2CLLA

Tryptophan synthase (external aldimine state) in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
257
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
total genus 98
structure length 257
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cllA00
3NZ1A 4LC8A 2ZZ1A 2Y88A 1YTEA 2NX3A 3NA8A 4RLIA 4UMCA 4Z1AA 1HFBA 3BARA 1PHQA 5I3KA 3P81A 1SZGA 3CHVA 2DZUA 1QPOA 4FB7A 1M7PA 1H61A 1FDZA 5F4XA 2NXHA 3ABSA 3P8IA 3CM4A 3LCLA 5E1QA 3HPSA 3P80A 1H51A 1GVRA 1SPQA 1LCOA 3DI0A 4DO5A 4Y90A 3MP3A 2B0MA 2GVLA 1R2SA 3LXAA 3TW6A 2NV1A 3BO9A 2A5HA 4UTWA 3AJXA 5K7JA 3W1PA 3WK2A 2ISVA 3TC6A 4AHQA 1H7NA 1WQ5A 1FWSA 3DFPA 1J4EA 4I9AA 2QCEA 1C29A 1FY6A 2I1OA 5DCEA 1SUXA 3DENA 4XTIA 2GQAA 1D9EA 5K9XA 3W73A 4LTSA 3P5YA 4KFPA 5G2WA 3N3MA 1W31A 2V81A 1GYLA 3CT7A 4L4MA 3FLUA 3MI6A 1OF8A 1EUAA 1GT8A 3GNNA 1FXQA 3TIMA 4S2BA 5DELA 3W7HA 1LBFA 1OF6A 5KZEA 2WJZA 3Q94A 1W3IA 1QNVA 4CQAA 3I6RA 3W2UA 1H7WA 3TE9A 3MP5A 1G4SA 3P67A 4EF8A 1ICSA 5FEZA 5FEXA 3LHYA 2E6YA 4GUIA 1LLWA 4UTJA 1ZCOA 4H6KA 3O16A 4IMCA 1GG1A 2RFGA 2VFDA 3OEXA 1TPFA 4UTTC 4OWGA 4U4MA 2JKPA 4WY0B 3LV6A 1ADOA 2BZNA 3ZFHA 4O13A 1OFPA 1GWJA 4HSOA 4QQ3A 1C8VA 4WZHA 4UFJA 2BLEA 1OHLA 2A1YA 1SSGA 1H63A 3IGSA 1FDYA 1GVSA 3C2EA 3M5XA 2V2HA 4JNMA 3VNDA 3RMJA 2VFEA 2ZZ2A 3OG3A 3LHWA 4K37A 2YPIA 3C0JA 4HT3A 3N9RA 2Y7GA 2A21A 4M19A 1A5SA 3EKZA 1RQHA 2Q3RA 3FJ6A 3S6DA 4JICA 2FIQA 1GEQA 1RR2A 1XBXA 3NQ8A 3NYZA 4K8HA 2VXNA 4JXCA 3W75A 4OHQA 4O11A 2Z0IA 1W37A 3LM7A 4Z1DA 3BLFA 3EWYA 1W5MA 4DPQA 2QJGA 3O1NA 2C14A 2Y89A 1SR9A 1EX5A 3O6CA 3U2OA 3IIPA 1TMHA 4QSHA 5EA9A 1RV8A 3HBLA 3G0SA 3QMSA 1NAL1 2WO5A 5D2TA 1MXSA 1ZAHA 4AMAA 4UTTA 5HULA 4BR1A 4Y8FA 5G1YA 3P61A 3C3NA 4JYDA 1P0KA 4YLWA 3C2VA 4LVBA 2PCQA 3CC1A 4M6QA 2WKJA 1A53A 4YXGA 3ATYA 3BG9A 3R5EA 4P61A 4XKYB 2BTMA 4M7SA 4UR8A 2QCMA 3E12A 3HGRA 1IXPA 3BLEA 2WNNA 3CTLA 3STGA 4N9DA 4E2BA 1PE1A 3UZJA 1XDLA 1SO4A 3N34A 5T26A 4RZ4A 4CNNA 3SSJA 4IXXA 1B4EA 3GAYA 1KV5A 4BWLC 2XFWA 3W1AA 2GVGA 1YLVA 3W2KA 2WSQA 3S8HA 5IBXC 1OFAA 3WK0A 4L4LA 3G8EA 1HTIA 3UD6A 1QO2A 3W74A 4JTLA 3GAKA 1FWWA 3JRKA 5AC7A 3SI9A 1B3OA 4HNNA 4MY1A 4TIMA 1QPNA 4IMFA 3DGRA 3SFKA 8TIMA 1FDJA 4BI6A 4HHPA 4N6EA 3RFAA 3NQVA 1TPUA 4JD4A 1TREA 3UWZA 3NAVA 2WQPA 3HGJA 5KZMA 2E1DA 3W7IA 2XN1A 1CI1A 4NNCA 4BWLA 5DCDA 3MJYA 3B06A 1KM3A 1NEYA 2DORA 1OK4A 1I8JA 3HG4A 4CNOA 1N8FA 3WJYA 2XN2A 1SZEA 4K6AA 3OBKA 3S5NA 4JTGA 2DU2A 4DF0A 2Y62A 3L2IA 3LCGA 5I3FA 2PRLA 4DQWA 2YR1A 3I7RA 3LI1A 4LS1A 3GYEA 3GDRA 4CQ8A 2H8ZA 4IJBA 1DOSA 3NR0A 2YYUA 1XFBA 5I3IA 4POCA 2CZEA 4LVGA 1K3UA 3A22A 3TV8A 4MPQA 3QH2A 4I7UA 2ZZ3A 3NXFA 3O06A 3N2MA 2Q8ZA 3NL6A 1A5CA 4XZ9A 1M5WA 5DBTA 1H5YA 1RD5A 3L0GA 1SSDA 1BEUA 4E38A 2B7PA 1KLZA 2ATMA 4QITA 3W1TA 1TPB1 5TBOA 4IPIA 3PVFA 2CU0A 2QCDB 1AW1A 1H1YA 4RX0A 2QDGA 1FBAA 2VC6A 3FS2A 2NXIA 3W7RA 4DO6A 3STFA 1UCWA 2QCHA 4ADUA 1J5TA 3W85A 1BKSA 2NLIA 4JTHA 1F6KA 3G1AA 3GIYA 4IMDA 2E77A 3EKLA 4FX8A 3PBWA 4XBKA 1W3NA 2GJNA 3P74A 4OBTA 1SW0A 2P10A 1G69A 1O95A 1Q6OA 4TO8A 3TFCA 3PB2A 3TROA 2A4AA 2C15A 1K7FA 3BPWA 3PUEA 2V2CA 3NQCA 5CZSA 2FJKA 4O1CA 2V30A 1W0MA 1GTEA 3KRZA 4MZ8A 1TJPA 3BK0A 3FYOA 1X6UA 2NWRA 1LBLA 2F84A 4BFAA 4FNUA 3O8AA 2G97A 4LS0A 5F4WA 1OJXA 3BG3A 2VKZG 3EB2A 3G1DA 3TX9A 3NPWA 2VEIA 1XC4A 1VQTA 3G0XA 4Z1BA 2G5WA 4IMEA 2QUVA 1DQXA 2TMDA 5AHEA 3WJSA 3DFOA 1QCWA 2P1FA 1H7PA 5A5WA 5G2IA 4JTTA 5AC8A 2YFNA 1S5VA 2FPTA 1WXJA 4CCDA 3VFLA 1TTPA 1FCBA 1GVOA 3KVJA 4O0ZA 1JCLA 2OT1A 2YDAA 3BG5A 3IGUA 3F1QA 4H4IA 