2CLKA

Tryptophan synthase in complex with d-glyceraldehyde 3-phosphate (g3p)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
267
structure length
267
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 101
structure length 267
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2clkA00
3ATYA 4PA8A 3HPSA 2ZA3A 6TIMA 3B0UX 3DI0A 3WJYA 3PAJA 5HJLA 2RHGA 2OT0A 3TSMA 2DZSA 5T26A 2ZZ5A 4YCPA 4R53A 5D2XA 1XC4A 5AHIA 3S1UA 3ABRA 1K8YA 2NXGA 4GUIA 2WO5A 4S1FA 4ZQNA 4N9CA 4CCEA 3NPVA 3DU0A 1SZNA 2WJZA 2ZFAA 1W3TA 5CZSA 1X1ZA 5D02A 2A7RA 3S9YA 1EPXA 1DOSA 3U2OA 2AQWA 3F4WA 4XWUA 1HTIA 3C2FA 1DBTA 4QAIA 1KFKA 1Z41A 1LBFA 4QJ1A 4GUJA 1Q6OA 4XBSA 1TPVA 1G4TA 4POCA 3TMLA 1T99A 1QWGA 2BZNA 4O19A 3P61A 5AYZA 3W7PA 4K38A 1KW1A 3N3MA 1HO1A 1JQVA 2ZRYA 3GDKA 3IVUA 3I6RA 1K02A 2ATMA 3TJLA 4XKYA 2PRLA 1WDWA 3WK0A 1L2UA 3TCEA 4ZQMA 3LI1A 3MHGA 3P81A 4EF8A 2CLEA 2FIQA 2WV8A 3W75A 3G8EA 1P4CA 1TPFA 2J9XA 1VS1A 1TB3A 1SW0A 4ADSA 4O1AA 1G67A 2DZPA 4UTLA 1LBMA 3HGJA 1W1ZA 1D3HA 1UASA 1A5BA 3QQ1A 2JGQA 4GRSA 1WOBA 2H8ZA 2BX7A 3GLCA 2W79A 1OK4A 1GT8A 5AC8A 2EKCA 1Q45A 2EF9A 1ZNNA 5FF0A 2ZZ1A 4BWLA 3QH2A 3GR8A 1YXDA 1A53A 3NEVA 5D37A 4PL1A 3L21A 2VXNA 3W1NA 3EB2A 4FXSA 1W3IA 3QEZA 4DQWA 4MVAA 3PB2A 1R30A 5BW6A 4I7VA 5IBXA 3IGXA 1ALDA 3VKJA 2B7NA 2ZTKA 1D9EA 1R46A 3CHVA 3KHJA 3C2OA 5FF2A 3LERA 5H91A 5LKYA 1GVQA 4LVAA 1K7XA 4LVDA 4ZQPA 4NZFA 2TMDA 3T7VA 1SO4A 5F4XA 3INPA 4RKAA 1RD5A 1NSJA 1FQ0A 2RKXA 2C13A 3W7NA 3UWUA 2R94A 3BGGA 4IPIA 1YDOA 3G3MA 1TTQA 1KM2A 2OZ0A 4ONVA 3O6CA 4Y90A 4O1CA 2ABBA 1UB3A 2VFEA 1C8VA 8TIMA 3MO7A 4JX6A 2RH9A 2JK2A 2YFNA 3TA6A 3ZR4A 4BK9A 1GJPA 2CZ5A 4FNPA 1W5OA 5CSSA 4EIVA 3FIGA 5D33A 5AC7A 1VHNA 4JDYA 3KVMA 1I2QA 3NNTA 4CQAA 3A5FA 4LC8A 1Z48A 1L9WA 3GZ3A 1DKWA 3B04A 1EP3A 5F2MA 4IMDA 1L6WA 5G4EA 1TPWA 3UXDA 1J5TA 2DJXA 1KM0A 4IWWA 2FB2A 1KFEA 2QCGA 5GVJA 3S1XA 5EA9A 2NXHA 5FESA 2CLMA 3PY2A 3DKLA 3OIXA 2DZVA 2H3DA 5J5DA 1OVDA 4AMAA 4BI5A 3W3OA 1WV2A 3PS7A 3R5EA 3OBKA 3GDMA 3MP3A 4O0KA 2QJHA 1KM3A 3A24A 1OABA 5FF7A 1F2JA 4MLRA 2WQPA 5BNKA 4JXCA 1QOPA 2ZZ7A 1F05A 4UMBA 1I2PA 1H7PA 3HPZA 3D0CA 5D09A 1MZHA 4IQLA 2NZLA 3G0UA 1EP2A 3WJSA 3S5ZA 3JR2A 1ZENA 1VQTA 4W9TA 2CFFA 2TRSA 1MXSA 4IX2A 1AK5A 4IXXA 2Z0IA 1OFQA 4MJMA 2Y7FA 4JNMA 1OX4B 1YXCA 1XUUA 4YXGA 3EWXA 1G4PA 4TX9A 1YPIA 4RZ4A 5FF3A 4RV8A 1X6UA 3A22A 2EGZA 3SZ8A 5KZMA 3ZWTA 2QUUA 2FQIA 3MI6A 2ZCGA 3BG3A 3M41A 3BLIA 4AVFA 4Z1CA 3L5LA 3RMJA 5LGZA 2V82A 2DU2A 2DZWA 3R13A 5LNUA 3GXTA 3W1XA 2YYUA 3G1HA 4FNSA 3L5AA 5AYYA 1DJNA 3LDVA 4EVZA 3W07A 3C6CA 5HR7A 1X7FA 3HQ1A 2QJIA 1KFJA 2DZTA 4OQVA 3H54A 3RU6A 3B05A 2H90A 1KFLA 3E96A 4MY8A 3P8JA 1FUYA 3LB0A 2A4AA 4N6EA 2BLEA 1PCWA 2RDUA 1DJQA 2VEKA 3WK3A 1LM1A 5FF4A 3HJZA 4HNTA 1PE1A 3OA3A 3DGRA 4E38A 2GQ9A 4UCGA 1QPRA 2NWSA 3KVLA 3P8IA 3S0CA 2GUUA 3W7JA 1O5KA 3Q2DA 3MP5A 5I3IA 1TV8A 2ZZ6A 3QSTA 4UFKA 3NA8A 4HPJA 1T8XA 3P5YA 3KOFA 3UWVA 3LHUA 1QMLA 3AO0A 1YTKA 1ICSA 2C14A 4O28A 4PODA 3TAKA 4FNQA 5A5WA 3GDTA 1BTMA 1MEIA 1K8XA 4JYEA 4LV4A 1O60A 3NPWA 4JTLA 2CLFA 3M1ZA 2DZUA 4UIOA 1LRTA 4LU0A 2A85A 5LHFA 2GJLA 3KAOA 3W2NA 3NQ7A 3M5XA 4AEOA 5CPNA 3G1YA 4UNLA 5K9DA 1FCUA 2J24A 3NO5A 4UFHA 3O8AA 1ZHAA 2CU0A 2LLEA 4MFEA 3KRSA 4BFAA 5AYXA 4O13A 2R8WA 2V2HA 4LOCA 1WA3A 4UFIA 3EWUA 2FLIA 4JY8A 2C6QA 3N14A 4DPPA 3NL3A 2GVJA 1GVOA 1H61A 2A6NA 4UTTC 3OEXA 5K4XA 3A9IA 1H60A 4WUIA 3W1UA 5LNRA 4JTEA 2YYTA 5FEXA 1JVNA 2YR1A 2VEIA 2GOUA 1ZALA 2FPYA 4O8RA 4BR1A 4Z0JA 1H62A 4RCXA 3EXRA 3IIPA 3M16A 1N7KA 4AB4A 4E2DA 4IJBA 4O16A 2DZXA 1F6KA 4UFLA 2G95A 1W56A 3TC6A 2FPTA 2RDTA 3TQ0A 1VPXA 4QITA 4O52A 5I3KA 5AFDA 5G5IA 1FCBA 4CNNA 4QISA 3L68A 4ORMA 4K7YA 1UJPA 4A22A 4UTWC 3LCGA 2FJKA 2Y85A 4M6VA 3GNDA 4DELA 3DFNA 3H53A 1CX9A 4UTIA 3M5VA 3B0VC 2YX0A 1BWLA 3MBDA 5AOUA 3EX4A 4UFJA 3M43A 2BXVA 1JCMP 3EWWA 1FDYA 2V30A 5CZTA 1RQHA 3I7RA 4P61A 1JR1A 3SJ3A 3W2MA 4OHQA 5TIMA 3PM6A 2ZA2A 1PL9A 4B5NA 3LTYA 4CCDA 5C6MA 5KINA 2QCLA 1J2WA 4ADUA 4MFDA 1FWWA 1Q6QA 3GAKA 3ZFHA 3QMRA 3G1AA 4NNCA 4DBEA 3TE9A 3NQMA 3M0ZA 4DF1A 2E5DA 3QFEA 3TXVA 3HPXA 4L4MA 5F4WA 4TO8A 2A2IA 1W8SA 1OX4A 3NQ2A 3M5YA 2CWNA 3NPXA 3IEBA 4UTHA 4JX5A 3G8RA 4WY0A 1TCDA 3CTLA 5I3FA 4WOQA 5AB3A 3NXFA 3G24A 4AH7A 3PSVA 4QSHA 2NWRA 2C16A 4QNEA 5SWUA 2Y7DA 1H1ZA 3I65A 4O11A 3STGA 3JS3A 3O15A 2A0NA 3G0SA 3UWWA 4HNVA 4JICA 1TPH1 4TU1A 3NQFA 1L6YA 3P67A 4D2JA 1WQ5A 3LBCA 1ZAIA 4HN4A 3S1VA 2H6RA 1W5NA 4YWIA 1ZAHA 5EMUA 1NEYA 4PEKA 3NG3A 1KA9F 5F2GA 3UWQA 5DBUA 1K7EA 4NJJA 2PRHA 1JRCA 2FB3A 4S2BA 3EWYA 3MI2A 2X30A 2VFDA 5AHFA 4UMAA 4DF2A 5D2WA 3G1SA 3Q94A 3W23A 4DBDA 5G4WA 4HHPA 1PV8A 4EOUA 3W22A 1B3OA 4OGZA 2H3BA 1FY6A 2IQTA 1SZGA 2G5WA 2Q8LA 1GYLA 4LUJA 4H3DA 1DL3A 4UMCA 3T4CA 3W1LA 5LGXA 4OV9A 3W7KA 4MYXA 3OVQA 1QPNA 3TW6A 1TPB1 3W1TA 3M47A 3UYCA 3CWOX 2R14A 2YSWA 1RZMA 3NOEA 3PBUA 3QW4B 1PHWA 3NL2A 4LVBA 2CLOA 3A23A 1TQJA 2NX1A 2Y70A 2F84A 4WQ6A 1O94A 1W37A 3USBA 1Y0EA 5HINA 4E2BA 1W5PA 4A3UA 3TMQA 1YYAA 4NJIA 4GNJA 3VE7A 1SR9A 2CLKA 3QMTA 5E1QA 1LTDA 1NF0A 2A6LA 1EUAA 3C4UA 1FCQA 