3CL6A 1LUCB 2P10A 1EF3A 3GTNA 2ZRUA 2KX9A 4DAIA 2GDVA 5LHEA 2NQZA 3H22A 1W9XA 2R1LA 2QCEA 1A5NC 1K9TA 1G0CA 1MEHA 1C3FA 4J3WA 2XGZA 4S3AA 4K1GA 2HSAA 3HPSA 3GDLA 3QKEA 1BHGA 3NA8A 2CETA 2OELA 2B0MA 5H8UA 1OBAA 1ZU8A 3HQNA 3M0HA 1EXPA 3KRBA 4UQBA 4A6GA 3QOKA 1J2BA 5CC7A 2EPNA 4UTUA 1QR7A 3LEPA 3PZQA 3WO8A 2UZ9A 1W5QA 3HM7A 4E2VA 4Q8WA 1YYAA 3NZPA 2F6XA 4AVFA 4DRSA 2V5BA 2IKGA 5FESA 1RCXB 3OGVA 5FJPA 3UWEA 3MMUA 2J7FA 2X1UA 2EG7A 4C6EA 3E2RA 2OGJA 4YNGA 2FFCA 2L5HA 3V5FA 3S1XA 4LY8A 2PDFA 4K3ZA 4ZQRA 1DXFA 2E4TA 2C0AA 3T2QA 3W1LA 2FVKA 1JCXA 2PTYA 1TMHA 1XC6A 3C0JA 3GXTA 5REQA 3QZ6A 1XGDA 1EXBA 2REQB 5AYYA 4W8LA 2BODX 4RZ6A 2FIQA 2DW7A 1OYAA 1OCQA 3NO3A 2FZNA 1GTHA 4DO6A 3S46A 3G6LA 4PTVA 4FXJA 5AY7A 2CBIA 1P1XA 3T2OA 1YMYA 5H8PA 3ERPA 3VC5A 5CZJA 1O60A 4MHBA 5I09A 2ZTKA 4WGXA 3P60A 1Q6FA 3RLUA 4XZ9A 4LCQA 1LQAA 4Y7EA 2PFHA 5JXQA 3RLGA 4EKJA 1DWAM 4NNBA 3RCMA 2W27A 1F9CA 4JTKA 3IUIA 1MRAA 4RNJA 1X38A 4LH8A 3W7NA 2A85A 2PCQA 2VM8A 5A3HA 3VIOA 1X1OA 2QUMA 2DIEA 2ZWZA 2GUBA 1QASA 1NWSA 4IMCA 3N2XA 4EAYA 5LZLA 3JVAA 1Y5XA 4PSRA 3WQDA 3DFNA 1E5NA 4P7LA 3C2FA 5IHRA 1A5SA 3ES7A 3VMPA 2CYGA 1Q2RA 1DJYA 1EBGA 3LCWA 3FV9A 4DJDC 4QNWA 4BQ4A 4W88A 4GY1A 4I9AA 5I6SA 5K7JA 5D02A 1IXNA 3GBEA 3QGVA 4BEQA 2OOGA 2RKXA 1ZAJA 1EEPA 3WQGA 2J88A 1UPMB 2CZFA 3GDKA 5FJTA 4P8XA 1G1YA 5DCDA 2QUTA 3GTXA 4G56A 4XKMA 3CAVA 5FEWA 1P0NA 3JUGA 1SO5A 1OFOA 3AJ7A 5I3DA 4IISA 2NXGA 5DQPA 2FFIA 3BLDA 3QV9A 1DWJM 1Z8AA 5DF0A 3MV01 3GNRA 4I7VA 4ZOCA 3RN6A 4LWWA 4XAYA 1SW0A 2FGLA 1XIIA 5LGXA 1KV5A 3VKBA 3OVGA 4AX7A 3NGJA 1W3KA 4NU7A 2BWGA 3W7LA 3KL0A 3DUGA 4H8HA 4BF9A 2D0HA 2Q01A 3ZMRA 3H2CA 4PN2A 2OZ3A 4CD4A 4FF5A 2UBPC 2Z1VA 1JFXA 4AHQA 2WM0A 4HJWA 4LCSA 3O6YX 2NT1A 5A6SA 2DFAA 2VENA 5HNUA 5C7VA 1A47A 4A8LA 2DH3A 3UD6A 3CQHA 4DBSA 3WF0A 2FTWA 1GQLA 4CCZA 2Y89A 4ZODA 2C1GA 3RPTA 2GJLA 1K8CA 4KRUA 3SGUA 1KGWA 2VWTA 4LJ3A 1UIOA 1V02E 2YA2A 6CGTA 4CCCA 2G4JA 3RRAA 1Q8AA 1R2TA 4EWJA 3IWPA 3NQ6A 3CIWA 3VILA 2VI0A 1J5TA 4O0KA 3H2MA 1HF6A 4LVFA 6PTDA 1NP0A 2ZQ0A 1W1PA 3N9RA 1G6CA 3QHNA 2OU4A 4EX4A 1R30A 3AXIA 1JI1A 1P6CA 1WO2A 5EMYA 3WN6A 5KZ6A 1EX1A 2CBUA 4GX9A 3CUZA 3CZGA 4HNUA 4ZR8A 2VTFA 1REQB 4YS1A 5KZDA 3V0TA 5T26A 3G22A 1EGZA 3HOJA 1C92A 1YPIA 1ONRA 4WF7A 4L4PA 2WMGA 3A5FA 3DEQA 4KGLA 1JCMP 4E2DA 1NDYA 3ZFHA 3SAZA 3KBWA 4AD0A 3PJTA 1R9XA 3E9AA 2ZTJA 4GYFA 4MPQA 1UZDA 4ICCX 3NZ1A 4AEEA 3VOJA 1D8WA 3L23A 4AH7A 4HBKA 2OX4A 1GVQA 2EXOA 3IPWA 4DPPA 4R7WA 1I6NA 1ZBWA 1RQHA 5G4EA 2A3LA 3U7VA 4CN6A 1KXHA 4WUIA 2VXNA 1Q4WA 4KEZA 3O16A 3TC3A 5FACA 1E9IA 5DRIA 1XH0A 4Z42C 3P93A 4UR8A 1DHPA 3ARVA 3TOPA 2IPGA 2PPGA 2XVLA 4QAWA 4CGTA 3UXAA 