2CLKA

Tryptophan synthase in complex with d-glyceraldehyde 3-phosphate (g3p)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
267
structure length
267
Chain Sequence
b'MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 101
structure length 267
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2clkA00
5AHMA 4PTNA 2ZRZA 5G2HA 5KSWA 1IXOA 1QDSA 1XI3A 3BW2A 3HB9A 2EPHA 5DXXA 1X1OA 1EIXA 2J6XA 4MKNA 3OVQA 3BLIA 3TAKA 4AH7A 1YPIA 1TV7A 5EY5A 3OVPA 3PY2A 3UD6A 4DF1A 1OFBA 3IVSA 1TV8A 4A22A 3MO7A 4BI5A 4A2RA 2ZTJA 4AF0A 4E2BA 3LBCA 3B0VC 2TPSA 4OV4A 3DHDA 3MMTA 1OFQA 1L6YA 3Q37A 4ML9A 4D2JA 4UTJA 1KM4A 3W3OA 2DZWA 2HS8A 4N9DA 3S9YA 1EWEA 3C56A 1W0MA 2I9EA 3W7IA 5BOOA 2WSRA 3EWZA 2BLEA 3GDKA 2Q3OA 3E0IA 2ABBA 4JX5A 1KM6A 4LNYA 1QR7A 2X16A 5C6MA 1TPB1 3L21A 1GVQA 1I2OA 4CNNA 4ZQOA 2FPTA 4KFNA 3VE7A 4HNTA 1H63A 1W5PA 3RLUA 3QJAA 5LNWA 1VS1A 2QCMA 3EXTA 1FCVA 2VFFA 3EB2A 2WJZA 1W31A 3DFSA 4RZ4A 1QOQA 3N3MA 3LBMA 2ZA1A 3UYCA 4XKYA 2A4AA 2ZTKA 3WFAA 3M5ZA 3R8RA 4ONVA 2AAMA 3DFQA 5F4SA 3L65A 1SPQA 1KM1A 2GVLA 3ZWSA 4MLJA 5CPOA 4IPIA 2TSYA 1ZJIA 4IMDA 1QPNA 4ZQNA 4PFMA 1UB3A 3RFAA 2DJLA 3BW3A 3L0GA 1DQXA 3GR8A 1B57A 3R12A 4N6EA 4E0CA 4TO8A 1OK6A 1GZGA 3QMRA 4R7JA 3L66A 3PUEA 3G1VA 4K8EA 3B05A 1UCWA 1YXYA 4GWEA 1SZGA 1WYIA 1XDMA 4LTSA 3W1UA 3O6CA 2DU2A 5EA9A 4IPJA 1GJPA 3I7SA 1V7YA 3BVJA 3FYOA 2Y7DA 3HPXA 2DZPA 1M6JA 3GDTA 1O5KA 2E6FA 4EF8A 3BARA 3QZEA 5IM51 2A7PA 2NUWA 4CCEA 1JCYA 4N9EA 4N02A 2J27A 3TU9A 3CU2A 3NXFA 3TQ0A 3H55A 2A2IA 1OFAA 3KRSA 3KX6A 1GEQA 1TPEA 1S5WA 4GE8A 1ONRA 3PF3A 5FF7A 1SO3A 5E0KA 1DHPA 5F1UA 2H3DA 5AN7A 2ZZ2A 5FI8A 4LOCA 5AC6A 1A5SA 2B4GA 2CLOA 5F1VA 1XBYA 1H7OA 2CLMA 3NPUA 1GQNA 1F2JA 2FFCA 2XN1A 2EAWA 1WOBA 4XBSA 1ZHAA 3GDMA 1I4NA 1P1XA 3GDLA 3WJZA 5I3GA 4Y9AA 3LLFA 2E5BA 4MZ8A 2CLIA 2RKXA 3NM1A 2PRLA 1KFKA 1DORA 2Z2UA 1KBIA 1T96A 3PBVA 5IBXA 4EF9A 4AWSA 4AEOA 2QCHA 4MJZA 2DJXA 3DKLA 5D33A 1AG1O 1B4KA 4MY1A 3FEMA 4GJ1A 3TAOA 3QPZA 3C0JA 1R2SA 4WQ6A 1TO3A 5CKSA 1EUNA 4CCCA 1HUVA 1VZWA 3FS2A 3WK0A 5BMWA 2YZRA 2YCEA 2EF9A 2J88A 2P0OA 4CNPA 1WDWA 1I2RA 5CPMA 4FIRA 3HGJA 5HMSA 3W88A 1VYPX 3T4CA 3NQAA 4GXMA 1NEYA 3H53A 5KZDA 1I2QA 3NPWA 2F7FA 1BWKA 5U7SA 3TFXA 1W5NA 3VKJA 3MJYA 3RU6A 4Z1BA 1L2UA 4HNUA 4Z0SA 2DP3A 1KFJA 1K3UA 4FX6M 3G0SA 1ICPA 2YSWA 3PUDA 4JEQA 3NO5A 1G4TA 2H8XA 3CLMA 3HO8A 5D04C 3W7LA 2FQIA 1DOSA 3U2OA 3OBKA 4S2BA 1H7RA 2QCLA 1ZAIA 3SGZA 2A7RA 1FX6A 1HL2A 4AHOA 1F6PA 3NQCA 4LRSA 2GOUA 4HSNA 4MIMA 1WBHA 3BW4A 1LBMA 4FHAA 3W75A 4O13A 1GVSA 2V8ZA 2F84A 1TPVA 1MEWA 3SIZA 3HGRA 3STEA 1P0KA 1PHQA 3JRKA 1BKSA 3HQ1A 4FNQA 5AC7A 3UZ5A 2VOMA 3I7QA 4BWLA 1K7EA 2C3ZA 1N8FA 4E2DA 4OHQA 2A6NA 4DEFA 5EYWA 3N19B 1K8XA 1JRBA 4JYEA 1W5QA 1WX0A 1FCQA 4Z1DA 2X2GA 4Y8FA 4OGZA 1JJKA 1YDVA 3TV8A 3IIXA 4HNVA 4MFEA 5LSMA 4WXYA 1L6SA 4UFMA 3L5AA 4DF0A 5TQLA 1EP1A 1C8VA 5CZSA 5CG7A 4NNBA 2J9ZA 3QFEA 3MUXA 1EP3A 4O1AA 3DZ1A 5AHEA 3W73A 2Z0IA 2HS6A 1P4CA 1K03A 2Z6JA 4POCA 1Y0EA 3SFKA 2VEKA 1FWRA 2VFHA 3SJ3A 1AW2A 4DELA 5DELA 2JKEA 1M7OA 1JR1A 3KVKA 3K30A 4UMAA 3TC7A 4CQ9A 5I3FA 4FO4A 1LYXA 3FOKA 1VLWA 2ZRUA 3CB8A 3GXPA 3WK3A 3NL3A 3WJYA 4YLWA 4MYAA 3BLEA 3LOTA 4JXCA 3THAA 2ATSA 2QKFA 3S5YA 1TV5A 1J5TA 1FUYA 1G7UA 1W5MA 4NJHA 3NNTA 1HO4A 3KOFA 3QC3A 4CCDA 3W86A 3IVTA 2V82A 2EGZA 1O94A 3DHFA 3HF3A 4NQ1A 1TTPA 3TR2A 5D09A 3DI1A 3LB0A 3FLUA 5GVJA 4YCOA 4O10A 1XUZA 3CIWA 3FKKA 2A6LA 1YYAA 3L5MA 5AB3A 1TJRA 4FIQA 2JGYA 3NZ1A 4LT9A 1H50A 3W2UA 2YXGA 2QCNA 2WSYA 4KKXA 4R53A 1YDOA 5D02A 3KVMA 1BEUA 4MZ1A 4FXRA 5CZ0A 4R33A 5KTLA 3LV6A 1SSGA 4LS2A 5FEWA 4M6PA 4WY0A 3ZS4A 1W3TA 1TRDA 3N2MA 1QWGA 3N14A 3JR2A 2C14A 1OABA 1Z41A 1FDYA 1ML1A 1KFCA 4G1KA 2C0AA 2JK2A 3NL6A 4NXSA 4U4MA 2X1SA 1W37A 4GRSA 4X9SA 4EVZA 4AF0B 3LLDA 3PWAA 3QW3A 1PV8A 1X8FA 2I14A 2Y7EA 3M9YA 1SO5A 4O53A 1IF2A 4JTUA 5LHEA 3CPRA 3TMQA 3EWYA 5D32A 4JYDA 4XUGA 3S1XA 3NPVA 3BG5A 1I2PA 1FCBA 3T78A 2QCCA 2ZBTA 3STFA 2XFWA 3IV3A 3GXNA 3NYZA 3HGOA 4RZ5A 1LTDA 3G0XA 5BNKA 1LBFA 4XBKA 4QSHA 3N73A 1G7VA 4GUJA 3STGA 2JKAA 3NQ8A 3WJXA 3M1ZA 5CSRA 3CWNA 3O05A 4NJGA 3NQVA 3DFPA 4H6KA 5AYYA 3HJZA 3NA8A 1H7PA 4EWND 2VEMA 3G18A 5C2XA 4K6AA 3MWAA 4DBEA 4Y6GA 3LCGA 1JQXA 3LHWA 1XBVA 3S5OA 3UWUA 1HTIA 4N9BA 2V30A 2PRMA 3C2VA 3G1XA 4YWIA 3EX2A 4LS1A 1VYRA 3QW4B 2NX3A 4MOZA 4XKYB 3KHJA 3RF9A 2V81A 3S5ZA 3KVLA 2GQ9A 1DJQA 4MJMA 1O95A 2GUUA 4M19A 4FNUA 1D3HA 1OYCA 3NDOA 2WO5A 1TSIA 3IGSA 1LRTA 5HWJA 4ZQPA 1OFRA 2ZRWA 2NLIA 2ZZ6A 1TQXA 1AK5A 2CFFA 4XTDA 4NX0A 3THQA 1PHWA 1IXQA 1WOAA 1RQEA 4UTUA 3NQMA 4UR7A 4UMCA 4K37A 3EWXA 1VLIA 5HR7A 2HTMA 3N9SA 1VH7A 1GT8A 2PE4A 3HIJA 1GTEA 4RJEA 4A21A 1LLWA 1OX4A 3OEXA 2CZ5A 1TTJA 3W22A 5AC8A 5LNVA 4AWUA 4O0ZA 4TU1A 1QO5A 4FNTA 3EWUA 3S42A 1H60A 3QMTA 4UXDA 4X2RA 1Z48A 3G1YA 1JUBA 2YW3A 4LC6A 1JCXA 3MI3A 4PCFA 1UBSA 3G1SA 1SSDA 4NJKA 5BMXA 1PL9A 1XBXA 3W1RA 5J5RA 3LI1A 1XM3A 4JICA 4PEKA 2Y89A 1LRQA 2ZZ4A 1QMLA 1SO4A 1F5ZA 5A8GA 2D73A 4IMEA 3CT7A 1XXXA 3LTYA 2QDGA 4I7UA 4C1KA 3O07A 5I3KA 3TKFA 4DPQA 1DKWA 4ZQRA 3BG9A 3FFSA 2Y63A 