3SGUA 3NL6A 3W1RA 5E93A 3DZ1A 3BLEA 2QUTA 2ZRZA 1LBLA 4LW7A 1RV8A 1VZWA 2V0TA 1M5WA 4HSNA 5E0KA 3S6DA 1OFEA 1R47A 1H7WA 4YMZA 4MYAA 2ZZ3A 4LVGA 1O5XA 4Q33A 3TROA 3QMSA 5D2TA 1F73A 3LHWA 5I3GA 4O10A 4O0ZA 3G1XA 3M9YA 2BWGA 5C54A 3EKZA 1YXYA 3RFAA 3STFA 2PCQA 4O15A 4XQ6A 4QNWA 1ZCOA 3QPYA 4FEZA 1HO4A 3NQGA 3C52A 4KFNA 3MW7A 4MIMA 4JS3A 4NNBA 2QCDB 2E5BA 3HG5A 2QAFA 5U4NA 2PE4A 3ZWSA 3S5OA 3K30A 4Y6GA 1FBAA 3UY8A 3F4NA 3OVPA 1H7XA 1P0NA 3QJAA 3LOTA 3CB8A 3STEA 4WXYA 4FB7A 1OYBA 3MYOA 2GQ8A 3W7OA 2NUWA 3W76A 1TREA 3NQDA 5LZLA 3C61A 3G1FA 2W6RA 2ABAA 2HS6A 4FX6M 4LNYA 4O1BA 1OFDA 5C5YA 1K8ZA 1XUZA 1XM3A 5D04C 4JEQA 4YL2A 3LM7A 4IMCA 5D03A 3C3NA 3B06A 4UXDA 1B4KA 1F5ZA 1VCGA 3PC0A 4Z08A 4EF9A 3VFLA 2J27A 3GKAA 3CT7A 4CLMA 1OFPA 3BO9A 3F03K 1OK6A 3PG8A 3LXAA 3BV4A 1TRDA 3W1MA 5LSMA 4AF0B 4X2RA 3F1QA 3NAVA 4K8EA 3GB6A 2CZDA 1ME8A 4LY8A 1DQWA 4M5PA 4NJKA 1LLWA 3HGSA 4CQ8A 4OV4A 1SW7A 3DI1A 4LT9A 3IRDA 1PVNA 3IIOA 3L5MA 3DHDA 2WSRA 1MO0A 3N2MA 3TXZA 2X2GA 3SECA 1W54A 4FX7A 1ONRA 1KFBA 4WD0A 1VC4A 3PR2A 2KZHA 4H6KA 1VYRA 1P5BA 3ABQA 1FX6A 1SPQA 1HL2A 1YTDA 2QEZA 4OWGA 3OG3A 2V9DA 2Y6ZA 3MMTA 2C3ZA 3V1PA 2HS8A 3IGSA 4JR5A 3EX3A 5LNSA 1LROA 1V7YA 1N8FA 4QQ3A 2PRMA 3C56A 3LTSA 5KITA 1GG0A 1MEWA 2J88A 4CNPA 3W7MA 4I9AA 3HO8A 2VOMA 1I8JA 1GQNA 2QDGA 1EB3A 1H7RA 3VCRA 4X22A 2JKPA 1G4SA 5FEPA 1SW3A 2Y88A 3WJWA 2NUYA 3HBLA 2Y7GA 4RX0A 1G7VA 1W5QA 3HB9A 1IXQA 2FTPA 2RDWA 2Q3OA 3LHVA 3L66A 4ALDA 2Z1BA 3MYPA 1SU5A 1LZOA 5FEWA 1JCYA 2QCMA 2WKJA 3E0IA 1JCNA 3RF9A 2GJNA 3FYPA 4GWEA 2Y61A 1TV5A 1OX5A 4BWLC 3C0JA 5LHEA 2VFIA 2YPIA 2C15A 5CG7A 5HULA 3DAQA 3O06A 1GWJA 3IV3A 3B0PA 3R12A 2WSYA 4FNTA 4TIMA 3TK7A 5IBXC 1QPOA 3GX9A 1EUNA 1Z42A 1GG1A 1WYIA 1OFOA 2G96A 4NQ1A 2EHHA 1TTIA 4O57A 2B7OA 1SZFA 3CQ0A 2Y62A 2QF7A 4HSOA 4JTHA 4AWUA 4ML9A 5DELA 3C8FA 4K39A 1UBSA 4XTDA 1EX5A 5HUOA 2ZYFA 3LGEA 2YGYA 2OMAA 4GFSA 4NX0A 1I4NA 3HIJA 1Q3NA 1ICQA 4UFMA 5A8GA 1H7OA 5BRBA 1OF6A 2Z6IA 3PSWA 3G1VA 4KWVA 3PBWA 5EKYA 5AHMA 1ZFJA 2GPTA 3RK8A 2DP3A 1RPXA 1UCWA 5KZEA 4O53A 3TJXA 3W70A 2H8XA 4ZQCA 3NZRA 1KLZA 5AC6A 2QCDA 1XBYA 3GIYA 4AHOA 1ZY9A 4LC6A 2VFGA 4JTGA 3GYEA 1XL9A 5AHEA 1GVSA 3GVGA 1C9DA 2V2CA 1IXPA 2QCNA 4CQ9A 5CPMA 3SW6A 3GDRA 3CIWA 1ICPA 3W87A 4O12A 1YDNA 4TMCA 3O07A 3NQVA 1VLWA 1M6JA 4GC4A 2C0AA 2EAWA 4RLIA 4ORIA 1FWTA 2GVLA 4Q4KA 5HR6A 2V5BA 1KBIA 3CPRA 1SO3A 3QZEA 1FWRA 2DJLA 4A2RA 1F7BA 4AAJA 3IIZA 1KTBA 2FPVA 2GQAA 4JTKA 3S5YA 3ABOA 3UZ5A 4AF0A 1NVMA 3AJXA 4JYFA 2O7SA 1SZEA 4C1KA 3QF0A 2HSAA 2NLIA 4M7SA 3T78A 1S5TA 2P0OA 1VYSX 4DO5A 2VENA 1OX6A 3LI0A 1OJXA 3FKKA 4NUWA 5MHBA 3W88A 2ZRXA 1ML1A 3PUDA 1IXNA 3ZS4A 1OHLA 1W0MA 2Q3RA 1PCKA 4LTSA 4X3ZA 5G2IA 4Z1DA 1I45A 4QM1A 4FX8A 3CEUA 3LXCA 1D3GA 2B7QA 2QCFA 4ZQOA 3TKFA 1FXQA 2NX3A 3CU2A 3QW3A 1N55A 3R89A 3EXSA 3MJYA 1EIXA 1AG1O 4LV9A 3G18A 3OVRA 1C29A 1VLIA 1XDMA 4H4IA 5DCBA 3TUUA 3BW3A 2Y63A 5CPLA 3DBPA 4MZYA 1S5WA 3GDLA 3LHTA 4PH6A 3NDOA 1IXOA 3TFXA 3ABSA 2A1YA 3LCIA 1U83A 4JTIA 4TMBA 4FXRA 1FDJA 3GR7A 3SFKA 2TSYA 3W83A 2NV1A 3C2EA 3L0GA 2CZFA 1RR2A 1HUVA 4BI7A 5EBUA 2QUVA 1VCFA 3H55A 5F1UA 3BG5A 3T55A 1JCXA 2TPSA 3A21A 3NQAA 4WY0F 1QDSA 2QAPA 3IVSA 4S2CA 4RJEA 3GKFA 3P7YA 1QCWA 1SFJA 5F1VA 3E49A 1A5SA 4Y96A 1OFAA 3KRUA 2WSQA 3GNNA 1TJRA 5HMSA 5DN1A 3HG2A 3EX1A 2VC6A 4HT3A 1TYGA 4JDBA 4ZL1A 1YADA 3PBYA 3BK0A 1DV7A 2ZRWA 2Y89A 4P2VA 2CLIA 3W9ZA 2X1UA 5F2IA 3Q37A 4PFMA 3UQNA 1LDCA 3KVJA 4N4QA 4IMEA 1U5JA 1NFBA 5D32A 3LV6A 1DQXA 3BGJA 4HNUA 3FS2A 3L0KA 3M7WA 3P84A 4DO4A 1T96A 3PUEA 1TO3A 4RXGA 1XFBA 3FKRA 5K7JA 1R2TA 4UR8A 3G1DA 1GYNA 4FIRA 3NVTA 2VELA 3QSRA 1R2RA 4NZJA 3N2XA 3TSDA 4CCCA 3THQA 4OBTA 3TV8A 5K4ZA 3LRMA 5G1YA 3WK2A 3I7QA 3ELFA 4PL2A 2F7FA 5D2YA 1B57A 3KRZA 4OE7A 4GXMA 2E77A 3P82A 3LBMA 1F76A 1Q6RA 1K7FA 1OF8A 1NAL1 3BPWA 5KZDA 2J9ZA 4OT7A 2ZZ4A 3S8HA 4JTFA 3N19B 4HKPA 1A5AA 4MOZA 2YW4A 2OJPA 3I7SA 2XN1A 3TH6A 4Y9AA 2C1HA 1TSIA 3JRKA 3DFOA 1VJIA 4Z1AA 4NXKA 3LX9A 1TQXA 1S5VA 4XUGA 4PCFA 3W1PA 1GTEA 3LLDA 4PC8A 3MUXA 3O6YX 4I7UA 3HGRA 5G2WA 1UUMA 4NJHA 2NX9A 3Q58A 2DORA 1JQXA 4NX5A 5AHNA 3TSBA 3WK1A 4UNKA 1L6SA 5TQLA 4IXHA 2HTMA 4DPQA 1TPDA 2E6DA 1YLVA 4IUOA 3TW7A 5LNWA 4G1KA 3EKLA 3QM3A 2E1DA 4I7WA 4AWSA 4LS1A 1VH7A 4MJZA 3LCXA 3DFSA 1SO6A 1TRIA 3TAOA 3NQ6A 3PWAA 3T44A 2VEMA 4JTSA 3W7DA 1XKYA 4GE8A 4N2YA 4A29A 5IM51 3I68A 3CLMA 1RQEA 3N34A 4PTNA 3DH7A 3FJ6A 4O54A 3HG4A 5K3VA 4JIQA 1P1XA 3BLFA 4FNUA 1XI3A 4RZ5A 4M7TA 1ZJIA 1AMKA 3P62A 4UTMA 1QR7A 4IOTA 1OYAA 3E9AA 3N9RA 1DORA 3EWBX 1LYXA 3NGJA 2WPBA 1WX0A 2QCEA 1B9BA 3O6DA 4FO4A 3RNDA 3SY5A 6ALDA 4ICNA 3CEPA 2ISVA 4AHPA 4DF0A 3G0XA 3PUOA 2C18A 5HQEA 1BWKA 2A21A 3THAA 1PIIA 3WFAA 3LXBA 1G6CA 2FFCA 4MLJA 1YTEA 1BKSA 4YCOA 3QPZA 2A7NA 3EWZA 4JYDA 1WXJA 4MY9A 1TPEA 1THFD 5CGQA 1AW2A 3W2JA 3N9SA 3PG9A 4XZ9A 1WBHA 3CC1A 5L6UA 1LRQA 2Y7EA 5DBTA 2WNQA 3WJZA 4OU1A 5H2ZA 4UUIA 3T40A 4NT0A 2CW6A 4Z1BA 3O63A 3MHFA 4MUZA 4E0CA 1IF2A 2ZRVA 1GPWA 4MPQA 2E09A 5F2LA 4O4WA 3HGOA 3SIZA 4XTIA 3PF3A 1KM5A 3U6WA 3PB0A 1AL8A 3EX2A 1XBVA 5F4SA 