1GVFA 5LNWA 1DJXA 4KEVA 3N73A 1BG4A 3LCIA 3V0SA 3W2NA 4XBJA 4R33A 3GE7A 3SR7A 5CZSA 1TTIA 2Q09A 1Q63A 4AY1A 3NWRA 2VJXA 4B5TA 4QRNA 4WJXA 1Y5VA 5DMMA 2NWSA 4DI8A 4JQ2A 2B7PA 2NQHA 3UXLA 1VCFA 2C1HA 1UZ1A 2TYSA 4HU4A 2NZLA 5ECVA 3SADA 1SSGA 3W84A 1LZOA 1WDDA 4NZ4A 2WJZA 1YTEA 1H62A 2PTDA 2PGRA 1P48A 2CBVA 1OFEA 3NUKA 1VB9A 1YX1A 4JL1A 4OE7A 5M3WA 3RIKA 3LOTA 1BWLA 3C52A 3WLIA 3T2PA 3WK0A 4QJ1A 3QF0A 2PGWA 5F4SA 4LXFA 1JAEA 2WMKA 3GC4A 1JL8A 4JEQA 1LM1A 4ZOAA 1FXQA 3SY8A 2HNHA 3F5KA 4YHGA 3FJ4A 4I7UA 3WJXA 3W85A 3FS2A 4JTTA 1H4PA 2Y2WA 4RV8A 2E1DA 4HSNA 4CD5A 3I4KA 2PWEA 4LBRA 2Z1KA 5CBJA 3UJFA 2YOCA 3NYDA 3VD7A 3TR9A 3RRXA 4JFWA 1I2RA 5AOUA 3FIGA 2NQ5A 1GOQA 3AHTA 4JEJA 3GB6A 3BMVA 1KM2A 1K9FA 1X1ZA 1YQ2A 5JU6A 1UJQA 3CGTA 4JQ1A 1FHVA 2R6OA 1S38A 2O7SA 4S38A 2HVOA 3TZNA 1J0ZA 1CYGA 2ABBA 3HPAA 2DZXA 1LDCA 3EWXA 4GD0A 1ZJAA 2BVWA 2Q3RA 4KWSA 4GO8A 1N7KA 1O5QA 4H8VA 2VRKA 2A3HA 3ZT5A 1R46A 3OLEA 1DKWA 3W7QA 4FAMA 1E4IA 4Q7BA 1K02A 2D22A 1E0UA 5CC5A 5DN1A 3UG3A 2HROA 4FXSA 1ITQA 3KEHA 1JDCA 1MZRA 2JK2A 3P62A 1FP9A 3M47A 2HK0A 3DI1A 4L6DA 2E28A 2QYGA 4WX2A 1G67A 2PA6A 3A9IA 2PWDA 4QGCA 1XLCA 1H50A 4NUWA 2TPSA 2I17A 1PKYA 1S5WA 1IXQA 4WJ8A 2W92A 3ARZA 3R5EA 4HNVA 3ZOAA 2BGSA 4M81A 2BHYA 4R85A 2BOEX 1QNRA 3NOEA 4FLRA 4E4PA 1HKWA 1CENA 1DE6A 2FB2A 3QR1A 1RUSA 4HN4A 3KBMA 3CLWA 4G8TA 3PBWA 2X1SA 1KFEA 1UR8A 3P5ZA 1XGEA 4C6BA 4D6GA 5F2LA 2ZXQA 3KTSA 3NQ7A 1VH7A 4JTFA 5I0DA 1E56A 1QWGA 2XFWA 3PZTA 4DUWA 3CZJA 2WHJA 3YPIA 2I57A 3CXOA 1LWHA 1QXLA 3UWZA 4L9XA 3W27A 4HQVA 1GYMA 3NAVA 4U3AA 5LIYX 5BZAA 3L0KA 2JE8A 2J7CA 1EC9A 3DDMA 3ABQA 4AZBA 4UFMA 4FR1A 2VP8A 3AXMA 3ITOA 3U4AA 3KBNA 4AF0B 2YL6A 1EKOA 2Q8LA 1YKWA 3ARUA 4N9BA 1DXIA 4B5UA 1GK8A 4IICA 4M3PA 1XKYA 4CCDA 4NILA 1JCLA 4A3UA 1DQUA 4IPLA 4MM1A 1TREA 1QW7A 3EAUA 4QJ4B 1PXGA 3M0MA 1FDJA 5CXPA 1QU4A 2OG9A 4MKVA 2GDQA 4S2CA 3EDEA 4QCEA 1O6IA 1QMLA 2VC9A 4JFVA 2W91A 4J3UA 1X7FA 2YR1A 4XTIA 5CAKA 1TRDA 1ECEA 2G5WA 3ZJKA 2Y5EA 4M6UA 1U5JA 1TMQA 4JFSA 3SCUA 4NZ5A 5BXPA 1ME7A 1OADA 5JH2A 3QLLA 2F84A 1SUXA 4UMCA 5AHIA 3P0XA 1DL3A 3GSMA 4Q4SA 3W1AA 5FJUA 1VZWA 3RM8A 1EHAA 3STCA 2D2HA 4OWGA 4XD3A 3GNNA 5BOEA 4HKPA 2C13A 3BAIA 3S1WA 2J9ZA 4E5TA 4RNIA 5EMUA 3NQ2A 4Z2GA 1EA0A 1Q4NX 4KEUA 4LS1A 3LXCA 5BXSA 3A22A 1W6TA 3INPA 1UASA 1C90A 2Z26A 4DZHA 4LVDA 3OO2A 4RL3A 4E8CA 1M6JA 4MFEA 1KKOA 2CPUA 3GNXA 3NZGA 2VFFA 1ZFJA 3C2VA 4JXCA 3VDBA 3C6CA 1OX4A 3LHWA 4PEKA 2A6NA 2BXVA 3GVRA 3WLLA 5D05A 3E1F1 5A5WA 1XIMA 1XRSA 1PYFA 3WNNA 5DY3A 1B57A 3WJZA 3KOYA 4NZJA 4FOUA 1EB3A 3S4TA 2WZHA 5F1VA 5CBIA 2VL4A 1ZNNA 5CGMA 2A21A 3H6OA 4TR9A 5JIWA 1O1HA 1S5VA 4M1BA 2P3EA 