1YTKA 1F74A 5C2XA 1IXOA 1GYNA 2E5BA 1GOXA 2Z1BA 4JYEA 3EWUA 4AWUA 1O94A 2TSYA 1JQVA 4O15A 4CCEA 7TIMA 4GUJA 5K9CA 1AW2A 1OFBA 3DKLA 2GQ8A 3W70A 3RF9A 3L65A 3P7YA 4RK8A 1B4KA 4QNWA 3UPWA 5C54A 2Y7EA 4Q32A 2YCEA 4ORIA 3TH6A 4O17A 3PUDA 4O4VA 2X16A 2ZRZA 2QKFA 2WNQA 2ISSA 3TNOA 4UMAA 3BV4A 5AHLA 1LTDA 3STCA 1W56A 1VHCA 1N55A 1EP1A 4YMZA 3W1QA 1TCDA 1Z41A 2QEZA 1YADA 1LP6A 1WV2A 4KWVA 4LVAA 1ML1A 2OMAA 3L5MA 1SQ7A 4ZMGA 5K2ZA 1EIXA 1VJIA 5AHIA 4O50A 4TMCA 2E6DA 1YDVA 4JX5A 2NZLA 3S42A 4NVTA 1ZY9A 1VLIA 3WFAA 1GZGA 4CLMA 4UXDA 5D03A 2RDWA 3Q58A 1I4NA 2CLKA 4NZFA 1XL9A 4NJIA 1T96A 4LVFA 1B57A 5CZJA 3GXNA 1M7OA 2RDUA 4UTLA 2JKEA 3PWAA 5L9FA 2B7OA 3R2GA 4JDBA 3CLMA 3FKRA 5D04C 3QM3A 2ZRYA 5LNUA 5LNWA 2Y61A 3F4WA 4EOUA 1XXXA 2ATSA 2OZ0A 1CX9A 1XM3A 3CEUA 2TPSA 2ZCGA 5FF0A 3BW4A 1X1OA 1FWRA 1GG0A 1DJQA 1QPQA 1WDWA 3LLFA 1KW1A 2E6AA 3HJZA 4R53A 5G2HA 3DHFA 3C4UA 4X2RA 1VPXA 4LRSA 4Y9AA 5DY3A 3W1NA 1MZHA 1PL9A 4YCPA 4JTSA 1K7EA 3LHUA 1ME8A 1LROA 2LLEA 4HNVA 3TUUA 2Y7FA 3KXQA 1IF2A 3GVGA 3MHFA 3EWBX 3HPZA 1SW3A 3LTPA 5LHEA 3UY7A 4Q4KA 2E68A 3H54A 5CGQA 2E09A 1GVFA 5K4XA 1MEIA 2CZFA 2ZA2A 4I7WA 3UWUA 4UIOA 1JUBA 5AC6A 3OIXA 2TRSA 3EWXA 3W7OA 2ZQ0A 3QJAA 3M0ZA 1VHNA 1R30A 3KHJA 5HWMA 3KRSA 4UFIA 1TPVA 1ZAIA 2NUWA 4M6PA 3T55A 1KBIA 3A5VA 5HJLA 3B05A 2X1RA 4O8RA 1QWGA 1OFQA 2JBMA 3JR2A 2ISWA 3LV5A 4JS3A 4O1DA 4FNSA 2C18A 1XBVA 1QO5A 3TMLA 5DN1A 1OG0A 1AL7A 3DZ1A 5FEPA 1A5BA 2VFHA 4J9JA 5EYWA 4ZQMA 3FEMA 3QF0A 1DKWA 2VFGA 2PRHA 4HNTA 3M7WA 4JIQA 5EBUA 3T4CA 4NJJA 2Y6ZA 3PAJA 1JCYA 4UFLA 1VZWA 1TV7A 5BW6A 4NNAA 5D2XA 1GJPA 1Z42A 1QFEA 3PBUA 3UPBA 4FIRA 4XWUA 4LUIA 5KINA 2A6LA 1JR1A 4DBDA 3G24A 1OABA 3LHVA 1OFDA 2HS8A 1UASA 1TTIA 2ZZ6A 2WSRA 1DJNA 2C0AA 3FA5A 4FNTA 4LS2A 3FIGA 1SU5A 3K30A 5AYYA 2QCFA 2H3DA 5FF4A 2EPHA 5GVJA 4HN4A 1S5TA 1I2NA 4AB4A 5A8GA 3LB0A 5D2YA 2DZVA 1IGSA 2NUXA 2J27A 2V8ZA 3NPVA 3W7GA 5FF7A 2V5BA 3CB8A 4AHOA 4MJZA 5H91A 3ABOA 2B4GA 1R47A 3NQFA 5FI8A 3W7NA 3LCFA 3WK3A 2YYTA 3GLCA 4JGDA 2QR6A 4PTNA 4ORMA 5H2ZA 3W87A 1K03A 3UWQA 1K7XA 3NQMA 4B5NA 2YSWA 3W2JA 3CWNA 4DELA 4A22A 1T99A 4NJHA 5F2GA 4O52A 3W07A 2VELA 4MOZA 5I3HA 1VYPX 4UNLA 4C1LA 5FF3A 1YDNA 3C8FA 1L6SA 3M43A 3W7CA 3BGGA 1LBMA 3DFTA 3W3OA 3W7KA 1FQ0A 4MYXA 1KM5A 2DZWA 4XQ6A 3THAA 3SW6A 3N19B 3W7JA 1HG3A 1ZALA 3GDMA 1O5XA 2G95A 2YW4A 3PY2A 1RQBA 2A7RA 5SWUA 2FLIA 3P8JA 1LLZA 1AW5A 3HQ1A 4A29A 2R91A 3IVSA 1ONRA 3GZ3A 3M1ZA 2RH9A 3DFNA 4R7JA 1G4PA 4PA8A 3AO0A 3C2OA 3CIXA 4O10A 4JYFA 1IIHA 4ZVJA 1JUEA 1NSJA 3N14A 1UUMA 4Z0SA 4MY9A 4FIQA 1OX5A 2HMCA 2C6QA 3KX6A 3B03A 3UY8A 3S5ZA 3G3MA 5C6MA 2H90A 2ZTJA 2Y7DA 1VH7A 3G0UA 1O4UA 1PIIA 3LRLA 1ZFJA 4MFEA 4Z1CA 3TC7A 3CPRA 4QJ1A 1XBZA 4LU0A 4KWWA 3ABQA 3UNDA 3PS7A 4X3ZA 5DXXA 5HINA 3VE7A 4LY8A 2PURA 4Z08A 4FXSA 1BWKA 5FESA 1TO3A 4LV4A 4JY8A 4WD0A 1FCUA 3VE9A 1K8ZA 5ABTA 3S9YA 2FB3A 1O60A 2X1TA 1F05A 4O57A 3CWOX 3NQDA 3NQ6A 3L5AA 4GWEA 3KAOA 3EXSA 1AMKA 3SGZA 4IQLA 3MWAA 4JR5A 4KFOA 3GDTA 5F2LA 2CFFA 3NQ7A 1U83A 3MW7A 3UWWA 1IXQA 4EVZA 4TR9A 3INPA 3TA6A 1OX4A 3M5VA 3C56A 2ZRVA 1I2RA 3A5FA 3TSMA 3SR7A 3HB9A 5FF2A 2NWSA 2A0NA 4N2YA 2V0TA 3OVRA 3L66A 1Z48A 1JRBA 3TJXA 1UJPA 1LM1A 4FX6M 5G4WA 5CSSA 5LGZA 1B9BA 3W1XA 3LX9A 1FWNA 2ZA1A 4AHPA 2E5DA 3ATZA 4NX5A 3FFSA 4A2RA 4N9EA 1X7FA 1SW7A 4DEFA 2JK2A 4O53A 1JVNA 3MBDA 2A6NA 1SZNA 3QEZA 3DHDA 1KV8A 1OVDA 2NUYA 5LGXA 1HO4A 1QDSA 2YFOA 1KFCA 5CPOA 3PSWA 2RKXA 1LOQA 1QOPA 2X1UA 3HO8A 3LBCA 3QSRA 1A5AA 4QISA 3TR2A 4EF9A 3WJZA 