2WSQA 1MEIA 1Z42A 4I7VA 3G22A 4IMCA 3IIPA 3P7YA 3LRKA 1UASA 1W56A 1OFEA 1HO1A 5C5YA 1XKYA 4XZ9A 1VQTA 3W1NA 1LBLA 3IRDA 3M5VA 3T40A 4HSOA 2B7NA 3P61A 1H62A 5U4NA 4LVDA 1TYGA 4ALDA 3C61A 4M7SA 4Q4KA 3GNNA 2FB2A 1CI1A 3A23A 5F4XA 4N6FA 5HULA 3I65A 1LOLA 2VFIA 4A3UA 4Z0JA 1E51A 5LKYA 3BG3A 5D2TA 3WK1A 1MO0A 3G8RA 3LHYA 4QISA 2ZZ7A 3MYPA 2NV2A 3LV5A 3NAVA 5F4WA 1GVOA 1A5BA 2CZEA 3W7MA 3MW7A 3F4WA 1J2WA 2C1HA 4P61A 4E38A 1AW5A 1I2NA 2R91A 2DZSA 1JUKA 2QAFA 4NJIA 2QJGA 3U6WA 2QJIA 1SW0A 3WJWA 1TPFA 1VC4A 1GYNA 4IWWA 3DENA 3NL2A 5F2MA 4ZL1A 2QJHA 4HPXA 2DZTA 3PC0A 3IIVA 1MXSA 1SW7A 5G1YA 3LCWA 4TX9A 2BSLA 1EUAA 3S1WA 1LOSA 2PC4A 1OX5A 5FEZA 4O11A 4HPJA 1KM2A 3TXZA 3MBDA 3SGUA 5LNRA 5K4ZA 1O60A 3OA3A 1K02A 1UUOA 2G5WA 4OWGA 4NVTA 1F7BA 3QQ1A 5EBUA 4FNPA 4O0KA 3E49A 2WQPA 1MZHA 2NUXA 3P60A 1NAL1 2VXNA 4UCGA 1G4EA 1R2RA 3A9IA 3F1QA 1N55A 1TMHA 5IBXC 3TSDA 3ZWTA 2YYTA 4TMCA 3VE9A 2ZDRA 4UFIA 4WXZA 4YMZA 1EP2A 3TJXA 3AJXA 4LY8A 4OBTA 4QNEA 4W9TA 2V2HA 3GXTA 1M5WA 3CEUA 4LW7A 8TIMA 1RVGA 1H7NA 3A22A 4TR9A 4IXHA 5D2YA 2VEIA 2NXIA 4UNLA 3EX3A 3P5ZA 3W2JA 1H1YA 4BFAA 1RZMA 3G3DA 4FF7A 4ZMGA 3B8DA 1XBZA 2P10A 3L0NA 3KFTA 4FB7A 3W6YA 4RR4A 1G4SA 2QCDB 2QUTA 3PM6A 4JN6A 3TH6A 2RH9A 2VKZG 1KV5A 5CZJA 4ADTA 6TIMA 4UTIA 3Q94A 4UFJA 1KFEA 2EHHA 4IX2A 1VRDA 4NNCA 1EPXA 2BTMA 3W1XA 4RXFA 1G6CA 5HINA 1JVNA 2CW6A 1GVFA 3ABOA 5LZLA 2V9DA 3GR7A 1QPOA 4MFDA 5AHIA 3L2IA 3C3NA 5LNSA 2A0NA 3ATYA 1LORA 3DI0A 3NPXA 4WX2A 5C55A 4UFHA 3DXIA 1GTHA 4OQVA 4GFSA 2ZRVA 3G8EA 1OX6A 1VCFA 2V5BA 4JDYA 4JTIA 3W1PA 3M41A 4BR1A 3PG8A 1KLYA 2H3BA 5MHBA 4WOQA 3SW6A 4QNWA 3LX9A 1WV2A 4O50A 3W2LA 2Y62A 2KZHA 4BWLC 3TCEA 3OVRA 3QEZA 4O54A 1SU5A 4JTEA 4FX8A 3I7RA 3C4UA 2A7NA 3P74A 4CNOA 1KBJA 4O18A 1D9EA 1K8YA 2GJNA 4K8HA 3UY7A 1QO2A 3CQ0A 2DZVA 5I3IA 3TXVA 5D2VA 4X3ZA 1GG0A 2ABAA 1FWSA 2R14A 2ZA3A 3UZJA 3HG3A 3UWYA 5AYXA 5LGXA 1S5TA 3QYQA 1RR2A 3W87A 3Q2DA 3RK8A 4NT0A 2FIQA 1H7WA 3QRHA 1RQHA 4LS0A 2W6RA 2OT1A 4IMGA 1OG0A 2YYUA 3DAQA 1F05A 3T55A 2GQAA 2WV8A 1GOXA 4XQ6A 4I9AA 5DN1A 1EEPA 1O5XA 3C8FA 1P5BA 3G1HA 3F03K 3R2GA 4BK9A 2A85A 2CU0A 3PS7A 5C54A 4DXVA 4KFPA 1BTMA 1OYAA 3PG9A 2ZCGA 3MI2A 4DO5A 1ZFJA 3LERA 1Q6LA 3QSTA 3L9CA 4ZZ9A 1NFBA 3SZ8A 1LP6A 2NXGA 2X1TA 3C2FA 3LHTA 2Q3RA 3DFOA 4JY9A 2IQTA 5HR6A 4ICNA 1BWLA 1KTNA 3WK2A 2UV8G 3N2XA 4CQ8A 4UTWA 1QPQA 5FF3A 3M6YA 3YPIA 2QF7A 1TCDA 1H51A 1TJPA 4IUOA 4JTTA 1K8ZA 4NXKA 3EEGA 1SR9A 3TJLA 5KMYA 3ZFHA 1ZNNA 2GQ8A 4RCXA 4WY0F 3QQ0A 3HPSA 2HSAA 4M6VA 3W1MA 2OX1A 3MHGA 1F76A 2YW4A 3C2OA 1M7PA 5D03A 4H3DA 2NZLA 4K38A 5AFDA 3LXBA 3PR2A 2I1OA 3M7WA 3W7JA 2H8ZA 5H91A 2XN0A 3NQ6A 5F2LA 4XTIA 1PE1A 3W74A 1VR6A 1IXNA 4O17A 1KLZA 1UUMA 3PSVA 2R94A 3L0KA 1GG1A 2TMDA 3G3MA 4ORMA 5EKYA 1TQJA 1DVJA 1L9WA 3TW7A 1QCWA 3W83A 1OFPA 3PULA 7TIMA 1EB3A 2ISSA 4HT3A 2LLEA 4O1DA 2Z6IA 4C1LA 1AL7A 2C6QA 1LM1A 3GX9A 1GVRA 4CLMA 1ME8A 4PH6A 3QM3A 4PC8A 4UTLA 3N34A 1B4EA 2YFNA 2C13A 4FEZA 2H6RA 2Y70A 4Z08A 5CGQA 2FTPA 5G5IA 1KM3A 2CLFA 1DJNA 1AMKA 1SFJA 4IMFA 1Q6RA 1ME9A 1OX4B 3R5EA 2OCZA 4IX0A 4JR5A 4UMBA 3UNDA 4O4WA 3LCIA 3UPBA 4UIOA 3P8IA 3W71A 2ISVA 2FDSA 4K39A 3ABSA 3L68A 4FXSA 3W2MA 1TREA 3F4NA 2RFGA 3GNDA 1WBJA 2RDUA 1ZENA 5A5WA 3C2EA 3M16A 1SZEA 1LOQA 1XC4A 5FF2A 4GC4A 4IJBA 4UTMA 4JTFA 3W7QA 4M6QA 5DBTA 2VENA 3T7VA 4NU7A 3UWZA 1W3NA 1OFOA 1FQ0A 2ZRYA 4JTLA 2O7QA 1PCWA 1WA3A 3HG2A 3PB2A 5HUPA 1JCLA 2GVGA 3NQEA 4RXGA 1ICQA 1LRNA 3FJLA 2ZZ5A 3EX1A 3FYPA 5CZTA 1TPC1 1T0OA 4JTJA 1KA9F 1JQVA 5H2ZA 3S5NA 5T26A 1B9BA 5D30A 1RD5A 3PUOA 1R30A 5D05A 3GB6A 1T8XA 1MSSA 3LHVA 1I8JA 4HHPA 4JGDA 1SFLA 1FDJA 3TA6A 4NX5A 4O19A 4LRTA 3CM4A 4LV9A 2VEPA 3EKZA 4L4LA 1X7FA 4QIUA 3IVUA 3D0CA 3A21A 5FF4A 5HUOA 3AO0A 3LRLA 5EMUA 3BGJA 5AYZA 4UTTC 4AAJA 3LRMA 3MP5A 1Q3NA 3QMSA 4OT7A 4O52A 1SQ7A 4BF9A 3UXAA 4O15A 4GUHA 4JTSA 4R34A 3MI6A 2C19A 2Y7FA 1G69A 3LCXA 1GPWA 2QUUA 2W0UA 4O14A 2QUVA 4ORIA 1YADA 3KRUA 1PCKA 4XWUA 5FEPA 3R13A 5G2IA 1TRIA 2C16A 2OT0A 4HNNA 1KV8A 2Y6ZA 1ADOA 1OF6A 4O16A 3DFTA 3NR0A 2Y88A 4MVAA 1PVNA 3S8HA 3NG3A 2QR6A 4UC5A 1KM0A 3EXRA 4Z1AA 2QCFA 4UTKA 1VYSX 1TPWA 1H7XA 2BWGA 5FESA 2QCEA 3NVTA 4RKAA 4WD0A 4HN4A 3W7NA 2B0MA 1IIGA 4BI6A 4JNMA 4LC8A 5AHNA 3NQ7A 1YDNA 1H1ZA 3O8AA 4MYXA 1QPRA 4MPQA 4DPPA 3UWQA 4J9JA 5DCDA 3BO9A 2CLKA 3A5VA 3LHUA 3NEVA 1KW1A 2A21A 3M44A 2RDTA 3E9AA 3TFCA 2J9YA 2Q8LA 3NQFA 5E93A 3B0PA 3W7RA 4UTTA 5K3VA 1IXPA 1ZAJA 2CLHA 1TPUA 4QJ1A 3W7PA 4IXXA 1RV8A 4Q33A 5EPDA 3QF0A 4YXGA 3W7HA 5D2WA 4KWVA 3TROA 1MEHA 4TIMA 2WPBA 5G2WA 3EWWA 1G67A 5KZEA 1DQWA 3L5LA 4GUIA 2ZRXA 3B04A 1FBAA 3IIZA 2RHGA 3O15A 3HGSA 2FPYA 4FNSA 3TIMA 3WJSA 2J9XA 2ZA2A 4GUFA 1WQ5A 5F2GA 4RX0A 3W76A 3FJ6A 5DY3A 3DU0A 4RLIA 4AMAA 2YR1A 4LVBA 2E5DA 2VC6A 3TSBA 1JCMP 1LDCA 3ELFA 3FKRA 3GDRA 2EKCA 1DL3A 2QCGA 3GKFA 4Q32A 4S2CA 3GK0A 2PRHA 4L4MA 3SI9A 3IGUA 2AQWA 1JUEA 5K9XA 4PA8A 2QAPA 4RK8A 4FNRA 3S1UA 3W1QA 1SO6A 3GVGA 4ADUA 2V2DA 3M5XA 5LHFA 2NXHA 1SW3A 3TUUA 4O1BA 2YX0A 3M0ZA 1A5CA 4ZQMA 3DKJA 4AXKA 4NZJA 3EX6A 3PBUA 3UPWA 3LXAA 3GIYA 2VFEA 