3U8GA 1LP6A 1H7NA 2FDSA 1WAUA 3LCHA 5FI8A 2J6XA 1OFRA 5AN7A 4C1LA 4IGHA 3NPUA 2E68A 1SO5A 4M19A 3W86A 2ATSA 3IVTA 3UD6A 3C2VA 2GVGA 2JKEA 1EP1A 2XFWA 1SSDA 2BSLA 3CIXA 5DCDA 3SGZA 5CZJA 3TFCA 3NQCA 1BEUA 1XBZA 2C19A 3GK0A 4AWTA 1A50A 3R2GA 1TTPA 4R7JA 7TIMA 1TPUA 4A2SA 1FWSA 5HNRA 1GZGA 5D05A 3UWYA 3GAYA 1KBJA 1Z44A 5BMXA 3UWZA 3E02A 4M6PA 5CPOA 5I3HA 3NM3A 4NXSA 1V5XA 1JCJA 4MZ8A 3DXIA 1VCVA 1XBXA 2NXIA 3VI2A 3P5ZA 1QO2A 1VYPX 5HWMA 1AW1A 4WJEA 4NJGA 2J9YA 4M6QA 4LUIA 1IIGA 3LTPA 4K7VA 3W7QA 3SR7A 1Q6LA 3TX9A 1X1OA 5C2XA 3SI9A 2QKFA 2YW3A 1GTHA 3HG3A 2Z6JA 4RK8A 1QFEA 4UTKA 4ADTA 4KKXA 4N9EA 4DEFA 1YDVA 4O4VA 3FYOA 3W7CA 1G69A 3DENA 3MI3A 5CSRA 1S3HA 3W7EA 1GVRA 2I14A 3P60A 2P10A 3FA5A 1KTNA 4RXFA 1LRNA 1HG3A 1QPQA 3W7LA 4WXZA 3HMJG 1P0KA 2E6FA 2WNNA 2E6AA 3W72A 1OFBA 4LVFA 1RVGA 2E6YA 1LLZA 2CLLA 4JTUA 4J9JA 2PURA 3B03A 3G22A 4GUFA 2Q8ZA 1H51A 4DXVA 1EA0A 5DCEA 3UNDA 1W5MA 4ZMGA 4IMFA 4GJ1A 4O50A 3WJXA 5C55A 2CZEA 1TJPA 3IGUA 3FFSA 2YXGA 3DFTA 1KM4A 3IIVA 3KVKA 1X8FA 3W1AA 4LRSA 4XBKA 3RLVA 1RQBA 1VRDA 4UTTA 4X9SA 2ISSA 3FEMA 4MZ1A 2V2DA 3O05A 1QAPA 3LCLA 4FHAA 5U7SA 3GXPA 3KFTA 2A7PA 3W7HA 3PBVA 3W7GA 2VFFA 1NF7A 5D38A 1KLYA 1JUEA 2NV2A 3QC3A 2QCCA 3L65A 3EXTA 4AHQA 3UXAA 3TIMA 1SSGA 4WY0B 3MBFA 1TPC1 3O16A 3VNDA 1J4EA 1H50A 3P80A 4UTWA 2ALDA 2Z2UA 4UC5A 1F74A 4WX2A 1ME7A 3LCFA 5DLCA 1KFCA 2V8ZA 4EWND 5KTLA 2ZTJA 5G1TA 4WZHA 3HOJA 1LCOA 3ANYA 2X1RA 2EPHA 4LS0A 4O1DA 4JD4A 1FCVA 2XN2A 5G2HA 1IIHA 3M6YA 4U4MA 1KM6A 3W85A 2E5CA 2A5HA 3QYQA 2B4GA 4O18A 4QIUA 5L9FA 2X16A 3BVJA 3NZ1A 4RR4A 5EYWA 3TU9A 3BARA 1E51A 4WOZA 2AAMA 3TDFA 1KM1A 3MWAA 1KTCA 3LHYA 4UTJA 2I1OA 3G3DA 1JULA 1JJKA 2YZRA 2B7PA 3W2KA 3TR2A 3LHZA 1VHCA 4U28A 2ZBTA 2QCHA 1ZAJA 1IGSA 3LCWA 4A21A 1M7OA 2QDHA 3NQ8A 3PVFA 3A5VA 4HNNA 3CM4A 3GXNA 1EWEA 5DXXA 4BI6A 2I9EA 3W74A 4FIQA 3L0NA 4AXKA 2V81A 4GUHA 4N6FA 4R33A 3NYZA 3C2RA 5KMYA 2HMCA 4JGDA 5BOOA 1M7PA 4JN6A 3NR0A 5DY3A 3S5NA 5D30A 5K2ZA 3BG9A 4JX4A 3FLUA 4R34A 5I3JA 5K9XA 3UY7A 1JCLA 2JBMA 3SSJA 1TMHA 1AL7A 4ZZ9A 3TQKA 3NM1A 3ATZA 4TR9A 2OCZA 1VR6A 2NUXA 3BW4A 3YPIA 3IIXA 1ADOA 3M5ZA 1W3NA 4NU7A 3B4UA 2VEPA 3LRKA 1FWNA 4N9BA 4O17A 1TTJA 2YDAA 5HWJA 1I2NA 2OT1A 3DHFA 3PULA 4LRTA 1I2OA 3W2LA 4CNOA 2O7QA 4IMGA 4JIPA 3L67A 4YLWA 1H63A 1LOQA 1R2SA 1MEHA 3O1NA 3UPBA 3VE9A 3W7IA 4NVTA 4XKYB 1W31A 4IX0A 4JY9A 1JUKA 1XDLA 3R8RA 2ZDRA 4L4LA 4MY1A 4LS2A 4HPXA 4LWWA 1F6PA 3W73A 4N9DA 1GOXA 3P74A 1B4EA 3MHUA 1H1YA 4DO6A 1ME9A 3TNOA 4FNRA 3BW2A 3LRLA 1LOLA 3DFPA 2XN0A 3STCA 3W6YA 2V5LA 3EEGA 5CZ0A 3DFQA 5ABTA 4K36A 4FF7A 5J5RA 1O4UA 3RLUA 4BF9A 5HWNA 1G4EA 2ZA1A 5EPDA 2ZRUA 4Y8FA 3NQEA 2VFHA 3E12A 3HF3A 4NNAA 2OX1A 1LORA 1XCFA 2TYSA 4HIBA 4UR7A 5TBOA 1FDZA 1WOAA 1OG0A 1KV5A 4MKNA 1CI1A 1EWDA 1CW2A 4JTJA 1AW5A 1TIMA 4KFOA 1GEQA 3LV5A 2UV8G 1JUBA 3NL5A 5FEZA 1SFLA 3CWNA 3W1QA 1K3UA 1YPFA 5EY5A 2W0UA 3TQVA 1JRBA 2BTMA 3S1WA 1FXPA 1TV7A 2R91A 2JGYA 3S42A 1HFBA 3KXQA 1PS9A 2D73A 5D2VA 4K37A 4K8HA 2YCEA 1SUXA 2CLHA 1QNVA 1I2RA 5HUPA 4GUGA 2AGKA 4UTUA 1H5YA 1UUOA 5DXYA 3KX6A 3OHIA 5BMWA 1A5CA 2QR6A 4GBUA 5KSWA 2PC4A 5K9CA 1EEPA 3UZJA 3MP4A 1OYCA 1VGAA 5AHLA 1XXXA 1QO5A 4KWWA 4KFPA 4Q32A 2WNZA 1PHQA 2VKZG 2ZQ0A 4O14A 3L9CA 2WOQA 3EX6A 3W2UA 1LOSA 3B8DA 1QOQA 1SQ7A 1T0OA 3M44A 4JTTA 3FJLA 4RZ6A 1DHPA 2ISWA 3QRHA 3N73A 2RFGA 2ZZ2A 4K6AA 3V75A 3W71A 4ZQRA 3UPWA 2B0MA 3TC7A 2JKAA 3DKJA 3LLFA 4IPJA 2P1FA 4N02A 5DY2A 5CKSA 1DVJA 4N4PA 1WBJA 2YFOA 2X1SA 2X1TA 5LNVA 1MSSA 1GVFA 2G97A 4ZVJA 1O95A 5EL1A 3L2IA 2QJGA 1KV8A 3QQ0A 1K03A 3FOKA 3W84A 4Z0SA 3W7RA 1G7UA
chains in the Genus database with same CATH superfamily
7ENLA 2CERA 3HQNA 1PWLA 2ZA3A 3B0UX 3DI0A 3WJYA 3KUMA 4W93A 4NYUA 1KXHA 5GNZA 5T26A 4RE4A 2ZX8A 1SFTA 1D2KA 5AHIA 4FAMA 2FZBA 4GHRA 1SZNA 2DVXA 1A47A 1LG1A 2NQ9A 1EPXA 3W02A 1E6SM 1BGGA 3U2OA 3S2MA 1E55A 4Q6JA 2QXWA 3C2FA 1DBTA 3URBA 3SCQA 1Z41A 4QJ1A 4XBSA 3ARSA 1G4TA 5EU9A 3U2ZA 3LGDA 3EDJA 8A3HA 3P61A 2PD9A 3H4GA 1E43A 4XAYA 5C9RA 1JQVA 2C71A 2G50A 3GDKA 3IVUA 1RALA 2HROA 2X8RA 2VVNA 2FMOA 1K02A 2X7VA 3HTWA 2ATMA 3TJLA 2E9LA 4XKYA 3LI1A 3V18A 3P81A 5LA0A 4EF8A 2CLEA 2FIQA 4XV0A 3G8EA 2DSZA 3UPMA 4OBRA 3EPOA 1SW0A 4ADSA 4O1AA 1NH6A 1LBMA 2OYLA 1BAGA 3KS6A 4WRHA 2ICSA 2GGIA 2BX7A 2CHOA 3GLCA 3LENA 1QW8A 4ACZB 4V1XA 3BH4A 1OK4A 1EOMA 1E1EA 1EXBA 4AD0A 1Q45A 4F0SA 3DG3A 4UZSA 2YCLA 4MPKA 3XIMA 1QTWA 1YXDA 3GR8A 3T09A 3NEVA 4X2PA 1YMYA 4B91A 1LF1A 1E70M 1F4HA 4FXSA 2BOFX 1R30A 1WKEA 1UP2A 4ATDA 1IEQA 3BQ6A 3VKJA 2ZTKA 4DUXA 2QS8A 4IFKB 5FF2A 3TVAA 3WUBA 1RK5A 2Z2AA 3WD2A 1MMFA 3KLLA 2GOKA 1K7XA 3BCFA 4I6KA 3WQ6A 2W9MA 3INPA 1UR9A 1Z3NA 4GZ7A 3UJ2A 2HDJA 4G2DA 3SCVA 3S6TA 2FHFA 3RRAA 5CBBA 4D1IA 3W7NA 3BGGA 3VGDA 3G3MA 5T8GA 4DWSB 2J8TA 5AZ1A 2ABBA 4XD6A 2OKOA 3MO7A 3HM7A 2VYOA 3OGVA 4KBXA 2RH9A 2QYGA 4L56A 4BK9A 4HK7A 4MG4A 4EIVA 2ACRA 1VHNA 4C1NB 3RLHA 3VAVA 3NNTA 4CQAA 3A5FA 3GZ3A 3V0TA 3AU2A 3EA3A 4B5SA 1QI2A 2PDYA 4GO9A 5G4EA 1OC5A 4S39A 1KM0A 1MZRA 4IWWA 5M1TA 3STPA 3S1XA 4S3GA 5GVJA 2NXHA 1W6TA 