4JY9A 2O7QA 4RXFA 3NM3A 4UFKA 3Q2DA 3H55A 1O5KA 3M44A 3PF3A 1KBJA 1I2PA 3WJWA 1YPFA 1KLYA 3GDLA 1YXCA 2Y63A 1I45A 2DP3A 2QCDA 4GUGA 4O18A 2A7NA 2ZFAA 1OYAA 1DL3A 3RLVA 1JUKA 1JCJA 1LORA 3E9AA 3DBPA 5F2IA 1H7OA 1YTDA 1TPH1 2ZRXA 3LRKA 3DXIA 5LHFA 1EUNA 2YXGA 3HIJA 3IV3A 1H1ZA 4K7VA 2C16A 3HG3A 1WAUA 2ZRUA 4G1KA 1I2QA 3P60A 1W8SA 4AF0A 3SGUA 3VI2A 1TV8A 3OVQA 2AAMA 1LRQA 2FFCA 3S0CA 1YPIA 4IWWA 1KM2A 1PS9A 3LI0A 3UWYA 3NQAA 2QAPA 1KA9F 1P1XA 2NV2A 1W3TA 1WOBA 4EIVA 4LNYA 1G67A 1XCFA 2AGKA 3MMTA 2QCNA 5L6UA 2KZHA 4FEZA 1ME7A 4UNKA 3QW4B 1P5BA 3KVMA 3R8RA 4QNEA 3UZ5A 2WV8A 4P2VA 1LDCA 1HO1A 3O15A 4IXHA 1DV7A 1PCWA 2BX7A 4NU7A 3GR8A 4IUOA 1Y0EA 1LOLA 4ADTA 1H62A 4QM1A 3KOFA 5F1VA 3QQ0A 2QCLA 2ZYFA 4UCGA 3W7LA 1EB3A 5TIMA 5AB3A 1TB3A 3W71A 4IX0A 5KTLA 3RU6A 5HR6A 4AAJA 3H53A 4DXVA 4OGZA 3CEPA 4WXYA 3TSDA 2H6RA 2OX1A 1FCQA 4OU1A 1W5QA 3HG5A 3HOJA 4LVDA 3RNDA 4M7TA 1EP3A 3RLUA 1LRNA 1UUOA 3A9IA 3MBFA 2NXGA 2CLIA 5C5YA 3M16A 3IIVA 3QSTA 5AFDA 2YW3A 3JS3A 3TKFA 3B0VC 4QIUA 3LBMA 4H3DA 2X1SA 5EL1A 1QOQA 1KM4A 4U28A 4MIMA 5FEWA 2CLLA 1QAPA 4GJ1A 1F73A 4QAIA 2H8XA 2RHGA 4GNJA 5G1TA 3L67A 2DZXA 3LCIA 2PC4A 3N2XA 5HR7A 2GUUA 4JTIA 4E2DA 1S3HA 3G18A 5HMSA 4AEOA 1CW2A 1XBYA 3S5YA 3W22A 4JTKA 4PL2A 3EWWA 1F5ZA 2FTPA 3B8DA 3S1VA 4UTMA 3HMJG 3DFSA 4UTWC 4JTFA 4NUWA 1HL2A 4O1BA 4O0KA 1RZMA 3MI3A 1W54A 4LOCA 4MZ1A 1Q45A 2HTMA 4RR4A 2VFFA 1R46A 4IX2A 3A24A 5F2MA 2QUTA 3EX4A 4N9BA 1KFEA 5I3JA 1ICQA 1SO6A 3LCWA 3W2NA 1D3GA 3C2RA 3KVKA 3QW3A 2J88A 4Z0JA 2VFIA 5LSMA 3NOEA 4O4WA 1EWDA 5CZTA 3Q37A 1TPDA 3I7SA 3IGXA 3D0CA 1DORA 3TAKA 2WNZA 3A23A 3QRHA 3G1YA 4S1FA 5KMYA 3L0NA 4N9CA 3T7VA 4ZL1A 5BOOA 4R34A 1SO5A 2HS6A 1TQXA 2EGZA 3NL3A 3N73A 1K02A 4RZ5A 4AWTA 3F4NA 1EEPA 4JIPA 3W7EA 4Q33A 2D73A 1A50A 1WOAA 1VR6A 4DF2A 3GNDA 4GE8A 4UFMA 1JCNA 1F7BA 3L21A 3W1MA 1R2RA 2OT0A 5K3VA 1VRDA 3KRUA 4BI5A 1QR7A 2I14A 2VENA 5AOUA 1XI3A 2E6FA 2IQTA 3O07A 5KITA 3ANYA 4CQ9A 3NNTA 1W5OA 4NJKA 1VYRA 1XUZA 1TQJA 5J5RA 4UTKA 3OVPA 4RKAA 3UXAA 4WXZA 2WSYA 1TJRA 1WA3A 3LGEA 1OFRA 3GB6A 3W1LA 1VS1A 2NX9A 3TFXA 2V9DA 1ALDA 5E93A 1T8XA 5DCBA 3YPIA 2C1HA 3IEBA 4NNBA 4AXKA 3QQ1A 2V2DA 4Y6GA 3GXPA 4LV9A 4K8EA 3BGJA 4GUFA 3DFQA 2OJPA 3MYOA 1ZNNA 4MY8A 1KFKA 4MYAA 1NF7A 1WBJA 3QFEA 3W23A 3NM1A 1GQNA 3O05A 2EHHA 2ZDRA 3USBA 3TMQA 3NQEA 5G4EA 1MEWA 2I9EA 1AL8A 4OV9A 3G22A 3W88A 1MEHA 2CLFA 5K9DA 5AYZA 2O7SA 4DF1A 2DZPA 3SECA 2QJHA 3W7MA 3LOTA 4M6VA 1H60A 3PC0A 1AK5A 2EF9A 4S2CA 1QPRA 2DJLA 2R94A 4NQ1A 4AVFA 4N4PA 2A2IA 2QCGA 1GTHA 4CNPA 1Q6QA 3IRDA 1Z44A 3PULA 1OYCA 2DZTA 2PE4A 2YX0A 2CWNA 1JQXA 2E5CA 3FYPA 3CQ0A 1X8FA 1L9WA 1XUUA 1W5NA 2A85A 3DKJA 4IMGA 3GKFA 4ALDA 5C55A 1BWLA 1PV8A 4WY0A 2TYSA 3W1UA 4O54A 4LWWA 1V7YA 2R14A 2XN0A 3HGOA 5U4NA 4XTDA 4HPXA 3EX2A 1L2UA 5CPLA 1Q6LA 1KFJA 5CKSA 3S1UA 1NVMA 2WOQA 1FWTA 4GXMA 3BW2A 3UQNA 4UUIA 4NX0A 1NF0A 3M41A 2J9ZA 4BK9A 3TXVA 1FCVA 3LCXA 3QMTA 4N6FA 5HUPA 1HUVA 2JGYA 1C9DA 3B0PA 1EP2A 4I7VA 3CU2A 4IGHA 1MSSA 2J9XA 1VGAA 1W5PA 1ZENA 3MP4A 1H50A 3EX1A 3ZS4A 5D38A 1EWEA 5HQEA 4DO4A 3P84A 4ICNA 3NPXA 5D05A 3PG8A 1G4EA 2X2GA 1K8XA 5E0KA 4MLRA 4GFSA 2ALDA 2Z2UA 3W7DA 3LHZA 1FUYA 2CZDA 2AQWA 1ZJIA 3QZEA 1FXPA 3N9SA 4FNPA 4HIBA 3ELFA 5DY2A 1TIMA 1TYGA 1UBSA 4YL2A 3PG9A 3U8GA 4OV4A 2ABBA 1YXYA 1OYBA 1VCGA 2NX1A 1GPWA 3O6YX 3ZR4A 3G1SA 4JX4A 4JTJA 1OFOA 3R89A 2GPTA 1ZAJA 6TIMA 2BXVA 4K39A 1VYSX 5AHNA 4GBUA 3KFTA 4NJGA 4XBSA 1DHPA 1KTNA 5CZ0A 4FXRA 4ADSA 2B7QA 3NO5A 1J2WA 2CLMA 2YGYA 4FNQA 5LNVA 