5DCEA 2V5LA 1DV7A 4GUGA 3M5YA 3MBFA 1QOPA 2Q8ZA 2J24A 1OYBA 4JY8A 3LHZA 1OK4A 3PAJA 1V5XA 1EX5A 3A24A 3U8GA 2E68A 4DF2A 1Z44A 2NWRA 3T44A 1RPXA 3E12A 2G95A 5D2XA 3SY5A 4S1FA 1PS9A 2NWSA 3JS3A 4M7TA 1ZAHA 1NF7A 4MUZA 3TNOA 2YPIA 4UR8A 3LGEA 3L67A 3OHIA 1TB3A 2BZNA 2CLEA 3W1LA 3NQ2A 2DZUA 5DLCA 1W5OA 3CTLA 1Q45A 3LCLA 3HPZA 3TSMA 3OG3A 2P1FA 3ANYA 5K2ZA 1A50A 5HWMA 3V75A 1KFLA 1ZY9A 4DQWA 2Y7GA 2JKPA 1F73A 3ABRA 3FA5A 2ALDA 3KXQA 4KFOA 3E96A 4JYFA 5E1QA 4ZVJA 1D3GA 1PIIA 2GJLA 5BRBA 3W7CA 3O63A 3GZ3A 3DBPA 2W79A 4LWWA 2CZDA 5KITA 1R47A 3TW6A 4NUWA 2DORA 1LLZA 2ZYFA 1ME7A 4FX7A 3C52A 2BX7A 3GYEA 2ISWA 4JD4A 3GLCA 4Y96A 3TQKA 1QAPA 1TPDA 3O1NA 5HNRA 4H4IA 3MYOA 3EKLA 4MLRA 3EX4A 4Y90A 2YDAA 1UJPA 3HG5A 4I7WA 3IEBA 3DFNA 4LVGA 2ZZ1A 2HMCA 5BW6A 3HMJG 2NX9A 1VGAA 2O7SA 4WOZA 3C6CA 2VELA 4ZQCA 3VCRA 1QFEA 2A5HA 1HFBA 1VCGA 4JDBA 3TE9A 1W54A 3W1AA 3M43A 4EOUA 3P82A 2YGYA 4IOTA 3LI0A 5FF0A 1JULA 1YLVA 3PVFA 1Q6QA 3TX9A 1VPXA 5L9FA 5J5DA 4IGHA 1XFBA 3EWBX 2Z1BA 4RV8A 5AHLA 5K9DA 1XCFA 2JBMA 4QAIA 4LV4A 4HKPA 4UTWC 4LVFA 4QITA 4JTGA 4WZHA 1KTCA 3TDFA 5DBUA 3GAKA 1NF0A 4JX4A 1H5YA 1DBTA 4GNJA 1I45A 1NVMA 1JRCA 1K7XA 1EA0A 4QQ3A 1K7FA 1OF8A 2CLLA 3N9RA 1ICSA 4UFLA 1FXQA 1P0NA 2GVJA 2Y85A 5G1TA 1FY6A 2E09A 5LNUA 3W23A 4DBDA 3SECA 1XL9A 4AVFA 4NJJA 2G96A 3W72A 4UUIA 1ZALA 3PSWA 4X22A 1W3IA 1LZOA 1KTBA 1CW2A 3CEPA 2FJKA 3CIXA 3QSRA 3MP4A 3NQGA 3EXSA 4WY0B 4RZ6A 1W1ZA 1A53A 4K7VA 4PL1A 3CHVA 5D38A 2G97A 3BV4A 1KFBA 4A29A 5TIMA 3LDVA 1JCJA 4MY8A 1GYLA 2QEZA 2TRSA 3V1PA 3BLFA 4O8RA 3HOJA 1G4PA 3P5YA 1FWTA 3CWOX 2PCQA 1SUXA 4AHPA 3NL5A 2OZ0A 1VCVA 5K9CA 3ZR4A 1YPFA 2B7QA 3S0CA 4AHQA 1THFD 3UY8A 3TC6A 1T99A 3W7DA 5G4WA 3VFLA 1LCOA 5HQEA 4OV9A 4JTHA 4B5NA 4P2VA 5HJLA 2JGQA 1VHNA 1OFDA 5HWNA 5I3JA 2R8WA 5EL1A 3UWVA 3PB0A 2QCDA 3O6YX 1AL8A 1ZCOA 4KWWA 3O06A 3GAYA 4O1CA 1Q6OA 1WAUA 2VFGA 1C29A 2WNZA 5KINA 1RQBA 2PURA 5CPLA 4EIVA 3P62A 4JS3A 3OIXA 1U83A 4NNAA 4N2YA 4PL2A 5KZMA 3NZRA 1QNVA 3ABQA 3R89A 3HG4A 3LCHA 2FLIA 1R2TA 4N9CA 1FWNA 5I3HA 3UXDA 4A2SA 3RNDA 4OE7A 2CWNA 3W7EA 1KM5A 1CX9A 4MZYA 1TPH1 3NQDA 3W70A 5ABTA 1ALDA 3RMJA 1XUUA 3BGGA 3TK7A 3UQNA 3M47A 3W9ZA 2Y61A 4UNKA 2V2CA 4LVAA 4PODA 4LU0A 3MHUA 4WUIA 4O57A 4OU1A 4AWTA 5CSSA 2ZZ3A 4NZFA 3STCA 3W7KA 1FCUA 3IGXA 4Z1CA 5DXYA 1SZFA 1B3OA 1TIMA 1SZNA 5AHFA 3LM7A 4UTHA 3BPWA 3UWWA 3W1TA 2C18A 5DCBA 5L6UA 4TMBA 3A5FA 2ZFAA 2X1UA 4WJEA 1NSJA 2E6AA 1EWDA 4O4VA 4LUJA 3DH7A 1L6WA 4YCPA 5K4XA 4YL2A 1XDLA 3S6DA 3B4UA 3I68A 1J4EA 4UFKA 4JIPA 1OVDA 3NGJA 2WNNA 3G1FA 4JTKA 3NOEA 1AW1A 3SSJA 3KRZA 5TBOA 4JX6A 2X1RA 1YXCA 4AB4A 2BXVA 3VNDA 3LXCA 1N7KA 3GKAA 1FDZA 2E6YA 1X1ZA 2WOQA 2NUYA 5G4EA 2B7OA 3SR7A 2VFDA 4O12A 2FB3A 3G1AA 1YTDA 1JCNA 3G24A 3Q58A 3W7GA 4GBUA 1VHCA 1A5AA 2FPVA 3INPA 1R46A 3E02A 5D37A 3B06A 5K7JA 4JIQA 1OHLA 3NM3A 3TQVA 2QDHA 2XN2A 4IQLA 3PBWA 2RDWA 2AGKA 3S1VA 2TYSA 2ZQ0A 3P81A 2H90A 1S3HA 3HBLA 1TTIA 4N4QA 5F2IA 4DO6A 3TMLA 1X6UA 3BK0A 3P84A 3LTPA 4ADSA 3USBA 1F74A 3FIGA 4M5PA 2A1YA 2C15A 3O16A 2X30A 1F6KA 2E1DA 4K7YA 5DY2A 1H61A 3I6RA 3PBYA 3W2KA 4O28A 3P80A 1IIHA 3DGRA 6ALDA 3O6DA 2B7PA 3H54A 3W07A 2OMAA 1W8SA 5CPNA 2GPTA 4CQAA 2DZXA 2NV1A 3KVJA 3MP3A 3QPYA 1TTQA 1HG3A 2ATMA 1IGSA 3P8JA 1FXPA 4LUIA 1WXJA 5SWUA 1YTEA 4N4PA 3ATZA 4DO4A 2WKJA 3W2NA 2NX1A 3G1DA 3MHFA 1U5JA 4QM1A 3B03A 3QH2A 1FWWA 3P67A 2V0TA 1LROA 1C9DA 2E6DA 2E77A 4K36A 2OJPA 3B0UX 3W7OA 3VI2A 2E5CA 3LTSA 1S5VA 3G0UA 4BI7A 1O4UA 3C2RA 1YTKA 2WNQA 1GWJA 3KAOA 2YFOA 5LGZA 1YXDA 3W85A 4U28A 2CZFA 3IIOA 1OJXA 5FEXA 3LCFA 1VJIA 5AOUA 3CC1A 3RLVA 3W84A 4HIBA 4MY9A
chains in the Genus database with same CATH superfamily
5AHMA 4J3WA 3Q45A 4PULA 2ZRZA 2QYGA 3RPDA 1DIKA 3GY1A 1Q6GA 4YHEA 1TFVA 5A2BA 1HKMA 2ACQA 1X1OA 3M6DA 1EIXA 3DGBA 1R5YA 3V16A 3OVQA 3BLIA 1FFRA 3AHXA 2WZHA 4P7QA 3WH9A 3RIKA 3IVSA 4UB9A 4US5A 4AF0A 3B0VC 3WD1A 1GOIA 3O0KA 4WSKA 1F8IA 5H8PA 1KM4A 1R7OA 4FAMA 4PUEA 4N9DA 3S9YA 1EWEA 1Q65A 5FSDC 2I9EA 2PLJA 5BOOA 1E4NA 4DBSA 2IW0A 1NWRA 3GDKA 3E0IA 4JX5A 4JHZA 1WZMA 4CNNA 2UY3A 1UD3A 2GVEA 3I3EA 4KFNA 4KQNA 4J28A 1AD4A 1EJTC 2O9RA 5BU9A 3RLUA 1VS1A 1Q2RA 4AEEA 4IQJA 4HPNA 1XYLA 3EB2A 1TR9A 4RZ4A 5C9UA 3RXZA 3GD6A 1TJ0A 3UESA 2ZTKA 3WFAA 4LCRA 3M5ZA 3F4DA 2AMXA 4OBRA 5BROA 2D0FA 1ONXA 1LL6A 2WM1A 4R7WA 2GJRA 3E2SA 3L65A 3UZXA 3EEZA 2V68A 3GFZA 3KLLA 4D6JA 2VZSA 4OECA 1UB3A 3BOLA 2XG9A 1P0BA 3BW3A 1E0XA 1DQXA 4E0CA 3FSTA 2ACUA 1PBGA 4TO8A 4R7JA 4NAEB 3L66A 3G1VA 4K8EA 3GHRA 1UCWA 1JL8A 3BLKA 1WYIA 1XDMA 2R6OA 1XH0A 1QUMA 2J66A 2DU2A 4IPJA 1GJPA 3SCVA 3GYCA 1CPUA 4PMQA 1KRMA 4ROPA 1J0HA 2ZUTA 4FOKA 1UIOA 2DFAA 3URAA 3CU2A 3NXFA 2PDXA 4FOJA 1TPEA 1EX1A 1EOKA 4JFSA 1SO3A 4LALA 3V18A 3GNPA 3DECA 5F1UA 1UWAA 2H3DA 4R7OA 2ZZ2A 4NZ4A 4LOCA 5JH1A 1NJJA 2W66A 1JAEA 2XFFA 5F1VA 2E67A 1VPQA 1TJ1A 1H7OA 2CLMA 1AQMA 4GYPC 2HNHA 4C6DA 2F2KA 4I6KA 3GDLA 1FWHC 3NM1A 4GQRA 1KFKA 3WBXA 3CASA 3FVMA 5CGTA 5A69A 2NQ5A 2Z2BA 4GIEA 1NP2A 4YTQA 2DQWA 4PYSA 1M53A 3GXIA 1ADSA 4DN1A 4EX4A 2QCHA 3RR4A 4MJZA 2VTFA 1AG1O 