1VFUA 2VCCA 2O9RA 3WCZA 4HIBA 4UTWC 4IP5A 3CO8A 3EOLA 3OZMA 3A4AA 4HHPA 3KCLA 1VIZA 4AISA 5CSRA 1EUNA 4UC5A 1XW8A 1WXJA 1GOXA 4GX8A 3W6YA 4LOCA 3TSMA 5DCEA 3LRLA 4GUGA 2OVLA 4JGDA 2XVNA 4MWAC 1WXYA 2GGGA 2FVMA 1DJGA 1AQMA 3UNDA 1TPUA 3W53A 3BAYA 4I9MA 4JIIX 5FF0A 2YL9A 5E09A 2VCAA 3AZRA 3VGGA 1O68A 4GNJA 5J5DA 3WMLA 1W0MA 2YLLA 4PMZA 2ISVA 4C6DA 4AEOA 3W72A 3CHVA 1XS2A 4XZNX 4ZL1A 3OLIA 3L4UA 4JQ4A 4L5ZA 1UW9A 2QPUA 4YVVA 3O6CA 1WZKA 4GUHA 2OYMA 5K3VA 3R0UA 5C71A 3GIYA 4ORMA 2GK1B 1X6NA 3U2ZA 4LB3A 3PZIA 5EY5A 4R7OA 3CV7A 4FX8A 2TODA 2XYLA 4L56A 2BVDA 3GHRA 1FCQA 3ARYA 4EPKA 1V3JA 3EWUA 2WXDM 3LN3A 4YCOA 2W4XA 3TAOA 2VURA 3GW0A 3N13A 2POZA 2YYUA 1KFLA 1UZ4A 3BG3A 2WWDA 1CGYA 4IIDA 1OC5A 4FHAA 1R2SA 2GZXA 4TMBA 5FIPA 3O06A 4KF1A 4XD6A 2BOGX 1XINA 3WUGA 3LCGA 4TUFA 3LBMA 2EG8A 4D1IA 4UFJA 4PL1A 3UVAA 1RCOB 3TTOA 4EAMA 1I0BA 4CVUA 3STPA 3AUJA 1ZENA 4ZQOA 1C7SA 1DJZA 3UNTA 4XUGA 2CBJA 2BTMA 2ALDA 3VIKA 1M7JA 4BKNA 3DFYA 1TQXA 4R9XA 2ZADA 4W8AA 3WDHA 2BXYA 4Q4OA 5HBFA 3B3DA 4RJEA 3LV6A 1SVDA 1JYXA 1NIUA 1KFCA 1QPKA 1DTNA 6XIAA 1SZGA 4ZTYA 1SZEA 4JIQA 4PTMA 4O12A 5D2TA 4LBUA 5IFPA 3HO8A 3ENLA 3QYSA 3L4TA 3GVWA 3D3FA 1QNOA 3NM1A 4MVAA 4UTFA 4YXGA 1EP3A 1XCFA 2EPMX 4AX6A 2GSHA 1DWIM 4NI3A 4HK6A 3WD3A 3EKGA 3SUSA 3F7JA 4AAJA 4CD8A 2ISWA 4DJEC 2IW0A 4UTKA 4K38A 2NVCA 5XIMA 1TO3A 3R13A 4A8RA 1B9ZA 2RDTA 3WH6A 4AZ7A 3LPPA 1OT1A 1Q65A 1DOSA 2NQJA 3N18A 1KLZA 3HG4A 1D8CA 1HGWA 4CNUA 3MSYA 5I3IA 4B4HA 4U2ZA 1PDYA 4JX5A 1MZHA 4F0KA 2IXUA 1PTAA 5BWAA 4FLQA 2XUCA 2Z1XA 1UROA 1WXZA 3NO1A 3L5MA 1LRTA 1TV3A 3P7YA 1WZMA 1I2QA 3F1QA 3HGOA 5LSMA 4L1XA 4B16A 2I5IA 3EA2A 3QN3A 5DXXA 2J7GA 1VPQA 1N55A 2OQLA 1R7OA 4F79A 3JU2A 2CLOA 4WKFA 4CEUC 3UVIA 3B97A 2OXNA 4J9JA 3W00A 1H1NA 1W3LA 4QNEA 1R0MA 3NPXA 3ITXA 4GA8A 4E8DA 2OSWA 1OFRA 2VEIA 2Y7EA 2EQDA 2WMFA 5A6AA 2VEGA 5AN7A 2YCIX 3HGSA 4J3ZA 4DWDA 4PSPA 1NY1A 5FCZA 1YNYA 3UZYA 1CXKA 1SJCA 2XDFA 1UA3A 3B04A 2J24A 1EH9A 4WSKA 2ICSA 3SDOA 3AQUA 3BGGA 1B3ZA 4LUJA 3S9YA 3IV8A 3L0GA 4Q8MA 4JIHA 4L4MA 4LUTA 2INEA 3WDPP 2YZ5A 2OO0A 4F0RA 3GYCA 5TNVA 3W38A 4GO9A 1KCKA 3AU2A 3REQA 1V6XA 2HK1A 3PUOA 5G1TA 1JJKA 5D9OA 3LM7A 4PMYA 5J5RA 4KETA 1C8VA 2V2CA 5ABHA 4AHPA 3POHA 5BROA 2OQHA 4O18A 4IZGA 2Z7GA 4DYKA 1W1ZA 5D33A 1F05A 1HTIA 3G0UA 3ZM8A 3XIMA 5KSWA 4D1JA 4KERA 1BYDA 3C3NA 3BLOA 4WDTA 4WCJA 3ME3A 3OQ8A 1RH9A 3G1YA 1E6PA 1XDJA 1JDDA 1UBSA 2PU1A 4J7RA 4D6JA 3WUBA 5CAHA 1WDPA 1MXSA 4UNIA 2VDHA 5AZ0A 5IXEA 1VEPA 1V3KA 3FAWA 3Q45A 4ZBCA 4LTSA 4MIMA 1K7FA 4DY1A 1XH1A 2Z2UA 3L2LA 1QCWA 4I90A 4NIRA 1PB0A 1B3OA 3TOYA 3SSZA 2HDJA 5E0KA 4LQ1A 3IK4A 1W3JA 4HZ6A 5LKYA 1CB2A 1QO5A 1IXOA 