3KOZA 3PY2A 4L9XA 2DZVA 3UA3A 2PDLA 5J5DA 1QW9A 3VIHA 1F3XA 3IWPA 4AZHA 3W3OA 2EPNA 3FAXA 3PS7A 4DJDA 3G1RA 4I6VA 3SBFA 4ZXOA 1OABA 2WQPA 1F05A 1AH0A 1W3LA 1TWDA 5D09A 4IQLA 4PMRA 2NZLA 3ALGA 2OO6A 1Q66A 4Q8MA 2WK2A 3JZUA 4LAOA 4JL2A 3S5ZA 1ZENA 4DJDD 2PCEA 2FVMA 5ECVA 1PYMA 4C6KA 4GZEA 1P6WA 3N1AA 1YXCA 3VU2A 1G4PA 4TX9A 4WJXA 3BV7A 4L64A 5FF3A 3N6HA 2VO5A 2FQIA 3BG3A 4QDPA 4K1WA 3M41A 2R24A 3SCUA 2D0FA 2DZWA 1EGVA 2PDJA 3R25A 3N6JA 5TNVA 4TTUA 3L5AA 5KZ6A 3BZGA 3W07A 1XGZA 3C6CA 3FK4A 3H23A 3B05A 1SJAA 1E6PA 2W66A 1KFLA 4MY8A 1A5UA 3P8JA 1KCZA 1WZKA 3SCPA 4DB7A 1U1JA 3RO6A 2BLEA 4Q6XA 2ZE3A 3HJZA 4ACZA 1PE1A 1QPRA 4HCDA 1GKPA 2GUUA 3WQDA 2WWDA 1A80A 1GZ1A 3N6QA 3MP5A 3AMLA 4UFKA 3V7PA 1CGXA 3MVIA 1QMLA 2C14A 4L6OA 3GDTA 4JYEA 2DSVA 2VWSA 2CLFA 4Y9NA 4IFKA 3RR1A 4DUOA 1H41A 4LU0A 5LA2A 2A85A 2OWCA 1POJA 3SJNA 3M5XA 3S2JA 3BAKA 3UZXA 5C9ZA 4MFEA 3LU2A 4KGJA 4LOCA 2VOTA 4HCLA 2WCGA 4DWSA 4NI8A 4UFIA 4XIAA 2RGMA 4RPQA 4H6QA 4JY8A 2WZIA 1GW9A 3SO7A 1F07A 2PDWA 1TJ1A 1EJ7L 3N14A 1JEZA 3SCNA 4C6EA 1H61A 2A6NA 3HA1A 5CJNA 1H60A 5LNRA 4GA8A 2YR1A 2VEIA 1H62A 1XLGA 2JIEA 4DWSD 3ISIX 1XG4A 1N7KA 3M16A 4HZ6A 1JZ6A 4WVXA 2G8ZA 8XIMA 4UFLA 3DYOA 3L12A 2FPTA 4H9UA 5AFDA 4QITA 3S83A 5G5IA 1ZB5A 4QISA 1UJPA 4A22A 4M24A 4XAPA 3TA9A 3GNDA 3DFNA 3H53A 2D2HA 4GQQA 5CBJA 1T6MA 3VIJA 4JHOA 1CCWB 1J93A 3GY1A 2WC3A 3M43A 1OINA 3EB3A 1HJQA 3II1A 1KQZA 5CZTA 3W2MA 2DUXA 1XLFA 1PL9A 1UG6A 2POZA 3LTYA 2OTDA 4GY7A 1I9CB 4HZMA 4PMUA 3TN6A 3G1AA 4NNCA 3NUKA 3WG6A 4FF5A 2VX6A 4DBEA 3TE9A 3NQMA 2VTFA 2F2KA 4DF1A 2ONEA 1BVZA 4UCFA 2PDMA 2HK0A 4KT2A 2X40A 4TO8A 3AMCA 4AIUA 1CB2A 2CWNA 1R3VA 4WOQA 1RCXB 1G1YA 1BQCA 1XIJA 5I78A 4AH7A 3PSVA 4PUUA 2A3EA 1EGMA 5SWUA 2Y7DA 1A0EA 1KGUA 3I65A 3STGA 3JS3A 4S3EA 1XD0A 3UWWA 1P0EA 2PWFA 4HNVA 3C86A 4O1EA 3P67A 3WDPP 3LSCA 1ZAIA 4ATLA 3FA4A 2DY3A 4B92A 1NEYA 5F2GA 2CKSA 5DBUA 1A5OC 3FN9A 2PRHA 3RR4A 3GE7A 2FB3A 4JN8A 3OLGA 4AIOA 3EWYA 2OFJA 4IIHA 3BMXA 2P53A 3S2CA 2VFDA 4ZA0A 2R1KA 1IR2A 1BSIA 4AW7A 1M1BA 4DBDA 4F4RA 2Q09A 3MS8A 5EFDA 2V67A 1PV8A 4EOUA 1RBOB 4OGZA 2INEA 2H3BA 1GYLA 5LA1A 1BG4A 1IYXA 3W1LA 3GXFA 3W7KA 1W9UA 2OELA 4LCRA 3OVQA 1QPNA 2FZDA 1ZJHA 2VUNA 1CEOA 1TPB1 1KCLA 3W1TA 4OKDA 3UYCA 1TMQA 4FR1A 1RZMA 3DFHA 1NM9A 3PBUA 3VM5A 3QW4B 5CLTA 4LVBA 2CLOA 2NX1A 3SFWA 1MUCA 1M68A 3PJXA 2DV0A 1W8GA 3IPWA 1CWYA 4PCPA 4E2BA 3ARUA 1B90A 1UMYA 2Z1WA 2EG7A 4H00A 3QHMA 1E15A 1CZ1A 3F2CA 1SR9A 2CLKA 2HVMA 5AECA 1FKWA 3EZ4A 2PI6A 1LTDA 4GCAA 1EF2A 1JAKA 3LBOA 3GIPA 5JH2A 3SGUA 3A9BA 3NL6A 3B3DA 4F9DA 3PNZA 2NW0A 2F8QA 3W1RA 3CAKA 1TX0A 1WDSA 3MJMA 1NWSA 3DZ1A 3BLEA 2QUTA 4LW7A 1RV8A 2V0TA 3OBAA 1AD4A 1W1VA 5CC7A 3RPDA 2E9BA 4DYJA 3P2VA 1R47A 1H7WA 2PDBA 3KWSA 4C7FA 4PSRA 1RH9A 3BMVA 4FLSA 3NO3A 4S3KA 4W5UA 2IPGA 5JIPA 1FKXA 1EL3A 1GKQA 4R9OA 3EKZA 4QQUA 3RFAA 1VFFA 3GVVA 3STFA 4HU8A 4XQ6A 2EQDA 1ZCOA 4FEZA 1HO4A 3C52A 3M0KA 3MW7A 4KFNA 4MIMA 2C0HA 5BROA 1QT1A 2Q02A 3HG5A 4HBKA 3H7VA 5U4NA 3WNKA 2W92A 4RDVA 1H7XA 1QBAA 4BJHA 1P0NA 3VKKA 2JEQA 3LOTA 3STEA 4P5UA 3UNTA 4PSPA 1RK6A 3WBAA 5HQMA 3KW3A 3NQDA 1P43A 2W6RA 3O3RA 2YBTA 1DJWA 2OLHA 5C5YA 3KWXA 1K8ZA 4X60A 1W9VA 2WAGA 1GJUA 1VFHA 5G4HC 1ISVA 1YEYA 5FSEC 5LIYX 1F5ZA 3UU0A 2V3GA 1LWJA 1OFPA 2TAAA 1PKYA 1OK6A 1V3IA 3ITVA 1ZQ5A 4MADA 4US5A 3ZT5A 2QW5A 3WMLA 2GGHA 3N04A 3LS9A 4M5PA 1KB3A 5KEZA 4H19A 4CQ8A 3PPFA 2BXYA 3T07A 2WQDA 1RP9A 3IRDA 4EE9A 5MKGA 4JFVA 3IIOA 2PBGA 4US5D 3L5MA 1AQFA 1PX8A 1DIOA 3N2MA 1FVPA 3SUWA 4FX7A 4NIRA 3PR2A 2KZHA 2QPSA 4H6KA 2FYMA 2O9TA 1FX6A 3BLDA 3OG3A 1H5VA 1W32A 3F2DA 1FTXA 2Y6ZA 5DX7A 3V1PA 1JD7A 4JR5A 1UWSA 3EX3A 5LNSA 1LROA 1V7YA 4IP7A 4J40A 5REQA 2PLCA 1N8FA 4YTTA 3AWOA 3OZMA 2QIIA 2DSKA 5KITA 2AQVA 1EXPA 1V3KA 3DYMA 2F61A 5HATA 4CNPA 3W7MA 3HO8A 2VOMA 1Z7AA 1ONXA 4HNLA 1EB3A 1QI0A 4J3ZA 3WJWA 3EMZA 2BVTA 4O1FA 3AC0A 3WELA 4N0RA 3LHVA 2Y5SA 2Z1BA 3MYPA 2IXVA 3K1DA 3K46A 1JCYA 2WKJA 2XTKA 1TV5A 3LM3A 1LG2A 5EB8A 3CT2A 2YPIA 5HULA 3DAQA 1S5NA 3RCMA 1UROA 5A6BA 1BVWA 4CNTA 2WSYA 3TK7A 3SADA 5IBXC 4M80A 4HOXA 4AMCA 1XYLA 2CWXA 4Q4SA 2G96A 3VOFA 5HK4A 1EO5A 3BJTA 3LMZA 4AYSA 1TE6A 1SZFA 1Q7ZA 2QF7A 1XISA 5A6LA 4XTDA 1UBSA 4CN6A 5A6BD 3LGEA 3ZJ7A 4MUPA 1IWBA 1Q3NA 2XG9A 4UFMA 3PSWA 1O66A 1HVXA 2XUCA 4INFA 4PTWA 5AHMA 4JN7A 4RV3A 3CUGA 5KZEA 2H8XA 3SUTA 4FZIA 4ZQCA 3NTYA 1XYCA 1IV8A 1TWIA 2INFA 4LC6A 4GQ0A 3M0MA 3PHAA 4NF7A 5AHEA 4ZXLA 4ZO6A 1C9DA 2V2CA 3C0SA 1XV8A 4OOUA 1EQPA 4DZIA 4IG2A 1W1A1 3CS2A 1E4MM 2VGGA 3QQWA 3JZEA 5E5CA 1V6UA 1TR1A 2DDXA 1YDNA 1V93A 3NQVA 1YIXA 2D3NA 3ABXA 5I03A 2C0AA 4E4PA 2YCKX 5ABGA 3I3DA 4TQTA 1KBIA 3CPRA 1SO3A 3QZEA 3PAOA 3AALA 5I24A 4C6NA 2Y1HA 3ZT7A 1UWAA 2PDXA 1GK8A 2FPVA 1JI2A 1EGZA 1OD0A 3S5YA 4PUEA 2O7SA 4PEEA 2NLIA 4M7SA 1TMLA 1XYMA 3B0YA 4ATWA 1XICA 3EPNA 1OX6A 3LI0A 3CB3A 4CNSA 4ILSA 5EMLA 4D6DA 2EO7A 4Z1DA 4GMEA 1I45A 3EMQA 3K4DA 3DCPA 3LXCA 4RDYA 2MNRA 1ISYA 1O7AA 3QW3A 1N55A 3EXSA 2DPEA 1AG1O 3W27A 1RLCL 2GZXA 5DCBA 4H4IA 3GTNA 3NYDA 2Y63A 4MZYA 1S5WA 3GDLA 3LHTA 4DYEA 1IXOA 