2CLKA

Tryptophan synthase in complex with d-glyceraldehyde 3-phosphate (g3p)
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
267
structure length
267
Chain Sequence
MERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLAIIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGAENRGALPLHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Synthesis and Characterization of Allosteric Probes of Substrate Channeling in the Tryptophan Synthase Bienzyme Complex.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 101
structure length 267
sequence length 267
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2clkA00
4LC8A 3CC1A 4UXDA 4ZL1A 4HNTA 4JY8A 3RK8A 2V5BA 2ZA1A 3LCFA 5KSWA 4U4MA 4AF0B 1PIIA 8TIMA 2CLEA 3R5EA 2B7PA 2H3BA 1BKSA 1A5BA 4DEFA 1TQXA 3W71A 3W87A 4YWIA 4WZHA 3MJYA 3UWZA 1I2NA 1FQ0A 4RKAA 3GAYA 1K03A 4IMGA 3UWVA 1C29A 1Q6OA 3RLVA 4UTKA 2ATMA 5G2IA 4IOTA 2X16A 2ZYFA 4JTJA 3BLFA 3DGRA 3NQDA 2DORA 3TW6A 1TTIA 1GVOA 2B0MA 3N3MA 3PBVA 1JCLA 4LRTA 5AHFA 3NM3A 1W0MA 2C0AA 4JTKA 1XCFA 4TMBA 1LRQA 1S5WA 4XWUA 5DXXA 4A2SA 1AMKA 4UTMA 3BGGA 2PRLA 3HF3A 1TTQA 2CLOA 4R7JA 1DORA 1Z42A 4LOCA 1A5CA 3P5ZA 4LC6A 1KW1A 3EKZA 1ZFJA 3BO9A 4O28A 1Q3NA 4QSHA 5D30A 5FF2A 3TXZA 1K8XA 4IMEA 2CFFA 1A53A 2Z0IA 3ZR4A 4WD0A 4FB7A 4NVTA 5H2ZA 1J5TA 5AOUA 2YW4A 4MUZA 3W22A 3UZ5A 3LXBA 2YZRA 4FF7A 3KVKA 3R13A 3VFLA 5HINA 4O15A 4TO8A 3B06A 4JTUA 1H62A 3W1PA 1IIHA 4UTUA 3R12A 1XBYA 3W85A 4JYDA 2TYSA 1QDSA 1FBAA 1XDLA 2V2DA 2FB3A 3C2FA 3FYPA 3NNTA 1NF7A 1O95A 1PS9A 3LCGA 4X9SA 2J9YA 4OWGA 5FEWA 3QSTA 3TQ0A 3FIGA 3QFEA 4ONVA 1F73A 1OJXA 5T26A 2J9ZA 1JRBA 4LVFA 1KV5A 4O1CA 4ZQPA 3WK0A 2V30A 3LCIA 5G5IA 1AK5A 3O05A 2RDWA 5ABTA 3WJYA 1LTDA 4XTDA 1QWGA 5HUOA 3HG3A 1G4SA 4EF8A 3TSMA 3W7GA 3G24A 4UTHA 1EP3A 4Z1BA 4DO4A 2E5BA 2PRHA 2WNNA 1ZAHA 1SW7A 4KFPA 3C8FA 2DZXA 1XDMA 3IEBA 4FX8A 4GNJA 4O52A 5CPLA 1UBSA 2RKXA 3C0JA 5HUPA 4XKYA 3R8RA 2RFGA 4FNUA 4WUIA 4R53A 3W2JA 1A50A 1TPEA 1GTHA 1LOLA 4Y8FA 4O0ZA 4S1FA 5FF0A 1GYLA 3L2IA 4NNCA 3GKAA 3FEMA 2NUWA 2VEIA 2DZWA 1F05A 4UNKA 4GXMA 4Z08A 4RZ4A 4K6AA 1FDZA 2C13A 2CLFA 4CQ9A 1YDNA 4AWTA 4M7TA 3B04A 4O19A 4UMBA 5L6UA 4IWWA 3L5MA 2Q3OA 4K8HA 3OG3A 5HULA 3W73A 2YPIA 1W37A 3V1PA 3TUUA 1H1YA 1JQXA 1G6CA 1G4EA 3W7MA 1FCQA 5LNWA 2NX1A 2QCHA 1J2WA 4A21A 1U83A 2QUTA 1B4EA 3LCHA 1XL9A 5DN1A 3DFTA 3QQ0A 1RZMA 3QC3A 1YYAA 5AHMA 1GWJA 1LM1A 3W88A 4LS1A 2YXGA 1VLWA 2NXHA 4BFAA 4FEZA 3W2LA 1NF0A 4IX2A 1XBVA 3QEZA 5HNRA 4ADSA 2C18A 2P10A 3AJXA 3L5AA 1T8XA 4R34A 2PE4A 5TBOA 1QOPA 3ANYA 4XKYB 3LHZA 3PUDA 3QQ1A 3C2VA 4JS3A 1P4CA 3CTLA 2UV8G 3I68A 3O8AA 4FXSA 1H1ZA 3NPUA 1QOQA 2CZFA 3L67A 4YXGA 2JKEA 1X1OA 4I7UA 1RV8A 3NAVA 3EXTA 2ZA2A 2ZDRA 3S42A 3TMLA 3C52A 3TQVA 2OT1A 4E2BA 1TV8A 4FNSA 4LU0A 3NL2A 2ZRUA 2EPHA 4FHAA 4IPJA 1HFBA 3S1WA 4AWUA 1I2RA 4N9CA 3IV3A 4HIBA 5DCBA 3DFNA 3DH7A 1XI3A 4N4QA 1SZNA 1FWWA 3UY7A 1WA3A 4IMFA 1PL9A 2GVLA 2YSWA 3RF9A 2ZRVA 3NL5A 5KINA 2I9EA 3Q37A 3TFXA 1LDCA 4ZQRA 2A4AA 1MEHA 3HO8A 5KZDA 3P61A 3FS2A 2OX1A 3NQ2A 1DQXA 2W0UA 5KITA 3IRDA 2R14A 2WOQA 3IGSA 3STCA 1DVJA 3S8HA 1DJQA 1WXJA 5K2ZA 1SQ7A 1V7YA 4UFJA 1JRCA 4O1BA 2QR6A 3B4UA 4CCEA 3QF0A 1T0OA 5D2TA 2QCLA 4FNQA 2WNZA 4DELA 2QEZA 1KBIA 3LCLA 1LP6A 5LGXA 1NSJA 3A24A 3BK0A 2QDHA 1C9DA 4B5NA 4K38A 4OQVA 1YXYA 4MYXA 2FFCA 3TC6A 1QNVA 1VLIA 2Y7DA 3M47A 1QAPA 5LZLA 3QJAA 3NEVA 2YFNA 1I2OA 4PEKA 1FUYA 5TIMA 3W9ZA 2FJKA 2JK2A 2NXGA 3NO5A 5AFDA 4CNNA 1H7NA 4UFKA 1X6UA 4JX4A 4C1KA 4N9EA 1QPRA 1KFEA 1LRTA 3O63A 3KRZA 1ZHAA 4RXGA 1W3IA 4AHOA 3G1XA 1Q6QA 3TU9A 3P7YA 3F03K 2CZ5A 2DP3A 3C3NA 1RQHA 4XBSA 1Y0EA 1LZOA 1P1XA 1OABA 2J6XA 2F84A 3NQFA 3R89A 1S5TA 1LOSA 3S5ZA 4GUHA 3G1HA 1MEWA 3KX6A 3N2XA 4FX7A 1S3HA 5D2WA 1TPUA 3HIJA 4DBEA 4LVGA 3PB2A 3E0IA 4UFMA 3T55A 2X1UA 3I65A 2HS6A 3P5YA 2V81A 1OX5A 3GYEA 4TMCA 2A21A 3HGRA 4HKPA 1YPFA 2C6QA 4O16A 3S1VA 4DF2A 4WOQA 5I3JA 2ABBA 2VFIA 5LNSA 4JDYA 5EMUA 3O6DA 4XQ6A 3RNDA 1FCVA 5AHLA 3L9CA 4TIMA 3GB6A 3FA5A 4A29A 3UNDA 2J27A 6TIMA 1HUVA 2ZZ1A 2GQ9A 2VELA 3FOKA 1I8JA 1T99A 1LBMA 3W72A 1KFCA 1OK6A 3JR2A 1F6KA 2OJPA 4ZQOA 3Q94A 1DQWA 4MVAA 3C2EA 4N02A 2QAFA 3C4UA 2XN1A 3A5FA 3W7JA 3EWYA 1OFDA 3MO7A 4TX9A 1HL2A 1GTEA 1KLZA 2NZLA 4JGDA 1SR9A 4UUIA 4Z1CA 4DPPA 5EPDA 3G1FA 4O18A 3G1DA 1VZWA 4MKNA 3SW6A 2Z1BA 1N55A 4HSNA 3EX2A 2GQ8A 1GJPA 3TDFA 3P81A 3EWUA 4JTLA 3RMJA 1EX5A 4UFHA 1FX6A 3MI6A 5HWNA 3FJLA 3RFAA 2QCCA 2H8ZA 3QZEA 2Y7FA 1EA0A 1JQVA 4MIMA 2FLIA 3KVLA 2B7NA 4RZ5A 3W7IA 4XUGA 1ZAJA 5DCEA 2H6RA 4JICA 1TPWA 4JIQA 1O60A 2FDSA 3P84A 3H54A 3MI3A 4AF0A 5D33A 1I2PA 2YGYA 1W1ZA 4NJGA 5AN7A 4BR1A 4OV4A 3DKJA 3DFSA 4EOUA 1XKYA 3TFCA 1RPXA 3H53A 1F7BA 2GVGA 3S1XA 3HGOA 3NYZA 1IXQA 3PF3A 4DO5A 4Z0JA 4PCFA 5BOOA 3C56A 4Z0SA 2D73A 4O8RA 1GPWA 1U5JA 4LV9A 1GVFA 1K7XA 5D02A 4E38A 1VCVA 3LCWA 2Y85A 1D9EA 5EKYA 3G0XA 4N2YA 5K3VA 4ORIA 1TPC1 1W5MA 1LYXA 1KM4A 3LLDA 5U4NA 4BK9A 3GXNA 3BVJA 4O50A 2CW6A 1XUUA 4UTTA 2QF7A 3PBWA 1ZJIA 1XM3A 1EEPA 3W74A 1VCGA 5F2IA 1KV8A 3P8IA 4ZMGA 3W07A 1TPB1 5G1TA 1HO1A 3S0CA 4O17A 3GIYA 3THAA 3I7QA 4M6QA 2VXNA 