1T41A 3ZJ6A 2ON3A 4CVWA 1D2KA 2W66A 3W28A 4HTYA 2YPIA 5BU6A 2E9MA 2ZUWA 4JPGA 3UZWA 1TV7A 1CEOA 3CO4A 4MUPA 4BZYA 4EWND 3LGGA 3IAQA 3VE9A 3L9CA 1JZ8A 1V6VA 3LX9A 4R27A 4PCPA 5ECUA 2Z1WA 4YYFA 2JGQA 4IQEA 3AS3A 1ZS2A 3PHAA 4IG2A 2WC7A 2CESA 3B9OA 2PDJA 4PH6A 3S5YA 1CXFA 2DGAA 3W2JA 3BLFA 1Q2SA 1ZAHA 4EIVA 5CPOA 3AYVA 3LMZA 1N8FA 4ZB2A 3O05A 3LHZA 1WV2A 3S2LA 1X96A 5C0QA 7CGTA 1LBFA 3KVJA 1Z7AA 4ZMGA 3H12A 3N3MA 1B3XA 6REQB 3RU6A 1UZHA 3NSNA 3QHOA 4I3GA 1LOQA 3ARSA 1J79A 1Y7VA 3IGUA 2VT0A 2J74A 1XBZA 2PWUA 4PUEA 1FWNA 2BSLA 5CGTA 3S8HA 4F66A 3C86A 1UMYA 4QS5A 1EIBA 1JGIA 2QPXA 2VNCA 5IDZA 1J96A 3TQPA 3TR2A 2BFGA 2UY4A 3M0XA 3P80A 5DT7A 2YGYA 2HS6A 3PG9A 3NXFA 1WDQA 3T0TA 3LNPA 1G5AA 1QBAA 1EJSC 5I7GA 1XF0A 3PWGA 3RILA 3WQ8A 5M1TA 2REQA 2HV5A 2H9AB 3UERA 3VCNA 4B91A 4O1AA 2Q6ZA 1XLGA 3WLHA 3CWHA 4H00A 3J7HA 3DBNA 4IIGA 1JZ6A 4F0HA 3BJTA 4P2VA 4P8WA 1XRTA 1OINA 3KW3A 4RZ4A 2C14A 1TZ9A 1BXCA 4DWSA 4LW7A 1KBKA 8A3HA 3EX2A 5B80A 3MP3A 3FYOA 1OIFA 4B2DA 3F4VA 3OG3A 4L1GA 1S2WA 2QDEA 1QNSA 5CC6A 4LS2A 1U2YA 4GUIA 2JEPA 2WHMA 1UOKA 3GIQA 4GXWA 1LF1A 2JF6A 4QE5A 1UUMA 3N11A 4OQVA 1F6KA 1HJSA 1O5KA 4O0QA 5G1MA 3EOOA 3LGDA 3EMZA 5HATA 4MB1A 3IJ8A 2PGFA 2QVNA 3KHDA 2DIKA 2G3IA 3ES8A 4IJCA 4AEFA 1BTMA 3HGJA 4J2PA 3LQLA 2X7VA 1H7OA 1TKKA 3DAQA 2FZBA 1JYVA 3BANA 3O0KA 4H6RA 4W9TA 1LJYA 1VBRA 4IMEA 1RK5A 1XP3A 1FWSA 1BG9A 1VFFA 1G7VA 1VBGA 4W89A 1DYSA 5F2GA 3W7KA 2YX0A 5JVLA 5FF3A 1HO1A 2X16A 3KFTA 3GKFA 4F0SA 2CKSA 3W7EA 3N9KA 5I3FA 3STFA 3R8RA 4AD2A 4KCTA 3G1AA 6A3HA 3H7RA 2ZDRA 2B7QA 1W1A1 1QATA 5I03A 3T8QA 1JCJA 4V28A 2XN2A 4DM2A 1RBOB 1TPVA 3GG0A 2WSQA 3I7SA 2FHCA 3TH6A 4D8LA 3WLRA 1NJJA 1XIHA 5EU9A 3VDCA 3C0QA 3SJNA 4JCMA 4GABA 4X0VA 2C0HA 4WKAA 5CSYA 2OJPA 3G18A 1OGBA 2V2DA 4L4OA 2FJKA 2CNCA 4RK8A 2D20A 5CH9A 4C6FA 5C2GA 2J13A 1A5MC 4Z08A 1C8QA 1OC6A 3A9BA 4DN1A 2AMGA 3D6NA 4QROA 2CLHA 1B3YA 8RUCA 4A2RA 1U30A 5XIAA 4KMQA 4MY1A 1X6LA 4O1EA 1OJXA 4JTQA 4KFOA 4JNYA 2FZ8A 1BAGA 1TVPA 2OB3A 3LRMA 6TIMA 4NASA 1TX2A 1GYLA 4HHMA 4LAOA 1VFLA 1K6AA 4PMVA 1AG1O 4JS3A 4OV4A 3ZJ7A 1TV2A 2OYLA 1V3MA 3VNMA 5H6HA 3CEUA 1BXNA 3PZMA 3FJ6A 1VJZA 4PFMA 3PZUA 4A22A 3W24A 1R9YA 3WF3A 3KL5A 1WKYA 1QI5A 2ZA2A 5BMXA 3U2EA 1Q6OA 3W1NA 2QULA 1DXEA 2V68A 1HN1A 3BDKA 3WQFA 3IJ7A 4H3DA 2D69A 5F4XA 4DQWA 3S9ZA 3NJ3A 3MUZ1 4NJIA 4Y2WA 5CPTA 4MZYA 4AIOA 1ZQ5A 3SGZA 3T1GA 2G4FA 1TCMA 1AW5A 3AYSA 1EC7A 5C9XA 1HGYA 3RITA 4FEZA 3T05A 3PM6A 4H1ZA 3EPOA 4IXHA 3W7GA 1E0WA 1KGUA 5A8PA 4M7SA 3B0PA 1OCBA 4JKLA 1CXIA 3VKCA 2PDKA 5B7YA 5I5RA 2RAGA 4PCTA 1GTEA 1EP1A 5ABFB 3BW4A 3UY8A 4QQUA 3M0JA 5HDRA 3WF1A 3E6EA 4A3QA 1V3IA 4XK2A 3A4WA 