4ZOEA 3A6OA 3LCIA 1NOFA 3W83A 2NT1A 3L0GA 1W1B1 4GXPA 4L9ZA 3FJNA 3OZOA 3MY9A 4BI7A 4UB9A 5EBUA 1V3HA 4ICMA 3E38A 2G3NA 3GIQA 3H55A 2PAJA 2BGNE 2BHUA 3ITOA 3IUIA 3GW0A 2V3DA 2ACUA 4WY0F 2VZUA 4Q7IA 4S2CA 3L4TA 4RJEA 1E6ZA 3GFZA 1EJSC 1SFJA 3N4FA 4RNFA 2XVLA 4J27A 2OSXA 2WSQA 3GNNA 2IUZA 5HMSA 1S2CA 1XIIA 3HG2A 4GACA 4JCLA 4F0LA 1TYGA 1YADA 3BK0A 5CXPA 1DV7A 3VM7A 1MYRA 3W9ZA 1MRQA 2X1UA 1OGGA 5F2IA 3CL8A 2VMFA 4WCJA 4MMWA 4MKVA 4N4QA 3WLOA 4G1NA 3MSRA 6TAAA 4H04A 4WSHA 1NFBA 2PGFA 5D32A 3BGJA 1CYGA 2GJXB 4HNUA 2P0IA 3WY1A 1E3XA 4AY8A 2VZOA 3PUEA 5A1AA 2G0WA 1R2TA 1UKSA 1GYNA 4FIRA 3NVTA 1R2RA 3N2XA 3TSDA 3E74A 4OBTA 4CN1A 3ITTA 3TLLA 3QOMA 4PL2A 2F7FA 5D2YA 3KRZA 2E77A 1W1YA 4DBWA 3BPWA 1QHZA 4QJ5B 1J10A 3N19B 4MOZA 1ZPTA 5AZ0A 2OJPA 4GYFA 3TH6A 3MV11 4Y9AA 1ZJAA 1TSIA 1GJWA 2PWEA 1Q6FA 3GVQA 5J8LA 4P8XA 2BVDA 2W63A 1IE7C 4HPGA 2PMQA 2FDMA 2Z28A 3TJIA 4XUGA 3VINA 1Y5WA 1E1CB 2FMNA 4PC8A 1EFZA 3O6YX 4D8ZA 1JYXA 3HGRA 4AVOA 3D3FA 3GXIA 3V4BA 3MSDA 4XD5A 3TSBA 4AG0A 1JPDX 2FGLA 5ENLA 3R43A 5TQLA 4H6RA 2E6DA 2JQXA 5JBFA 1PKLA 4GVFA 4CD7A 1UD2A 3DFSA 3QV6A 3EBVA 5HQLA 1TRIA 1QI4A 4GE8A 4N2YA 1JNDA 1LUCA 4C7DA 1RQEA 2MANA 3DH7A 3FJ6A 2BS9A 1O68A 1X38A 4GQRA 1P1XA 2BOEX 4DY1A 1V03A 1AMKA 5T9BG 4LPCA 4IOTA 1OYAA 3BLKA 1DORA 1TCMA 3EA2A 2WPBA 3W53A 3O6DA 1KCXA 4FO4A 3AYSA 4AHPA 4DF0A 1FWEC 2P3ZA 5JH1A 3PUOA 3UETA 3DN5A 5HQEA 3GXDA 2A21A 5E0CA 1PIIA 3WFAA 3LXBA 1G6CA 3T08A 2BDQA 1YTEA 4ZENA 3BAWA 4AU0A 4F66A 1WXJA 1HGWA 1THFD 5CGQA 2EXOA 4NYYA 3CC1A 1AVAA 1AMYA 4QCFA 1EZWA 2Y7EA 2JFEX 3WJZA 3VYLA 1UJQA 4N7QA 5GJPA 1F3EA 2WYSA 3T40A 1QHPA 3CIVA 3MHFA 4E0CA 4F2TA 1GPWA 4YYCA 5F2LA 1PTAA 1VEMA 1KM5A 3U6WA 4J4KA 3SB0A 1AL8A 3U8GA 2VZSA 4GIAA 1LP6A 2G3JA 2E28A 4MNKA 4C1LA 3SRDA 2E68A 4M19A 1WZMA 1MUWA 4NILA 1XCWA 1EP1A 2XFWA 3MUZ1 3W29A 3SGZA 2WCAA 3UVAA 1BEUA 4AWTA 6REQB 1U2YA 2F6UA 1XSKA 4A2SA 1FWSA 4XB3A 3VGHA 1NDYA 1E0VA 1VF8A 2GJXA 1Z44A 5BMXA 3UWZA 1C8XA 5CPOA 5I3HA 7REQB 3RAOA 3NDYA 3WQOA 1KQYA 4H83A 1AW1A 1CB7B 2OGJA 2J9YA 3R11A 4A3RA 1M01A 2XGBA 1UPPA 3W37A 3W7QA 2D24A 3RILA 3MCOA 2YL6A 3SI9A 4YPJA 1WDQA 2YW3A 1GTHA 4GG9A 1QFEA 2PDGA 4J1OA 4ADTA 2CXGA 4URIA 4ZR8A 3DENA 2KAUC 5CBIA 5CSRA 3W7EA 2P10A 3LA4A 2OQYA 4AIEA 4PULA 2GDVA 3HMJG 2VGBA 3ZMRA 2E6AA 4IGMA 2JF6A 3BDKA 4LVFA 4CEXC 1LLZA 4J9JA 2NT0A 2PURA 1E1CA 1JDDA 3PZOA 1H51A 3ABZA 3WFLA 3E0LA 3CBWA 1TJPA 5D4YA 3KVKA 3LYEA 5A3HA 4GLEA 1X8FA 1J18A 2PA6A 3W1AA 3RLVA 1ELSA 1S39A 5JQ9A 4X9SA 4MZ1A 2XINA 2HWGA 4Y9MA 1W3HA 3ZO9A 5D9NA 2YA0A 4Z2KA 5U7SA 3KFTA 3GU1A 2A7PA 2VFFA 1NF7A 5C8BB 4W86A 1KLYA 2NV2A 5ECUA 3L65A 3EXTA 3ONCA 4AHQA 2YB1A 4PMJA 4NAFB 1J4EA 3FYYA 2Z2UA 3TTQA 1MW2A 5D8WA 4IUGA 3MMWA 5DLCA 1E6QM 1XLCA 3P93A 1NWRA 4MB4A 3N25A 4WZHA 3BAJA 5BXTA 5DT5A 1ZP3A 1IIHA 3QHOA 2A5HA 3QYQA 1GQKA 4H8VA 4RR4A 5GPRA 2OG9A 3LEPA 4WOZA 3VVGA 4EXBA 1JF6A 3BAYA 3JW7A 1KTCA 4UTJA 3OZYA 2J7EA 5M2FX 1EHAA 2YZRA 3TR2A 1VHCA 4Y7EA 3B40A 2ZBTA 3LCWA 3VNKA 3WF0A 4Z2LA 1Y7VA 1E9YB 1EWEA 2VM8A 3UBPC 3W74A 2GGEA 4GBDA 4ZFMA 4UBPC 4GUHA 4F0KA 4JNZA 4BCEA 3COTA 3NYZA 3C2RA 5KMYA 4AY1A 3CLWA 3NR0A 3S5NA 3AIUA 5D30A 2CHRA 1MQQA 4HYWA 4P8UA 2HE5A 1EDQA 2RDXA 4M0XA 5DRCA 2DSUA 1A0DA 3B0XA 4JTQA 3S46A 6REQA 2PTZA 5K9XA 5BXRA 1BG9A 3WQCA 3TQKA 3B8IA 2HRWA 2OCZA 2PWGA 5CC3A 2NUXA 1ADOA 5TAOA 2VEPA 3LNMA 7REQA 3RUBL 3DHFA 4XZHA 1PXGA 1ITQA 1CECA 3BXWA 4JIPA 4YLWA 2IKIA 4GYKA 1MEHA 2VRQA 4NVTA 3VIIA 1MQPA 2V3FA 3VX1A 3WH6A 2ZDRA 5FJRA 4L4LA 4MY1A 4HPXA 4LWWA 3IGHX 4N9DA 1UA7A 5AY7A 2OZTA 1H1YA 4ZO7A 1ME9A 2ACSA 3BW2A 3LRLA 1LOLA 3L4UA 4WDXA 4UNIA 3STCA 2V5LA 3DFQA 4KPLA 1AD1A 1OCNA 4HPHA 5J5RA 2PP0A 4ES4A 3VUPA 3UG3A 5HWNA 3OA5A 4Y8EA 4Y8FA 3E12A 3I10A 3C2YA 3IARA 2OX1A 1IT7A 1LORA 4HP5A 4UWMA 4HIBA 1RUSA 4EAMA 4MTVA 3WLLA 4GYJA 1DEDA 1FDZA 1CI1A 5GJNA 2UV8G 1SFLA 4DI9A 3TQVA 3CQKA 3S1WA 5GQBA 2R91A 1TV7A 7A3HA 4C5ZA 2PLKA 5D2VA 4K37A 1XQLA 1YNYA 1P1MA 2CLHA 5FJJA 4UTUA 1R9XA 5CPQA 4PMOA 5DXYA 3OHIA 5BMWA 2QR6A 1V3LA 5KSWA 3WQPA 4ML4A 5A94A 3ARYA 4XD3A 5AYIA 3RN6A 4Z17A 4LGXA 4R27A 2XVGA 4H8NA 1G5AA 4NAFA 1CTNA 2O92A 1DIDA 1XXXA 1XF0A 4KFPA 4UOZA 3CHFA 3VMPA 2WNZA 1PHQA 1UWIA 2QT3A 5JMUA 4DIAA 3B8DA 1SQ7A 5HMEA 1T0OA 4MKSA 2POTA 3FJLA 1EJUC 3TNBA 3HURA 3QRHA 2DZAA 4LANA 3LPPA 3N73A 2RFGA 2J78A 4WKHA 1C9WA 4OVXA 4IQEA 5HPOA 2CITA 1S2WA 3GBDA 3VPLA 2JKAA 4PBGA 2P3EA 1PDZA 3GZAA 3P0WA 1EDTA 2I9UA 1VBUA 1I0BA 3UZZA 1RJPA 4C6LA 1WBJA 2PTDA 2X1SA 2X1TA 4ECLA 3AS3A 2ISFA 3L2IA 2QJGA 1V79A 2Y2WA 4DLMA 1KRCC 3TTOA 6TIMA 1HL9A 1OSEA 3VIPA 1K6WA 2RHGA 4GI4A 3WQ5A 1OM0A 3KBSA 3O0KA 4BF5A 4BKNA 3NSMA 1K8YA 3IJ8A 4GUIA 2WO5A 3WNPA 4IIEA 4ZQNA 4CCEA 3DU0A 2WJZA 2ZFAA 1W3TA 3VNLA 4QGCA 2A7RA 1QNRA 1Q7QA 1QRQA 4PTMA 3CH0A 2AQWA 1KR1A 4QAIA 2PDNA 2OVLA 3GC4A 1Q6OA 5BRPA 3S9ZA 2IKHA 3TMLA 2E7FA 1KCKA 1L8PA 3PANA 1ISZA 1KW1A 5BCAA 3KL0A 3H2EA 2FTWA 3I6RA 4A8NA 3W6LA 3KS5A 1BXCA 3AZSA 3MANA 1L2UA 1V6YA 1BD0A 3A4XA 1GOKA 3VZYA 3W75A 1P4CA 1TPFA 3L4YA 1VS1A 1TB3A 3EOOA 3AIVA 1PZ2A 4W85A 1D3HA 2PB1A 1HIZA 