2WSYA 1FXPA 4LT9A 4PA8A 5DXYA 3PG8A 1ZENA 4QNWA 2XFWA 4BI6A 4XTIA 4CNPA 3M44A 3MI2A 1R2SA 2BLEA 3KXQA 3N19B 2WPBA 2QAPA 1NVMA 1O5XA 2ALDA 1P0KA 2HSAA 1W5PA 4MLJA 4OHQA 3STGA 2V8ZA 3G1VA 4GRSA 3NR0A 3L5LA 2PCQA 3F1QA 3O16A 3ZFHA 1H61A 1LLZA 3DHDA 5FEXA 5D32A 4KFOA 3M5ZA 2QJIA 3P67A 5CG7A 2RDUA 4JTFA 2C19A 3NXFA 3TA6A 5LKYA 1RQEA 3N2MA 2A7PA 3PUOA 4NNBA 4MOZA 3C6CA 4CNOA 5G2WA 3W2UA 5FF7A 3GXPA 1M7PA 3BW4A 3OA3A 5CPNA 5FI8A 3MYPA 3GX9A 3W7LA 1W5QA 3TCEA 2VFHA 3UYCA 4LV4A 1Q45A 3G1AA 2C3ZA 1TV5A 3LHVA 3MWAA 3NVTA 3SSJA 2ZQ0A 5D05A 3QPYA 1JCJA 1OYAA 3W7DA 1I45A 3SGZA 1GVSA 3W75A 3W84A 1PCWA 1OX6A 5DELA 3TNOA 3ABRA 3IGXA 3TH6A 3IIOA 1GQNA 1IXNA 3SIZA 3IIXA 1OFQA 3W7NA 5I3GA 4NNAA 1SO3A 5C6MA 1LORA 4UFIA 5D2YA 2WJZA 3LERA 4YCOA 3NQCA 1KTBA 1OF6A 4OT7A 3FKRA 4CCDA 1GT8A 4H4IA 4QIUA 3GXTA 2IQTA 4RXFA 4WJEA 5A5WA 5DY3A 3S6DA 2W79A 3GZ3A 1ZAIA 5AC8A 3L68A 3QMSA 3SI9A 2W6RA 4O54A 2DJLA 1ICQA 4MYAA 1K3UA 4HNNA 1S5VA 4GBUA 3TMQA 1EUAA 1G7VA 1K8ZA 3SR7A 3DFOA 1TSIA 3MHUA 3PG9A 2P0OA 1OFPA 1FWTA 3KRSA 1NAL1 4DO6A 4UTTC 2WQPA 2RH9A 3UQNA 4LNYA 1LOQA 1X7FA 2A0NA 4ZVJA 2V9DA 4N6FA 3EEGA 3B0UX 3G3MA 1QFEA 5HR6A 1Z41A 1OX4B 3QRHA 3WFAA 5AYXA 3PSWA 3CU2A 5FEPA 2V2CA 4WY0F 1TPVA 1A5SA 2ZZ4A 3IVSA 1YTEA 3DFQA 5DLCA 3ZS4A 3KHJA 2RDTA 4IX0A 4A22A 2OT0A 3KOFA 2FIQA 4KFNA 2NLIA 4QJ1A 4ML9A 2GJLA 3Q2DA 4UTWA 3NQMA 1ICSA 4PFMA 3A21A 4CQ8A 1VQTA 3P82A 1ME7A 3NM1A 5D03A 4E0CA 5CSSA 4NX0A 5EA9A 3BLIA 5G2HA 5A8GA 2OMAA 2ZTKA 4MJMA 1UUOA 3MP4A 5LNVA 1GVRA 3PR2A 4HSOA 3TROA 3WJXA 2BWGA 3EB2A 5D37A 1IXOA 3W7KA 3L0GA 1OFBA 3HG5A 2NX9A 3S1UA 3DFPA 4EIVA 4IGHA 3W7CA 1G69A 3IVTA 4POCA 3GLCA 3L0NA 4GE8A 1HO4A 2YDAA 4CQAA 1H7OA 3P60A 3W7OA 3OEXA 3BW3A 1G7UA 1OFAA 4MY8A 4O12A 3MW7A 3TXVA 4QITA 4ORMA 4IQLA 3T44A 1H51A 4I7WA 4UMCA 4IMDA 3G8EA 3KAOA 3L66A 1OYCA 5CPOA 3NPXA 2V5LA 3SJ3A 2WKJA 5D38A 4M19A 5HQEA 1M6JA 2RHGA 4NXKA 3I6RA 3CT7A 3RU6A 2VC6A 4GUFA 3PS7A 1K7EA 2ISVA 3GR7A 1KA9F 4A2RA 3EX3A 4CCCA 4Z1AA 2XN2A 1GZGA 2G97A 1JJKA 1VHCA 5DBTA 1W8SA 5U7SA 3SFKA 1ZY9A 5KZEA 1I4NA 2GOUA 4AVFA 2Z2UA 2Z6IA 4IXHA 2VEMA 1DBTA 1P0NA 2QJGA 4AHQA 5CSRA 3W70A 1YDVA 3I7SA 1R46A 1D3GA 3SECA 1AW1A 3INPA 3I7RA 3LX9A 2ZBTA 4JTHA 4K8EA 4R33A 3O07A 1TO3A 4NQ1A 3OVQA 2ATSA 3WJWA 3K30A 4HPXA 5C54A 3A5VA 1XUZA 5HMSA 1ZCOA 4AB4A 2DZTA 2E09A 1SO6A 2H3DA 1KBJA 3EX6A 2X1TA 4BI7A 3FYOA 4WXYA 3E12A 1JCYA 3NPWA 3W83A 3T40A 3OIXA 3PBYA 2YYUA 2V2HA 1PHWA 1AW2A 2E6FA 1AW5A 2XN0A 4FIQA 2CWNA 3ABQA 4RLIA 4FX6M 4RJEA 3NA8A 4J9JA 5FEZA 2A5HA 3PUEA 3G8RA 1H7RA 3EX1A 3H55A 1TB3A 3B0PA 3CWNA 4UTWC 3W2MA 4GUGA 3UPWA 4AAJA 1ME8A 3C61A 4ADUA 5KMYA 3W6YA 3GNDA 1H7WA 3O6CA 4QQ3A 3DI1A 3W1AA 1FWRA 5FF4A 3S5YA 2DU2A 4O53A 2YCEA 4LS0A 4MFEA 3W76A 5F1VA 4IPIA 2JKPA 4O57A 3UY8A 2G5WA 3CM4A 1TRIA 3BPWA 1TJPA 4Z1DA 5G1YA 2TPSA 2QKFA 2Y7GA 3ATYA 2QUUA 4O10A 2FB2A 1OFEA 3M1ZA 3LV5A 1VCFA 2R94A 1ICPA 4LTSA 4I7VA 3TC7A 2VKZG 2AGKA 2FPTA 3MBDA 3UWYA 3UD6A 3NQ6A 5BW6A 2Y70A 1GOXA 3NQGA 4JD4A 3W86A 4GWEA 3KFTA 5IBXA 3F4NA 4FIRA 5DBUA 2E5CA 2X2GA 3W1QA 5F1UA 1SZEA 1SPQA 4KWWA 3S5NA 4QISA 3PY2A 1OFRA 5HWJA 3WJSA 1ALDA 2FTPA 1WV2A 3TJXA 1NFBA 1XBZA 4UC5A 1WQ5A 5I3FA 5BNKA 5F2GA 1DHPA 1EP2A 4MY9A 5K9CA 4JXCA 2B7OA 4EF9A 3LHUA 3M6YA 2ZZ5A 3LGEA 3M41A 5E93A 1UB3A 5TQLA 4RZ6A 5I3KA 3G3DA 5CZTA 2ZRYA 2KZHA 2TSYA 4QM1A 1LBLA 1XBXA 4UIOA 1W5NA 3T7VA 1OVDA 4WY0B 4KWVA 1FDJA 3CHVA 1H63A 5CZ0A 4UNLA 2BX7A 3LTSA 3QW4B 1KM6A 3TAOA 1VR6A 1EB3A 2Z6JA 2CLKA 1PCKA 5F4XA 3LRMA 5K7JA 3CEPA 4O0KA 3LCXA 2JGQA 1SZFA 4JTTA 3HMJG 3IVUA 2O7SA 2J9XA 3KVJA 4JEQA 1TPH1 3EWXA 2YFOA 4E2DA 1TIMA 1JUKA 3QMTA 4UR7A 4UMAA 4FNTA 2C15A 3HG2A 3LHYA 1WX0A 3E9AA 1H7XA 1O4UA 4FNRA 4DF1A 1JCNA 2OCZA 3SGUA 3S9YA 3F4WA 2C1HA 3IIPA 3STEA 5LHEA 3L0KA 4TU1A 1ME9A 3CIXA 1GEQA 3DBPA 2YX0A 4W9TA 3TIMA 4AEOA 4BWLA 1SO4A 3T4CA 1F74A 2QCGA 3M5VA 3TX9A 4MZ8A 3CLMA 5F2MA 4M6PA 4D2JA 3NQ7A 1OYBA 3UPBA 4O13A 3PWAA 1WOAA 3PB0A 4LUJA 3NL6A 1QPOA 2E1DA 3IIZA 4LS2A 3MMTA 1KFBA 3M7WA 3VI2A 3NQ8A 5D04C 1M5WA 3AO0A 2OZ0A 3S5OA 4JIPA 1SU5A 4LW7A 3M0ZA 1VPXA 3QM3A 3FLUA 3NZ1A 4HNUA 4GJ1A 1JUEA 2E5DA 2CLIA 5EY5A 4UCGA 3U6WA 3W2NA 2A85A 1RD5A 3GKFA 1Q6LA 5EBUA 3LV6A 3C2RA 3HPZA 1TCDA 1UJPA 1JVNA 4OV9A 1JCMP 3DENA 2V82A 4ZQMA 5G4EA 4M7SA 1PHQA 5IBXC 4GFSA 1K8YA 1THFD 2GUUA 1CX9A 1EPXA 1YADA 5F4WA 2NWSA 3UWQA 5HWMA 1QR7A 1VGAA 4PODA 3PBUA 3N14A 1PV8A 3TK7A 1CW2A 4GUJA 4LRSA 4O14A 4Y6GA 4AHPA 4O1DA 1UUMA 3BV4A 3EWZA 3HOJA 4S2CA 5AC6A 3NG3A 4Q4KA 1UASA 4JDBA 4DQWA 2ZZ3A 2EKCA 4OGZA 5SWUA 4ALDA 5CZJA 4YCPA 2CLLA 4K36A 5H91A 1KFJA 4JY9A 4IMCA 1XFBA 2F7FA 4RCXA 1KM5A 1W56A 3HJZA 2E77A 4PL2A 4WXZA 5AYYA 1QPNA 3LTYA 3OBKA 1ZNNA 2QJHA 4NJJA 2DZSA 3GVGA 1QO5A 4PH6A 1L9WA 2HTMA 1ML1A 4FO4A 3HPXA 3LTPA 1OHLA 2ZFAA 4ZQCA 1TTPA 4DF0A 3TSDA 1LRNA 2ISWA 3P62A 4NX5A 1TMHA 1KM0A 2VENA 5F2LA 4P2VA 1IGSA 2HMCA 5E0KA 4WX2A 3LHWA 3T78A 2DZVA 3LHTA 3G0SA 1DKWA 4JTGA 5CKSA 3GAKA 1OX4A 2CLMA 3SY5A 4ZQNA 4AMAA 4UFLA 2E6YA 3LRLA 1VJIA 1FY6A 1SO5A 2GVJA 3NZRA 4HHPA 3THQA 1TPDA 3N34A 1M7OA 4AWSA 3NL3A 1EIXA 3DHFA 2X1RA 3LI1A 4UTIA 2QCDB 