3W1QA 2FHFA 2WNNA 1E0XA 1ADDA 4DBUA 5C54A 1CWYA 4W87A 4ERAA 4DWSD 3MUXA 3C5QA 4MOZA 4IIEA 3ZZ1A 4DPQA 5EA9A 1J8VA 3WNLA 1WDSA 5EKYA 1RA0A 4HMEA 4Q4QA 3HQOA 4M80A 1VGAA 4JN8A 3FN9A 4B2DD 3AIQA 3K1DA 1ZSXA 4HMCA 3KBVA 3ABSA 4XIAA 1TTPA 3CUJA 1QVBA 1VLWA 4WDWA 5C9UA 3EMCA 1RP9A 1VENA 4GE8A 2WLZA 5IBXC 3H2NA 3UESA 5K4XA 1WYIA 1BKSA 3KDOA 2CLMA 2E5DA 1XLMA 2A5HA 2WSRA 5LIXX 1TWWA 3I6RA 3H4XA 4MZ8A 3BW3A 2V81A 3ATYA 4C6MA 2GSJA 3G2GA 5G5IA 3EBVA 3IANA 3ZLGA 2XVKA 4PRWA 3C3UA 2E68A 3B8DA 4LY4A 1M03A 3DFOA 2AAMA 4K8GA 1D9EA 3M7WA 3VGFA 1BYCA 1ITXA 1TPDA 3FLUA 2J8GA 1BRLA 4QLLA 1FP8A 4ML4A 3WDRA 1GKQA 4AZCA 3BSHA 4OU1A 1B1YA 1XD1A 3QY8A 5LNRA 1BSIA 5KZEA 5KITA 5E6YA 2VEFA 2D1ZA 1C7TA 4X22A 1CXLA 3DHPA 3GY1A 4GNKB 1G4TA 1R7AA 3OODA 4PB5A 1UKPA 4N2YA 4QP0A 3O6DA 3REQB 1Q6EA 3PG8A 3G1DA 2QAPA 4JD4A 1ONWA 1M41A 2FB3A 3MTWA 3PNZA 3CC1A 4QG6A 4CNSA 4O4VA 4US6A 1AVAA 4M0XA 2EKGA 3FGCB 5E9XA 1ZBKA 4O1FA 2E8ZA 1P0EA 1N8IA 2EJAA 4AYGA 2QDHA 4XZIA 2WKJA 2HVMA 2OKTA 3T55A 3NXLA 1T0OA 4ERGA 4IWWA 4XX6A 4QQ3A 7ODCA 3CH0A 4OVXA 4GBDA 1W8SA 3QW3A 4NQ1A 3CQJA 4AZHA 2HVNA 4H7VA 2OSYA 4JTIA 4NYUA 4E0CA 1NWUA 4D6CA 4AZ5A 2AL1A 1E15A 3QEZA 3U2OA 1BVWA 4UQAA 4FLOA 2HE8A 2G3JA 3AYRA 4MNLA 4PODA 1RAKA 2PDGA 3LHUA 4GIEA 2DUZA 4GQBA 3TAKA 2GQ9A 1FFRA 4A2SA 4PC8A 4DB7A 4WLCA 2OODA 2JKPA 2QV4A 1FDZA 3MHUA 3CWNA 3STGA 4QR6A 1DQWA 1WZLA 2ZUUA 2NV1A 5ABFA 3QPYA 4IGSA 9XIMA 3LK6A 3N2OA 4A35A 2AGTA 2DZWA 4U31A 1JNEA 4E6MA 1NVMA 2DV0A 2A0NA 3MDUA 2DQWA 2FTYA 1S39A 3MW7A 4K8EA 1WOBA 1YDVA 3L2MA 1YXCA 4D2JA 3SCVA 2QGHA 1L0PA 3GXFA 1UB3A 2RJHA 5BNKA 2P8CA 4GZEA 4PL2A 4M51A 1YTKA 4N6FA 5ENLA 4OUIA 3CBWA 3PF3A 3BG5A 2ZOXA 4DI9A 4TVDA 1GQJA 3W37A 3M7SA 2BOFX 1J10A 1XISA 4X2RA 1PPIA 1AJZA 2JIWA 3CUGA 2QQ6A 1TPFA 4AWUA 3JRKA 3QR3A 1XPGA 1WX0A 4DBDA 4PUWA 3BZJA 4S23A 4HGXA 3THCA 1CCWB 2QCGA 4XSMA 4Q4KA 4C1NB 5IHSA 4TOQA 1PTDA 4GCXA 8XIAA 1AMKA 5LA2A 3TQ0A 4HPGA 1HKVA 1E3XA 1TFVA 4B5VA 3TP4A 3GR8A 4Y8EA 4A21A 3Q65A 3EX4A 1V6WA 2NX1A 4MKNA 1GZJA 2YYTA 3QV7A 1VRXA 3GFYA 2B4GA 2J47A 2V8ZA 1PHQA 3L4YA 3A24A 3AMGA 2WMHA 4GYKA 2Y70A 2H8XA 1DVJA 2FPYA 1OIMA 2HJPA 3PWIA 3WBEA 2YIHA 3DHUA 4HJFA 2XH0A 3M64A 3GR4A 4HK7A 1U5VA 3LCLA 2YDSA 3UPMA 2YW3A 3U4FA 3FGCA 2X1TA 3W7JA 1W2VA 4YTUA 2Y7GA 1V08A 2FYMA 3NDZA 4I7WA 4W85A 1IWAA 1S2CA 1F61A 4ACZB 4Z1AA 3ABXA 4BQ3A 5DXYA 2UY2A 1PYMA 3WH7A 1XCWA 1R3VA 3IVTA 4UIOA 5CLWA 5JH1A 1EJTC 5KETA 5KEZA 1NEYA 3KTXA 4O17A 4UBPC 4EOUA 1ITUA 1C9DA 3D5HA 2NVDA 4DVOA 3UYCA 1ESWA 4NP7A 2NW0A 1T8QA 2PTWA 3P5YA 3GXPA 1VEOA 3K8MA 1KWKA 1P6WA 5T9CE 2OSXA 3POCA 5D9PA 2D3NA 2ZBTA 1LROA 1GVSA 2OZTA 4HZ7A 1E1EA 4O8RA 5EL1A 4ROQA 