4W9TA 3TAOA 5CSRA 3NQGA 4OQVA 4IPJA 3HF3A 4UFHA 4LRTA 1S5WA 1RVGA 3TQ0A 3RK8A 3BW3A 4M5PA 3UWVA 1IXNA 2PRMA 1FX6A 4RXGA 5U7SA 3E0IA 3WJXA 5CPMA 2C19A 1ME9A 4EWND 4ML9A 1G7VA 5D2VA 3DU0A 1H7RA 5F1UA 3QC3A 1KM1A 4UTHA 4TMBA 1EA0A 2HSAA 3L9CA 3C52A 4HSNA 5D02A 3G1HA 2ZTKA 3GK0A 4X22A 3DI1A 3EX6A 3M5YA 2R8WA 4GRSA 5D32A 1OFEA 1KM0A 4PH6A 4FHAA 4NT0A 3LLDA 3LERA 2ZRWA 4LC6A 1U5JA 4HKPA 3MI2A 3W83A 4HNUA 2QJIA 4A21A 5D09A 1TPEA 3NQ2A 4MLJA 3G3DA 4MFDA 4TU1A 4X9SA 4NZJA 5BMXA 3SZ8A 4Y96A 2A7PA 1R2TA 1VCVA 2FDSA 3ZWSA 1WBHA 2V82A 3S5OA 1KTBA 2CW6A 5G5IA 4WOQA 2J24A 3HGSA 4UTIA 2GQ9A 3W2LA 1KFBA 4CCCA 5EPDA 4PL1A 2W0UA 3NZRA 3C6CA 1ICPA 2ABAA 3W7PA 1L6WA 4HPJA 3MUXA 2F7FA 3MHGA 5KSWA 3I7QA 4JTEA 3IIZA 3W1RA 3TSBA 3B0UX 1KTCA 1V5XA 4ZQOA 3A21A 1SFLA 4A3UA 1OK6A 3SJ3A 1SFJA 1VLWA 4UMBA 4PODA 1TPC1 4GC4A 4LUJA 2H3BA 3DH7A 5EKYA 1JCXA 3M47A 1LOSA 1THFD 3TU9A 4KKXA 3S1WA 2Y85A 3I65A 3LHTA 4WUIA 4O12A 3NPUA 3MYPA 1TV5A 4WY0F 3NL2A 2Y70A 2UV8G 3L5LA 3THQA 2V5LA 4AWSA 1P0NA 2ZA3A 1XDMA 4WX2A 4JDYA 3C61A 3V1PA 5LNSA 3G8RA 2P0OA 3L68A 4LW7A 3IIOA 4FX7A 1G4TA 4RV8A 1VC4A 3PM6A 2QUUA 5DXYA 2FQIA 1L6YA 2X30A 4A2SA 4AF0B 3O6DA 4BI7A 2W79A 5D37A 1OX6A 4O16A 5HUOA 3W9ZA 5BMWA 4MZYA 1E51A 3GDKA 3LDVA 5LZLA 4ZQRA 4XKYA 3VKJA 1T0OA 3QYQA 4JN6A 3IVUA 3MHUA 1N7KA 3TW7A 2GJLA 3MO7A 3OA3A 5BRBA 5AYXA 3BVJA 1DQWA 1JULA 3LXBA 3LCHA 4PEKA 4NXSA 3B4UA 3W72A 2QAFA 5MHBA 3TCEA 4RJEA 2W6RA 2CLOA 4OT7A 4PFMA 1P4CA 3TJLA 4YCOA 3NG3A 4D2JA 4PC8A 1KFLA 4OE7A 1PHWA 1NFBA 1JJKA 2ZZ7A 3EWZA 3EXTA 2C13A 1OX4B 1EPXA 3W86A 5LNRA 3T40A 4MVAA 4FO4A 3G1VA 4ONVA 2BWGA 2VEMA 3STEA 3G1XA 1TSIA 3HPXA 5TQLA 1F6PA 1PCKA 2WPBA 4JEQA 5HNRA 1AG1O 4WJEA 1IIGA 3GXTA 2GVJA 1ZHAA 3LRMA 2DJXA 2Z6JA 3W76A 1TTJA 4C1KA 3LTSA 2QCCA 3BLIA 3QPZA 3HG2A 2QF7A 4YWIA 3U6WA 3UXDA 4BF9A 1TTQA 3ABRA 5D30A 2GOUA 3LXCA 1WX0A 2FPVA 3R13A 4ZQPA 4WQ6A 2J9YA 2C3ZA 3IVTA 3NEVA 4O1AA 4FF7A 3VCRA 3DAQA 1TRIA 4LT9A 1K8YA 2VOMA 3GKAA 5EMUA 2VEPA 4XUGA 4DPPA 4NXKA 1VCFA 4IOTA 1TRDA 1X1ZA 5AHFA 3TDFA 3TQVA 4AH7A 4WOZA 1M6JA 4KFNA 5J5DA 3E49A 3QPYA 3W84A 1DBTA 1D3HA 3TK7A 1F2JA 1G6CA 1W1ZA 5D2WA 3P62A 3E02A 1SZFA 5LKYA 3OHIA 3L0KA 3NGJA 4ZQCA 3S1XA 3T78A 2CLEA 1LZOA 6ALDA 4N4QA 2Q3OA 2QDHA 1WYIA 2YZRA 1YDOA 3WK1A 3R12A 3EXRA 4O14A 4K7YA 3GR7A 2RDTA 2BSLA 5K4ZA 1JCMP 3PBVA 3T44A 3F03K 5IBXA 1SO3A 1H7XA 2CLHA 4FNRA 3GX9A 1G7UA 1BTMA 2ZZ5A 2FB2A 2ZZ4A 5KZDA 4MJMA 5HWNA 3FKKA 4K36A 3PB0A 1GVQA 4GUHA 4E0CA 3P82A 3V75A 4R33A 3P5ZA 3M6YA 2CZ5A 3SY5A 4ZZ9A 4ZQNA 3O63A 2G96A 2OCZA 1YXDA 4K38A 4JX6A 3PBYA 4UR7A 3M9YA 2B7NA 1JRCA 3KVLA 4UC5A 3PR2A 5DLCA 1UB3A 5EY5A 1XKYA 3I68A 3M5ZA 2J6XA 1LRTA 3PUOA 1Q6RA 4N02A 1QMLA 1PVNA 4DBEA 3SIZA 3B04A 2JGQA 2Q8LA 1LYXA 1I2OA 2EKCA 5CPNA 3CIWA 1KM6A 3NVTA 5AN7A 4UTUA 2DZSA 1Q3NA 4JTUA 4O19A 2Z6IA 3W7QA 5CG7A 4PCFA 5AHMA 1F76A 3QMRA 3TQKA 1RQEA 3W6YA 5HWJA 4MUZA 5DBUA 3C2FA 3FJLA 3G1FA 4TX9A 3TXZA 3NDOA 2EAWA 2FPYA 5BNKA 4O28A 4RCXA 5I3GA 1YYAA 3NL5A 2JKAA 3FOKA 5D33A 4RZ6A 1DVJA 3UYCA 3ZWTA 2ZBTA 1TPWA 2VEKA 3EX3A 5F4SA 3IIXA 3EEGA 4MKNA 3PSVA 1RPXA 3E96A 3W2MA 1MO0A 3LTYA 5IM51
chains in the Genus database with same CATH superfamily