3MP3A 3OVPA 3VCRA 1TTJA 3LXCA 5BMXA 1WAUA 3M43A 4BWLC 1RR2A 1MSSA 2DZPA 4RX0A 3PM6A 2QCFA 3DKLA 5D09A 2R91A 2JGYA 1AL7A 2NV2A 2ZRXA 1FDYA 1VS1A 4K37A 1VHNA 3BG5A 5CZSA 5K9DA 4NXSA 3TKFA 3LBMA 4JTEA 2VFFA 4H6KA 1TJRA 4S2BA 6ALDA 1BWLA 1O94A 3VE9A 4WOZA 1EP1A 4BF9A 1HTIA 3G18A 4Y9AA 3W7HA 3ATZA 2Y7EA 4NUWA 3GDLA 1PVNA 3U2OA 1OF8A 1YDOA 1YTKA 5J5DA 1DOSA 1R2TA 1DV7A 2ABAA 2WO5A 2FPVA 1MXSA 1FXQA 1J4EA 4O4WA 1EWEA 2BXVA 1R47A 2VEPA 1QMLA 3E02A 2BZNA 3O15A 1VH7A 2NUXA 1L6SA 3ZWSA 3G22A 4HNVA 2QDGA 2B7QA 3GK0A 1H50A 3DXIA 5AC7A 5C55A 1E51A 4AXKA 3DZ1A 2ZRWA 1MEIA 1W54A 1H5YA 3BLEA 1K02A 1N7KA 2G96A 3D0CA 3NQAA 3G1SA 1SW0A 3W23A 4O11A 1BWKA 4Q33A 2E68A 3MP5A 2Q8LA 5EL1A 2VFDA 1Z48A 1L6YA 1TRDA 4ADTA 1AG1O 4X22A 5I3HA 1A5AA 3PSVA 3GDRA 1KTCA 3W1UA 3M5XA 3TSBA 3UXDA 1L2UA 5LNUA 4LY8A 3LXAA 3CIWA 3HGSA 2VFEA 1LROA 4RV8A 4NZFA 1G4TA 4UR8A 4CLMA 4JX6A 4IUOA 4Y90A 1VYPX 3P80A 3E96A 4JX5A 4N9DA 5F4SA 1R2RA 4HN4A 2A7RA 2WSQA 1X8FA 4MZ1A 3LI0A 1Z44A 1KM2A 2TRSA 1SFJA 4A3UA 3L21A 4O4VA 4MLRA 2VFGA 2X1SA 1UCWA 3KVMA 3L65A 1JCXA 3N73A 1KTNA 4JTSA 1B57A 2NXIA 4ZZ9A 5HR7A 3HQ1A 4O1AA 3UXAA 1RVGA 3KRUA 3DAQA 3HBLA 2GJNA 2FPYA 3CWOX 1W5OA 2J88A 3B0VC 2Y88A 4MZYA 4JTIA 3RLUA 3EX4A 4MJZA 4YLWA 2GPTA 2ISSA 5G4WA 2V0TA 2EF9A 4JR5A 1F2JA 3W1LA 1KM1A 3BARA 3NGJA 2ZZ7A 3B8DA 3G0UA 4AH7A 3WK1A 1K7FA 2QCMA 4N6EA 2B4GA 2EGZA 1TREA 3O1NA 3E49A 1WOBA 4N4PA 1TPFA 4NJHA 3B03A 4FXRA 5BRBA 5LSMA 1GYNA 1YTDA 4QAIA 3OVRA 1O5KA 1LCOA 3JRKA 5KZMA 1D3HA 2Y62A 3UWWA 1TYGA 3FFSA 1FCBA 4K7YA 3ZWTA 2GQAA 4L4LA 3DU0A 5CGQA 3QPZA 4NZJA 3NOEA 4RR4A 2A6NA 2I14A 4NU7A 1YPIA 1ZALA 1SZGA 4PL1A 2WSRA 5E1QA 3UZJA 1MO0A 2BSLA 3VNDA 1SSDA 3LRKA 5D2XA 4LVAA 3TJLA 1YLVA 5BMWA 1GG1A 2A2IA 4YMZA 4RK8A 3EKLA 3UWUA 3IIVA 3BG9A 3WK2A 3QW3A 2NV1A 3TW7A 5L9FA 4G1KA 2WV8A 3W7EA 5C2XA 1W3NA 4GUIA 3W7RA 3MBFA 1WYIA 3W1RA 4LVDA 4LVBA 3YPIA 2A1YA 4I9AA 1W3TA 2LLEA 3LBCA 3U8GA 1R30A 4WY0A 3NPVA 2A7NA 1XXXA 3G1YA 2PURA 1JR1A 3IGUA 3M5YA 2QCNA 3OHIA 4QNEA 1H60A 4OU1A 3LB0A 1G4PA 4ICNA 2NUYA 3C2OA 3Q58A 5AHEA 3CPRA 2C14A 5AHIA 1V5XA 2DZUA 4LUIA 1KM3A 3VKJA 1ONRA 4PC8A 3O06A 1L6WA 3O6YX 4X3ZA 1IIGA 3PVFA 3LM7A 4FNPA 5K4ZA 4MY1A 3W3OA 1OG0A 2ZZ2A 1BTMA 3TAKA 3FJ6A 4Y96A 4N9BA 3B05A 3NQVA 3W1TA 3TV8A 1JULA 2QUVA 4M6VA 2YYTA 3M16A 5LGZA 3NDOA 3TQKA 3BW2A 3WJZA 1B3OA 1FWSA 5K9XA 3MHGA 5MHBA 2TMDA 4X2RA 1XC4A 1IXPA 3A23A 2CZDA 3W2KA 1F76A 1JUBA 7TIMA 4LWWA 4IJBA 2PC4A 1WDWA 4NJIA 1F5ZA 2NX3A 3QSRA 1X1ZA 5HJLA 2ZA3A 3QYQA 1SSGA 4K7VA 4BI5A 1VRDA 1YXDA 5DCDA 3EXSA 3W1MA 2ZZ6A 3MYOA 2I1OA 4JYEA 5K4XA 2AAMA 4OBTA 4C1LA 4MFDA 1OK4A 5D2VA 5J5RA 4XZ9A 3M9YA 4H3DA 1KFKA 3HG4A 3N9SA 1EWDA 4WQ6A 1VYRA 1C8VA 3CEUA 4UTLA 2Q3RA 1B4KA 1F6PA 5EYWA 3W7QA 1LBFA 2HS8A 3W1NA 1GVQA 2X30A 2G95A 1FWNA 5IM51 1TV7A 4M5PA 4K39A 3V75A 2E6AA 3GDKA 3JS3A 3STFA 2J24A 1MZHA 5I3IA 2VEKA 1YXCA 3A22A 1WBHA 3CQ0A 4Q32A 3SZ8A 2H8XA 2ZCGA 1FCUA 4EWND 5DY2A 1IF2A 5FF3A 2CU0A 2BTMA 2E6DA 1P5BA 1QPQA 3NQEA 3USBA 3BGJA 2R8WA 3CB8A 3GDTA 1SW3A 1DL3A 1HG3A 3EWWA 3ELFA 1CI1A 2P1FA 3GR8A 3MUXA 3HB9A 2Y63A 1N8FA 4MPQA 4HT3A 5LHFA 1EUNA 2ZTJA 3QH2A 1W31A 2O7QA 3HPSA 3FKKA 3GNNA 3DI0A 4NJKA 3P74A 4DXVA 3LDVA 2Y89A 3MHFA 3BG3A 2C16A 3QMRA 3VE7A 4L4MA 1SFLA 4HPJA 5CPMA 4YL2A 3ABOA 1VYSX 1DJNA 1VC4A 3LOTA 3W7PA 5C5YA 1TQJA 4P61A 1H7PA 1WBJA 4JNMA 1BEUA 1ADOA 3P8JA 1PE1A 2WNQA 5AYZA 2YW3A 4OE7A 4UTJA 2CLHA 2EHHA 1KLYA 1RQBA 1LLWA 4DBDA 3PC0A 2EAWA 1I2QA 3ABSA 2ZRZA 2NWRA 2Y61A 2Q8ZA 5KTLA 1G67A 4NT0A 1GG0A 5AHNA 2A6LA 5AB3A 2Y6ZA 3R2GA 2PRMA 2VOMA 1QO2A 3EXRA 1OFOA 2FQIA 5FESA 1B9BA 1SUXA 2DJXA 3LLFA 4KKXA 4DPQA 1KFLA 3EWBX 3GDMA 3W1XA 4TR9A 1Q6RA 1AL8A 2H90A 2CZEA 4EVZA 2AQWA 2QCDA 3PULA 3TR2A 2JKAA 4JYFA 3PAJA 4XBKA 3WK3A 1T96A 4JN6A 5GVJA 1NEYA 3HGJA 2YR1A 4GC4A 3A9IA 3N9RA 1QCWA 3TE9A 4U28A 2QCEA 5LNRA 2JBMA 4IXXA 4PTNA
chains in the Genus database with same CATH superfamily
3CC1A 3FGCB 3SRKA 3RK8A 2GGEA 3M0MA 3CPUA 3M64A 5KSWA 3NQBA 3L4WA 5FSEC 2EPLX 3FYYA 5EBAA 2YCLA 1V6XA 8TIMA 4M1RA 2XTKA 2BXYA 2BY2A 3ZT5A 4WZHA 4GIRA 4IMGA 1IQ8A 4XSLA 4WGXA 4Q4QA 2Y5SA 2HZGA 4YTQA 3LYEA 1C7TA 3W6LA 3BLFA 3DGRA 2HE8A 1GVOA 2B0MA 4JTKA 1XCFA 4TMBA 5DXXA 2XJ7A 4JIHA 1TTQA 4C6MA 1S38A 1Z42A 1A5CA 4LC6A 2YXXA 5GNXA 4IMEA 3W25A 2CFFA 1QVBA 2VRQA 3IK4A 5I02A 2XIIA 3I3DA 4WD0A 4FB7A 3AU6A 2X0HA 2YW4A 2Z27A 1OZQA 4CQCA 2WZHA 5FCZA 2YZRA 1GEHA 3KVKA 3R13A 4W7VA 4JTUA 1H62A 1XC6A 2BVTA 3W1PA 2FZ9A 3IV8A 5IDZA 3QY6A 5JU6A 3EPNA 3RG6A 4IFKA 1FBAA 2V2DA 3WLKX 4DUOA 3UETA 3FYPA 1UR3M 3NCOA 2ZDSA 1FWBC 1NF7A 3QTGA 3LCGA 4X9SA 3E0VA 3EOSA 3DESA 4MWAD 4OWGA 3MUY1 1HNYA 1E6NA 1F73A 1JPHA 4P7QA 5T26A 1JRBA 4KWUA 1KV5A 4LF1A 3PTKA 3B3DA 3EMZA 1VBHA 4DZHA 1CGUA 1R9ZA 5ABTA 1TX2A 1AVAA 4R88A 3HG3A 4EF8A 2VCCA 5A69A 1TZZA 5I09A 1KCXA 1NOWA 1EP3A 3IJQA 2AAAA 1BSIA 3AHZA 2BOFX 4O52A 4ZB2A 2QMKA 1Y65A 2OLSA 3CZJA 2QMJA 3R8RA 2PGRA 4H8UA 3KBJA 4JQ1A 4R53A 3W2JA 5CC6A 2VMFA 1GTHA 2IKGA 3CZKA 4DXKA 2FKPA 1GYLA 4NNCA 3FEMA 2NUWA 2V5DA 4FR6A 1WP6A 3IJLA 1H2JA 1FDZA 3TOPA 4CQ9A 4AWTA 4O19A 4IWWA 3CMGA 1LQ0A 