4PBEA 3AU6A 3DFQA 2WVUA 2QUUA 3OOQA 2DJLA 4BQ5A 3F4NA 3MJMA 3VM7A 3G3DA 4Q33A 3L7RA 2G0WA 3GR7A 2ZRWA 4JY8A 3ZS4A 4PE8A 2PUZA 4CD6A 1MEWA 1UD6A 3NQFA 3VIHA 4W5UA 2OWWA 2PDMA 3FKRA 4JKMA 3AYTA 3ZO9A 4DLFA 2VD9A 4MF4A 1V3LA 4GY0A 3HIJA 2GL5A 4DYEA 3EA1A 3QFWA 5EYWA 3W4RA 4IL2A 5U4NA 2E6FA 3LY0A 4AD4A 4NAEA 5C2XA 2ZFAA 4O8AA 1QW8A 2HXTA 3CUHA 3T9PA 3WLSA 5LGZA 5GNZA 1CGXA 2A7NA 1OG0A 2W67A 3VKJA 3SECA 3M0VA 2QS8A 9XIAA 1PZ2A 2WSYA 1QWKA 1V79A 3TJXA 4Q7NA 3NDOA 2ABAA 4AWEA 1W1YA 1RLCL 4NG3A 1S1RA 3MI2A 2CHOA 4Y6GA 5EPDA 3IVUA 2XFYA 5JIPA 3NPVA 4AUBA 3CV6A 3OLDA 5DFAA 2V3DA 4H7ZA 2O9PA 1LG1A 1ONEA 4M6VA 3SSJA 3HG5A 4QBXA 4IFOA 3VUSA 1TPC1 4DO5A 1KTNA 5HQMA 2H9AA 4AD1A 3DGRA 4B4FA 3MANA 3WLPA 3PBMA 1TJPA 4Q4RA 5CZKA 3DFTA 1QOXA 1NDVA 3PANA 4FPSA 3TXZA 3BARA 1UH4A 7REQB 5D09A 3HMCA 3IGXA 3VD5A 1M9HA 4JICA 3UCCA 3E49A 1FDYA 1F07A 1BWVA 3W87A 4C60A 4OZOA 1XYMA 3O0FA 3LZ3A 4CNOA 2F2HA 2YL8A 3DESA 4PMRA 3SIMA 5FD0A 3QR0A 3IGHX 3EB4A 4QIUA 3TONA 2C79A 1WAUA 1Z69A 3VNYA 1OGGA 3WG6A 4ROPA 3NOYA 1GORA 4ZB5A 1DORA 3I4EA 1GONA 1J6PA 3NCOA 3A64A 4XQ6A 2YDRA 4H9TA 4GI6A 4WDXA 4PMNA 4UFLA 3GVQA 5DRCA 3OHMB 3CIVA 3PJXA 1GVYA 4YN5A 2VCBA 2OR2A 3QMSA 4U28A 3C2OA 4MZ1A 3MU7A 1Q3NA 2WPBA 4MWAD 3QQWA 1XSJA 4IF2A 4B5NA 5I23A 4HYWA 1FWTA 1D3HA 2QCFA 4DZ5A 3W86A 1RVKA 4H01A 4Z2JA 5BW6A 3CV2A 1TUFA 4UTMA 1TZZA 2Z1BA 1R47A 3MWAA 1OC7A 1Z41A 1UMLA 1AUSL 4D6IA 3CLMA 1QT1A 1ALDA 4AC7C 2PZNA 4U5IA 2BB0A 4FOKA 3KWSA 3NGFA 3SO7A 4L9ZA 4GI8A 3W1UA 4PEEA 3AMCA 4E4FA 1EEXA 1JD9A 1LBLA 1RSCA 3T6CA 3VIPA 4LRSA 5I00A 2P1FA 3WD1A 5EBUA 1XHGA 1UWTA 4ZE4A 1O66A 4XAGA 3OBAA 1E40A 2AGKA 4F3HA 2R91A 1DQXA 4DXXA 3M0ZA 1P0DA 4O11A 3H21A 5HWJA 1KV8A 4IFRA 1KM4A 3TTEA 2FGBA 4BA0A 2V3GA 2BV9A 1ZCCA 1X6UA 2WZTA 3VX1A 1BRLB 4EP8C 2CLKA 1V0NA 4RZ5A 1H5YA 3ITTA 4Q8QA 3N2CA 3SRFA 3R94A 2ZXDA 2DUXA 1F3XA 3WSUA 3WEMA 5K9CA 3WH8A 1XLDA 1SFJA 3T0DA 2VOMA 3GQYA 2DT0A 1JD7A 3SCSA 3Q58A 4HN8A 1XLEA 2YSWA 3GU2A 4QG9A 1GOWA 3WK2A 3OBEA 2QUVA 3UCDA 2YZRA 3S6TA 3SQLA 3QQ1A 5KMYA 4PBGA 3NVDA 4QHRA 5BYWA 2YBVA 3MS8A 4MNJA 1B54A 4JY9A 1ZTVA 2PDHA 3V7PA 4IGMA 1D3CA 4OBRA 3SN0A 3AFBA 3M0KA 3W26A 4INFA 1J93A 2J66A 5FAGA 1JPHA 2WBGA 1BTCA 3GAKA 4IPNB 2MNRA 5FL0A 1EOKA 4RKAA 4P5UA 3E96A 1J18A 2FZDA 3R12A 2OO6A 1AW1A 4ZQNA 4O10A 1RQBA 4I9TA 3LSBA 2VO5A 3LCHA 4NZ1A 1XM3A 1A4MA 2INZA 5BCAA 4PTNA 2F6UA 1AH3A 3H8AA 3EMQA 4ZZ9A 1Q6QA 1UR0A 1Y8BA 3GDBA 4XD4A 4X9SA 1Y65A 1OHLA 3PN8A 2WBKA 1FWDC 1JYWA 1SQ7A 1UUOA 4Y9OA 3M6DA 4H9XA 1OK4A 4JBRA 3ITVA 3WQ4A 3HPZA 3UXDA 3OW1A 2XSXA 1IF2A 2XGIA 4ZENA 2ACRA 1IR2A 3VNZA 2ZZ1A 5A8OA 3U0HA 4K1WA 5C70A 1Z32X 4XVDA 2QJHA 1K9EA 