1JZ2A 5B7YA 1TWZA 3WX7A 4CCCA 1IGWA 1B2YA 3AU2A 3AI0A 4J3TA 1C3FA 3GHTA 2EF9A 3IPWA 5C71A 1KD0A 3HGJA 1XFCA 3PTDA 1VYPX 4GXMA 4LB3A 3UPMA 2W27A 4HNUA 2BS9A 1KFJA 1K3UA 1REQB 4CD7A 4JEQA 3NO5A 2H8XA 2WWCA 3CLMA 4Q8UA 4AY7A 3OBKA 4S2BA 3N25A 2E3ZA 1HL2A 3V5FA 1MXDA 3AMGA 3AXIA 1JFXA 3S5SA 1AQ0A 1WBHA 2F61A 1LBMA 4FHAA 1IZJA 1CXEA 2B81A 2G3IA 4CEUC 1P0DA 1GCYA 1WDSA 3PZMA 4CNUA 5I5RA 3JRKA 4U3CA 3QTPA 1BKSA 4FNQA 1ONEA 2BGQA 1XLAA 2ONEA 2VOMA 3D46A 4XAGA 3UJEA 5LYRA 2A6NA 3W29A 1NM9A 3WNKA 3P14A 4LF1A 3V3WA 4Y9PA 3ME3A 1WAWA 4HD5A 1WX0A 1QXLA 3SIMA 1R0MA 3ABXA 6REQA 4OGZA 4YYFA 4KRTA 4WGXA 1NWUA 4HNVA 3N6HA 4P8XA 5JVLA 4P7OA 1VD6A 4D6DA 1GK8A 3NEHA 4JNZA 1EP1A 1W2VA 5CZSA 3AZRA 1OM0A 2INEA 4W7UA 5A6BA 4O1AA 5HMFA 4D1IA 4IISA 5A8QA 7A3HA 3D3FA 3W73A 2Z0IA 2HS6A 1P4CA 1K03A 1G01A 3CUFA 1JF5A 2VFHA 1V3KA 3SJ3A 3ITOA 3KDOA 4QP0A 3K30A 3R25A 3PTMA 3TC7A 1V51A 3GIQA 5I3FA 3H8AA 1OQFA 3WQVA 3SRHA 2OR2A 2WVVA 2ZRUA 2WW5A 4ZOBA 1PIFA 3H2CA 4B15A 4GQGA 1VEPA 3BLEA 3LOTA 1XF0A 2ATSA 2PDHA 1TV5A 3ICJA 4FLSA 4JFUA 1E0TA 1FUYA 1G7UA 1W5MA 3GWQA 4E4FA 1EBHA 1HQTA 3W86A 1E4IA 3H6OA 1O5QA 2QJNA 5D09A 7CGTA 1XUZA 3LNPA 5AB3A 2YXXA 2JGYA 4PMDA 4LT9A 1H50A 3W2UA 3OYZA 4KKXA 2PDCA 4XZIA 3CZEA 1O5RA 4MZ1A 4FXRA 1QNRA 2C91A 2PTZA 1XICA 4A3RA 5IRPA 4G6CA 2C14A 3JW7A 1OABA 2C0AA 2AMGA 4U4MA 1DIOA 4X9SA 4MNJA 3WQDA 4Z17A 3E2VA 1PV8A 2I14A 1XSJA 2OKOA 2QVHA 2Z28A 5C70A 3U5UA 4O53A 3VD5A 1EBGA 1NH6A 2BY2A 2QNEA 3EWYA 4AY1A 3EAUA 4YYCA 3S1XA 1SGJA 1M41A 4GZ7A 3II1A 3QXBA 4XAZA 4IF2A 3GXNA 1XLBA 4IGNA 3E0VA 1HJVA 4RE4A 1LBFA 2W62A 4QSHA 2J79A 3R1ZA 4AD2A 1UWSA 2DT2A 4HYWA 3UGVA 2UY4A 3DFPA 3HJZA 3NA8A 4ZOCA 1S2VA 1BPLB 3MWAA 4DBEA 3LCGA 4PBFA 2EPNA 2PRMA 4LS1A 2XIBA 3RF9A 2GQ9A 1DJQA 1IEXA 4MJMA 4D9PA 4ZENA 5FD0A 1D3HA 1IYXA 2IPJA 2WK2A 2O4MA 1FTXA 4HMNA 1DJXA 1E70M 1PHWA 1XQKA 4RUBA 1X39A 1NIUA 2EG8A 4J40A 4C1NA 4W7VA 4EK7A 4K37A 3EWXA 5HR7A 2HTMA 4PGLA 1VH7A 1GT8A 1XD1A 6XIAA 2O9TA 1VB9A 1TTJA 5AC8A 2P53A 5GNXA 2DPEA 5EB8A 5LNVA 4AWUA 4DJDD 1VPYA 2Z4GA 1XLCA 3S42A 1FA2A 1Z48A 3FK4A 5E9XA 4LC6A 1JCXA 1M3UA 4NJKA 2PCEA 3T2PA 2OWWA 1AJ2A 3W1RA 3PFRA 1QBAA 4LAUA 4JICA 4X0NA 3RPMA 4FI4A 3TR9A 1MUWA 3H7UA 1RVKA 5A8GA 2PDIA 4FMVA 2XVPA 5TAOA 5I3KA 3TKFA 1VIZA 4IL0A 3PPCA 2QLYA 4GX9A 5CQ1A 1Z42A 4X9YA 3G22A 4IMCA 3IIPA 1HO1A 3O7UA 4H2HA 1XKYA 1PWLA 1V93A 4MJ4A 1S1RA 3WQFA 5EMJA 1M7XA 4WKFA 2E40A 3SUUA 1CI1A 3A23A 1E55A 1KNWA 2Y5JA 1BTCA 1FH8A 3BG3A 3F4VA 5D2TA 3LHYA 2ZZ7A 2PGEA 1GVOA 3GTXA 1NTHA 1J2WA 2C1HA 4D6HA 3SCSA 4GZEA 2W5FA 5M5DA 4DBWA 3MCMA 4U2YA 4A6GA 3RJXA 3U6WA 3ZT6A 3WJWA 1G5AA 3LSCA 2XH0A 1GYNA 4IWWA 3DENA 3NSXA 3GR4A 2WJEA 1U1JA 2FVLA 4PUNA 3S3GA 4IIGA 3S1WA 2PC4A 5FEZA 4O11A 2GOKA 4S39A 4LBUA 1E6NA 3GC5A 3WCZA 3MBDA 2VZUA 3DYMA 3OA3A 2YCIX 1K02A 1UUOA 3FV9A 3QQ1A 1CDGA 4HQVA 4FNPA 1NAL1 4E3VA 1G4EA 4DIAA 3F1QA 4KGJA 2HK0A 2VURA 2FHBA 3ZWTA 2YYTA 3QHNA 4UQBA 2OQHA 2X41A 3B9EA 1XYCA 1XH1A 2DZAA 3OZMA 3AJXA 4R9OA 2V2HA 3A3HA 3GU9A 2PDBA 4DYKA 8TIMA 1RVGA 3B8WA 2ON3A 4I9TA 4Z2JA 4UNLA 3WNNA 1H1YA 3B3DA 4AQLA 4ZMGA 1ZJBA 1XBZA 3KFTA 3W6YA 4XKMA 2QCDB 6TIMA 4UTIA 3Q94A 1W9PA 1VRDA 4HU4A 1EPXA 3W1XA 4FS9A 4ZE5A 4CQCA 1GVFA 1M1BA 3ABOA 4GI9A 3B8VA 3VIMA 4HHHA 1GJUA 1EJ7L 1PJ9A 4WEVX 2NSOA 2R82A 5LNSA 4M82A 1UG6A 4S3FA 3VU2A 1CZ1A 5C55A 3DXIA 3EOLA 5CBIA 3QZ6A 4Z1YA 3TA9A 3G8EA 2V5BA 4B9YA 2PGFA 3AISA 4W5UA 1KQYA 3PAOA 2XVLA 4PN2A 1R9YA 2REQB 3CZLA 4AUBA 2H3BA 5MHBA 4WOQA 3WF4A 3GE7A 2X7WA 3RM4A 3TCEA 3LENA 1TE1A 1MMFA 3OB8A 2PDGA 1EPVA 1V3MA 4FX8A 3I7RA 3R10A 4CNOA 1L2QA 1D9EA 2CHNA 2OO6A 3CQ0A 3FEQA 2DZVA 3PNUA 5I3IA 3CYVA 3U48A 2YCKX 4J3SA 5BU6A 3BANA 1R87A 5AYXA 3QYQA 1VEOA 3Q2DA 1GHRA 2RJGA 1Q7ZA 4H1ZA 1RQHA 4IMGA 3CGTA 3IV8A 3T09A 3WLTA 4PTDA 3EOEA 3IK4A 3UYIA 5CLWA 4CN4A 5T91A 2PU0A 1P5BA 3R2GA 3H12A 4K1WA 3PS7A 3K8KA 3SRDA 4KFPA 1OYAA 1QATA 3TYDA 4NP7A 3BMVA 2AQOA 4ZZ9A 4PCTA 1NFBA 3A4XA 1VFFA 5H1WA 2X1TA 3C2FA 4F0MA 2Q3RA 3DFOA 3MTWA 2VCBA 1KB3A 3APGA 3VTRA 2UBPC 4ICNA 3CAQA 5JU6A 1IV8A 1KTNA 3WK2A 4NKCA 3N2XA 3BJSA 4V1YA 4RE0A 1C7SA 5JIWA 4JTTA 4NXKA 2I5GA 3ANVA 4W85A 3WUBA 1B5TA 1K4GA 5KMYA 1W3KA 3ZFHA 1NOFA 5GNYA 1HNYA 4WY0F 4QJ3B 3HPSA 2HSAA 3CUHA 2TODA 3I4KA 3MHGA 2WPGA 3PR2A 2CXEA 4XTIA 1PE1A 2BB0A 1IXNA 1KLZA 4U33A 2GSEA 3L0KA 2IKGA 2GSHA 3W25A 4ORMA 1L9WA 1QCWA 4V28A 2R1NA 1OFPA 3TQPA 1JXJA 2Z6IA 3CUJA 1C8XA 2WHMA 2OXNA 1LM1A 3GX9A 1PX8A 1GVRA 3EWCA 3N17A 4LAKA 4JCMA 2EG7A 1ME8A 1SR0A 3N34A 1UWIA 3ALFA 4XD3A 4QEEA 3F7JA 5CC6A 2FTPA 4TV6A 2Y24A 4GJIA 1SFJA 4IMFA 1ME9A 3R5EA 3GS6A 2FKPA 4JR5A 4UMBA 4O4WA 2A3EA 1EJXC 4HMCA 4XK2A 2PWFA 3U7BA 2ZWYA 3IJLA 1UWTA 4GHRA 1TREA 3VDHA 1WBJA 1ZENA 1A5MC 4CQDA 4HP5A 1SZEA 2Y4SA 4PMNA 2J13A 3H4XA 4A8LA 4JTFA 1RBLA 5DBTA 3ZIZA 2VENA 5KETA 3NJ3A 2ADAA 3RUBL 4JTLA 1XWYA 1PCWA 2ZUWA 3F5KA 2FGLA 2DIEA 3VINA 3VM5A 4HA3A 3FSUA 4GH1A 3PPFA 1B9BA 4ZO6A 2PD9A 5E09A 3MSYA 2PDUA 3KWSA 5D30A 3TTOA 1RD5A 3VIHA 3PUOA 1R30A 4GQBA 3H70A 3SDOA 1NWTA 5CAHA 4HHPA 1P48A 4JGDA 1RPKA 1SFLA 4NX5A 3L4YA 