1NWSA 2VURA 5HULA 2YPIA 1W37A 3N2CA 4QBXA 5FKYA 3L4XA 1EJWC 1J2WA 4OOZA 4RW5A 3WZ0E 2WZMA 1L8PA 1W2VA 2J62A 1RZMA 4L1XA 1UZ4A 5AHMA 1Q8JA 2VX6A 3MB9A 1VLWA 2X7WA 3M6DA 1DTNA 4PCPA 2OSWA 5HNRA 1JFXA 1EC9A 3ZM8A 2PE4A 1YPXA 4A8LA 3LHZA 4E4FA 1DWJM 3QQ1A 5I6SA 2XUCA 5A8MA 1RBAA 3C2VA 3MTWA 1P4CA 3CTLA 2DVUA 3I68A 4FXSA 2NQHA 1FA2A 4V27A 4DM1A 3L67A 5M2FX 3R25A 1RV8A 2I9UA 2ZDRA 3OLDA 1K6WA 3S42A 4BF5A 1YW1A 1B30A 3MQTA 1QHOA 4LU0A 2Z1KA 2ZRUA 3GD6A 3DBNA 4IPJA 1WUEA 5M3WA 3MVIA 3V0UA 3LM3A 5DCBA 4YWSA 3DFNA 3DH7A 1FWWA 2A3AA 4IMFA 1MDRA 3RF9A 4XZNX 1RJPA 3II1A 3BZJA 3HO8A 1FHLA 5KZDA 3VDCA 2WCGA 4KRTA 2W0UA 4MB4A 3IRDA 1DVJA 3S8HA 3DIPA 3GVVA 5A2AA 2QR6A 1T0OA 1A3XA 2QCLA 2XIMA 1RLDA 1TVNA 1XINA 4CNUA 4AZ5A 3BK0A 2HVNA 1UR9A 4B5NA 3M0HA 3TC6A 3RIKA 1QNVA 3BAKA 3M47A 4HOWA 1CGYA 3T2OA 3QJAA 2YFNA 1I2OA 4PEKA 4I5XA 1FOBA 4GH1A 5CGTA 1SJDA 1XS2A 4UFKA 4DBWA 1X6UA 1CXLA 1VEMA 4C1KA 4N9EA 4RNFA 1KFEA 3GRIA 3KRZA 4D6DA 1W3IA 3G1XA 1KWKA 2CZ5A 2VEGA 1RQHA 4XBSA 1LZOA 1P1XA 4AG0A 1KNWA 5E9AA 3S5ZA 1S5TA 4EE9A 4QE1A 1XYFA 2GUYA 3G1HA 3WNKA 5D2WA 5M17A 4ERIA 4MWAC 5C9RA 3HIJA 5BOEA 2R24A 1HIZA 4GI6A 5FIPA 1Q2RA 3TWAA 5E70A 3WQFA 4H9XA 2XPKA 3HGRA 4YNGA 3LG3A 3OG2A 3RX2A 4Q8VA 4PUWA 1YPFA 4WOQA 4XIMA 3S9ZA 2CXEA 5LNSA 4C6DA 2CBIA 3O6DA 3RNDA 4RE3A 3UZXA 3GB6A 1KRBC 1P43A 3RHGA 1I8JA 1LBMA 1JCTA 4OBRA 1PTGA 4M80A 1CLKA 2OO6A 3JR2A 1JD9A 1S39A 3UNTA 3O3RA 2OEJA 2QNEA 5IOBA 3C2EA 3L2MA 3MZNA 4QCFA 2IQ0A 3R79A 4XAZA 3C4UA 4PMVA 3MSGA 1HL2A 2NZLA 4A8NA 4UUIA 4WJXA 5EPDA 1W1VA 4AVNA 1HJSA 3G1DA 1VZWA 1YE4A 3SW6A 1N55A 5I2UA 3C8NA 4HSNA 1JNEA 4DYEA 3EX2A 3FSTA 4A05A 3BLDA 1R86A 1GJPA 2G50A 4JTLA 3WD3A 1FX6A 5HWNA 3RFAA 3ZLFA 3CASA 3NIYA 4MIMA 5LIYX 3F4VA 2B7NA 3VKBA 5DCEA 1R3YA 3J7HA 3OBAA 3O6AA 3C0SA 1XYCA 3GUWA 1S2AA 2P8CA 4KESA 3DDMA 3QGKC 4C6NA 2IS7A 4NJGA 3DKJA 1ADDA 3H53A 1ZGDA 3GFXA 1QNRA 1CIUA 4LALA 3K5XA 2BGQA 3PF3A 1M7JA 3E5PA 1IGWA 1W6TA 1GPWA 3U4FA 4R9XA 4LX4A 2RGLA 2QVHA 3RRXA 4E38A 5A6BD 3MV11 2Y85A 4NP7A 4D8ZA 3MZ2A 1GVEA 3H4XA 1EA9C 1LYXA 4BY3A 4GY1A 3BVJA 3EPMA 2AL2A 4UTTA 5EMJA 5LIKX 2BNJA 1ZJIA 4JTAA 5C7VA 2ZXQA 3S2NA 1DJZA 2DFAA 1KV8A 5ABFA 4ZMGA 5HANA 5TF0A 1GNXA 2XSBA 1HO1A 3GIYA 1YRRA 2ON3A 4M6QA 1FXPA 1E4NA 2QXWA 3WD1A 2XFWA 4CNPA 4N42A 2YXOA 2BLEA 1IEXA 1M65A 5C0QA 4M0XA 3AIQA 1NQKA 5I00A 1W5PA 4K2SA 4MLJA 1JDAA 3VZYA 3ARQA 5TNVA 3ABZA 3ZFHA 1H61A 1LLZA 4NYYA 2DSZA 3DFYA 3H24A 3V5CA 3N29A 1NP2A 1JNDA 1PDZA 5M1TA 2HE5A 3NXFA 3TA6A 4LYPA 1RQEA 3PUOA 2A7PA 3C6CA 4UNIA 3W2UA 3APTA 1M7PA 3BW4A 3LPPA 3TCEA 1ECEA 1XV8A 2YJQA 1V6UA 1Q45A 5EFDA 2QJMA 4IP5A 1TV5A 4PTXA 1JCJA 3CV2A 1OYAA 1I45A 3SGZA 1GVSA 1PCWA 3QLDA 4O0QA 1EGMA 3PWGA 3IIXA 3SIZA 5GQBA 5BXTA 2JF7A 3WLQA 4UFIA 4RE4A 3PP7A 4BHYA 4YCOA 2PF0A 2O9TA 4OT7A 1GT8A 4H4IA 5C8BB 4RXFA 1AFSA 1C8XA 1HGYA 1P0BA 4F48A 4F0KA 2FH8A 1E5JA 1QXLA 3AZTA 2WMHA 3GZ3A 5BCAA 1PXGA 3WDJA 1J2BA 3QMSA 3CZLA 2VR4A 4LQ1A 2DJLA 4TVDA 4GO9A 4HNNA 1S5VA 1T41A 4GBUA 3LPGA 1YIXA 3AXKA 3LPOA 1OFPA 1FWTA 4U3CA 3AMCA 3IJ7A 2RH9A 5CJNA 4LNYA 4GY7A 1X7FA 2A0NA 4N6FA 3WFZA 3EEGA 3RU8X 5HR6A 1KBBA 1FWJC 4B4FA 3M0VA 1XLGA 1ZUAX 4IX0A 5HPOA 3DN5A 2GJLA 4C6FA 1G9HA 1KRMA 1TV3A 1TJ2A 3NQMA 4Q8TA 4PFMA 1R0MA 2PGWA 3S9IA 2PBGA 3NM1A 4H8HA 1ZS2A 4RPPA 3GY1A 3D46A 3N17A 3ITXA 3BLIA 4L9YA 3ES8A 2ZTKA 1VBRA 3BE7A 2C7FA 2GFTA 3MP4A 1GVRA 1KXHA 3LK6A 4JCLA 1UWRA 3TROA 1A0EA 3TW9A 3QKZA 3OP2A 3EB2A 4JAWA 3L0GA 3UU0A 2A3LA 4HOXA 1TWDA 2PLJA 3JU2A 1IYXA 4AX7A 4POCA 2CEQA 3GLCA 3L0NA 1B3VA 2HK1A 1A3WA 2WCAA 3EOEA 3P60A 3JZEA 1G7UA 3L7RA 4LUSB 3ZXWA 3QHNA 4MY8A 4QITA 1HN1A 2FZMA 4GQBA 1UPPA 3OQEA 4EKJA 1AH3A 4BA0A 2QGYA 3URAA 1XIGA 2WKJA 5D38A 1E5NA 2Z29A 1M6JA 1XQKA 3GR7A 3WELA 6TAAA 3EX3A 2INEA 4CCCA 4NRRA 1E9ZB 3OLEA 3VDHA 1FP9A 5CBIA 1T7LA 5DBTA 3HQPA 2WM0A 3D5HA 4XAGA 1JL8A 3T9PA 2GOUA 2Z2UA 4IXHA 3O0FA 4C6PA 2QJGA 2A3CA 3KBVA 1R46A 2BY3A 1OINA 2XG9A 1AW1A 1WB0A 3I7RA 1KO0A 3AYTA 1NDYA 1HJVA 1EIBA 2YA1A 2G8ZA 3O07A 4ZENA 2XVLA 2A3HA 4W87A 5C54A 2HISA 2H3DA 1OC6A 1KBJA 3KWSA 3EX6A 2YLAA 3SCPA 3RCMA 3FYOA 4JTDA 3ME3A 3CUIA 4G6CA 3NUKA 3E12A 3NPWA 3WBEA 1KXTA 4L9XA 2YYUA 1AQFA 3EMCA 3TTYA 5HK4A 1ZCCA 2W67A 4D9PA 2X0YA 3ZR5A 4GQ0A 4GVFA 3G8RA 1GKQA 3B0PA 4GUGA 4AAJA 1ME8A 2ZX9A 5CLWA 3CLWA 5XIMA 3T0BA 1H7WA 1LJYA 3TLQA 2EPKX 1ZQ5A 1MZRA 4O1EA 3S5YA 5HNTA 4O53A 5JUVA 3TYUA 3VNLA 4FXFA 2JKPA 4IPIA 4O57A 2G5WA 4AIUA 3CM4A 2R1PA 4XUYA 4Z1DA 1XG3A 2OEMA 4IPLA 4HBKA 2R94A 4D71A 2VKZG 5FJPA 2AGKA 3EB3A 4AD2A 1Q6DA 3NQ6A 2X09A 2Y70A 1VP5A 3W86A 2Z28A 3NTYA 2E5CA 5F1UA 1BYAA 4KWWA 1AMYA 1MNZA 4RL3A 2PWVA 3ARXA 1I60A 3ARVA 3PY2A 1E72M 1XX1A 3WJSA 2W62A 2FTPA 2PDUA 5T91A 2RAGA 4JXCA 1V0NA 1E1FA 2B7OA 3LHUA 2ZZ5A 1DPMA 2WZEA 1XKJA 2REQB 5I3KA 1DWGM 1FFRA 1OVDA 1CXIA 2DW6A 4KWVA 3MKKA 1CECA 4WDXA 4JQ4A 2DEPA 2ZWYA 5FOOA 4XD5A 3BUVA 1M7XA 2Z6JA 2PF8A 1EJVC 5KEZA 1UR4A 1O1ZA 4O0KA 1PZ0A 1KCKA 1XW8A 2IPWA 4KS0A 3AWNA 3E6EA 2DIJA 2PDHA 2XH4A 3MPGA 3EWXA 3WLNA 2XVKA 1TIMA 4UR7A 2UY5A 7TAAA 3FHAA 3JZUA 2G41A 5CSUA 3PANA 3TN5A 4Q4OA 4FNTA 3E9AA 2OCZA 3SGUA 