2ZRYA 3PUGA 1AD4A 1OEPA 2D0FA 3AICA 1IWBA 2GVEA 2AQVA 2WJFA 1OZQA 3BCFA 1I2PA 4EXAA 4Z1BA 4DWSB 3GYEA 3EXSA 1VFOA 1QPNA 1BQGA 2RHGA 5CZ0A 4BS0A 4FI4A 3O6AA 5GPRA 3AHYA 2OZ0A 1KGXA 4HSHA 4H6QA 1PO9A 4MNMA 3SM0A 3DFPA 4KRTA 1MNZA 1C8XA 2R14A 2VYOA 4QE4A 1WBHA 2XIQA 3UQNA 4IFKA 2WJDA 3BG9A 1EF2A 1E3ZA 1UP2A 2R1KA 3LHVA 3LPGA 3NPWA 2WVVB 4S2BA 4Y9NA 1DHKA 1H49A 4LANA 3MKCA 1KC7A 1UWUA 3LTYA 3QZEA 1Q45A 3HA1A 3L68A 1RJQA 2VWSA 1JPKA 4QG8A 1XIJA 4B15A 2OLHA 3H53A 3VOGA 2ZZ5A 4PYSA 1PS9A 1SO4A 3GVVA 3CPUA 3R0KA 1XRFA 2F8QA 1K7EA 1XBYA 3LMYA 4HU8A 1AQHA 3P61A 3TKFA 5GJMA 2PS2A 3IRDA 4CQAA 1CB7B 1VYSX 5EBAA 3G1FA 5A6TC 3DI0A 4B5SA 1ME8A 3MSRA 1I4NA 4DIAA 1FHUA 4MPKA 3NQAA 4OHQA 3BJFA 4AZCB 3AIBA 4AWTA 4J1OA 4QM1A 1WDWA 4IP4A 1PWLA 1IT0A 3AIVA 3SCTA 4TV6A 4HYRA 3FY1A 4GH3A 1TRIA 3OEXA 2GGJA 3THAA 3QFEA 4XAZA 3D47A 2QPSA 4R53A 3Q67A 1JDFA 5CG0A 1K8XA 5XINA 2C1IA 1KRMA 4HOXA 1GHRA 1QI0A 3ANYA 3T07A 4HCDA 3VDHA 1BXBA 3N2MA 3OIXA 5GNYA 2FTPA 2VZSA 3VGBA 1MDRA 4PUKA 1EP2A 3TJLA 1XBVA 3SQMA 1HKJA 5H2ZA 3UWQA 3CZLA 3RLVA 4DJDA 2ZUSA 4K2SA 1UC5A 3ARQA 4YVXA 1U83A 4L7ZA 2PE4A 3S1GA 2IPJA 3TLLA 1DTUA 4HPNA 2WKLA 1J12A 1CI1A 4GI9A 1UKSA 4OKDA 1H5VA 1JUEA 5A2AA 3M5ZA 5T9BG 3AIEA 4UWMA 3TNBA 1GPFA 4XBSA 5LXXA 3KLLA 1A53A 3CQKA 3SCPA 4S1FA 1MW3A 1WQ5A 1Q6LA 1V4YA 4DX3A 5D38A 3EPNA 3RJYA 4NL1A 1FH7A 1EYWA 1FCUA 3GK0A 4QLJA 1GYNA 3M44A 3MT1A 4MFDA 4FIQA 3THDA 3OTRA 3ZSTA 1L6YA 2QDDA 3I3DA 2A4AA 1VS1A 3TYDA 5DBUA 2J7HA 4KEMA 3GDMA 1KQZA 1KQYA 3PC0A 1QRQA 1W31A 4JR5A 5D9NA 1SJAA 1R3QA 5AHLA 3UF9A 2XH2A 1ECQA 1FWFC 1MW0A 3VOHA 1EWDA 3FDKA 1NWTA 1QAPA 3GG1A 2ZX8A 4AMCA 2VD8A 2BZNA 2DZBA 3SN1A 5AFDA 2VELA 4ZOBA 5K9XA 2Y24A 2CLIA 1U33A 2X1IA 4UZSA 3ECQA 4QSFA 3S1UA 3QPEA 4RLIA 2CZEA 2XSBA 5LIWX 3WNPA 3QLDA 3KXQA 2GLKA 4BK9A 2VX5A 1W3TA 1D3GA 3CS2A 1ODUA 3GH4A 1VF8A 3MV11 3B05A 5FJJA 3S0CA 3GO2A 4LAZA 5C2CA 3QGKC 4WIWA 3ZT6A 2O56A 2PURA 2QCHA 3OLGA 2BG5A 4GPNA 1ZLPA 3T81A 3CUXA 1RBAA 4E2OA 1K8ZA 3TQKA 3CEPA 2OKOA 3IEBA 3W88A 2BNJA 1UR9A 1CGTA 4BHYA 1VJIA 2V67A 5U7SA 4BQ2A 1L9WA 2BVYA 2ISDA 1POKA 3S3GA 3CHCA 4M82A 2QLYA 3RCNA 3VMNA 2EG6A 3KCJA 1G7UA 1TMLA 3VIMA 2E0PA 3T7VA 4FSAA 1PKNA 2WQPA 4IIBA 4UUIA 1PWMA 2ISFA 4RDYA 3CZ8A 3VC6A 2INFA 4PA8A 3P14A 3TCEA 1MO0A 1PL9A 4S39A 1R9ZA 3OPSA 4LF2A 2ZKMX 3O3RA 3LSCA 2VUYA 2E3ZA 2NSXA 5FSDC 4X63A 1BSLA 4KIRA 3AIWA 3LCXA 4B5WA 3GH7A 1IWPA 4JOMA 3SRDA 4I5UA 2CKRA 4JQ3A 4I6KA 5A6LA 1QI3A 3VDAA 2QKFA 4OOZA 4IPPA 4AFYA 2V6AA 3LTPA 1ZP3A 1WA3A 1IGWA 1H09A 3CYJA 5DMNA 1UQZA 3Q4DA 2WK2A 1E5JA 4BWLC 3AXHA 4RV3A 4DJFD 2PDQA 2NX3A 3F2BA 5CPLA 4W4QA 2CIPA 3ISIX 2ZYFA 1YDNA 2O9TA 2AOSA 3BUVA 