4UMCA 1YTEA 1E6QM 3VIMA 1QPKA 2V3DA 1KGUA 1KO0A 3ZVIA 1AA1B 1FDZA 3ABSA 2PODA 3CM4A 3LCLA 4J3SA 3HPSA 3P80A 1H51A 1SPQA 5E0FA 4Y90A 2DH2A 2B0MA 3LXAA 3AALA 3TW6A 4F0SA 3W81A 4GVFA 2XH0A 4GK8A 4ZO7A 2PU0A 4E2VA 3TC6A 1WQ5A 4HZ8A 1J4EA 1FY6A 4NYYA 2I1OA 1F6YA 1SUXA 1D9EA 4GI4A 1R7AA 3AS0A 3P5YA 3H21A 1W31A 4JCMA 1GYLA 3CT7A 4ICCX 4L4MA 2X0SA 3FLUA 3MI6A 3BXWA 4IIBA 4DN1A 3GNNA 1FXQA 3MTWA 3OW1A 1LBFA 4DUVA 3QBUA 2WJZA 4G8TA 4XUYA 1W3IA 2I5GA 5HBFA 3MP5A 3LMZA 3M0KA 3BANA 5FEXA 4C7FA 2E6YA 2VZTA 4GUIA 1JFXA 1LLWA 1IWAA 3O16A 2DIEA 3QV9A 2VFDA 4AZ7A 3OEXA 4UTTC 4S3BA 4U4MA 2NVDA 3ANVA 3UCQA 2XGBA 1ADOA 2XH2A 1XYLA 3VU2A 3H7VA 1F3TA 4HSOA 5HPOA 2BVYA 4UFJA 2BLEA 3M64A 4PTVA 5A6MA 3M5XA 2CESA 3K46A 3TLQA 2UBPC 3GHSA 2EJ1A 4PB5A 2Z2AA 3OG3A 5DANA 2WZIA 4W86A 4EACA 1LL7A 2ZKMX 4H6EA 2W27A 2Y7GA 1A5SA 5M5DA 2XIIA 4LUYA 2Q3RA 2I56A 4OKDA 3WENA 2L5HA 5ABHA 1AVAA 1RJQA 3GE7A 1WZAA 1UC4A 1SJCA 3SCOA 1RR2A 2VXNA 4ZXLA 3W75A 1B2YA 3B9OA 2WVSA 3BLFA 1W5MA 1FH8A 3SAZA 4DPQA 3W02A 1Q4NX 4PEEA 4UQBA 1QBAA 4H01A 4C1NA 2E9LA 3ITXA 3O6CA 1XYMA 3OYZA 3TYAA 1RV8A 2G3JA 4K1GA 3DYMA 1R5YA 5LYRA 4UBPC 5CC3A 2I17A 4H7VA 4JYDA 4MGGA 2PDHA 4QE4A 3R0DA 1UPPA 4L7ZA 1X7IA 2VI0A 3QHNA 4R9OA 4GXWA 4XKYB 4QFUA 4M7SA 2ZXQA 4N9DA 3N2CA 1AZ1A 4J3UA 3RMEA 4LAZA 4DLMA 3TYDA 1EJRC 3MT1A 4CNNA 1TUFA 4IXXA 1B4EA 4MB4A 1KV5A 1HXJA 3MMWA 1BF6A 3W1AA 2GVGA 4DX3A 4L65A 1TIWA 1YLVA 2DT2A 3MSYA 4L4LA 1UIPA 1HTIA 3W74A 4W85A 3BCFA 1FWWA 2O9PA 1TZZA 3JRKA 3GXFA 4C6KA 1MQRA 1B3OA 1Z3NA 4J2MA 3WL0A 1IR2A 4N6EA 3RFAA 3V18A 3NQVA 2WWCA 3BH4A 4IFOA 3V35A 5DCDA 5IDIA 3B06A 3W6MA 3URBA 3R10A 1NEYA 1I8JA 1JZ3A 4ZOCA 1QHPA 3WJYA 1TVPA 5D9NA 3OBKA 4C90A 3L2IA 3LCGA 1CDGA 4DQWA 3LI1A 1NDZA 2J7CA 4CN6A 4RDVA 4WKHA 3UVAA 3VC5A 3FDGA 4NP7A 3NR0A 4ZOEA 1AODA 1XFBA 2CBVA 5J04A 3VD9A 4F8XA 1K3UA 4F2BA 4C6MA 2OSXA 1VBRA 3CQIA 1RLCL 2ZZ3A 3O06A 1SJDA 1ITCA 2AQOA 5BYWA 1A5CA 3CLWA 1M5WA 1V93A 4HA1A 2FKPA 3L0GA 1BEUA 4F0RA 2P50A 1TWWA 1QI3A 1V3LA 4P7OA 4QITA 1WAWA 1TPB1 2VGFA 3CQKA 3SY8A 2DQWA 4QP0A 2VURA 4JOMA 4HVXA 1AW1A 4BF7A 3PZIA 4UCFA 4H8UA 4BZYA 1OBAA 4DO6A 1NH6A 1UCWA 4DUWA 4HHMA 1V7AA 3RM9A 2FMNA 2Y8VA 2CWXA 3GIYA 1ADSA 5HMDA 1U1UA 2GJNA 3P74A 4GINA 1SW0A 1G69A 3PJXA 1Q6OA 5AYIA 2EPKX 1AJ0A 3KL5A 1QNSA 3PUEA 2EEXA 3NQCA 2PWGA 5I00A 2J7HA 1CGWA 1W0MA 1GTEA 4MZ8A 4ILSA 3FYOA 1LBLA 2F84A 4FNUA 3O8AA 2G97A 4LS0A 5HJXA 5F4WA 2VKZG 3G1DA 2A3HA 3XINA 4EKJA 1TJ2A 2VEIA 2G5WA 2TMDA 4JQAA 3WJSA 5A5WA 4JTTA 1MVYA 1DIDA 2YFNA 3BLKA 3UW6A 1O1HA 3VFLA 1D8CA 2VGIA 1RH9A 2OT1A 3IGUA 3F1QA 3H4GA 1YTKA 2HRWA 3DCPA 3TJIA 1V6UA 4D9PA 5CC6A 2Z1BA 4JYEA 3EWUA 4O15A 3VX0A 3GIPA 4AD5A 3P7YA 4ZBCA 4C6OA 1RCXB 4QNWA 2POZA 4A8RA 4H1ZA 4JFWA 4M1BA 2D23A 4O4VA 2VVNA 4DJEC 5AHLA 3STCA 3ZJ6A 1OCQA 5IXEA 3KL0A 1ZRQA 1EP1A 4YMZA 1TCDA 3CB3A 1Z41A 4KERA 4LVAA 3AHVA 1RA0A 4W7UA 5E9XA 1PPIA 1VJIA 5AHIA 1B30A 4O50A 4TMCA 2E6DA 1YDVA 1VF8A 2QULA 3KBMA 4AZIA 4DXKA 2BY0A 1SFSA 4PTMA 5FJTA 1O12A 3LQLA 4RDWA 4EXAA 2VHLA 3WDPP 3Q58A 4DUOA 1RK6A 4ZB5A 5CPSA 1B57A 4LX4A 4QEEA 2RDUA 4UTLA 2JKEA 1KC7A 3GTIA 1UD3A 4L80A 3R2GA 3ARQA 3NSMA 2EG6A 2Z7KA 5D04C 3PZTA 3GNOA 5LNWA 1WDDA 4EOUA 3ICJA 1DXIA 4AU0A 1P6CA 2B81A 3CEUA 2TPSA 1U22A 3BW4A 1X1OA 1T41A 1GHRA 1DJZA 1KW1A 3WMSA 4O0QA 3NO3A 4R53A 2AL2A 4KQNA 4PB3A 1Z9AA 4LRSA 4Y9AA 4ZR8A 4DBSA 3VC6A 3W1NA 4GY0A 3MANA 3NZGA 1MZHA 1L6GA 4JTSA 3WNMA 3JW7A 4HNVA 3GVGA 3EWBX 3UJ2A 1Y5VA 4A8IA 3LTPA 4QGCA 4ZEPA 4PB4A 3NZQA 4Z42C 4DJED 2ZE0A 4AIBA 1TV3A 4GGHA 4PSPA 2ZA2A 3URAA 1R3VA 2ZQ0A 4LBRA 1R30A 3KHJA 1ZAIA 2BOEX 2VVSA 3KTCA 3B8UA 1AUSL 2X1RA 4O8RA 1OFQA 3RU8X 1A4LA 4LCRA 5BWFA 4D6IA 3F5LA 2PDQA 1XIGA 3M46A 4FNSA 2C18A 1TV4A 3KBVA 1QO5A 1B3XA 1S1RA 5FEPA 1T6MA 3P2VA 1A5BA 4CQBA 1QI5A 2VFGA 2D2GA 3R79A 1E0UA 4V1XA 5EBUA 4ZO9A 