5FJRA 3F4WA 3VPLA 4TU1A 1TV4A 2Z2AA 1XIJA 4W9TA 4AEOA 1SO4A 3T4CA 2WNWA 3M5VA 2DY3A 4IIGA 3CLMA 4OUIA 2J7BA 4NIRA 4DJED 1OYBA 2YL8A 2PMQA 2CZVA 3ERPA 3H2AA 4K1WA 3MMTA 3M7WA 4U10A 4LBSA 1M5WA 4IUGA 1UOKA 4LW7A 3AUJA 3OHMB 3FLUA 3NZ1A 4GJ1A 1JUEA 2E5DA 1UKOA 2CLIA 5ECVA 1L0PA 2YCKX 1UC5A 3N04A 3TN6A 1OY0A 1WZMA 2A85A 4C6OA 3CH0A 3C2RA 1VEPA 4TOQA 4OV9A 1JCMP 1V3LA 1HJUA 2V82A 4DI8A 3SCOA 3FA3A 2ZUNA 1PHQA 4DLFA 5IBXC 1FRBA 1WZLA 4R27A 3UWQA 1QR7A 4F0SA 3D47A 3N12A 4GUJA 5PTDA 4LRSA 4Y6GA 4AHPA 4O1DA 3HOJA 2UY2A 4D8AA 3NG3A 1ZBCA 1IE7C 1JXJA 1P0DA 3LLXA 4IH3A 4ALDA 4K36A 3AXIA 5CG0A 1E55A 1BLIA 1R6WA 3TP4A 2WXDM 4NAFA 2E77A 2IPGA 1B3WA 5AYYA 2RGMA 3GIQA 2BBFA 2DZSA 1BVWA 3WBXA 4PH6A 2VO5A 2HTMA 1UZHA 3H6OA 1KQYA 4FO4A 4MNJA 2PP3A 1TTPA 3OPSA 3TSDA 4DF0A 1LRNA 4B5TA 4DVOA 4NX5A 1TMHA 3MKVA 4BZYA 2W92A 4C60A 3LHWA 4GKLA 3GAKA 1W3LA 1E1EA 1OX4A 3W4RA 5A6BA 4ACYA 2WWCA 1HT6A 1JDCA 3SY5A 3LRLA 1W1IE 4ZGYA 1FY6A 1SO5A 4HHPA 1UMLA 3N34A 1M7OA 4JN8A 3DHFA 3LI1A 4UTIA 5C2CA 2QCDB 3OVPA 4L6HA 3VCRA 1SJAA 3CUHA 3RR1A 1RR2A 1I0BA 4XG1A 3S2MA 3BG5A 2OYMA 4N7QA 1HL8A 3AZSA 5JBFA 3UJSA 1TELA 6ALDA 2VR5A 2YB1A 3U2ZA 3ARTA 3S2CA 2I16A 2FGBA 3W7HA 4UWMA 3EA3A 1PVNA 3V5OA 3QR3A 1YTKA 1DOSA 1DV7A 3TN3A 2FPVA 4O4WA 4NY2A 1JZ2A 2AGTA 2J7EA 3OODA 1QMLA 2FMOA 3RITA 4ZO7A 4HNVA 2B7QA 2P53A 1H50A 3DXIA 3VKAA 3L4UA 1MEIA 1R9XA 3D0CA 3GFZA 3RX3A 1UWTA 5IHRA 5H8PA 1L6YA 3NSNA 4PRTA 2X42A 5I3HA 3U5YA 2WVTA 3T09A 3GDRA 4PMNA 5HQMA 2PS2A 3UXDA 1L2UA 4LY8A 3LXAA 4QAWA 1D3CA 2VFEA 1LROA 4RV8A 4XBJA 5G1MA 1KGXA 2QPUA 4J1OA 3GFYA 4ZODA 4JX5A 3E96A 1XR2A 2WSQA 5FJJA 3LI0A 1Z44A 3TC3A 4ZEPA 1UBPC 4A3UA 3L21A 2VWTA 2I7GA 4XO7A 1YBQA 4AY8A 2GDUA 1S2UA 1UCWA 4J7RA 4JCMA 3EZ4A 4HN8A 4JHOA 3ARUA 3BJSA 2VP8A 1A5OC 4ZE4A 3HQ1A 2DH2A 2IKJA 5REQB 1UH2A 2Y4SA 3HBLA 2FPYA 3CWOX 4Q3MA 2WMJA 3A9BA 2WMIA 3EX4A 2GPTA 4I9TA 4JHZA 3KBNA 3AROA 2EF9A 1MUMA 3MV01 1JPMA 4FA3A 1TCMA 4AH7A 2WK2A 4J2PA 1DJHA 4H7VA 1US0A 3B9AA 4IGSA 1V3KA 1TREA 3VOFA 4TTGA 4W4QA 3B03A 4AD3A 4RNHA 5BRBA 1GYNA 3EWCA 1DWHM 1E3XA 3SUVA 4B3ZA 3NFUA 1LCOA 4NZ3A 1CLVA 3LMZA 1BQCA 1JEZA 3UWWA 1TYGA 5H6HA 1FCBA 4K7YA 5EMKA 2GQAA 3DU0A 5CGQA 3QPZA 3BQ6A 3VINA 1PX4A 2A6NA 4B5SA 5A3HA 4Y9NA 2I14A 4NU7A 4GZEA 1SZGA 2WSRA 1BWVA 3UZJA 2YDSA 2Y8KA 1ZBWA 3LRKA 3WNMA 4WDWA 3CMFA 3L12A 1GG1A 4KEZA 1PZ3A 2VWSA 4RK8A 2YBTA 5J8LA 4ZB5A 1UH4A 4LAKA 3UWUA 3IIVA 1ZTVA 3S6TA 4D1JA 2V38A 3VGEA 1UWAA 3QW3A 3S2JA 3UCQA 3U57A 4GXPA 2WV8A 5C2XA 2WZTA 4NHVA 3MBFA 5C7HA 1JI1A 4U5KA 4LVBA 3YPIA 1N2VA 4ILSA 1QU4A 1R30A 4WY0A 4B2DD 3NPVA 1XXXA 1XGDA 1JR1A 4QEEA 1H60A 4M56A 3CPRA 5AHIA 3W6MA 3VKJA 3F5JA 3O06A 3QR1A 4JKLA 2AQVA 3R43A 1OG0A 1V6VA 1BTMA 1RSCA 3H4GA 4QLLA 2XDFA 2WBKA 4HOZA 3TV8A 4MDPA 1JULA 2NQ9A 2QUVA 4M6VA 3M16A 3IUDA 3TQKA 2B81A 1FWSA 3N3TA 4UQBA 1VBUA 3DC8A 3TYEA 3ITCA 3ZT6A 2F38A 3A4AA 4NJIA 3QSRA 1X1ZA 5HJLA 3N6HA 4ENLA 3T1GA 4H6QA 3P14A 3IUHA 2Y5EA 1NQ6A 4BI5A 1E70M 3TZFA 1AZ2A 2ZZ6A 1DEDA 1X96A 2WW5A 3MC5A 3VMPA 5K4XA 1XISA 2D0FA 1Y8BA 5D2VA 4DWSD 3WUEA 1POJA 4EACA 4QFUA 4RE0A 4WQ6A 3LUTA 5EYWA 3W7QA 3LQGA 3W1NA 1GVQA 2V5KA 2X30A 3ICJA 4AY1A 1D8WA 1JD7A 2CERA 3GDKA 3VIIA 1MZHA 3HPFA 5I23A 2BHUA 3AIUA 4IG2B 2P5NA 2J8GA 1FCUA 4DBSA 2XIQA 5EU9A 4EWND 1LQAA 5DY2A 1PX8A 5A8NA 2OXNA 5H1WA 2CU0A 1P5BA 2O56A 3M0YA 2PDBA 4HMCA 3NQEA 3WQWA 5JH2A 5E5CA 1SW3A 5A8OA 3W82A 3WIJA 4EX4A 3ELFA 3CUGA 1J5SA 1K9FA 3SN4A 1D7KA 4HHMA 3HB9A 3BCDA 4F3HA 1N8FA 4WVXA 3VX1A 4HT3A 1RUSA 1GW1A 4L7ZA 4HYRA 1UD6A 4HPJA 4YL2A 1VYSX 3QZAA 1VC4A 5DANA 4KIEA 3LOTA 3GM8A 5EB8A 1JZ3A 5C5YA 4XK2A 4P61A 1H7PA 1WBJA 2XHYA 1BEUA 3KBMA 2PWHA 4OZOA 1V0MA 4YPJA 4UTJA 5FJTA 3TWBA 2EAWA 2ZRZA 1YKWA 2Q8ZA 4W85A 1K70A 4LBUA 5AHNA 3WF0A 2VOMA 3EXRA 3UA4A 4B15A 4DPQA 3WQ6A 1KFLA 4QROA 3GBDA 2H90A 2I5GA 3UG4A 2AQWA 3TOYA 4KMQA 1BRLA 3GSMA 2PTZA 1XDJA 3ABXA 4FI4A 1W17A 3HGJA 4YTSA 3A9IA 4IICA 3B97A 4XD3A 1SFSA 2J79A 4UXDA 4HNTA 2VQUA 3VNJA 2BDQA 1S1RA 3CHEA 1UHVA 1V77A 4U4MA 2CLEA 1F3WA 2H3BA 2BY1A 3U2EA 1A5BA 2OPJA 1UWSA 3W87A 3WBAA 3MJYA 4QR6A 4RKAA 1TIWA 4W89A 3CV7A 5DT7A 1Q6OA 3UWVA 1DWFM 1GOIA 4F8XA 4UTKA 5G2IA 4DJEA 2J6VA 2X16A 4JTJA 4P7NA 3TW6A 3WFLA 4B5VA 3ZOAA 3R0KA 1JCLA 3NM3A 5JIWA 3PBGA 3UGRA 4NZ5A 4UTMA 2WVUA 4ERAA 4R7JA 4LOCA 2AL2B 2Q6ZA 3WNOA 5AECA 3EKZA 3OA5A 7ENLA 3BO9A 1QNOA 1KXVA 4LB4A 1BD0A 4QSHA 5FF2A 3TXZA 2CBJA 3WEZA 4KEMA 5ABFB 3TYCA 1XYAA 3AXMA 3ZR4A 3RUBL 5H2ZA 1ZRQA 2P88A 4AU0A 1J5TA 3G5EA 2PD5A 4MUZA 3LXBA 1ITUA 2HK0A 1OADA 3AYRA 3VFLA 3OZOA 5HINA 4TO8A 1JFHA 1U5HA 3FK4A 3PPFA 3R12A 3RCYA 2Z7KA 1QDSA 1JYNA 1Q6CA 3PUGA 3B8UA 1BQGA 1O95A 4F79A 4GLEA 3VUSA 3TQ0A 2VEFA 4ONVA 2J25A 1U30A 2F6UA 3GHUA 2DIKA 1FHUA 4GA8A 1AD1A 1EXBA 4E4PA 4DWSC 2V30A 3AHTA 3LCIA 5HNUA 2RDWA 3WJYA 1QWGA 1R5YA 4B90A 3F2BA 4WIWA 1E6ZA 1HKMA 3G24A 3QHMA 4CEXC 3VNMA 4Z2JA 3ES7A 4DO4A 2E5BA 5HMDA 4HA0A 3UVIA 4V1XA 1WCGA 1ZAHA 1SW7A 2IXUA 4KFPA 3C8FA 1XDMA 2D3LA 2IXVA 1UWQA 1UBSA 3C0JA 4NZ1A 3PJTA 3KZPA 1XSKA 1WNOA 4HJWA 2RFGA 4NILA 4QG8A 1A50A 4FZIA 4Y8FA 1LOLA 1EJUC 1NFPA 4E6MA 2ZC1A 5FF0A 