1BQCA 2POTA 3U6WA 2BP1A 2R9RA 3LGEA 3C8FA 1FX6A 1US3A 3TU9A 5AC6A 4PGLA 1GOKA 3CT2A 5CSUA 1FWAC 3EKZA 1HKMA 4Z1YA 3UJEA 2HMCA 2WZIA 1X98A 3MO4A 1EJVC 1YRRA 2G95A 1ISVA 3VKAA 1UR2A 3FJNA 3B8SA 4L4LA 1QDSA 2X42A 1MNSA 4PRRA 1LRQA 5H8MA 3K8KA 4E2BA 5K9DA 1UP3A 1GVOA 4FB7A 3UG4A 1GQKA 2PDWA 4TQTA 1E73M 3DGBA 1VP5A 3KL3A 1V77A 3SFWA 1NOFA 3T0BA 5AC8A 1FKXA 3QQ0A 2X09A 4ZGYA 2WSKA 2VDIA 1YLVA 2D24A 4H04A 3I6TA 3WQCA 1AW2A 1FUYA 3ZT7A 4IOTA 3SCOA 1B3VA 1M5WA 3A3XA 3MBFA 3WK3A 2WWCA 2YDAA 4NAEB 1W5OA 3C2EA 1KCZA 3UA3A 1MUWA 1O94A 3WLNA 3U2CA 2E40A 3W2UA 1QUMA 5H91A 1S5MA 2H3DA 2QR6A 4KCWA 3N6QA 3L66A 4MLJA 1MFVA 3L4XA 4LALA 1HFBA 3VNKA 1LOSA 3M6YA 1FCVA 1XDMA 3BC9A 3E2QA 4QISA 3CTTA 4GCAA 4N4QA 1VFSA 1TR1A 3H2AA 1XYLA 3MSDA 1M53A 3ARTA 2FH8A 4J2MA 4BF5A 1LL4A 1EPVA 4H4IA 4FIRA 1ZJIA 4Z2HA 1VR6A 3ZR6A 5I3HA 4HT3A 1TTQA 2VX4A 4ZTXA 4J28A 2F7FA 3CHFA 1T6MA 2GPTA 2WHKA 3WH5A 5A6MA 5J8LA 3ZSSA 4AMAA 1PIGA 3W7IA 1JZ3A 3WLKX 5HR6A 1M7OA 4CQ9A 1IR1A 2VC6A 4B9ZA 3WZ0E 4WGHA 2HE5A 3R58A 4X60A 1E0VA 1N82A 3HTWA 4HOZA 1FHDA 5LA1A 3WD0A 1RD6A 1XICA 3T4CA 3G1VA 3N12A 4ADTA 1PX8A 3UR2A 2VHLA 4I8DA 3PAJA 1W1B1 1E71M 2BY2A 2VFHA 1W37A 2W6RA 3LXAA 4XTDA 1SFSA 1R3RA 3PZ9A 1CBGA 3TV8A 2OT0A 3CAQA 3E0LA 5JUVA 1FWJC 2NV9A 3KTCA 2PRLA 4S3CA 2ZX6A 2J7EA 1JCTA 2G50A 2C16A 1BWKA 5A8QA 1CXEA 1KKRA 1SM9A 1VIWA 2QVHA 5SWUA 2JKAA 4FALA 2HRWA 3SGGA 3V18A 4XAFA 2QT3A 2VC5A 1SFTA 4PFHA 4WD0A 1E70M 1H7WA 3VUPA 1S2UA 4DELA 2B7NA 1CGVA 3H7VA 3GG8A 3URNA 5CJMA 1G4SA 5D32A 4O57A 2E6YA 1AL8A 4LNYA 4AD3A 2X05A 2E09A 4Q7IA 4MGGA 5FI8A 2WOQA 1FWHC 3MDWA 3W1MA 3LRKA 3ARPA 5DY2A 1DIDA 4HA1A 4PZVA 4ADSA 3UCQA 1KM3A 3G1RA 3TC7A 2DZUA 2YW4A 1MVYA 2E9LA 5HK4A 2XFFA 4AB4A 3ABOA 3MVTA 1XLLA 2NVAA 4DF1A 3EDJA 3NSMA 5CPSA 1OFPA 1PKMA 4QITA 1FWWA 3O07A 3CASA 2GJNA 3H24A 1REQA 1CGWA 3NQDA 1KTCA 4UZUA 2WMIB 4P7RA 1IZJA 1QO2A 1IYXA 1ZRQA 2V5JA 1XPYA 4W93A 1QK2A 4Z0SA 1HVQA 3UBPC 1LLWA 2GK1A 2XINA 4J40A 3V0UA 3BV7A 4XZLX 2JQXA 2YA0A 3S42A 1QBBA 2J62A 2CFFA 4NRSA 1DEDA 3PWAA 1Z42A 2R1PA 2ZZ7A 4G9PA 2Y4SA 3W7DA 1IQ8A 4AIUA 3KS5A 4CQBA 4UFHA 3WD4A 4OGZA 2XG9A 4IX0A 3EEZA 5C5YA 2R1MA 4Q4MA 3W74A 2D2GA 4O53A 4N4PA 1AJ2A 1CXHA 3WKZA 2J9YA 3O63A 4BI5A 3APGA 3VNJA 4FOJA 4MB3A 1HP4A 1TA3B 4WXZA 3PS7A 3K4DA 5KINA 4HA0A 5JBEA 4TMCA 3BQ6A 4PTDA 3O15A 1AA1B 4ZQCA 3L5AA 4J3TA 4YIWA 2PLCA 4NJJA 2GGIA 4MDOA 3PJUA 2ATMA 3IUDA 1UBPC 3RK8A 1H1ZA 6XIMA 1KB3A 2E6DA 2FQIA 5HWNA 4GVHA 1TB3A 3PBUA 3WJWA 4ATLA 3EWWA 2Z7KA 1BYAA 3KVMA 3P8JA 2A3CA 1J0YA 4EVZA 1RY0A 4GH1A 4O28A 1WKEA 4V27A 3PB2A 3FSUA 1VPYA 3F4CA 3W9ZA 3FNDA 3D3AA 4TVCA 4AIBA 2G96A 1XSKA 2DORA 5IM51 5LIKX 3VOF