1J2BA 4DUWA 4TVUA 2H8ZA 2IQDA 2ZOXA 1L6FA 3SCSA 3KDNA 3ZVIA 5IHRA 2EF9A 3W01A 5HNTA 2Z29A 2WHJA 2VXNA 3W1NA 3Q65A 3EB2A 4GGBA 1W3IA 4DQWA 1EJXC 3IV8A 5IBXA 4ERAA 3MSGA 2H9AB 2B7NA 1D9EA 1R46A 3CHVA 3B9OA 1JGMA 3LERA 5H91A 5LKYA 5CLWA 4H9YA 4LVAA 2XGIA 4XBJA 3T7VA 4Z2HA 3KM8A 2DH2A 1RD5A 3OLIA 2RKXA 5E6YA 3UWUA 1TV4A 2R94A 3OP2A 4IPIA 1JFXA 2OZ0A 4NRSA 4JQ2A 3AS2A 4Y90A 4O1CA 5I02A 3WBWA 1HP4A 3RYSA 8TIMA 1CXKA 2HZGA 7CGTA 1Z6KA 3PJTA 3ZR4A 1GJPA 2CZ5A 3AYTA 1W5OA 4CCZA 4WSJA 3WNOA 5GJMA 3ONBA 3FIGA 4C6IA 4K2SA 3WLNA 3HV8A 3ANUA 3VIMA 1QXLA 3B04A 3S4TA 4IMDA 1L6WA 4YTRA 4NRRA 4CNUA 3PBMA 1KFEA 2PEVA 1Q65A 2QCGA 4MWAE 2CLMA 4JEJA 1QNPA 1J8VA 3F5LA 1OVDA 5TD4A 3AXIA 4AMAA 1NTHA 4BI5A 4PMNA 3VMOA 2AKZA 2WANA 3BURA 4PBFA 3MP3A 4KRUA 2VDGA 4S3DA 5FF7A 4MLRA 1GOMA 2RGLA 2ZZ7A 4UMBA 4H9ZA 3HPZA 1MZHA 3G0UA 5EFFA 5CH9A 5CJMA 1EP2A 1A5NC 3WJSA 4GD0A 5C9UA 1VQTA 2CFFA 1MXSA 4IX2A 3CO8A 2HBXA 1AK5A 3F2BA 4GNKB 1C91A 1WDRA 4JNMA 3VZZA 1OX4B 2C1IA 5IFTA 2PD5A 3FHQA 3VNMA 1YPIA 4RZ4A 3AUJA 3A22A 1IZJA 2EGZA 4UQ9A 3BLIA 3TJ4A 3RMJA 5LGZA 3VFCA 2V82A 3AXKA 5LNUA 3QV8A 2A79A 4GZJA 2YYUA 3CUXA 4P7NA 3POCA 4I3GA 4EX4A 5AYYA 5CJ5A 3KZPA 5HR7A 3HQ1A 1HL8A 1KFJA 4Q3MA 4OQVA 3H54A 1FUYA 4PMZA 2A4AA 3REQB 4N6EA 2WZTA 3ZJ8A 1PCWA 1DIEA 2VEKA 3VMNA 4HU0A 2AQOA 3QR3A 1NWTA 2BY3A 3Q67A 3OA3A 2XVKA 1E4NA 1GPFA 4UCGA 3KVLA 3ZOAA 3GNPA 5AYBA 2YJQA 1V8EA 5I3IA 3H4WA 4B2DA 2Z4GA 3N15A 4HPJA 3KOFA 4FS9A 1YE4A 3KBJA 3TAKA 2VI0A 4LBRA 2H9AA 4AX7A 1K8XA 3H26A 2AL2B 4LV4A 3CAWA 3NPWA 5C7HA 4NAEA 3M1ZA 2VQUA 2DZUA 1WUEA 3ZLGA 1LRTA 2QQ6A 1P6BA 4B2DD 2W91A 1K6AA 2GJLA 2YBUA 3W2NA 3H4XA 4AEOA 5HJYA 3G1YA 5K9DA 1DPMA 3S9IA 3O8AA 2CU0A 2ZUTA 2ZVRA 3EDFA 3CQJA 3FDKA 2V2HA 1WA3A 3AXMA 3EWUA 1RY8A 2VRJA 2WSPA 3K8MA 2ZX5A 3DDMA 2C6QA 1B1YA 4HK5A 2V5JA 1BGAA 3THDA 2GVJA 4PR4A 4UTTC 3BOFA 1US3A 3GH7A 4QE4A 2PU1A 3M4HA 5FEXA 2BNJA 3S47A 4Z0JA 4EXAA 4RCXA 3EXRA 4AB4A 1W56A 2EG8A 1DIKA 2VRKA 2RDTA 4XZMX 1KBKA 4KMQA 4K7YA 2XIMA 2O9RA 1KO0A 3LCGA 4B15A 4KQNA 3EKGA 4DELA 1CX9A 4JTDA 4UTIA 3M5VA 4AZBA 2YX0A 5AOUA 3EX4A 4UFJA 2EJ1A 1JCMP 2VT0A 4E5TA 3EWWA 5ABFB 1FDYA 2V30A 4HYVA 1RQHA 1JR1A 4DYKA 1XLDA 2BODX 3SJ3A 4Q4MA 1EYWA 5TIMA 3PM6A 1U1UA 4B5NA 1TVPA 4CCDA 3MUAA 4ADUA 4CUCA 1WKFA 4L4PA 3QMRA 3QV7A 1UYQA 4ZFCA 1RVKA 4AC1X 1R7OA 2E5DA 3M0LA 1US2A 1FWCC 4TUFA 4LAZA 2XSBA 4L4MA 1E6NA 2GJPA 1W8SA 2CEQA 1OX4A 4DNMA 4IQJA 3NPXA 5BWFA 4UTHA 4JX5A 3G8RA 4F0MA 1TCDA 4MNMA 3CTLA 1W1PA 3NXFA 1EF3A 4V1YA 2PLMA 2NWRA 4O11A 1UZDA 1JZ2A 1HKIA 4JICA 4TU1A 3ITXA 3NQFA 1GGOA 4D2JA 3FJ4A 1W2VA 3ES8A 3LBCA 3PPHA 4L80A 2WNWA 5EMUA 1V08A 3UWQA 4LCSA 2X42A 1GVYA 4B90A 3MI2A 3REQA 3P0XA 4UMAA 5AHFA 1GQJA 3SAZA 3WL1A 4DF2A 5D2WA 1R5YA 3Q94A 3VNYA 3U9IA 2V5DA 5G4WA 1WKYA 2PDCA 1SZGA 2G5WA 1H1NA 2ZWZA 4U3CA 2ZUWA 4LUJA 1CXLA 3A4AA 2WMIB 1ODUA 5LGXA 4OV9A 4MYXA 3SCWA 1IZCA 3TW6A 5C71A 4HPNA 3CWOX 4AWEA 2YSWA 3NOEA 3F5KA 1K1DA 1J5SA 3NL2A 2AL2A 1AQMA 3LLXA 3R8GA 2INZA 4K3ZA 1O94A 2WVUA 1W37A 5HINA 3BCDA 1NOUA 1W5PA 1CLKA 3GTIA 2D2JA 4ERIA 4NJIA 3VE7A 2G3MA 3EGJA 1ISXA 3QPEA 2EG6A 1NF0A 2VC7A 2A6LA 3C4UA 2X7WA 1FCQA 2YB4A 4DAFA 1XPYA 2XH7A 5E93A 2XGZA 2XIQA 1SYTA 1DJXA 4HSHA 2ZC1A 1XLEA 4GVHA 1AH3A 4YMZA 3IAPA 4M81A 5D2TA 4A35A 1VFOA 3KZSA 3VIFA 2CKRA 4O0ZA 1TUXA 3N4EA 2BWGA 3K5XA 1QI5A 1GVEA 3G77A 3B9NA 2OWWA 2DZBA 1MFVA 3M64A 4O15A 5A8OA 3QPYA 3QLLA 5D9OA 3NQGA 4PMVA 4KCUA 3HQPA 4FMVA 5MF5A 4G7EB 4Y6GA 5ABFA 3UY8A 3F4NA 4LXFA 3E5PA 4GX9A 4RW5A 3QJAA 3ORWA 4FB7A 2UY3A 3EB4A 1EC9A 3JU2A 1OYBA 3MMDA 2IKGA 3MYOA 1VPYA 2WBGA 3T0DA 3W76A 1Y5VA 3GS6A 4FX6M 4LNYA 2P8CA 1OFDA 5CGMA 2GDQA 3URNA 5D04C 5A6KA 3CPGA 4JEQA 3MT1A 3GO2A 4F2UA 4FA3A 2WJFA 4IMCA 3C3UA 4UXDA 3B06A 1V3MA 4E3TA 1B4KA 1VCGA 4Z08A 1H49A 3ZSSA 1UC5A 1VJZA 3PZMA 1R3QA 4W7VA 1QNSA 1Y5XA 4CLMA 3F03K 3TZNA 2VC5A 1TRDA 3BV4A 3W1MA 5LSMA 1R3WA 1PIGA 4X2RA 2I16A 3GB6A 1BFNA 2X0SA 3MO4A 4NJKA 1LLWA 3HGSA 4GVGA 2ZUMA 4CVWA 4OV4A 1SW7A 3NWRA 1IWAA 4RZBA 3LMYA 3DHDA 1MO0A 3TXZA 3GHTA 4XUYA 1ONRA 2ACQA 1KFBA 3GUWA 1VC4A 3TYZA 3N18A 4HJFA 1ISWA 1P5BA 3ABQA 2QEZA 4OWGA 3U5UA 3GTHA 2Y8UA 2VX4A 2V9DA 4GO8A 3RRXA 2OB3A 3H21A 1UH3A 2WLZA 3T0CA 4QQ3A 2PRMA 3C56A 1ZGDA 4HTBA 1GQNA 2OO0A 1H7RA 5FJUA 4X22A 3B97A 2WMIA 4QG8A 1G4SA 3AIEA 5FEPA 1SW3A 3U5YA 4HGXA 4RX0A 4JIRA 2Q3OA 3L66A 2ADAA 3U2EA 3E0IA 3WLQA 5HANA 1JCNA 3RF9A 3FYPA 4PUMA 2V6AA 2Y61A 2FJUB 2V38A 1B3VA 1OX5A 4AC7C 4BWLC 3TYUA 5H8PA 4QSFA 5CG7A 4J7RA 4IPPA 2VP8A 4PCNA 3IV3A 1UD8A 1QPOA 1Z42A 3MDWA 1GG1A 1XGEA 4NQ1A 2EHHA 5BU6A 4L61A 4O57A 3U2CA 4F0RA 3CQ0A 4AWUA 2J13A 5DELA 3C8FA 4K39A 2ZYFA 2BY2A 1FHUA 2OMAA 1OZMA 2V5CA 3FXYA 3G5EA 2PGEA 1I4NA 4NX0A 3RG6A 5BRBA 1OF6A 2OR2A 3BUVA 2QULA 3G1VA 4KWVA 4NZ4A 2GPTA 3RK8A 2DP3A 1J6PA 3J7HA 4EANA 3W70A 2BG5A 4CGTA 5H8MA 1KLZA 3VK5A 3DC8A 5AC6A 3IAQA 4M3PA 5JBDA 4XAFA 1GHSA 4G7EA 5FA5A 1ZY9A 4JTGA 1MW1A 3GYEA 4GNVA 2HXUA 1XL9A 1Z8AA 1GVSA 3GVGA 2G4FA 4HHHA 1UR1A 3B8WA 1BLIA 5LIXX 2QCNA 5CPMA 3SW6A 4CN4A 1XIEA 2KX9A 3GDRA 1LQ2A 4D9PA 3CIWA 