3L2IA 3APGA 3SFWA 3GKAA 1PWMA 2PB1A 4E2VA 1WZKA 4Z08A 4RZ4A 1ZJBA 3MSRA 3CB3A 1YDNA 2ICSA 3B04A 3NZPA 5IHSA 3L5MA 1CB7B 1DWAM 1FWAC 1LG2A 3SRFA 3V1PA 3TUUA 2EBNA 4GOAA 3NVDA 4P8XA 1SJCA 1WUFA 2PTDA 1G4EA 5LNWA 1UP0A 2NX1A 4QEHA 1JPDX 4A21A 1XIFA 1VPYA 2PDIA 3Q65A 2QUTA 2VCAA 4I6KA 3LCHA 4YJ5A 1CPUA 1TVLA 4C7GA 1YYAA 1GWJA 1LM1A 3B9OA 4LS1A 4DZ5A 3LGDA 2NXHA 1V6YA 4BFAA 4FEZA 1KBKA 2D2OA 3H12A 5C2GA 2PDPA 4ADSA 3WDRA 4LY4A 3AJXA 3TZNA 1U33A 1S2CA 3T2QA 1A4MA 4E5TA 1QOPA 4XKYB 1BGAA 2PWEA 4PTVA 3SGGA 1BGGA 1GK8A 1EZ2A 4HMDA 1IHIA 4L6OA 1C90A 2VC5A 2UV8G 3O8AA 2O9PA 3IJIA 1CGTA 2P3EA 1UUQA 4YXGA 3W37A 5CSYA 2CETA 1RCQA 3EXTA 3L4VA 3IJ9A 1RY8A 3TQVA 2GJXA 1BAGA 1RJRA 2O4MA 3E38A 1U1UA 3NL2A 4KCWA 4L4OA 4FHAA 4DX3A 2RDXA 4AWUA 4N9CA 5BU6A 1OCJA 1GPFA 2ACUA 5C9XA 4EAYA 4GVHA 4KCVA 1MQQA 2VC7A 4PB3A 1G94A 5A2CA 5C9UA 3DGBA 4BF7A 4KEVA 3WD4A 4A6GA 1PKNA 1A49A 2OX1A 1DQXA 4UBPC 3ZJ8A 4AW7A 3KZSA 2WOQA 1DJQA 1P48A 4MWAB 4QS5A 4W88A 1SQ7A 1V7YA 4UFJA 3WO8A 1JRCA 1CENA 1XICA 4O1BA 1KC7A 2PP1A 1L6FA 3AIEA 3IRSA 4M8UA 4CUCA 5CQ1A 4BQ2A 3LCLA 1XQLA 1S3TC 4QDWA 3A24A 3V3WA 5EFFA 2DSVA 1YXYA 2FFCA 3HJEA 4XVDA 1VLIA 1BYDA 3HN3A 4M82A 5LZLA 3ARWA 1GJWA 4DYJA 3UGVA 5DFAA 3W9ZA 2FJKA 2JK2A 1H7NA 4URIA 4GYJA 4JX4A 5CLTA 3O63A 1ZHAA 3WDHA 3TNBA 4FLSA 1BPLB 2DP3A 2NT1A 3C3NA 3T05A 1Y0EA 1H5VA 2J6XA 1OABA 4HK7A 3ARZA 5GJPA 3VXGA 4C90A 3NQFA 3R89A 3BLLA 3IACA 3UCDA 4DIAA 4Z2IA 2D0GA 3N2XA 1LQ2A 1RD6A 1ZZMA 2ACQA 1TPUA 2BASA 4DBEA 4LVGA 4A3QA 4PR4A 1IR2A 2V81A 5FA5A 3GYEA 4TMCA 2A21A 3GXIA 1SMDA 1ZB5A 3CQJA 3K8KA 4O16A 4DF2A 3UYIA 4UOQA 3BSMA 4JDYA 3OGSA 5EMUA 4M81A 2R1NA 3QN3A 4P8VA 1GKPA 1ZBVA 4A29A 3UNDA 2ACSA 6TIMA 4IJCA 2VELA 3FOKA 3N6QA 1OK6A 4GVGA 3VIOA 5AC5A 4XAYA 4ZQOA 1DQWA 2GL5A 4UQ9A 4HMEA 2F8QA 2VT0A 4MNKA 3A5FA 3W7JA 2OYKA 4UR9A 3CZ8A 4LUYA 3FAXA 4Q8QA 3EYPA 1KLZA 2XH0A 3CL8A 3GG0A 4J28A 3OO2A 4GIYA 4MKNA 3GW0A 1J0IA 3FDGA 1BKHA 4GPNA 1TMQA 4ECLA 1HP4A 1EKOA 4L6DA 2OWXA 4IIEA 1CZ1A 1TWZA 4PULA 2OZ8A 3RMJA 1J01A 1GYMA 3ZQ9A 2H8ZA 1EA0A 1F6YA 3BOLA 1I75A 3KVLA 3P93A 3W7IA 2PC8A 1ZAJA 2PWDA 3V7PA 4JICA 2Y0FA 3QV7A 4CD8A 4JIQA 1O60A 4YTRA 5ENLA 3H54A 5FD0A 4AF0A 4B4HA 3WF2A 2YGYA 1XLLA 3PNZA 1W1ZA 2FTYA 1AJZA 3DFSA 1EJXC 4KCUA 3OBEA 3HGOA 1OC5A 1WKYA 1IXQA 4DO5A 4E3TA 4Z0JA 2PWFA 3C56A 4Z0SA 4O8RA 4LV9A 1EBGA 1S5NA 3VC5A 1VCVA 1XYBA 3LCWA 2WMFA 3PZOA 1D9EA 5BRPA 1ISWA 2DPEA 3G0XA 3BAIA 1Z69A 5K3VA 3LD5A 2XM2A 1C7SA 3QOKA 4KBXA 1VAHA 4V33A 4BK9A 3AAMA 5BROA 2YL6A 4O50A 4K8GA 1XUUA 1J6OA 3OIHA 1H49A 3PBWA 3ZJKA 3AQUA 5IRPA 5AYBA 1F4AA 3VGBA 3WH9A 1QUMA 3P8IA 3BLKA 3RM8A 3W07A 4A8RA 3WLMA 3MMWA 3THAA 2NLYA 3E0WA 2HXUA 1EYEA 2YB4A 4UQAA 3URBA 5DXYA 4AEFA 4QNWA 3PFRA 4BI6A 3DG6A 3MI2A 4PUNA 3UFYA 2WC4A 2XM1A 3DOPA 3KXQA 3BQ5A 2QAPA 3CPGA 4IJRA 1OGBA 5ABHA 1O5XA 2V63A 2ALDA 1P0KA 2HSAA 5H8MA 3STGA 4YHEA 4S23A 4IM4A 1UQZA 3VIHA 3G1VA 4GRSA 3NR0A 3DG7A 1OZMA 2PCQA 3F1QA 2BFGA 2PEVA 5IFTA 3WQPA 1JYVA 3GHRA 4XAPA 1E6SM 1AODA 2OODA 3M5ZA 1V08A 4H8NA 4HK6A 2VJXA 4JTFA 2BB0A 2HRWA 2PU1A 5LKYA 3N2MA 4HYVA 5GJNA 4MOZA 5FF7A 3LZ5A 3OA3A 1CGVA 4JKKA 3MYPA 3GX9A 3W7LA 1PIGA 1W5QA 1U5VA 1XIIA 1B3YA 4LV4A 2C3ZA 1JZ4A 1DJWA 3LHVA 3MWAA 2V5JA 1AQ0A 3SSJA 2ZQ0A 2DVTA 3MUIA 1OX6A 2OQYA 3IGXA 3TH6A 4FALA 3IIOA 1V93A 3BOXA 1IXNA 1PZ1A 4W8LA 1DXEA 4J35A 1OFQA 1UH3A 3N4FA 3W7NA 3ORWA 3CUXA 4PYSA 1SO3A 1QTWA 3P6LA 1TZ7A 5D2YA 4H9VA 4XB3A 3FKRA 3OJGA 4WKAA 1OEPA 3GXTA 2PDMA 5DMMA 4DBUA 3UJFA 3EOUA 2HJPA 2JFEX 3VGDA 3KTCA 1Q6FA 4G8TA 4KIRA 3PAOA 1K4GA 2W79A 4ZCWA 4JKMA 4DXXA 4H9ZA 1IWBA 2CXGA 3S5SA 2JEPA 1ICQA 1K3UA 4LYKA 1GQLA 1UOZA 1JGMA 3RPTA 1G7VA 3SR7A 3PZ9A 1TR9A 1SZRA 3UJ2A 3SUTA 2WQPA 1J10A 4F0MA 2GZXA 2VUYA 2VVNA 2F6XA 3B0UX 4JFWA 1OX4B 5AYXA 3AXHA 4A8IA 5A6TC 3STPA 1TPVA 2ZZ4A 3IVSA 1W3KA 3KTXA 3V16A 1ZSXA 2V5CA 3KOFA 1UD4A 2PUZA 4KFNA 2I57A 4QJ1A 3Q2DA 2EG7A 4QX4A 4PMQA 4HPNA 4LPCA 2R1MA 2XIOA 4RV3A 4WRHA 5EA9A 3T2PA 3RO8A 3QV8A 1JG9A 4QE4A 4MJMA 3GO2A 2D22A 1XLCA 2ZE3A 5LIUX 4FXJA 4AIEA 3WJXA 3RO6A 2BWGA 1EOKA 5D37A 4EPDC 3T8QA 1OFBA 2MANA 3HG5A 2NX9A 1MFVA 4PBEA 1WE5A 4IGHA 3W7CA 3AHYA 1ISYA 3IVTA 2VDGA 3CGTA 4L9ZA 3AMDA 2YKKA 4CQAA 1MXGA 3BW3A 9RUBA 1OFAA 3TXVA 2GSHA 1YEYA 3T44A 1H51A 4UMCA 4HHLA 1OYCA 3W02A 4OFCA 3ZIZA 4LAOA 4FR1A 2FVKA 4M19A 3RXZA 3VOCA 4CD6A 3NXLA 1PWLA 3I6RA 2VC6A 2OEKA 3PS7A 2XGBA 4JZ5A 1KA9F 3QTPA 3GS6A 2W61A 2XN2A 1RHCA 1TKKA 1V3JA 4AVFA 3GU9A 1EQPA 4HNOA 4C6CA 1YDVA 4M24A 1UC4A 1D3GA 5FJIA 3BGAA 4S3AA 3LX9A 3QYSA 1EC7A 5D9OA 1LWHA 3HFYA 4MM1A 4B5XA 4D6IA 1W9UA 2J77A 4R33A 5DX7A 4AMCA 1TO3A 1LG1A 4NQ1A 2E8YA 1O12A 4HGXA 1XUZA 4AB4A 2DZTA 4PRWA 2E09A 1KGWA 2IPFA 1Y5XA 3WF4A 1EJTC 2JEQA 2PDGA 3W83A 3T40A 4LXFA 4UQEA 3PBYA 2WB5A 2E6FA 3I6EA 2XN0A 3M0XA 4FIQA 4C6BA 2WHMA 4FX6M 3ITLA 1ENUA 1P7TA 2WMIB 3GG7A 1H7RA 4ICCX 4H2CA 4UTWC 3VAVA 1NJJA 3W2MA 1EH9A 4GYKA 3PZQA 4QQUA 5KMYA 3W6YA 2WVVA 3O6CA 4QQ3A 3XINA 4B5UA 4ACZB 1JZ6A 4QXIA 1OG6A 5EMLA 4LS0A 4WR3A 1ECQA 2VHLA 3UY8A 2YCJA 1QNQA 4MWAE 1YQ2A 2QKFA 2Y7GA 2VZSA 1A5LC 3LV5A 2HCVA 3WQEA 2FPTA 4XZLX 2PWUA 