4O19A 1LWHA 3CM4A 4LV9A 3KBNA 4L9ZA 4L4LA 4S3GA 1UH3A 3VZYA 3WLMA 3H24A 4DLFA 2QVNA 3D0CA 5I00A 4EWJA 1KKOA 1TIWA 5FF4A 3AIWA 1XS2A 1KXQA 5EMUA 1WP6A 4UTTC 4FK9A 1HGWA 4GC3A 3WFZA 4HU0A 4O52A 1SQ7A 4BF9A 3BLOA 3UXAA 1EC9A 4GUHA 4R34A 2C19A 1G69A 3LCXA 2QUUA 1X7IA 2WQDA 3CZKA 4ORIA 1PCKA 4WDWA 4LQ1A 2J7DA 3RCYA 2C16A 1HJSA 1KV8A 2VCAA 2Y6ZA 1ADOA 4MVAA 4CN6A 2HE8A 3NG3A 2QR6A 4M3PA 1KM0A 3ZR6A 3VOGA 3ES7A 3RITA 4GOAA 2OB3A 3NVTA 4YJ5A 1XG3A 5KZ6A 3W7NA 2B0MA 2HEJA 4M1BA 1FP9A 2HBVA 3SBFA 1GVEA 3M4HA 1H1ZA 4MKVA 4DB7A 4MPQA 2FZMA 4DPPA 4J9JA 2CLKA 2HISA 3M44A 3UWEA 1E5NA 3TFCA 3MVIA 3VCNA 3SUVA 3NQFA 1OCBA 5JIPA 4Q8MA 1IXPA 1P0EA 1ZS2A 3CUGA 3KOWA 3ZO9A 4E2VA 3UBPC 5M1TA 1W1VA 3MSDA 1Z89A 4IXXA 1JNDA 4KCTA 1TMLA 5EPDA 5EU9A 3TROA 3WFLA 3EWWA 3DHPA 3L5LA 5XIMA 3B04A 3AXMA 1UPMB 2RHGA 3CO8A 2PPGA 3CLWA 4FNSA 3TIMA 3WJSA 3VGHA 4GUFA 1L6GA 1G94A 1TCMA 4RX0A 5E0CA 1RBAA 3FJ6A 3LM3A 5DY3A 2XUCA 4JNYA 2YR1A 2E5DA 4X0VA 3ELFA 5FSEC 2BODX 1FH9A 2QCGA 4HPGA 3MZNA 1DJWA 4Q32A 2PRHA 1EDTA 2WMJA 1UWRA 3DFYA 1BSIA 4FNRA 3S1UA 3OU8A 1E6QM 4J35A 3K2GA 2C1GA 4MKSA 3M5XA 3TUUA 3M0ZA 1A5CA 3DKJA 4NZJA 4XISA 3VOIA 3WDHA 4PUJA 4M24A 3BSHA 3LXAA 2GLKA 4XUYA 1VENA 4GBDA 1EGZA 4JIEA 3BAJA 5A3HA 5CPTA 2J24A 4Q7NA 4JY8A 4Q4QA 3LK6A 4HVXA 1EX5A 3A24A 1Z44A 2NWRA 3OLGA 2RJHA 2PAJA 2FH8A 2YDQA 2J74A 3RN6A 1NF7A 1R3QA 2XSXA 4MUZA 2YPIA 4UR8A 2J47A 3M0JA 3M0XA 2DZUA 4GFIA 3IJ9A 4V27A 4K3ZA 1YNPA 4IQEA 1Q45A 5PTDA 1MFUA 4YTRA 2QDDA 3BAWA 1KFLA 3IWPA 3LBOA 4ZFMA 1QASA 3N2TA 3R94A 3ABRA 2ALDA 4W7WA 3FXGA 1OG6A 5E1QA 4ZVJA 1D3GA 1LLOA 3WQPA 3W7CA 3O63A 2QV5A 4L64A 1MNZA 2NVDA 2DORA 1LLZA 1ME7A 3ITLA 2WANA 2BX7A 5C2CA 3F2CA 4FR1A 2O0TA 1WB0A 3FGCA 2XISA 1ITUA 5T9CE 1OIFA 4MAVA 3KE0A 3EYPA 1TPDA 5DO8A 1UJQA 5ABFA 4MLRA 3EKLA 1I9CB 3LZ5A 2XH2A 3CHFA 2Q6ZA 4I7WA 1KXHA 2Q01A 2ISFA 3DFNA 2HMCA 3HMJG 2INZA 1X1NA 3C6CA 4ZQCA 3UG4A 4P5UA 3VKDA 1V08A 4C6BA 3AAMA 3FHQA 1XPGA 4KRZA 4NY2A 5TF0A 2NVAA 4M6UA 1PTGA 4EOUA 1QW9A 1V6YA 4DX3A 5FF0A 1JULA 1LL4A 1Q6QA 2XGBA 2XIIA 5L9FA 4RV8A 3SCTA 5K9DA 2WLZA 2EG6A 2J7BA 3CYJA 4JTGA 2IUZA 5H6HA 4MWAD 1GEHA 2NQLA 3LMYA 2QJMA 1NF0A 1Z3NA 1DBTA 1XRFA 3VKBA 3C5QA 1NVMA 1CTNA 3MB9A 3SJNA 4QQ3A 2ZWZA 1FXQA 1P0NA 2GVJA 1PX4A 4YIWA 1XLDA 2R1PA 3SECA 4AVFA 3WQ6A 4B16A 3R0DA 4ZGYA 1F4HA 1Z6KA 3CZ8A 1KTBA 1PAMA 3AICA 1CW2A 4EPBC 1CXIA 4IUGA 4YVVA 1TX2A 1NFPA 1TVNA 4H2CA 2VGBA 4DLMA 1WXZA 2QZRA 4XZWA 4RZ6A 5BXTA 4Q4SA 3PZ9A 4K7VA 2PUZA 4PL1A 5BXRA 4NHVA 1E4MM 3T2QA 4Y7EA 4HZ6A 4A29A 2XVGA 5ECUA 2YLLA 4HZ8A 5IDIA 2XPKA 4O8RA 3I6EA 1UYQA 3Q67A 4HU8A 1SUXA 3N18A 3PZNA 2OZ0A 1A5UA 2EJAA 1T7LA 3UG8A 1VCVA 3R79A 1FKXA 3ZR4A 1S5NA 1YPFA 5HMDA 3ARSA 1Z69A 2B7QA 3W7DA 2CESA 1RP8A 1OWQA 5HJLA 2JGQA 3VDAA 2WYSA 2VD9A 3PB0A 1ZCOA 1TKKA 2ZXAA 5I06A 2OGYA 1EJWC 4XV0A 3EWDA 3A9BA 4XD5A 3H23A 3DOPA 4PMZA 2WZMA 5BRPA 1RQBA 4RNFA 4EIVA 5CAKA 3UR5A 4IIDA 2V3GA 3ZT7A 3QQWA 4L4OA 4C6NA 3LCHA 2DSKA 2FLIA 1GUVA 3H2MA 4N9CA 1FWNA 3RNDA 3XISA 4C7FA 4KT2A 4OE7A 5ABEA 3VPLA 3W7EA 1KM5A 2VJXA 4XAFA 3W70A 3FW6A 1XYBA 3BGGA 1LL7A 3TK7A 3W9ZA 3H2NA 4UNKA 5HANA 4YU1A 3TP4A 2O4QA 4LU0A 4OU1A 3WY1A 1YE6A 3UJSA 4C6IA 5JBDA 4F0LA 4KRUA 3GW3A 1ZCCA 1L8NA 1SZFA 4W86A 1OZQA 3HU7A 5A8PA 3BPWA 3AS0A 4HTYA 5DCBA 3OA5A 4XZLX 2ZFAA 4WJEA 3VC6A 1NSJA 4UQDA 4F0HA 3WLKX 1K9TA 2PWDA 4H19A 3B4UA 3I68A 1WKFA 4JTRA 1J4EA 4UFKA 4L80A 1B3YA 1OVDA 5EFDA 4ERAA 1OY0A 4WJXA 2WNNA 1Q7MA 4JTKA 3SCRA 3SB0A 3HFTA 3I4EA 3KRZA 5FA5A 2BXVA 3BICA 3LXCA 1X1ZA 1JDEA 2NUYA 2B7OA 3NURA 3SR7A 2VFDA 1GPFA 1I0BA 1TZ7A 1P6CA 2FMOA 3Q58A 4QLLA 4GBUA 3UU0A 1B3WA 1US3A 4HTBA 3GNRA 1HVQA 2XIJA 1CLKA 5D37A 4W8AA 3HTWA 2XH4A 1UIPA 2AGKA 4IICA 1E9IA 2XZ9A 3P81A 3S1VA 1S3HA 4XO6A 3TMLA 1X6UA 3P84A 5E0FA 2FVKA 1HVXA 1XGEA 3GQYA 2V3DA 1E9LA 2A1YA 2C15A 3UVAA 3O16A 2ZXDA 1DQUA 2WHKA 1MW0A 4O28A 1IIHA 1B3ZA 2YBUA 1BAGA 3DC0A 3O6DA 3H54A 4UOQA 3SY8A 4CQAA 2FHCA 1H2JA 3TLLA 5EMLA 2ATMA 1KC7A 4AD4A 3P8JA 3NVDA 3SN4A 1YTEA 3BAIA 3W2NA 1RJPA 4AYGA 1V0MA 3QPEA 2G3MA 1FWWA 1W8GA 3OP2A 1B1YA 5DRCA 1FRBA 2Z00A 3MANA 2YCLA 4JN7A 1H5VA 3THCA 1S5VA 3G0UA 4JKKA 3PZVA 1JNEA 4H9YA 3WF0A 2X40A 2ALRA 3WELA 3ITGA 3KAOA 2Z1SA 3W85A 1W3LA 1LG1A 1OJXA 1XKJA 1NWSA 1JZ5A 3WNMA 4HIBA 1E6RA 1W1PA 1HZYA 1EYWA 4HZ7A 1A4MA 3ZYZA 4XIMA 3RX4A 5KSWA 1JPIA 4UTFA 1XI3A 2XIMA 3HB9A 4JQ2A 2OZ3A 1A49A 4HMEA 3CK5A 4MKNA 1TWWA 3WNLA 3RCMA 4LJ3A 2G8ZA 1TV7A 2R1MA 2CKRA 3UD6A 3SADA 3MO7A 4QDWA 4A2RA 4AC1X 5AC4A 4E2BA 4I8YA 1PKMA 4L4PA 1XIFA 1TMQA 1OCNA 3MMTA 3Q37A 4D2JA 4UTJA 3NSMA 3DFHA 3LGGA 3WBYA 5HBFA 1W0MA 2XHYA 2AKZA 2BLEA 2O56A 1E1CA 2Q3OA 4OKDA 2ABBA 4CNTA 1KM6A 2NLYA 3BOFA 3L21A 1GVQA 4ZQOA 1JGMA 1H1NA 2FPTA 4M80A 1H63A 2E28A 3C2YA 4FXFA 1J11A 2QCMA 4WCJA 5CZKA 1Q8AA 1XLGA 2PWUA 2E9BA 2WJZA 3PFMA 1QU4A 3QOMA 1W31A 3VCCA 3N3MA 5DX7A 3VDGA 5ENLA 4XKYA 3UZWA 2A4AA 3POCA 4U31A 3VK5A 4NYYA 2QF8A 4I9MA 4M1RA 4ONVA 3KBWA 4B92A 1R9ZA 3CTTA 2AAMA 2WHJA 1V7AA 1WDDA 3WSUA 1A5NC 2GVLA 1KM1A 3L7RA 1RSCA 4MLJA 4KW2A 3CNYA 3PWIA 1DP0A 4HBKA 3RFAA 