1ICPA 4S3BA 5B7YA 4J3VA 1ZL1A 5M17A 4TMCA 4ORIA 1FWTA 2XWDA 4Q4KA 1XJBA 4HD5A 5LIUX 3LPFA 4GINA 2DJLA 1F7BA 2PTWA 3IJ7A 3XISA 3IIZA 4Q8OA 1WZLA 2FZMA 3AJXA 4B5XA 3RHGA 5A8QA 1SZEA 4C1KA 4DXKA 3OZPA 2RJHA 2XH4A 3IJDA 3FA3A 1S5TA 2OZ8A 3OYXA 3UWEA 1EOKA 3FKKA 4NUWA 5MHBA 2DVTA 1ML1A 1JXJA 1OGSA 1S1PA 3ZS4A 4LTSA 3T0BA 4QM1A 2A3CA 4FX8A 1D3GA 4GKLA 3TKFA 1ZBWA 3VIOA 4HA3A 1VBJA 2CC0A 2EBNA 3UEQA 1C3FA 2OPJA 3TOPA 2G4JA 4HNCA 3OVRA 1C29A 3TUUA 2CXEA 4LUSB 3NDZA 4AZ7A 3NDOA 1N8WA 3VGFA 4F2BA 3SIMA 2TSYA 3VNIA 2NV1A 2CZFA 5HJXA 4XAZA 3CGTA 1J0JA 2J4GA 4LYRA 4PUDA 1MNSA 2WKGA 1ADSA 2QUVA 3M07A 4HCHA 1BTCA 5F1UA 3BG5A 1E6RA 2CHNA 2TPSA 3A21A 3NQAA 4ZEPA 2QAPA 1DWHM 3H2OA 3IVSA 3MB9A 3GKFA 2WM1A 3VKAA 1MDLA 1WAWA 1QCWA 1B3WA 2YCLB 1F9CA 5EBAA 2OKTA 3AHXA 1A5SA 3PZ9A 2NQZA 4GABA 2XFRA 3ALFA 1GOOA 3M6DA 1VB9A 1ECEA 2RJGA 3EX1A 2VC6A 4HT3A 4WEVX 4ZL1A 4JDBA 3RGTA 3PBYA 4MGGA 2ZRWA 1CGTA 4P2VA 3GU9A 1EC7A 3IUDA 3Q37A 3UQNA 3KVJA 4IMEA 3U3HA 1PEZA 1DQXA 4GYPC 1J0HA 3M7WA 3P84A 3GC2A 2JIWA 1T96A 3WQVA 5AC4A 1HJVA 3S2LA 5K7JA 2Z2BA 5CSYA 2VZVA 3N2OA 2E1WA 2GGGA 4CCCA 5B80A 4DBUA 3TN4A 2XYLA 3BE7A 1DTNA 4MM1A 4V27A 1AJ0A 1B57A 4U10A 4ZB2A 1NFPA 3A12A 4GXMA 3LBMA 1F76A 3NZPA 1K7FA 1OIFA 1OF8A 1XSIA 1NAL1 5AC5A 2YW4A 3N29A 3I7SA 2XN1A 4EK7A 3EDDA 2JALA 2C1HA 3AU6A 3JRKA 4DZAA 3DFOA 1VJIA 3E0FA 4NXKA 1HKKA 3V0SA 2P88A 2F6KA 4TX6A 1A4MA 2YOCA 1GTEA 1DYSA 3KBMA 3LLDA 2PP3A 4D8AA 3UG4A 4IICA 3PFMA 5G2WA 4NJHA 4ERGA 4F3HA 1IHIA 3KBNA 3M0XA 3CHDA 1JQXA 3GG8A 4E6MA 3UERA 1JDFA 2OEMA 2I57A 3KL5A 2ISDA 4UTFA 3CK5A 4XZLX 2HTMA 4DPQA 1Q8JA 4QG6A 3QM3A 1DWGM 1KXVA 2E1DA 2FKPA 4I7WA 1EC8A 1VH7A 1UR8A 4EPDC 3GD6A 4QS6A 4JKKA 1L6GA 1UC4A 2W3ZA 3T44A 2VEMA 1CXHA 3W7DA 3VOJA 1DJGA 5DMLA 3RM9A 2QGYA 4FNUA 3PZTA 1RJQA 3RX3A 7PTDA 3MV01 4TV6A 3PPGA 3OQEA 1B9BA 4HA4A 2O4QA 4ICNA 3R4IA 4MSSA 4IFOA 3BC9A 1EH9A 3ZM8A 4IISA 3UXKA 3B9DA 4WGHA 4LUSA 3ZVHB 3RCYA 1SVDA 1BKSA 4FK9A 1UH4A 2A7NA 2BGSA 3QGVA 3SN0A 9XIMA 3AOFA 3DOPA 3W2JA 4EWJA 3VDHA 1LRQA 4U3AA 4LAUA 2OLSA 3CASA 3GNOA 4UUIA 3CV7A 2VD9A 4Z1BA 2HV5A 4NZ5A 3QV9A 3ID7A 2WM0A 2ZRVA 5BXPA 4TXEA 1PBGA 4O4WA 3HGOA 2V3EA 1K4GA 3PF3A 3ZXWA 3EX2A 4LX4A 1XBVA 1WZAA 5EMMA 4V28A 2FDSA 1ZJBA 2X41A 1OFRA 5H8UA 3NPUA 3W86A 4Z42C 5CAKA 2GVGA 4KESA 2VCBA 1SSDA 3OLEA 4S3FA 5DCDA 4AZCB 2DUZA 2ZX7A 3HU7A 1XBZA 2C19A 3GK0A 4QLLA 4BQ4A 5A69A 4R7JA 1TPUA 4DJEC 3CV2A 1CPUA 5D05A 3PWGA 3UWYA 2CNCA 2CLPA 3PZUA 4RE0A 5F7UA 3OO2A 3V36A 2BHZA 4PGLA 3NM3A 1Q6CA 1V5XA 3AS0A 4A8LA 3T0TA 1JCJA 3DXIA 1EYEA 1VCVA 4NY2A 1O6IA 1ZP4A 1XBXA 3WZ0E 1YNQA 1XH2A 1V02A 1G94A 6ENLA 3KCOA 3WD1A 3A3WA 4HA1A 5HMFA 3OTRA 1Q6LA 4DLFA 5C2XA 2D0HA 2QKFA 5IDZA 4KKXA 4WKFA 1OB0A 1YDVA 1BHGA 4O4VA 4Q8UA 3W7CA 5I5RA 1LT8A 2YA2A 2Z26A 3WQEA 1LRNA 4YTSA 3DERA 1HG3A 1K4HA 4D1JA 3EDEA 2E6FA 2WNNA 4QP0A 1OFBA 1POKA 3BLPX 4WDTA 3LGGA 1XYFA 2A3AA 2Z1XA 2CLLA 4MF4A 1T7LA 3G22A 4A3YA 1GOWA 2ZX9A 3ITYA 2Q8ZA 2ZXBA 1EA0A 1OEPA 4HQVA 2CZEA 3IGUA 3PJWA 1DJIA 2YXGA 3DFTA 2AL1A 3WH7A 3TYEA 4UTTA 1AFSA 1CENA 2V2DA 1X39A 3O05A 2GL5A 1QAPA 5HA7A 5GNXA 4IH3A 2ZADA 3TTYA 2XVPA 3PBVA 1QWKA 3W7GA 2ZICA 2J7GA 1GQIA 3VIGA 1D7FA 4DWDA 3QC3A 1A49A 2YDQA 1BXBA 1PYFA 3TIMA 3RM4A 1SSGA 3MBFA 1XIDA 3R7MA 3RLGA 3SGGA 4CU7A 1LJYA 3BLOA 3P80A 1XQKA 1F74A 4WX2A 4W88A 4LUTA 5E0FA 2ZWYA 2ZTJA 3CNYA 1FWFC 3ANYA 3HN3A 4K1GA 2J8FA 2X1RA 1HT6A 3VD4A 4LS0A 4O1DA 3LQLA 4UR9A 4JD4A 3N3TA 4J5NA 4Q7NA 3W85A 3ZVHA 1U1HA 2PU0A 2B4GA 4O18A 4QIUA 3CZKA 3TU9A 3NZ1A 2IXUA 2AOSA 1E51A 1KM1A 5DO8A 3LHYA 3T8QA 5FJPA 4W4QA 1SMAA 1JULA 4KGLA 3GR4A 1ZSXA 2B7PA 3W2KA 1E3ZA 4H9XA 1OT2A 1TUFA 2OSWA 1U5HA 2WZHA 3H2AA 3NQ8A 4X63A 4ROPA 6PTDA 1KRAC 3CM4A 1BQGA 3FVDA 5I7GA 4CD4A 4AXKA 3O0FA 4ZCWA 1W2PA 4R33A 3MZ2A 2QPUA 2JF7A 1Z9AA 1H0GA 2HMCA 3F7JA 3FX4A 4JGDA 1M7PA 5K2ZA 3B9AA 3MWCA 4A4AA 4AZCA 2X1IA 4HOZA 4GCXA 3WLKX 4R34A 2WHMA 2PTYA 1UKPA 3L2LA 2R82A 2JBMA 1LQ0A 1S5MA 1AL7A 3LK6A 1FWHC 1A5KC 4ZZ9A 4U5IA 3WD3A 3EEZA 1VR6A 4IMAA 3IIXA 1RD6A 4NU7A 3B4UA 3GW3A 1FWNA 1TTJA 5HWJA 2AGTA 2GDUA 1I2NA 1X97A 3ARRA 2OT1A 3TYCA 4DRSA 3PULA 1I2OA 2XJ7A 1B3YA 2Z1KA 3W2LA 3OB8A 3L67A 3ZR6A 3GSMA 1LOQA 3I6EA 1R2SA 3W7IA 2PUZA 1M65A 3DESA 3S1GA 3R8RA 3UXIA 5AVHA 4OOZA 1OCBA 4C6PA 1XLLA 3W73A 3SCRA 1X6NA 2DW7A 3P74A 3TNOA 1CDGA 3FAWA 1PTGA 2XSXA 3QY8A 3DFPA 1JZ8A 4CVUA 5BYWA 2AAAA 4L7ZA 3NIYA 5DT7A 4K36A 2WVSA 2EEXA 3UR2A 1O4UA 4QJ3B 1XRSA 3RLUA 3EPMA 4BF9A 1G4EA 2ZRUA 3NQEA 4R9XA 3CUIA 3CUFA 2XPKA 2TYSA 1TWSA 4HMEA 5TBOA 1CGVA 1WOAA 4YIWA 5A6TC 2CIPA 3FW6A 3D46A 4MKNA 1EWDA 2J25A 1VAHA 4OUIA 1BRLA 1J0ZA 1GEQA 3LV5A 3NL5A 1TR9A 3W1QA 1VFUA 1FXPA 1LLOA 2CPUA 4PN2A 1PS9A 1E5NA 1GUVA 3BL3A 2YA1A 1EHNA 3VKBA 4KEMA 3DG7A 3FDGA 4GUGA 2AGKA 4W8LA 4ZE4A 3A13A 3KX6A 3H2FA 3RXZA 3VKDA 2A3LA 1EEPA 1XCXA 1JPHA 3UZJA 3SQSA 3MP4A 1NU5A 1XIBA 3ZLFA 1M9HA 1H3GA 4KWWA 3OVGA 4TOQA 2HXTA 1XH0A 2VKZG 2ZQ0A 2WW5A 3L9CA 3MUY1 1B3ZA 1Q4WA 5DMYA 3UCCA 1YE6A 4RZ6A 3WQFA 5MKGB 1DHPA 2ZZ2A 4K6AA 4RNJA 3MUIA 3GHRA 1ITUA 3TC7A 1MFUA 4HMCA 4C6CA 