4JD4A 3KFTA 2QV5A 3EA1A 3W1QA 4GGHA 1SPQA 2XIJA 3S5NA 3W29A 4LH8A 3GWQA 1K4HA 3EDJA 1OFRA 3NEHA 3MS8A 3APYA 1A5NC 2PAJA 1KR0A 1NFBA 1TWWA 1KR1A 1WQ5A 4NZCA 4TTUA 7CGTA 4DO7A 1DHPA 2YOCA 3E74A 3OB8A 4MPKA 1EP2A 4BQ5A 1A5UA 1XIHA 3WH8A 5E93A 3N2OA 5TQLA 3EB4A 3N15A 1CB2A 2ZRYA 1KCZA 2HVOA 3A3WA 3EBVA 3ZVHB 2DSWA 3QC0A 5GNZA 5ABGA 3T7VA 4WY0B 2KX9A 3CHVA 3HURA 4CN1A 1GVIA 3QGAC 4CN4A 4X0VA 1T8QA 2HWGA 3L4TA 4FLQA 2CLKA 1PCKA 5F4XA 3G6MA 3LCXA 2JGQA 4D6GA 3N2TA 4ATDA 1Y5WA 4QDMA 2INZA 4PRRA 3IVUA 2O7SA 4AZHA 2DGAA 1E1CB 4XZBA 1F61A 1C92A 1UWIA 4DJDA 2GJPA 4FNRA 5LXEA 2ZX7A 3I4EA 1VF8A 3S9YA 2C1HA 4WJ8A 4PB4A 1O1HA 3L0KA 4FS9A 1AQHA 3DBPA 2YX0A 2QCGA 3TX9A 4H1ZA 2QLYA 3MWCA 1KQZA 5F2MA 3NQ7A 4HK5A 3UPBA 4O13A 2FHCA 3PWAA 5A2BA 2AKMA 3VILA 4DWDA 3PB0A 2Z4GA 3NL6A 3O7UA 3VI2A 1XPGA 4REQA 4WKHA 3AO0A 1E9YB 3S5OA 4JIPA 1SU5A 1ITXA 2L5HA 1CXEA 1T40A 4HNUA 3RLGA 4UCGA 4CQDA 2G3IA 3GKFA 1Q6LA 1P1MA 2C0HA 3LV6A 1JVNA 1KCLA 4IQJA 1K8YA 1THFD 3MUAA 1CX9A 1YADA 5HWMA 4LAUA 1UR1A 4PODA 3N14A 2XH2A 3MSYA 4I6VA 2E1WA 5D8WA 1UUMA 3BV4A 3EWZA 4GGBA 4S2CA 5AC6A 4Q4KA 3NSXA 1RVKA 2EPMX 1ODZA 2J7DA 5BXPA 4DQWA 3CNYA 1FFQA 4YCPA 5H91A 3W27A 1FHVA 1H09A 1IZCA 1VBJA 4GI4A 3P3BA 3UJEA 4ZO8A 4GX9A 1CXHA 2O92A 1GVYA 4W93A 4A3YA 4HJFA 3WLSA 3CQIA 3LTPA 1OHLA 1XSIA 5BOFA 1E0XA 4H83A 4AQLA 3EDFA 2ISWA 2VX7A 1BG9A 3WD2A 1KM0A 5CGMA 5F2LA 1IGSA 3IAQA 1ELSA 1DKWA 3PTQA 2YDQA 1EQCA 1UKTA 2UZ9A 1ZBKA 4ZQNA 2XSXA 2E40A 4UFLA 2E6YA 1VJIA 2GVJA 3NZRA 2DSUA 4MJ2A 3NL3A 3WY1A 3AXXA 4WSHA 1MNSA 2XWDA 1BRLB 1Q2SA 1TTJA 3UXLA 1WAUA 2ZICA 2RUSA 4BWLC 1MSSA 4F0LA 1S46A 5D09A 1DIOA 1Z6KA 4HQVA 1ONEA 1VS1A 4E8DA 1VHNA 5CZSA 3UG3A 3GE7A 2Q8XA 1GJUA 1TJRA 3VKDA 1BWLA 3FVDA 3VE9A 4WOZA 1HTIA 4G1NA 4HTBA 3KBSA 4Y9AA 1J0ZA 1MYRA 3ATZA 2Y7EA 3GDLA 4DJFC 4PUDA 4Y9MA 5JBEA 4CCZA 1PO9A 2FFIA 1R2TA 2ABAA 3XIMA 3SUWA 1MXSA 3ARYA 1FXQA 2OLAA 1R47A 2VEPA 3R0DA 3E02A 2GGIA 5REQA 2NUXA 2Y5JA 3G22A 3ITVA 3BXWA 1C9WA 2QDGA 4H7ZA 4P7LA 3H70A 4XKMA 1HJXA 5AC4A 3P2VA 1VEOA 3GUGA 3DZ1A 2IMRA 2VGFA 1XLBA 2ZRWA 4C1NB 3AU2A 1H5YA 2HVMA 3BLEA 1N7KA 2G96A 3POCA 1SW0A 1BWKA 4Q33A 2E68A 2Q8LA 5A1AA 1PUDA 4IPNB 2VFDA 1GZJA 4ADTA 4OBSA 5C9WA 3VDAA 1GORA 1KTCA 2PZNA 1HVXA 3W1UA 2CCRA 2DVXA 3TSBA 2QJJA 4GJIA 2V3EA 5LNUA 2FZ8A 4GJJA 3SSZA 4XX6A 1C91A 4RZBA 1GGOA 4ROQA 1SMAA 1RALA 1VYPX 3CL7A 3S3GA 4HN4A 2A7RA 2D2HA 1X8FA 1DQUA 2QVNA 5CPTA 4LYRA 4Y2WA 1DYSA 1VBGA 3Q45A 3GXMA 1E6QM 2ZX6A 3VX0A 1S2WA 1NWUA 3CS2A 4JTSA 3LY0A 3TTOA 4O1AA 3UXAA 2EKGA 1ITCA 2DV0A 5LYRA 1H3GA 2J88A 3DYMA 1E43A 1KM1A 2ZZ7A 1VFHA 3FJNA 4L56A 3B8DA 4JNYA 4DY1A 3WNPA 5A6LA 4KRZA 3CYJA 5CPSA 3WK1A 2CKRA 1K7FA 2B4GA 3HZ3A 4JN7A 3E49A 4NJHA 1Z3NA 3QR0A 3CUJA 3ZLGA 5I79A 1O5KA 2PDQA 5KZMA 1MQPA 2Y62A 4O1FA 1QK2A 3LU2A 5B7YA 3ZWTA 1GQJA 1ZLPA 4L4LA 3VIPA 3NOEA 4GZ7A 4TX6A 4D6CA 1ZALA 5E1QA 3REQA 2YDRA 3PPGA 1R9YA 1ZL1A 2HNEA 2PDFA 4JOMA 1NDVA 4YMZA 1TUFA 1ZP4A 3EKLA 1QW9A 4EXBA 3EWDA 1Z89A 1DXIA 3VKCA 3WEMA 3UR7A 2JQXA 3B9EA 4XSMA 3LBOA 5L9FA 2BV9A 3SY8A 4GUIA 3W7RA 5CBBA 5JBDA 1WYIA 1R3TA 1B0IA 1IR1A 2BGSA 2A1YA 4I9AA 2LLEA 1JDFA 1M3UA 3K4DA 2A7NA 2OTDA 3ONCA 4ZOBA 1K6AA 1X8CA 2PURA 3M5YA 3OHIA 3LB0A 1G4PA 5A94A 2FVLA 4WGHA 3C2OA 8A3HA 5AHEA 3B8WA 1PBGA 1BHGA 2DZUA 5HJYA 3BJTA 1KM3A 1LUCB 1QBAA 4PFHA 3WNLA 4FNPA 3WD0A 4GYPC 3W3OA 2GJXB 2ZZ2A 2E9LA 2FYMA 5IDIA 4Y96A 4IG2A 1PB0A 3W1TA 3GYCA 4RNIA 4LANA 2I5IA 2A3BA 3TYZA 4UB9A 3BW2A 4AX6A 2WHJA 3MHGA 4JL1A 4BCEA 4ZXLA 3H4WA 3V0SA 4XZHA 7TIMA 1NP0A 4IJBA 4QJ5B 3RDKA 2NX3A 3H22A 1EGZA 3QYQA 4KEUA 3W38A 4K7VA 4D6HA 1F8IA 3AS3A 4JYEA 2AAMA 3RLHA 1Z32X 2ODOA 4KGLA 1WDDA 3KS6A 3HG4A 2ISFA 3BL3A 1VYRA 1C8VA 4AY7A 5I78A 1EZWA 2PFHA 2HS8A 2AMGA 1FWNA 1RA5A 3CO4A 1TV7A 4K39A 3V75A 2NVAA 4IHCA 2VEKA 3BOFA 4PSRA 3SZ8A 5E6YA 3AYVA 2ZCGA 2O55A 3R6IA 2DZBA 3C0QA 5FF3A 2E6DA 4KRUA 2CWXA 3BGJA 2R8WA 4L65A 3CB8A 1M53A 4XZIA 3IARA 3VNKA 3VCCA 1CI1A 4D6JA 1V3MA 3LZ3A 3HQNA 3UZWA 3GR8A 3MUXA 3MY9A 4HTYA 2Y63A 1QWKA 5LHFA 3QH2A 3GNNA 3CYVA 2G4FA 3QY8A 4C5YA 4DNMA 2WMKA 4DXVA 1KRAC 3MHFA 2C16A 3QY7A 3UCCA 3OGVA 4HA4A 5HPCA 2OOFA 2ACRA 3CXOA 3W7PA 1TQJA 2NVDA 1UROA 4JNMA 1HL9A 4GZIA 2Y1HA 5E09A 1JZ5A 2WNQA 5AYZA 2NW0A 5LXXA 1QHPA 2GUBA 4DBDA 1X6NA 3E2VA 2NWRA 1SJBA 1B5TA 4D72A 3QV9A 3LNMA 5KTLA 1EEXA 3KLLA 1G67A 1GG0A 2WPGA 3NO1A 3WQDA 2Y6ZA 4JIEA 1OFOA 2FQIA 3WF1A 4W7UA 2XIBA 3F4DA 2YL5A 1B3ZA 3W1XA 4TR9A 1Q6RA 2CZEA 4EVZA 5HJXA 2BOGX 3TR2A 4JN6A 3SCSA 2NVCA 3SQSA 2YR1A 3VD7A 2X05A 3TE9A 2QCEA 2JBMA 1E9IA 4LC8A 4ZL1A 4JY8A 2PCEA 4QCEA 1EJRC 2V5BA 2ZA1A 4JIRA 3N2BA 4B92A 1U22A 3H2NA 4GY0A 3S47A 4AF0B 3R5EA 1VPQA 3KUMA 2GJRA 3UR5A 4DEFA 1EC8A 1MW1A 3WH5A 3UWZA 1I2NA 2V67A 1K03A 1M1BA 3BTNA 4DHGA 1HXJA 2J4GA 1C29A 2XISA 3DERA 4ML4A 4IOTA 2ZYFA 3GTFA 2OWCA 3NQDA 1JXKA 1RA0A 1BF6A 1TTIA 3K4AA 8CGTA 3N3MA 4LRTA 5AHFA 1XWYA 1WDSA 4HA1A 4DWSB 1LRQA 4XWUA 4A2SA 1AMKA 3EDEA 2PDLA 3OU8A 2FJUB 2PRLA 3H2CA 2CLOA 3HF3A 3BWWA 3P5ZA 3WCZA 3VOHA 1HX0A 1OCBA 3EKGA 2QV4A 2EO7A 1Q3NA 5D30A 1K8XA 2E9BA 4KW2A 2Z0IA 4DRSA 4CQBA 2RJHA 1UA7A 2YZ5A 2J75A 