3A3WA 1CWYA 5ABGA 2DJLA 2GSJA 1Y8BA 1W6TA 3L0GA 4IJRA 3R12A 4N6EA 1NY1A 4QSFA 4ASTA 2YA2A 3P6LA 3QMRA 1KGUA 3PUEA 1XP3A 3B05A 4JQ1A 1C8YA 1YXYA 3UCQA 1Y5VA 4LTSA 2J62A 1JPHA 4O1FA 3WO8A 1J5SA 3S2NA 3ZJKA 3MC5A 5BOEA 3VGEA 4B2DA 5IOBA 1GKPA 4NYUA 4H8HA 2V5DA 4J4KA 4S3JA 1XG4A 4N9EA 4D6FA 1V4YA 1BG9A 3KRSA 3WBAA 4JL1A 4I90A 2BDQA 1EJSC 3SM0A 2EEXA 4L9XA 5FF7A 2GJPA 1CT5A 1B0IA 5FI8A 5AC6A 1BWVA 1A5SA 1ZJAA 3PK7A 4CU7A 1P7TB 3LPOA 4RDZA 3NPUA 2VDGA 2FMNA 2FFCA 4TV5A 2EAWA 1P1XA 3GBEA 3WJZA 2E7FA 4DYEA 3QHOA 3WF1A 3WLNA 4MZ8A 4IIFA 2RKXA 2PRLA 1OSEA 3V35A 1KBIA 2J8TA 2ZUMA 3PBVA 4GZJA 5IBXA 1MDRA 4EF9A 4JL2A 3WQ4A 3PWGA 1MDLA 5D33A 2BMBA 5D9NA 1B90A 1B4KA 4MHBA 3FEMA 4GJ1A 1CGWA 1HP4A 4AWEA 3C0JA 3BL3A 3QR1A 3UFYA 3O2LA 4JBRA 3V0TA 1TO3A 3AYVA 4QRNA 3FS2A 1FVPA 3CV7A 2YZRA 1WUEA 3MMDA 1EXPA 2P0OA 4CNPA 1RLDA 1WDWA 4LYRA 5CPMA 1A4LA 4S3CA 3H53A 2IXVA 3ABZA 4GK8A 4NSBA 1JF6A 3VKJA 3RU6A 3N6QA 5D9PA 2CLPA 3SO7A 2YSWA 1J6OA 2QPSA 3EMZA 1EJVC 4H9XA 3U2OA 3C0LA 4GPNA 4FA3A 1UQYA 4V2XA 3WZ0E 4UZSA 3SGZA 3KTXA 4H9MA 4PB4A 4AHOA 2YA1A 4LRSA 2EXOA 3V5OA 1UH2A 2OLHA 2V8ZA 3MWCA 3HGRA 3E0LA 5I0DA 4Q22A 3WG6A 1P0KA 1H09A 1OEPA 1RK5A 3E2RA 3OODA 1KXVA 4AZBA 4OHQA 2PTDA 1S2AA 1V6WA 2WKLA 3BQ6A 2J6VA 1XLKA 5IFPA 1G9HA 4C6FA 4KGLA 2PSNA 1JJKA 3H2EA 1YDVA 4OOZA 3TV8A 1XRVA 3XINA 2HNEA 2VL4A 4WXYA 2FFIA 4UFMA 5DMYA 1C8VA 1FWAC 4NNBA 3QFEA 2E1WA 4J27A 3M64A 2RUSA 3DZ1A 1C93A 1OGSA 2RDXA 3NWRA 1XSIA 1Y0EA 3T0BA 3PUGA 5I02A 1CBGA 4LAMA 2JKEA 3HA1A 1M7OA 1JR1A 3KVKA 3QGVA 3H26A 3MMWA 1V02E 3LPPA 3D6NA 3DESA 1JPMA 1DWFM 1O1ZA 1VLWA 3CB8A 3AIVA 3WK3A 3PZGA 4YLWA 4MYAA 3IJ6A 2GL5A 3AHYA 3DC8A 3STPA 1CCWB 3EDKA 7ODCA 2G4JA 1HO4A 3KOFA 4YTTA 3IVTA 4DY1A 3A6OA 3E5BA 4NQ1A 4CNSA 4J7RA 1PKYA 2PD5A 2G3FA 5GVJA 1QK0A 4YCOA 3COTA 2BGNE 3FKKA 2A6LA 1V6TA 4M56A 4RZBA 2E0PA 1TJRA 2YXGA 4R53A 4MG4A 5CZ0A 4HOXA 4R33A 3LV6A 1EXBA 4U2ZA 1VBRA 1K9EA 4WY0A 3TJIA 3DYPA 4DWSA 1Z41A 4M29A 4G1KA 3NL6A 2H9AA 2X1SA 2ZXBA 5C9XA 4PFHA 3SCQA 3QW3A 4DJFD 4LUTA 3PJWA 4MMWA 1K1DA 6PTDA 1IF2A 3BE7A 1L0PA 1PTDA 3CPRA 3TMQA 5D32A 4JYDA 3NPVA 1NQ6A 1TX0A 3QGKC 3T78A 3N1AA 3MZ2A 3VIOA 3IV3A 3NYZA 1SJDA 4RZ5A 3G0XA 3I6TA 3N73A 1G7VA 1BYBA 4JPGA 4EPDC 2JKAA 2IKHA 3CWNA 3O05A 3WD0A 5AYYA 5LXEA 2VEMA 4F0KA 1H3GA 4JTQA 1PZ3A 4S23A 6XIMA 4K6AA 4P8VA 3LQGA 3S5OA 1XBVA 3UWUA 1DXEA 2JE8A 1ISVA 4KEMA 3C2VA 3VNYA 3G1XA 3ZVIA 3ARTA 3QW4B 4MOZA 3M0IA 5T9BG 1IR1A 2V81A 1D8CA 3KVLA 1O95A 4M19A 4FNUA 1LRTA 3DUGA 3NO3A 2ZRWA 4ZTYA 4L6DA 4IP5A 2ZZ6A 3A47A 2CFFA 4FF5A 3CIVA 4GI6A 4RDVA 2PWGA 1IXQA 3WKZA 4UR7A 1MNSA 4FP1A 1VLIA 3N9SA 4MB3A 4HOZA 1Q2SA 4QEHA 3TTEA 2PDFA 1OX4A 1CEOA 1E9YB 3OEXA 3M0YA 3HV9A 4Q8WA 3AQUA 4KWOA 4TU1A 1SJBA 3CHCA 1QO5A 1VAHA 1KWGA 3EWUA 1H60A 2X0YA 3CAWA 1UBSA 2BY1A 1SSDA 1DXIA 1PL9A 3LA4A 1XBXA 2W9MA 1BLIA 1M01A 5LA1A 4PEKA 3FGCB 4CD8A 4KWSA 1WDRA 4YS1A 1LRQA 2WMGA 2VR2A 1QMLA 1SO4A 4C6QA 4PCSA 3CT7A 4PCNA 4QG6A 5ABFB 1TR1A 3O07A 4GD0A 1VF8A 4QDPA 1R3RA 2WSQA 1MEIA 4GX8A 2XFYA 4HN8A 5GJMA 3VVGA 3BJFA 1UASA 1B30A 3LLXA 4L6HA 5C5YA 4XZ9A 2DSUA 3H7VA 1W32A 3P61A 4GY0A 5U4NA 4EP8C 1TYGA 1EDQA 1PZ2A 1GW9A 3ECQA 4QDMA 5HULA 2VOTA 3LSBA 3KS5A 3L4VA 2JIWA 4LUSA 4DJEA 4A3UA 4KETA 1MO0A 3WLLA 2JALA 3NAVA 5F4WA 2BNJA 1ZBVA 1DIDA 3RRXA 3W7MA 4E38A 2R91A 1IEIA 2QAFA 3UR2A 4DI9A 1GQKA 2QJGA 2CXGA 1XGZA 4IGMA 5CJNA 4R3UA 4UQAA 3IACA 3TOPA 4JQ3A 2D2OA 4ATLA 2CC0A 5F2MA 2GJXB 3IIVA 1SW7A 1VFMA 4KS0A 5CC7A 4PUDA 3DDMA 2OO0A 1J10A 4QAWA 1E6SM 4HPJA 2Z25A 4E8GA 4OWGA 2VC7A 3OJGA 4PTXA 3E49A 2WQPA 4HA4A 4M51A 4CD5A 2VXNA 4UQEA 4ACZA 2GUYA 3R4IA 1TMHA 5IBXC 1WPCA 4TMCA 3VE9A 1PZ0A 1IE7C 1UOZA 2WC3A 4WXZA 2WCGA 1XLLA 2V6AA 3VNJA 4W9TA 4OBTA 4QNEA 3RAOA 3VABA 1A5KC 4KCUA 4CKQA 4JKLA 2VCCA 1H7NA 4IXHA 3ITVA 2VEIA 3EX3A 3P5ZA 4JOMA 3ZSTA 2X2YA 3W2JA 3ZJ8A 4BFAA 2Z7GA 3G3DA 2PDMA 4P7NA 5EMKA 3FX4A 3B8DA 4OUEA 1ZZMA 2P10A 3S6OA 4FZIA 1G4SA 4I8DA 3PM6A 1K6WA 2CZVA 4UFJA 1N8WA 5A6JA 1F4AA 4NNCA 2Q09A 3R6IA 1G6CA 3N2CA 4NASA 3ZLFA 1A3XA 9CGTA 4MB1A 4QE5A 3L4WA 1ECQA 2VWSA 1DJHA 5JXQA 3IJ8A 4ZSTA 1LORA 5EFFA 3NPXA 1BVZA 3EOUA 2PA6A 3MVTA 4E4PA 4OQVA 4OFCA 1VCFA 4JDYA 4HJFA 1VJSA 1BD0A 3VNKA 4IPPA 1HKWA 3M41A 4BR1A 3PG8A 1KLYA 4KIEA 2C1IA 4JHOA 3KUMA 5BXSA 3LX9A 3JZUA 2KZHA 4O54A 1MZRA 1UMLA 5AY7A 1A3HA 2A7NA 5DF0A 3CAKA 3KP1A 3P74A 1EZ2A 3EBVA 2GJNA 3TOYA 1XHGA 3EZ4A 4DUWA 3UR7A 2Z1WA 2ABAA 4AC7C 3VOCA 1BYDA 2P5NA 3T0TA 3HG3A 5LGXA 1S5TA 1ENUA 1WZAA 3RK8A 4D71A 1WO2A 3PZUA 3N13A 3W82A 5FOOA 1HGYA 2OT1A 1OG0A 2YYUA 3DAQA 4PMOA 4AZ5A 2WV8A 4I9AA 5JBEA 4GNKB 1HKKA 4OJYA 1EEPA 1CB2A 4J5NA 5AZ1A 1GOQA 1S46A 5J04A 3NCOA 1W1YA 4UCFA 3G1HA 4BK9A 3ES8A 1GVYA 3R8HA 1EA9C 1W1B1 3PG9A 3FDGA 3VGGA 2QPXA 3BQ5A 1FWEC 4ZEPA 2Z7KA 1ZFJA 3LERA 1Q6LA 4AD3A 3OLEA 1ODUA 2V5CA 5CPSA 4A05A 4CD6A 1W1IE 3LHTA 5HDRA 2VVSA 1PSCA 2IQTA 1BWLA 3AUJA 1V3JA 3MCNA 1QPQA 1WCGA 1UZ4A 4PMXA 2VGIA 4ZO8A 2QF7A 3KCLA 3GC4A 1YQ2A 3GHSA 1M04A 4IUOA 1OD0A 3AS2A 3VDBA 1ZNNA 3WQ5A 3QQ0A 1JYXA 1JD7A 3W1MA 4W5ZA 2YW4A 3W01A 2NZLA 4EE9A 