1XD0A 2Y6ZA 2PF0A 4UFLA 1TV7A 3MCNA 5CC7A 3PBUA 5KINA 1TKKA 4GD0A 2A6LA 3TWBA 3CHCA 5HK4A 3VA8A 1OFDA 1TTIA 1KB3A 2C0AA 3FA5A 4FNTA 1SU5A 3T05A 2EPHA 2YDQA 1XC6A 3MWCA 4CKQA 4AB4A 3ENLA 4KS0A 3WL1A 3O9NA 4HJWA 2NUXA 4B3LA 5E6ZA 1J6PA 5GJPA 3CB8A 3WLPA 1HJXA 3AIQA 1YBQB 2BNJA 1D8WA 3W7NA 3LCFA 4S39A 1OM0A 1MNZA 2QR6A 4E3TA 4PTNA 1K03A 3AXKA 1DIEA 3UWQA 1K7XA 2E25A 4IP7A 3REQB 3F4CA 2FZDA 2UY5A 2YSWA 2HPMA 1JPIA 1C8XA 2BVWA 4O52A 3W07A 1UWSA 3NDZA 3WEOA 4AD1A 4UNLA 4XVDA 1L6SA 2C79A 4NAEB 1DE5A 1LBMA 3W3OA 1W3JA 2CBUA 4UZSA 2DZWA 4XQ6A 3THAA 1RBOB 4XZHA 3EOOA 5FJUA 3AZRA 3GDMA 3AUOA 1UWAA 2YW4A 5SWUA 3P8JA 4HTYA 4A29A 4CD7A 4Y2WA 4KCVA 1J93A 3GZ3A 3PHAA 4E4FA 2I57A 1G4PA 3AO0A 3C2OA 4LAKA 4Q6JA 4O10A 4L5ZA 4JZ5A 5BZAA 3AHZA 4Z0SA 4FIQA 2WVTA 5EMMA 1KWKA 1GCYA 3UY8A 4GLEA 2H90A 2HXUA 2PDUA 3G0UA 3UZXA 1O4UA 3LRLA 4F0KA 1ZFJA 4MFEA 4Z1CA 2VM8A 3TTSA 4R88A 4KWWA 3ABQA 4WSJA 4QJ5B 3L4UA 3CHFA 2QS8A 4LY8A 7A3HA 4Z08A 4JY8A 4WD0A 1IE7C 4IP4A 1OIFA 2ZX7A 2GL5A 2PDWA 1F05A 1NFGA 4GHRA 2PWEA 3NQDA 2ACRA 3L5AA 3EBVA 3KAOA 4GWEA 3EXSA 1AMKA 5EFFA 5HATA 3EEZA 4IQLA 3PZQA 4CNSA 1QU4A 3NQ7A 1U83A 2HVMA 2QDDA 1J10A 3ARSA 5REQA 4EVZA 3UERA 4U3AA 4QLJA 3M5VA 1BGAA 5IFPA 3P14A 1EJWC 4G7EB 5HA7A 2CNCA 3HB9A 3GD6A 5FF2A 1V79A 5ABFB 2E8YA 3V5FA 1Z48A 4YVXA 3NEHA 1QUMA 5A94A 3N29A 1OINA 2DSVA 2FZ8A 3W1XA 4U2ZA 4LJ3A 1FWNA 1JDDA 1XIFA 3V0TA 1W1A1 3GR4A 3H7UA 2QUNA 4O53A 4X2PA 2A6NA 2PF8A 1EBGA 1KGWA 1HO4A 1QDSA 2IPGA 3WQ4A 1OZMA 1KFCA 2OZ3A 5CPOA 3PSWA 2Z27A 2WCGA 3TR2A 1HP5A 4MNKA 3WJZA 4ACYA 3I3DA 3LGGA 1W17A 4RXFA 3GHTA 1I2PA 1YPFA 1KLYA 1T40A 2Y63A 2QCDA 3L4YA 4DYEA 2CZVA 1V02A 2XZ7A 5I24A 1VD6A 3GHRA 1TPH1 3LRKA 1A0EA 1TVLA 2GQ3A 2Q01A 5HQLA 1UUQA 2A3CA 2DSUA 3ARZA 2ZE3A 1H1ZA 1WZLA 3HG3A 1I2QA 4AF0A 3WELA 1TV8A 3OVQA 4B5SA 1LRQA 2GVYA 1R3QA 2CITA 3UWEA 2QAPA 4QXIA 2PDMA 1W3TA 4EIVA 1G67A 2X05A 3LU2A 1XLJA 5PTDA 1O5QA 4GMEA 4ZOAA 3R8RA 4IQJA 1RBLA 3LA4A 3UZ5A 3SDOA 3FX4A 4L61A 1IT7A 1PCWA 2OXNA 3O3RA 4A3YA 4DNMA 3ES8A 4NF7A 1Y0EA 4QQUA 4PYSA 2CHNA 3KOFA 3QQ0A 2QCLA 3W7LA 5GJNA 5TIMA 3S2MA 2B31A 3RU6A 1XQLA 3IJ9A 4AFYA 2H6RA 5D4YA 3HOJA 3LPPA 1BKHA 4LVDA 5DEZA 3RLUA 3VZXA 1LRNA 4S3EA 3MBFA 3HA1A 3WLIA 2DY3A 3K8KA 2CLIA 1Z89A 5EL1A 4JFVA 1W3KA 1OQFA 1KM4A 3VKBA 1BRLA 4GVIA 3B4YA 5C70A 1TZ7A 4LSBA 2A79A 4HCHA 4LUSB 2RJGA 2KAUC 4GJ1A 2Y5EA 4UQEA 2QW5A 4KPLA 1NQ6A 4C91A 2HE8A 5HR7A 1SYTA 4JTIA 4E2DA 1S3HA 1GK8A 3G18A 3MDWA 3MUCA 1L0PA 1Y65A 4JTKA 4GY7A 2DVTA 3AC0A 3S1VA 2WYSA 4UTMA 2A3LA 3DFSA 4UTWC 4PTXA 4O1BA 4O0KA 2VNCA 4LOCA 4MZ1A 2AGTA 1ISXA 4GGBA 2VFFA 2UY2A 2Z1XA 2J25A 5ENLA 4CVWA 3A24A 2QUTA 1JDCA 1GZJA 1ZBKA 4N9BA 1KFEA 4PUWA 1XIDA 4D6FA 1Q7QA 3GNRA 1RCQA 2J88A 3TTYA 2OO0A 3FAXA 3NO1A 3CZLA 4WIWA 5LSMA 4DLFA 3CZEA 3EMQA 1EWDA 5CZTA 3S2LA 4AD0A 4LAOA 1LT8A 3GVQA 2VDIA 2WM0A 1SMAA 2GVEA 3T7VA 4ZL1A 1OT1A 3H6OA 3BLOA 4CU7A 2V5KA 2Q8XA 2HNHA 3UXKA 1OC6A 4ERIA 3VD5A 1VJZA 4AWTA 2ZIDA 1AD1A 1IGWA 2D73A 1VR6A 1AZ2A 2FVKA 5A8NA 4GE8A 4J5NA 1JCNA 3VYLA 1F7BA 3L21A 3W1MA 4MTVA 3ALGA 4KW2A 5LA1A 1VRDA 2VC5A 4BI5A 3PFRA 2VMFA 3EA1A 3O07A 2R1MA 5KITA 1W5OA 2YL9A 1E5JA 5J5RA 1LF1A 4RKAA 2GWGA 4IF2A 3IJ6A 3A3XA 2WPGA 1UKSA 2BOFX 2O9TA 3KTXA 5CQ1A 5AYBA 1R3TA 5GQBA 2VR4A 3EDFA 3QQ1A 2V2DA 4S3AA 4NZ3A 4Y6GA 4B2DD 4UOQA 3BGJA 1BHGA 2RJHA 1ZNNA 4C6BA 2D3LA 3APYA 4IJRA 1HVXA 4MYAA 5GNYA 2P3ZA 1GOMA 1GQNA 2EHHA 2ZDRA 1GPFA 1I9CB 1S2UA 2EPOA 3TMQA 3EMZA 5FACA 3N4AA 2PZ0A 2VX7A 4MNMA 1V6XA 2BV9A 4GNVA 4M29A 