3LLFA 1CT5A 3LNPA 3WCZA 4HJWA 3DC0A 2CBJA 4N4PA 3GG0A 4R3UA 4TX8A 4YS1A 1O95A 5REQB 2WB5A 1K77A 1OGBA 3FOKA 4MNJA 3EOEA 3UF9A 3W7RA 1G7UA 5A8NA 5E70A 3AFBA 1DQUA 4PA8A 3WUFA 3E2VA 3IJQA 2ZUNA 4NP7A 1R86A 1JPKA 3TSMA 2DZSA 3C8NA 1V0MA 1LL6A 1MW0A 4GQGA 4YCPA 5CPSA 4CQCA 1ODZA 3ABRA 2NXGA 3VILA 4DBSA 4S1FA 3T6CA 4N9CA 1XIMA 3QKZA 2VEGA 4JHMA 3S9YA 2XHYA 3F4WA 2GVEA 3TC3A 3R8HA 1HTIA 4LAKA 1LBFA 3K4WA 4GUJA 3BMWA 2WMHA 2QVNA 3AHZA 4D6GA 4RE3A 4KW2A 4ZOCA 1PZ1A 1Q13A 4IGSA 5AYZA 2WJEA 2VNCA 1UBPC 3N3MA 2YBVA 2ZRYA 3H70A 4LY4A 3A47A 3BSHA 2WHLA 2DQWA 4B9YA 2BB0A 4ZE5A 1KR0A 4HMNA 3WK0A 1C8QA 1XD1A 2VDIA 3OLDA 9CGTA 2GUBA 3WH8A 5JIWA 2J9XA 3WEZA 1YRRA 2YIHA 1B0IA 1HKVA 2D1ZA 1S2UA 4UTLA 4HA0A 1JPIA 4QG9A 1A3WA 1X98A 2C91A 4B3ZA 1WOBA 4DHGA 2W79A 5AC8A 1GT8A 3T2OA 1ZNNA 4U2ZA 5FF0A 4DM1A 3DUGA 1P0DA 4C91A 4BWLA 3CYJA 4AZ6A 2WBKA 1U22A 2PDQA 4QHRA 3QEZA 3PB2A 4R88A 4IG2B 4I7VA 3IGXA 1J0IA 5I09A 3KHJA 3MKKA 3ERPA 4FLOA 5FSDC 1XLIA 5E6ZA 4LVDA 4ZQPA 2TMDA 4AZ5A 2DGAA 2DT0A 3DIPA 1R87A 1ECQA 3I3EA 1IT0A 4AD2A 3C5QA 2PZNA 3WBXA 2PDFA 1QW7A 1KM2A 2HJPA 2XISA 4LCQA 1UP0A 4ONVA 3O6CA 4YN5A 3BANA 1MRAA 2VFEA 1M04A 3NZGA 1C8VA 2FHBA 2JK2A 1CBGA 4E8GA 3APGA 3NURA 4LJ3A 3WQ8A 3AYVA 4FNPA 5CSSA 2HK1A 1OC6A 3WO8A 2J47A 5AC7A 4PMQA 3KVMA 4LC8A 1Z48A 2WKLA 1QVBA 2FHCA 1RPKA 5CPTA 1EP3A 1VD6A 5F2MA 4I5XA 3LPOA 1J5TA 3SUSA 3NGFA 4E4UA 3PZNA 2FB2A 3CZEA 4JOMA 2EPLX 4A3HA 3DKLA 1VFMA 4PUJA 3UR7A 4XISA 4W84A 3WF3A 1LL4A 3FCPA 3QVQA 3THCA 1HQTA 3GDMA 4O0KA 5FCZA 3LG3A 1K9DA 1KM3A 3A24A 1F2JA 1QNQA 4JXCA 3E1F1 1DXEA 1J9YA 3VNJA 1I2PA 4JAWA 1W1TA 2FTYA 3GC5A 4LUYA 4W9TA 1W3JA 2TRSA 4NZCA 4KERA 2E8YA 1UWTA 1VP5A 4PUWA 2Z0IA 4Q8NA 3UR8A 4AEFA 1XUUA 4KCVA 3W00A 3GQYA 5I77A 4RV8A 1X6UA 3N17A 3SZ8A 3CV1A 3ZWTA 3MUCA 2QUUA 2ZCGA 3L5LA 2DU2A 4GVIA 1R9YA 3R13A 3BAXA 3W1XA 4IQDA 3L4XA 3G1HA 3H8AA 4DZHA 1DJNA 3UGVA 3BWWA 2FZ9A 4KEVA 5TF0A 3H12A 2QJIA 2P76A 1XLKA 4ASTA 2DZTA 3L7RA 3T1GA 3WSUA 2H90A 5CC5A 5FOOA 1DWJM 3E96A 1R8LA 3LB0A 3NXLA 2J7CA 2WPGA 3S3GA 3RU8X 2Y5EA 3WK3A 4AY7A 5FKYA 5FF4A 2GUYA 1VKFA 4P7LA 4HNTA 4E38A 2GQ9A 1LWIA 1IEWA 1IEIA 3G6LA 3H22A 3CHCA 3S0CA 3W7JA 4LB4A 2OQLA 1O5KA 1TV8A 2ZZ6A 2YXOA 4QTGA 5I06A 2WXDM 2VGFA 3G2GA 3M0YA 3CMGA 1AH4A 1T8XA 2VZTA 3AO0A 1YTKA 4O28A 4PODA 4WJ8A 3CZ8A 4FNQA 2AMGA 4GYPA 1BTMA 3D5HA 1E40A 4REQB 2W62A 1O60A 5FIPA 2UBPC 3MPGA 5BWAA 3NQ7A 5CPNA 4UNLA 4KETA 2J24A 3NO5A 2R9RA 1ZS2A 4UFHA 2L5HA 1A0CA 2R8WA 5LXEA 1HX0A 1V6TA 2QDDA 2FLIA 1GYMA 1E5JA 1XRVA 3NL3A 2TODA 2GWGA 1LUCB 4AZGA 5K4XA 5I79A 2ASHA 1LQAA 3A9IA 1OBAA 2YYTA 1JVNA 4E2VA 1ZALA 4O8RA 1KKOA 2OX4A 3AIWA 1HVQA 3BAIA 1F6KA 3NO1A 3U7VA 5I3KA 3WLMA 4CNNA 4ORMA 1T8QA 4IZGA 3VO0A 3F5JA 2QV5A 4GC3A 2E25A 3AXHA 4J3XA 2Y85A 1KRMA 4M6VA 3TOYA 3PFRA 3WLPA 3B0VC 3U57A 1BWLA 1UZ1A 1BVNP 3HPAA 2BXVA 3ZZ1A 1J96A 3AYRA 2IS7A 4ZB0A 3A3HA 3D3AA 2UZ9A 2BP1A 4OIFA 3NSNA 4OHQA 4R7OA 3OJGA 1KWGA 3R79A 3U7BA 5C6MA 1Z32X 1O12A 1E73M 3PK7A 4EPBC 1Q2SA 1M41A 1EZ2A 1QK0A 3QYSA 2BY1A 2BMBA 4NL1A 3QFEA 1Y8BA 4K68A 3TXVA 1JGIA 1US0A 3GTFA 3HPXA 5F4WA 3DG6A 3UJSA 2A2IA 1TIWA 1Q8AA 4Q4OA 1S2TA 3NQ2A 3M5YA 3IEBA 3QZ6A 4WY0A 4JHZA 5AB3A 4IJRA 2REQB 5H1WA 4X0NA 4QSHA 1I1XA 2C16A 2VX7A 1H1ZA 1DWAM 1HKJA 5XIAA 4KEZA 4Z2JA 1TPH1 1L6YA 2XSAA 1WQ5A 1FFQA 1M53A 3ARVA 1TWWA 2DUAA 3QN3A 4E4FA 4YWIA 1ZAHA 4H7ZA 4PBEA 1Z69A 3KTCA 1KA9F 4G56A 2DT2A 2AKMA 4P7RA 4G8TA 1VBGA 4EPEC 4D6JA 1V6VA 2X30A 3CZJA 4DO7A 4WIWA 1CIUA 3GXMA 4BEQA 3G1SA 1DJZA 3AXXA 4IM4A 3W22A 4YWSA 5FACA 1YBQB 3OODA 3CMJA 2IQTA 3PTDA 2Q8LA 4GJJA 1NP0A 1DL3A 3AICA 3T4CA 2WVTA 2F9RA 3AIBA 2WC4A 4Y2WA 1JG9A 4DJEA 4HU3A 3M47A 3E2SA 1BYCA 2HQAA 2R14A 3AMKA 1XC6A 4REQA 1PHWA 3NOYA 4RUBA 2J77A 1EJRC 2DT1A 4GH1A 3TTSA 4CQDA 2F84A 4UQBA 3SUUA 1OCJA 3NVDA 4PYSA 4DJED 4A3UA 4FALA 3TMQA 3E6EA 1YYAA 1NP2A 4GNJA 2PF8A 3QMTA 3DYPA 5E1QA 2GYIA 2J7FA 4YHGA 3VXGA 1YDYA 2D3LA 2PS2A 3OQ8A 5C2CA 3VOCA 2FH8A 3RX4A 4MB5A 3CAQA 2ZUVA 2ZRZA 2HEJA 1VZWA 1TVNA 2GSJA 1M5WA 5FD0A 1MNZA 4HSNA 5E0KA 4GY1A 4KCTA 3SN4A 3S6DA 1OFEA 4MYAA 2ZZ3A 1O5XA 2G41A 3PZGA 2G3IA 4Q33A 1DXFA 1C8YA 3QMSA 3FHAA 2UY2A 2DQXA 1YPXA 5C54A 1DE6A 1ONWA 1JNEA 4X61A 4HN8A 1UZ4A 3L4VA 4QNWA 1EA9C 3EOLA 3OW1A 4AXNA 4JS3A 1DXIA 3SM0A 2XFYA 1RXOB 3QHNA 2PE4A 3ZWSA 4P7OA 3S5OA 3K30A 1DP0A 2BBFA 3OVPA 4KS0A 2O55A 4WXYA 4KWUA 4W8AA 4PE8A 4PTXA 4H9MA 2NUWA 1TREA 3I4EA 4BA0A 3KBVA 5LZLA 3G1FA 4BS0A 3MZNA 5FJOA 2HS6A 4PCSA 2ZXAA 2NSXA 4O1BA 4C6OA 3QGKC 1C7SA 2ZXDA 4KWSA 1XUZA 1TJ0A 1XM3A 4DX3A 4J28A 2YL9A 4B4HA 4W5ZA 3C3NA 3PC0A 3AUOA 3ARWA 2CZVA 3VFLA 1QPKA 3GKAA 1SFSA 3CT7A 4L1WA 3BO9A 3PG8A 3ME3A 5HNNA 2QVHA 3ARXA 1L8NA 3ANVA 1AUSL 3NAVA 5I3DA 4US6A 1WCGA 1ME8A 4LY8A 2GVYA 2UY5A 2REQA 3USZA 1AJ2A 1A5MC 4GFIA 1E9LA 3DI1A 3LD5A 5HDRA 3NCOA 3WEMA 3V0UA 7XIMA 1PVNA 4BQ2A 2OU4A 3W26A 3SECA 1CLXA 1UKTA 2OZ3A 4WD0A 3BJFA 3UFYA 4AD4A 4O0QA 1VYRA 4DI8A 1HL2A 5LXXA 4DJFC 1OQFA 5CEWA 3IGSA 5EGRA 4FLRA 1HZYA 1RA0A 2NVDA 4IL2A 3DHUA 3LTSA 3V5FA 1GG0A 3URAA 3GH5A 1I8JA 4D6EA 1YBQA 5B7ZA