2OSXA 4O15A 4L80A 1WO2A 1IIHA 4UTUA 3BCJA 4YIWA 1I6NA 4IFRA 3VKKA 3VGFA 3W85A 1UA3A 4JYDA 4FPSA 2OQLA 3AUOA 3NYDA 1GONA 1XDLA 1R85A 4IIDA 3S1GA 4KWSA 4I3GA 4RNJA 3VO0A 2J9YA 1UW9A 3QSTA 3KE0A 1BG4A 4FOUA 3QFEA 4NKCA 4ASTA 4IGMA 5M03A 4W5ZA 3S46A 3ZT7A 4LVFA 3LGGA 3GXDA 4MB5A 3D6NA 4AC7C 5I06A 5I03A 5G5IA 3O05A 1IZKA 2OZ3A 3PNUA 4Q8MA 5HUOA 1DE5A 3SBFA 3TSMA 3W7GA 3EOOA 3BCFA 2PD9A 2ZVIA 3SADA 4UTHA 4Z1BA 1TV2A 1NH6A 4UZUA 2WNNA 2WANA 3R8GA 2DZXA 1SFTA 5CPLA 1IT8A 4G9PA 4GNJA 3TYAA 3IANA 2WAGA 4U5IA 2ZVRA 3CUFA 1K8CA 3K8MA 4XKYA 1RAKA 4FNUA 1I1XA 3MDUA 2QPXA 4ZR8A 4MF4A 1TPEA 5BWFA 3ECQA 4S1FA 4G2DA 2JIEA 3G2GA 3GC2A 1LLOA 2WBGA 3VC6A 4H01A 7REQB 4ROPA 3GTNA 1G01A 4GXMA 5HNNA 1J79A 3GR4A 4WSJA 2C13A 4ZOAA 3HU7A 1AJ2A 5D9PA 2Q3OA 2POTA 1JPIA 2J47A 3AIWA 1RBLA 1BF2A 1H1YA 2PGEA 1JQXA 4TV5A 1G6CA 1MW3A 1FCQA 2QCHA 4S3GA 3G1RA 4JIIX 1CT5A 4J3SA 3UZZA 5DN1A 3DFTA 3QZ6A 2OQHA 2ZE0A 1E6XM 3QC3A 2YLLA 2YXGA 2OB3A 5BU9A 4XV0A 1KKOA 4MWAA 3W2LA 1XBVA 1O7AA 3QEZA 2GOKA 2C18A 3W26A 1KXQA 4L1WA 2P10A 1T8XA 1QI4A 4R34A 4LGXA 2VL4A 2CLPA 5FL1A 4P8WA 3AOFA 1FWEC 4ICMA 4CEUC 1PKLA 3GDBA 1H1ZA 1LL6A 2WSKA 2PGFA 3S83A 2CZFA 2JKEA 4ZTYA 4I7UA 3QQWA 3OGRA 3TMLA 5C71A 2PODA 3WDPP 4E2BA 1FWGC 4FNSA 4TXEA 3LSCA 2EPHA 5CCZA 1HFBA 3S1WA 3IV3A 4IQDA 3PPHA 3W81A 4N4QA 3UY7A 1WA3A 1PL9A 5BXRA 2YSWA 4LCRA 3U5UA 3NL5A 3Q37A 2WJEA 2NSXA 1LDCA 1Y7VA 2GLKA 1MEHA 4H2HA 5A95A 4OKDA 3P61A 3NQ2A 3FN9A 2DDXA 1CDGA 3IGSA 3ITGA 1WXJA 3T07A 2CHNA 3B4UA 5D2TA 1EL3A 2E25A 4DELA 2QEZA 5LGXA 1NSJA 1MW2A 3DC0A 1W1PA 2QDHA 3A13A 1C9DA 4GIAA 4PMYA 4OQVA 4MYXA 2IW0A 1U1HA 4EPBC 4Z2LA 2FZBA 1TMLA 5CXPA 1A47A 4MAZA 3NEVA 3R94A 1FUYA 5AFDA 3NO5A 4CNNA 4Y9PA 4FF5A 1R38A 1UQYA 5ECUA 4JEJA 2QIWA 4GCXA 5HXMA 4RXGA 4AHOA 3TU9A 5AVHA 4EXQA 3F03K 4UZSA 3URNA 4CU6A 1LOSA 2HPMA 1V3HA 4GUHA 3CQKA 3ZR6A 1K9EA 3L4YA 1ADSA 1MEWA 3KX6A 4FX7A 1S3HA 5DT5A 5E0FA 3CH9A 3PB2A 3CV1A 3T55A 3CUZA 1UKSA 1PEZA 2OGJA 1OX5A 1QI5A 1XYMA 3E0LA 3TLLA 2C6QA 4G56A 3S1VA 3H23A 1S2VA 5I3JA 1P7TB 4X61A 3CWHA 1MFUA 3L9CA 4EAMA 3NSMA 1A4LA 3FA5A 2OYLA 1HUVA 2ZZ1A 4CN6A 1Q13A 3W72A 3BMVA 2OJPA 2WVVB 1F9CA 4F2TA 1J0YA 4MVAA 4PUMA 2I56A 3PWIA 4N02A 5DMLA 2XN1A 3EWYA 3VIMA 3E2SA 1EHNA 1JGIA 4HA3A 3T6CA 1SR9A 2Y8UA 7A3HA 3G1FA 1LL4A 4O18A 1WDQA 1V0KA 4HB7A 2BHZA 2PDNA 2QF8A 3NJ3A 3V36A 3PK7A 3TDFA 3EWUA 3E2RA 1EX5A 1K9DA 4UFHA 3MI6A 2FHFA 2QCCA 3KCOA 3HPAA 3QZEA 1JQVA 1W91A 1W9VA 1JIBA 3NWRA 3MCNA 4RZ5A 1TPWA 4PTDA 5A6SA 2PA6A 3MI3A 1OT1A 1QBBA 3E3HA 5D33A 1XYZA 3GH7A 4YVVA 5AN7A 4OV4A 2PDJA 4B9YA 3AMLA 3TFCA 1RPXA 2J66A 5HQLA 2VDIA 1F7BA 4J40A 1Q6EA 4XVEA 1TR1A 2WSPA 3NYZA 2PSNA 3U2CA 5BOOA 4PCFA 4AFYA 1Q7ZA 3COTA 3UG5A 4Q7IA 1W32A 3A3XA 3L2LA 2Z25A 4X63A 1DJGA 1HKIA 1NWTA 2GGJA 1US2A 5D8ZA 4ORIA 1V4YA 3DG3A 2EEXA 6REQB 3T81A 2XVGA 2CESA 2CW6A 2QF7A 1YMYA 4CD5A 1XM3A 3W74A 1VCGA 4M6UA 2WM1A 2IUZA 1EDTA 3EAUA 1TPB1 1OCNA 4CD4A 3WQOA 3AS2A 2VXNA 2WSYA 4PA8A 1OD8A 3PG8A 1BVZA 4F9DA 3NZGA 4XTIA 1UYQA 3M44A 2PDWA 2V6AA 1HKJA 4OHQA 4QDPA 2V8ZA 4F4RA 3L5LA 4GQRA 2ALRA 1NDZA 1H4PA 5FEXA 4I8DA 1C8QA 5D32A 4NAEB 2E67A 1YHTA 4S3BA 2DQXA 4PUJA 3NDZA 1PYMA 5M5DA 4REQB 2C19A 1DJYA 2IQDA 1LT8A 4GCAA 4NNBA 4CNOA 3LPFA 3GXPA 4ZBCA 3VCNA 5CPNA 2P76A 1OT2A 2ZXBA 3UYCA 1O68A 2ZUWA 3JW7A 4Q8NA 1XLIA 3VNYA 3T0DA 3VGHA 5D05A 5AY7A 4M51A 3B8SA 3W75A 3TNOA 3WL1A 3WQVA 3ABRA 1MQRA 1PJ9A 1GQNA 1XRSA 1BXCA 5JH1A 1TX0A 2W66A 2QYGA 2OX4A 4Q6XA 3AMGA 1XLEA 4NI8A 3AYSA 1LORA 4FOKA 2C79A 2WJZA 3LERA 1X7IA 4C91A 3KRBA 3THCA 1OF6A 3ZMRA 3BSHA 4AYGA 1HP5A 4CCDA 2G3MA 4F66A 1XP3A 5DY3A 1VFFA 2D0HA 3S6DA 1XLDA 2ZUUA 3TTSA 1C3FA 4GG9A 4XZWA 1DIKA 1J8VA 3SI9A 3PZIA 4O54A 2BODX 4Q4SA 1R7OA 1E40A 3MHUA 3VMNA 4A3HA 4DO6A 4UTTC 5GNYA 3SAZA 2Z00A 4NRSA 3UQNA 1HF6A 4KERA 1LOQA 4P7RA 4CVWA 2V9DA 1FWIC 1Z8AA 2FH6A 4F0HA 2HBXA 1Z41A 3PSWA 3CU2A 2V2CA 4WY0F 1A5SA 3P0WA 4IPPA 2WWDA 3KHJA 2RDTA 1CWYA 4A22A 1DJXA 2FIQA 2NLIA 1T6MA 5T9CE 3PZUA 1N8IA 2DW7A 2V3FA 4E0CA 2J7CA 5CSSA 4NX0A 5A8GA 2OMAA 1CXFA 4MNMA 1Q8AA 5DRCA 1UUOA 5LNVA 3T08A 3PR2A 2ZWZA 2F2KA 3KL5A 1E6RA 3UR8A 2OLHA 4ATLA 1REQB 1IEIA 2WVSA 3S1UA 3UF9A 1FWDC 3POHA 4Z17A 5MKGB 3GG1A 1G69A 4IF2A 5B80A 5LIXX 3R10A 2YDAA 1IT7A 2POZA 3HMCA 2YBVA 4TVUA 1EFZA 2VGGA 3IUIA 3TONA 2Z1SA 4QG9A 4WK9A 3MW7A 4ORMA 4IQLA 4I7WA 2XU2A 1R8LA 3G8EA 2I17A 2CYGA 3KAOA 3L66A 4HCLA 4QP0A 5AYIA 3GTXA 1S1PA 1ODUA 4EPKA 4XD4A 3CHCA 1FP8A 5HQEA 2OFJA 4OJYA 2XSAA 4EK7A 3CT7A 1K7EA 3LA4A 1J0HA 2EPNA 5CC7A 4Z1AA 1GZGA 2G97A 5HATA 4ACZA 1W8SA 4PUKA 3M0IA 5U7SA 3MCMA 3SFKA 5KZEA 2Z6IA 3K4WA 1DBTA 4E2OA 4QSFA 1P0NA 3ANUA 2FHBA 3VD3A 4ZXOA 3DHPA 3SECA 3INPA 2Z1XA 5GJMA 3LNPA 2ZBTA 4R9OA 5IXEA 1TE6A 3I4KA 2HEJA 2DH3A 2ATSA 3K30A 5HMSA 2X41A 4BI7A 4WXYA 1JCYA 2V2HA 4HU8A 1AW2A 1M03A 3PZNA 2CWNA 4RLIA 1JAEA 3NA8A 1SR0A 4J9JA 5FEZA 3PUEA 3WEOA 3IAPA 3SUSA 4AZ6A 4BEQA 3H55A 5RUBA 2VZTA 3CWNA 1EBHA 3RILA 1TWIA 4B16A 3ZVHA 3C61A 3B0YA 4ZO9A 3N4AA 2ADAA 1H0IA 3ALFA 1QNPA 5C9ZA 3GNDA 3VUPA 1FWRA 5FF4A 1XRFA 2YCEA 4MFEA 3W76A 5F1VA 3VOJA 3U7VA 1NOUA 2Q09A 5G1YA 2TPSA