2O7SA 3GU2A 5XIAA 3WUBA 3PTKA 3W7MA 2EF9A 4S2CA 2DJLA 1ISVA 2DT3A 2H9AA 4NHVA 2REQB 5C2GA 1LLOA 3VM7A 4PTDA 2OGYA 4Z1YA 2PAJA 3IRDA 3U2EA 1PX8A 1Z44A 2NVAA 3Q67A 5FOOA 4H2CA 2DZTA 3UZZA 1X8FA 1XUUA 1W5NA 3DKJA 4IMGA 5HAOA 2VZOA 3KBJA 1JYWA 1LUCA 2GGHA 4LWWA 2WZHA 2XN0A 4Q6XA 3TA9A 4HPXA 3EX2A 4C6LA 5CPLA 3HQNA 5CKSA 3PUGA 3W0KA 3S1UA 1A3HA 1NVMA 4WJ8A 3QHOA 3IJLA 1HGWA 3ZLGA 4BK9A 3CAQA 3A9BA 4YTSA 1HUVA 3ZJ7A 3TVAA 1EP2A 4I7VA 5AZ0A 1MUCA 4IGHA 5TF0A 5D9PA 4BY3A 3RX4A 3GO2A 3GBEA 4UQAA 1R3SA 3MP4A 1H50A 3EX1A 1B31A 3KW3A 5D38A 3ZS4A 4RW3A 1XD1A 4DZ5A 3OLGA 2PP0A 2Z1KA 3PG8A 5E0KA 1K8XA 2IQ0A 4MNJA 1FWGC 4GG9A 1F3XA 4PMXA 3SADA 3WQ8A 2OLAA 2QYGA 1YEYA 3N9SA 4FNPA 2CBIA 3ELFA 1TG7A 1GOIA 1LWHA 4MNLA 1TYGA 1UBSA 2ABBA 1YXYA 2J62A 3O6YX 4Z2GA 4H9UA 4AYGA 4JTJA 1XIIA 2XFRA 3R89A 2QUMA 2PDJA 3VUSA 1ZAJA 3G6LA 5AHNA 3GTNA 3WLOA 1H2JA 1PZ3A 4ADSA 5I0DA 2XIMA 4G7FA 3NQGA 1K8CA 3AHXA 1RVGA 3TQ0A 4EANA 5DO8A 1TWSA 5A6JA 3POCA 9XIAA 5B80A 3GRIA 5ECUA 1G7VA 5F7UA 5D2VA 4EXQA 4IIEA 4UTHA 2Z24A 3IK2A 2HQAA 1PX4A 1US3A 1WZMA 2WBGA 1EQPA 1XRFA 3DI1A 3OPSA 1KM0A 3AIUA 2DT1A 3N3TA 5CJ5A 4YTRA 3VMOA 1J0ZA 4LC6A 4HNLA 3GM8A 1U5JA 3LD5A 2WC4A 5D09A 4A21A 1S2CA 3R94A 1FHLA 1HJVA 3PK7A 1CB7B 1HIZA 1S2VA 4Y96A 4EXBA 1WBHA 2V82A 5G5IA 3H22A 4WOQA 2WMGA 1NP0A 3HGSA 4L1WA 2GQ9A 3W2LA 3M7SA 4LQ1A 1FTXA 4CCCA 1Q85A 3WBEA 1PUDA 5EPDA 1P0BA 4DAFA 3NZRA 2ZVIA 1PTGA 3E3HA 4GIAA 4YHGA 3WN6A 3MUXA 1KBKA 2X0HA 3H2NA 2QMJA 3NGFA 1B5TA 4LEQA 1U1JA 2F8QA 3A21A 1SFLA 4A3UA 1OK6A 2WHJA 2W4XA 3CAKA 1EJSC 3SQLA 3VNKA 3OLDA 4LUJA 3DH7A 5EKYA 4BCEA 3M47A 1LOSA 5DMMA 1THFD 2W5FA 1F61A 1RY0A 1JYVA 3MYPA 4WY0F 4LB4A 2QDEA 3NL2A 2UV8G 1JDEA 3THQA 4YVVA 4AWSA 5CC5A 1PZ0A 3GFXA 3P0WA 3CUGA 4WX2A 3VILA 1FP9A 4RNFA 2I5IA 4X0VA 5LNSA 4HNCA 1MI3A 1BG4A 1XPGA 1QASA 4RPQA 2X30A 4A2SA 4Z2HA 3II1A 2C8NA 3LLXA 3GDKA 3HV9A 3CUXA 1KRAC 4RE3A 3QYQA 1VEOA 2CLPA 4DAIA 4ATLA 1WXYA 5BCAA 3IVUA 1TA3A 4H7ZA 2QT3A 3OA3A 4FK9A 5CPTA 1JGMA 2IKJA 1ZU8A 1DQWA 1JULA 3AS1A 2QJMA 1XSKA 4JTDA 3W72A 4UR9A 2SFPA 3AXMA 1PTAA 3VVGA 2W6RA 5A6KA 2CLOA 1UWRA 1UH3A 3TJLA 2FHCA 2WJEA 3EWZA 3GH5A 3UG8A 2C13A 1XLCA 3EDJA 1P0DA 1TUXA 3B0XA 5LNRA 2D2HA 2FFIA 3SRKA 2BWGA 2VEMA 3STEA 5B7ZA 1ONWA 3RRAA 1Q7ZA 2WPBA 4AVNA 2IXVA 1DTNA 3ABXA 5HNRA 4J3WA 4WJEA 3MB9A 3GXTA 1ESWA 2E1WA 2YDRA 1CXKA 1ZHAA 1Y5WA 3LRMA 2DJXA 3MDUA 5HXMA 4JBRA 4C1KA 4B5VA 3LG3A 3HG2A 2VX6A 6A3HA 3B97A 4YWIA 4J40A 3ITOA 3UXDA 4N42A 2GOUA 2OZTA 3XISA 2FPVA 3VD7A 4ZQPA 2OWCA 3VOJA 3IVTA 3KP0A 2J8GA 1T5AA 2DZAA 1MW2A 2VOMA 5EMUA 3CPGA 1UPMB 3WQOA 3PPFA 1VCFA 5E0CA 3TQVA 2VDGA 3E49A 4GBDA 3QPYA 2YCLA 1N82A 1QHZA 2QXWA 5JBEA 3TP4A 4IH3A 2OX4A 3E1F1 2FHBA 2IPWA 1W3HA 2J47A 3S1XA 1EJXC 3C5QA 6ALDA 1WYIA 4QSFA 2QPSA 3WK1A 3R12A 4AD2A 3RLHA 4JQ3A 4TV6A 3GX9A 1G7UA 2GSHA 2ZZ5A 2PWUA 4MJMA 3FKKA 4GUHA 3V75A 5BRQA 2CZ5A 4IISA 3SY5A 4LFYA 1R6WA 1DP0A 2DT0A 3TZFA 5MKGA 3VD3A 4K38A 5A6AA 4UR7A 4CU8A 2WXDM 3CH0A 2B7NA 3QGKC 1JRCA 5TD4A 3PR2A 2YJQA 5EY5A 2DFAA 1XKYA 3I68A 2J6XA 4NAEA 4GZ7A 1ITUA 1H0IA 1BLIA 3TYCA 1W3LA 1XLIA 1NP2A 4S3DA 1NDWA 3NVTA 1VFMA 1Q3NA 2Z6IA 1AH4A 1W1YA 3DC8A 1EQCA 4NZ5A 4PCFA 5CG7A 5AHMA 4PRWA 4GX9A 3PP7A 1BXCA 1XYZA 3TXZA 1U5VA 2XPKA 2EAWA 4XSLA 3VAVA 2DIKA 4WR3A 3C86A 2WJDA 2R24A 2JKAA 3NJ3A 1QJWA 2ZBTA 1TPWA 2VEKA 3TONA 1KD0A 3IIXA 3UA3A 1PKNA 4BWLA 3LTYA 4US5A 5IM51 3NZ1A 3S5SA 2Y88A 4NSBA 1PHQA 2DZUA 2VRQA 1FWIC 1M7PA 4PR4A 5F4XA 3NZPA 4JIIX 4ZGYA 1AD4A 1GVRA 1LCOA 3DI0A 