3M7WA 2JEQA 2XN0A 1R3SA 1VR6A 4O17A 4U10A 4AZCA 2YB4A 1KQZA 5BXPA 2R94A 3LU2A 5I2UA 3M07A 3CHDA 5EKYA 1TQJA 1DVJA 3LZ3A 1N82A 2X8RA 4GABA 3LMZA 1EB3A 2ISSA 4HT3A 2LLEA 4S3KA 3H22A 3VAVA 5LIKX 2PTWA 1UP3A 3U2ZA 4MPKA 3WH8A 1XGDA 3FXYA 4LSBA 2YOCA 3QM3A 4Z2IA 4PC8A 4UTLA 1KFWA 3H7RA 4NILA 2ZICA 4Z08A 2I7GA 4P7RA 5G5IA 3U57A 2HXUA 3WMCA 1DJNA 1E40A 3AMDA 1Q6RA 3TEVA 3UERA 5JQ9A 3LCIA 3EA2A 1K6AA 3AS3A 5IHSA 2ISVA 3VDCA 4K39A 1VBUA 2C8NA 1UMYA 3L68A 1D7KA 1GJWA 3GNDA 1XLJA 5A5WA 3M0KA 4EAYA 4UR9A 4G56A 3C2EA 4PE8A 1LOQA 2W67A 4GC4A 5A6TC 1V0LA 4UTMA 3LD5A 3MT1A 1UZ1A 1W3NA 4Q4RA 1OFOA 3WL0A 3U2EA 1PZ1A 1FQ0A 1J8VA 3GBDA 1HJWA 3PB2A 4DXXA 1JCLA 2GVGA 3NQEA 1OC7A 3FJLA 3AHTA 4DZAA 5CZTA 4JTJA 1KA9F 1JQVA 3GM8A 3BAKA 4PTMA 2OOGA 2PWHA 2ZX8A 3F5JA 1KCXA 1SMAA 3LEPA 1E1CB 1IR2A 5D05A 1EGVA 4H7VA 1FDJA 4KERA 2OODA 4XX6A 2Z26A 3M0VA 2CITA 1UKQA 4CU8A 3A21A 4LYKA 4D72A 3O0FA 1R3TA 3LRLA 3BGJA 1V8EA 5AYZA 5JMUA 4AAJA 3LRMA 1RCQA 4MM1A 2WC7A 4OT7A 2QGHA 3WQGA 3WMLA 1LJYA 4JTSA 1RLCL 1SM9A 3MI6A 2Y7FA 3UCCA 2OQLA 1GPWA 1EH9A 4NRSA 2OU4A 2W0UA 3TTYA 4O14A 2QUVA 1OC5A 5HPCA 5TD4A 2J77A 3KRUA 3TYBA 4O1EA 2O9PA 4WDUA 2ZIDA 3R13A 1TRIA 2EKGA 3A4JA 1TELA 1UP0A 1ELSA 4KMQA 4G2DA 3S46A 3PNZA 2AQVA 1S3TC 3EXRA 3H21A 1BRLA 3ZZ1A 1Y65A 1MXGA 3UA4A 3GUWA 3VGFA 5DANA 3KLKA 1TUFA 4BI6A 4JNMA 1E0UA 4LC8A 1YDNA 4WF7A 3ARZA 3MUCA 1UR0A 4JFTA 1QPRA 3BO9A 3NEVA 3DIPA 2A21A 4F8XA 4IFOA 2RDTA 4ZBCA 4BKNA 2J9YA 2HJPA 4S3AA 4D8LA 1MQQA 4GVFA 1X6NA 5K3VA 2CLHA 1ONWA 2XU2A 3W7PA 3BV7A 3QF0A 2CBIA 4KWVA 4Q4PA 1FWIC 5FACA 3N4AA 1G67A 1BXBA 3IIZA 3HGSA 4B3ZA 3FHAA 4ZXLA 2FPYA 3AMCA 2F2HA 1XR2A 2J9XA 2ZA2A 4B9ZA 4HZMA 3WUGA 3DU0A 4RLIA 3WN6A 4F2UA 3CQIA 4LVBA 3TSBA 2OQYA 1LDCA 2WNWA 4HU3A 3TZNA 2GK1B 1TE6A 5AYBA 2EKCA 1DL3A 4F0SA 3GK0A 4L4MA 5K9XA 4DRSA 4PA8A 2QAPA 3W1QA 3WLRA 3GHUA 3GVGA 3AZSA 2DVXA 2V2DA 1H0IA 1QVBA 3MKCA 5XIAA 1QTWA 2YX0A 2PDLA 3RMEA 5A6LA 4MAZA 1J93A 4AXKA 4UOZA 3UPWA 5A95A 5E6YA 3GIYA 2VFEA 5DCEA 4XZBA 4DNMA 5REQB 1QOPA 4H6QA 1MI3A 4R27A 1K4HA 2Q8ZA 3WLOA 4AEFA 1XX1A 4QLKA 4GI4A 2G3JA 4GYJA 3H2OA 1M7JA 3OZPA 3SY5A 6A3HA 3K4AA 4S1FA 2EPMX 1ZAHA 1LT7A 1W91A 3OHIA 3VUPA 1TB3A 2QT3A 5E6ZA 1I6NA 1MW2A 2BZNA 3F4CA 2PZNA 9XIAA 3BDKA 4QR6A 3SCPA 3LCLA 3HPZA 3TSMA 2P1FA 3ZMRA 5K2ZA 5HWMA 2B31A 1ZY9A 3VO0A 1Q6CA 1UR1A 4DQWA 4BS0A 1UHVA 2JIEA 4N42A 5HK4A 3UETA 2QIWA 1VIWA 3OG2A 2PDWA 1QNPA 1UD5A 1JYWA 1S1PA 4DJDA 2DH3A 3HPAA 2ZX6A 2W79A 1KR1A 1R47A 2X05A 2ANUA 2XINA 3WBWA 4FX7A 3C52A 1XJBA 4K8GA 2Z1XA 1ZSXA 4BQ5A 4Y96A 3FVDA 3ZLGA 3Q65A 4AZIA 1US2A 2AGTA 8A3HA 3MMUA 3AMLA 4ZR8A 1Q85A 4LNCA 3O1NA 5HNRA 1IEWA 1NQKA 4H4IA 3MYOA 3EX4A 4IMAA 1UZDA 2WVSA 1V03A 1UH4A 1E72M 4EACA 1UBPC 2NX9A 4H6EA 1GOOA 3GXFA 2VELA 3RLGA 1K9FA 3VCRA 2OELA 1HFBA 3SQLA 2V5JA 3N3TA 1VCGA 3M43A 3EOSA 2YA0A 3ZQ9A 1W3JA 4NZCA 1QI5A 3WH5A 1VPXA 5J5DA 2PODA 1XFBA 3EWBX 2ZC1A 1XCFA 4QAIA 2A3LA 3SGGA 2Y5EA 4MJ2A 2JQXA 3U4FA 4WZHA 4PMRA 5HNNA 4JX4A 2DEPA 1H5YA 2HVNA 4GNJA 1I45A 3OZYA 5A2CA 2Z1KA 1JRCA 1K7XA 2VR5A 3N9RA 1POJA 1MFVA 5G1TA 4F9DA 1FY6A 1UA3A 5FJPA 2PP0A 4JTDA 2G96A 3W72A 1EHNA 1ZALA 4IPNB 2D22A 1W3IA 1LZOA 3ZT5A 5FL0A 1QK2A 3MDUA 2CWXA 3QSRA 3MP4A 4CEXC 3EXSA 4WY0B 3ZVHB 1JFHA 1V3HA 2XDFA 3MJMA 3TZFA 4AIUA 4NAEA 1M65A 2H9AB 4RW3A 5TIMA 5C9WA 3LDVA 3ARQA 4H8NA 1SVDA 2P3ZA 3P5YA 3CWOX 1LUCB 2P88A 3AIRA 2EPOA 3IAPA 4ZTXA 1B3XA 2X0HA 3L4ZA 2BXYA 2OFJA 4GYFA 4XAPA 1KR0A 3VFLA 4FLQA 5HQEA 4OV9A 4B5NA 5HWNA 2WVTA 5I3JA 5EL1A 2Y2WA 2BG5A 1RCOB 4YVXA 4KWWA 1UR4A 4PTVA 3KZPA 2GGIA 3HPFA 3LPGA 3KL0A 4LXFA 2VFGA 2WNZA 4OUIA 4WKHA 4F2TA 4I5XA 1ISYA 2FGZA 3P93A 3EPMA 1FWGC 2PURA 3T6CA 5CPLA 2ZXQA 4PB3A 1IEQA 1U83A 1B54A 1P43A 4N2YA 4PL2A 4PRRA 3NZRA 3ABQA 4US6A 3R89A 4TTUA 3B9AA 5DT7A 1R2TA 3U2CA 5I3HA 3GU1A 2J7EA 3A3XA 1CX9A 1J9YA 1KBLA 3AYRA 1XUUA 2IMRA 1JZ4A 3UQNA 1Q5MA 5IDZA 2VGGA 2UZ9A 2OSYA 1JGIA 4O57A 1TWDA 5I77A 3STCA 1Q13A 2HE5A 3TYUA 5DXYA 1B3OA 1TIMA 5AHFA 1RAKA 3LM7A 4Q8VA 2PGRA 4WLCA 1U2YA 1RBOB 1UR2A 2Y8UA 4CUCA 1U5HA 3A5FA 2X1UA 2FZ9A 4AW7A 2JF7A 1FFQA 5HPOA 3J7HA 2Q02A 4TVDA 1T40A 2E6AA 5HNTA 1IHIA 4KESA 4LUJA 7TAAA 4YCPA 1REQA 1XDLA 2ZVIA 1P6BA 2DQXA 1E9ZB 2BVTA 3FCPA 3SAZA 8XIAA 1NDWA 4G7EA 4KCVA 4Z2GA 4LYPA 3HURA 3CUIA 1YXCA 4AB4A 4BHYA 2NT0A 5CH9A 3EB4A 3GC2A 3W81A 1BKHA 3W26A 2WMIB 2YL6A 2FB3A 1J0IA 4K1GA 3FDKA 4C90A 3W7GA 4D6EA 4DWDA 4IFKA 1FWDC 4KH2A 3IJIA 3SN0A 1E5JA 3ARYA 4JIQA 2GZXA 3BSMA 2XN2A 4YHGA 2ACSA 3GVRA 3TVAA 3HBLA 5F2IA 4PEEA 2OYLA 3E0FA 2AOSA 1GZ1A 2KX9A 4J3VA 1F74A 2E9LA 3FIGA 4IZGA 3ZLHA 5A1AA 4PZVA 3N2BA 3M0MA 2BHUA 4K7YA 1BG4A 1ZGDA 4DO7A 3V7PA 3P80A 4BA0A 1SJCA 2DT1A 1W8SA 1ITQA 2GPTA 2NV1A 3QPYA 4PMYA 1NOWA 5MF5A 1HP5A 2AKMA 1FXPA 3IS4A 3F2DA 3SCWA 4DO4A 2PZ0A 3MU7A 2NX1A 3E0WA 1U5JA 3L4TA 4TXEA 3P67A 3S47A 2V0TA 4AZGA 4YVPA 1C9DA 3TC3A 2HBXA 4ACZB 1AMYA 2BGSA 4PSPA 4A3QA 3OW1A 5LGZA 4DAIA 4U28A 3BGAA 3IIOA 4MB4A 3LCFA 3ONBA 3DEQA 2YBVA 2GQ3A 1YMYA 2ZX7A 4MY9A 3MSRA 4PTNA 2OLSA 3RR1A 1TA3B 1XLMA 3W53A 4LEQA 1IXOA 1EJRC 3N12A 4TVUA 4MGGA 2EPHA 4FPSA 1AA1B 2J6XA 2VEGA 3TAKA 2JEPA 1B3VA 1YPIA 3OVPA 3WEOA 1HL9A 4DF1A 3H2AA 3VC5A 1OFBA 1V6UA 4A22A 3LN3A 3NOYA 3B0YA 1HL8A 2TPSA 2XVNA 4EANA 3M0LA 1L6YA 3W3OA 2HS8A 1VFOA 2FJUB 3EWZA 1I1XA 2ACRA 1WDPA 4JCLA 2X16A 2PP1A 3RGTA 3GUGA 1I2OA 4ACYA 2DUZA 3PPHA 4DJDC 3VE7A 3VGBA 1W5PA 5LNWA 3GTIA 3EXTA 1FCVA 4V33A 3N11A 2ZOXA 2IPFA 4DM1A 2DZBA 5MKGA 1QI0A 1EIBA 3EKGA 4XZHA 3DFQA 5F4SA 1OADA 3ZWSA 4YTUA 5CPOA 4IPIA 1NDYA 1AQHA 4JQAA 1CXFA 1QPNA 2CPUA 4PFMA 3GVWA 3NDYA 4GO8A 1E6PA 3EMCA 1OK6A 3PPGA 3KCOA 1GZGA 1YBQB 4HK7A 2JFEX 3WBEA 3QTGA 4PUMA 5A2AA 3FNDA 1SZGA 2F6XA 3B8IA 3W24A 4C91A 1TVLA 4G7FA 4F9JA 1NARA 1Q66A 3HFYA 2Y7DA 3HPXA 3R43A 4RNIA 1O5KA 2E6FA 4LF2A 3GRIA 4EF8A 3BARA 5BZAA 3REQB 2R9RA 1RJQA 2A7PA 2QXWA 5IM51 2VRJA 4N02A 1W1A1 1VBJA 3H55A 3L12A 2A2IA 1GEQA 4REQA 1GZJA 1M03A 1S5WA 4HCDA 1O66A 3CPGA 1TG7A 3KL5A 4QJ5B 3SUSA 1V77A 1DHPA 3I3DA 1K9DA 3SCUA 5AN7A 4L9YA 2HQAA 4EPEC 4I6VA 1WDQA 2B4GA 2CLOA 8CGTA 2I9UA 2XIOA 1QOXA 1TV2A 1XBYA 1V0NA 1JYNA 1X38A 2AL2A 1WOBA 4PMUA 4XBSA 1ZHAA 3CL8A 2VC9A 2XGIA 3B40A 2DVUA 4Y9AA 3LLFA 2CLIA 3A64A 4GIRA 2PFHA 1VKFA 2CHOA 2XWEA 4AEOA 1EHAA 2DJXA 3CV2A 3DKLA 4PUKA 4MY1A 1EO5A 4NZ1A 2QGYA 5CKSA 1S38A 3QR3A 3THUA 2F8QA 2WCSA 1HUVA 1VZWA 4Q3MA 3VZZA 4K68A 3G6LA 5BMWA 1JZ3A 3WDRA 1I2RA 3QOKA 5HMSA 2E4TA 3N29A 3NQAA 1NEYA 2GWGA 1I2QA 2YIHA 3NPWA 2F7FA 1BWKA 4B5SA 1ITCA 3TFXA 1GHSA 2XZ7A 3MJYA 4EPKA 4Z1BA 4Z0SA 3UG5A 2DP3A 2Z27A 3CL6A 3G0SA 4FALA 3WH7A 1G4TA 5D04C 2IXUA 2VR4A 4H8VA 1N8IA 4AD5A 1ZAIA 2VYOA 2XGZA 3L4XA 3CHEA 3BSGA 5HJXA 2Y8VA 2GGEA 1CLVA 1JZ7A 4MIMA 3WF2A 2ZDSA 2MANA 1S2UA 1MEWA 3STEA 1PHQA 3N04A 2WLYA 2J7GA 3HQ1A 2XM2A 5AC7A 4N0RA 1K7EA 4DNHA 2FH6A 2C3ZA 1XIMA 1N8FA 4E2DA 5EYWA 4U5KA 3UEQA 4JYEA 3U0HA 2QMJA 2X2GA 4Y8FA 3JU2A 3HM7A 1F07A 3IIXA 2GDVA 3OO2A 3UXKA 5LSMA 3C3UA 1PEZA 4S3EA 5TQLA 4URIA 5I78A 4UOJA 3U9IA 2J9ZA 2PDJA 3MUXA 1EP3A 1RK6A 5FJUA 5AHEA 2FZNA 3V5CA 4POCA 1HXJA 2KAUC 2VEKA 3S9IA 1FWRA 4DELA 1AW2A 5DELA 4AD1A 4Q8OA 4UMAA 1VRXA 2OG9A 3EDFA 4CQ9A 2REQA 1BXNA 3OLIA 3L4UA 4FO4A 2VX6A 2WBGA 5FJRA 3NL3A 4QCFA 2DDXA 1BRLB 2FZDA 3OZOA 3MV01 4JXCA 3WUEA 3S5YA 2I56A 2FVMA 3VX0A 3NNTA 3AXXA 4AYSA 4JZ5A 4QJ4B 4MWAA 3QC3A 4ZFCA 4CCDA 2V82A 3ZOAA 1GKQA 4H41A 1VP5A 3HF3A 2PLCA 1RH9A 4R88A 1TTPA 4QLJA 4D8AA 3TR2A 3DI1A 3LB0A 3AS1A 1GVIA 3XIMA 3CIWA 1D7FA 3SURA 4FIQA 3NZ1A 2QCNA 3UP8A 2E25A 2PF0A 1YDOA 4GO9A 4B3KA 4LS2A 5FEWA 4C6MA 4M6PA 1Q6FA 3TJ4A 3CL7A 3N2MA 1QWGA 3N14A 3IANA 1EJUC 5EMYA 1ML1A 1KFCA 4XSMA 2JK2A 4IH3A 1W37A 3I10A 4XVEA 4AF0B 3LLDA 3NYDA 4WR3A 2YL9A 1PDZA 2Y7EA 1EFZA 1XSKA 4I5UA 4JTUA 3MUZ1 4J3UA 3O3RA 6CGTA 4ERGA 1E0WA 3BURA 1I2PA 1XRTA 1FCBA 4GQ0A 1JG9A 2QCCA 2ZBTA 3STFA 4PSRA 2XFWA 5TNVA 3RM9A 1TZZA 1KKRA 5BNKA 4AZ7A 3OBEA 4XBKA 5C9RA 4PTWA 2CIPA 3STGA 3WJXA 4NJGA 3NQVA 3NZGA 3GH4A 4EWND 5C2XA 4Y6GA 1JQXA 3KTCA 1HTIA 3S4TA 3OBAA 1E1FA 2V30A 4YWIA 3CMJA 3EX2A 4LFYA 4J3XA 4RDYA 2VQUA 1F9CA 1CGUA 2GUUA 1MYRA 1OYCA 1TSIA 3IGSA 2VZOA 4ZQPA 5HWJA 5CXPA 4U3AA 1ZBKA 4XTDA 4NX0A 1KCKA 3MKVA 3KWXA 4CU6A 4RW5A 3GTNA 2D2JA 2FDMA 1RQEA 3NQMA 1O6IA 3FAWA 1O12A 2POTA 4GG9A 3U5YA 4IQDA 3HIJA 1GTEA 4Y9MA 3BLPX 2HCVA 4A21A 1GW1A 1LLWA 3KEHA 1EC7A 4GVGA 4GLEA 3CAVA 4DYJA 3PANA 2YDSA 1UZHA 3QKZA 2PU1A 3QMTA 4UXDA 4X2RA 3WLJA 4QQUA 2YW3A 1F3TA 3MI3A 3BMWA 3G1SA 4HGXA 2BV9A 5BMXA 5C7VA 2OVLA 1RALA 5J5RA 4ICCX 3MQTA 2ZUUA 3FYYA 1OD8A 1HKVA 1XM3A 5HNUA 1FHDA 4AY8A 1WNOA 2WZIA 3PZQA 1UKTA 1W9DM 4LCSA 2W3ZA 2D73A 3VKKA 1N2VA 3ZJ6A 4R85A 1YEYA 1XXXA 4GI8A 2F6KA 4I7UA 3JUGA 3AU6A 4NF7A 1XIGA 4KEVA 1DKWA 2ZKMX 3BG9A 2Y63A 5EGRA 2PTYA 2OYKA 4TVCA 3LRKA 3VNIA 2J25A 2PDQA 1MW1A 1Z7AA 1VQTA 3SFWA 1J96A 1LBLA 3M5VA 3R11A 3T40A 1T41A 4HSOA 2B7NA 3WUFA 1H62A 4LVDA 1J18A 4ALDA 3C61A 5IFTA 3WMBA 3BH4A 4LBRA 4N6FA 5B80A 5FJOA 2VFIA 3VMPA 4IJCA 4Z0JA 5LKYA 3GG8A 3WK1A 2VM8A 1E0VA 2P8CA 3G8RA 1MUMA 5HA7A 4QISA 5FCZA 3LV5A 1IWAA 5HMEA 2G37A 4BF5A 3A4AA 1E3ZA 3F4WA 2WHLA 2DZSA 1X97A 2ZC8A 4NJIA 2PDKA 3RJYA 3UGRA 4Z2KA 2QJIA 1TPFA 1VC4A 4ZL1A 2QJHA 4HPXA 5G1YA 2DSWA 4NI8A 2QUNA 4TX9A 1LQ2A 1EUAA 1LOSA 1KM2A 1O60A 4MF4A 5AC5A 4Z2HA 4W93A 4NVTA 3KP0A 4C6OA 1MZHA 2NUXA 1UW9A 3SQSA 4UCGA 4GJJA 1R2RA 2DT3A 3A9IA 5LIYX 4TX8A 1EO7A 1N55A 3AROA 4GACA 3T42A 3TSDA 5BWAA 2ZDRA 1ZRQA 4UFIA 4LY8A 3V0UA 4HNLA 5KEZA 1M5WA 3HJEA 3CEUA 3K1DA 3UCDA 1W9VA 2ZX5A 3A22A 4TR9A 4F0RA 1DYSA 2NXIA 2HZGA 4I5RA 4QS6A 2IS7A 4FB7A 4RR4A 4XBJA 4J1OA 1HW6A 3WIJA 3F5LA 3QV8A 4L6OA 4XVDA 7PTDA 5IHRA 1KV5A 5CZJA 1KRCC 1QNOA 2EHHA 6REQB 3TWBA 4IX2A 4OTKA 2EQDA 3MKKA 4QG8A 4KCWA 2BTMA 2OEKA 3NTYA 4RXFA 5HINA 3RCNA 2CW6A 1ZPTA 4HNOA 4C5ZA 2PBOA 3CWHA 1QPOA 4BY3A 1QT1A 2A0NA 4CN1A 2QV4A 3DI0A 4JIIX 3TYCA 3W4RA 2BOEX 4UFHA 1GTHA 5F7UA 5HQMA 3GG1A 4IGSA 2QS8A 3QLDA 2ZRVA 1CLXA 4JTIA 4Q8QA 4AVOA 3GVVA 2ZUVA 3FN9A 2OPJA 3GTFA 1YIXA 3SW6A 2WVVB 3W2LA 1QRQA 3OVRA 2D24A 2VEFA 2V3EA 3VA8A 3T2OA 3GZAA 1K8YA 2J4GA 3P2VA 4K8HA 3UY7A 3QKEA 4GKTA 4MNKA 4X3ZA 4ZO9A 1FWSA 3MY9A 2ZA3A 3UWYA 4QXIA 2FTWA 1RR2A 3