1EJ7L 5CLTA 1R2SA 1JZ4A 2NV1A 3BO9A 4XAFA 3AJXA 4Q4SA 2PLJA 1X39A 1C3FA 2JF6A 2Z1SA 2ISVA 5GJMA 4AHQA 1NY1A 5LA0A 1CXLA 1FWSA 4JKKA 4I9AA 5DCEA 1J79A 5HMEA 3AFBA 5K9XA 3NVDA 3W73A 3TLLA 2NT0A 3UG3A 3N3MA 2V81A 3AMGA 1NOWA 2AKMA 1REQA 3UCCA 2OPJA 4IP5A 3TIMA 5AECA 3W7HA 3GUWA 4EK7A 2QIIA 3Q94A 4CQAA 1QNVA 3I6RA 3W2UA 3VMNA 3TE9A 4GH3A 3P67A 2ZWYA 1W1TA 4LANA 1UMLA 1MZRA 4IQEA 4CCZA 3GTXA 1BVWA 1ZBWA 3VNZA 4XZWA 1C90A 3GS6A 4IMCA 1FH9A 2EO7A 1TPFA 3QHMA 4OWGA 2ZUNA 1E3ZA 5IHSA 5FD0A 3ZFHA 4O13A 4CU6A 3NFUA 1XIJA 1EJTC 2D1ZA 4DYKA 1GVSA 1XG3A 1UBPC 4JNMA 3VNDA 4BKNA 2PGRA 4GH1A 4L6HA 3H26A 1EGZA 2XZ9A 3UNTA 5C7HA 3RMJA 2VFEA 2ZZ2A 3AWNA 3KOXA 3LHWA 2PDGA 1OD8A 1V77A 4F0MA 3B3DA 3N9RA 4HMDA 2WCSA 4M19A 4H6RA 3IS4A 3FJ6A 3UR7A 4KEZA 3AWOA 4JICA 2FIQA 1PZ1A 3N6JA 3UR5A 4K8HA 1JIBA 1K9EA 4O11A 2Z0IA 3EWYA 2FMOA 1IEXA 1QBBA 3FCPA 3O1NA 1ZJAA 2J13A 3CO8A 1SR9A 3V36A 1EX5A 3ZOAA 3IIPA 1TMHA 2CERA 4PCTA 2ANUA 3G0SA 3QMSA 3T2OA 5D2TA 2OEKA 3CYJA 3KCOA 3EAUA 2E9BA 4BR1A 1MW3A 3P61A 3C3NA 4WEVX 2PDXA 4B9ZA 3TOYA 3SEPA 3ME3A 4H2HA 3CUJA 2PCQA 5CBJA 4KETA 4BS0A 3M0JA 1GQIA 2WKJA 1A53A 4YXGA 3BG9A 3SN4A 4P61A 2WB5A 1IZJA 2QCMA 3E12A 1UR4A 3BLEA 2JE8A 2WNNA 3CTLA 3STGA 1K77A 2YKKA 2QJNA 4Q7NA 2HXTA 4F0LA 5IOBA 2YOCA 3N34A 5T26A 4RZ4A 1P6WA 4RL3A 3GAYA 4BWLC 5AKQA 3L2LA 3IACA 2G3IA 3SUSA 5IBXC 5DFAA 4B5XA 3G8EA 3OGSA 1QO2A 2G3MA 4JTLA 4LB3A 1RAKA 1EXPA 4MPKA 3OG2A 7CGTA 5AC7A 3SI9A 4HNNA 4TIMA 3EA2A 3CZGA 4IMFA 1FDJA 1I0DA 1JI1A 1TE1A 3NAVA 2WQPA 4R5EA 5KZMA 1DJYA 4JL2A 2XN1A 4P7NA 4LH8A 4A4AA 2DORA 4DUXA 1OT2A 1GKQA 3AI0A 2XSBA 2XN2A 2YLLA 2DU2A 2PGFA 5I3FA 4LS1A 5FJPA 4CQ8A 2H8ZA 4JHMA 1JPDX 3I6EA 4OOZA 1DOSA 4C7GA 3VIIA 1B3ZA 3PPGA 5I3IA 3HQOA 2CZEA 4LVGA 4W7WA 3WNOA 3QH2A 2OKOA 3N2MA 3SIMA 5G1MA 2GFTA 2O56A 1VENA 5DBTA 1TR9A 4RUBA 1G1YA 2B7PA 2ATMA 2NV9A 3WLRA 3N6HA 3HZ3A 4G2DA 2WWDA 1V51A 1IEWA 2QCDB 4XO6A 4RDZA 2QDGA 1FBAA 3G77A 3QV6A 1KR1A 3W7RA 3FN9A 5M17A 2QCHA 1WE5A 3W85A 1GONA 1Q13A 3VCCA 5BXSA 3WH9A 4JTHA 3TTOA 3KTSA 4IMDA 1TJ1A 3ZT7A 1Q65A 2WSPA 3NTYA 3Q45A 3FVDA 1JNEA 4TO8A 4DJEA 3TFCA 1F3EA 4ZODA 4KRZA 2A3AA 4L56A 2A4AA 4TTGA 2V2CA 1GGOA 5CZSA 2FJKA 4O1CA 4ZSUA 2V30A 4LAMA 2BXZA 4M6UA 1X6UA 2NWRA 5T9BG 3AYTA 5BWAA 3NPWA 4Z1BA 1VQTA 3BLLA 1QNQA 5EB8A 1MNSA 2QUVA 5AHEA 2YCIX 1EYWA 3DFOA 2P1FA 3MC5A 3PZUA 2W67A 2VD9A 4REQA 4J3VA 2DDXA 2VCCA 3SRDA 3NSNA 4H4IA 2TSYA 7TIMA 1PZ2A 1OFBA 1Z6KA 3GC2A 2H9AB 1W9UA 3BDKA 2GGEA 5C54A 4ZA0A 4Q32A 1CEOA 2J6VA 5EBAA 3PUDA 2I16A 3LUTA 4JHZA 3BLDA 3TNOA 3BV4A 1LTDA 2YBUA 2JALA 1MWOA 1N55A 3CAWA 2INZA 3ZSSA 3B8WA 4E3VA 2HROA 3IUHA 4HMCA 2BG5A 3H4WA 1VFHA 2QEZA 2YB4A 1JZ7A 3L5MA 2BY1A 3K4WA 4ZMGA 1E1CB 5K2ZA 1R9XA 2PDPA 1XRSA 5EMYA 3T8QA 3S42A 4DBUA 1VLIA 2HV5A 1GZGA 5TNVA 1J8VA 4CLMA 5C9UA 5D03A 2YXOA 2RDWA 2YL6A 1I4NA 3ZO9A 2J7DA 3THUA 5I23A 1UZ4A 1W8GA 1UP2A 3D3AA 3E0VA 5CZJA 1H4PA 2KX9A 5L9FA 2B7OA 3BOLA 3FKRA 2WM1A 5LNUA 1R7OA 2V6AA 5A95A 3F4WA 1A0DA 2A3BA 3UVIA 2ATSA 1CX9A 3MKVA 4P8VA 1BYBA 1I1XA 4B15A 1JF5A 2OB3A 1QPQA 3LLFA 3WMCA 3GG7A 3SCSA 2PU1A 3C4UA 4JFUA 1YE6A 4URIA 4D6CA 1VBHA 3WEMA 3BE7A 2EKGA 4HK6A 2CHOA 5JUVA 1FWDC 4IL2A 4C6FA 3LHUA 2Y7FA 1XS2A 4GJJA 4Q8UA 5LXEA 1EF3A 3QKEA 4C65A 2G4JA 5CGQA 3CJPA 5K4XA 4KIRA 4I7WA 3SCQA 5B7YA 1LWIA 2TRSA 3W7OA 4HNOA 3M0ZA 2D69A 4UFIA 1HKVA 3T55A 1KBIA 3G5EA 3B05A 2IPFA 2NQ5A 3BV7A 2JBMA 2ISWA 4L9XA 3LV5A 1T8QA 1XWYA 2CPUA 3OO2A 3HJEA 3SURA 4XX6A 4YS1A 1XSIA 1XBVA 1QVBA 1OG0A 1AL7A 2CYGA 4GO8A 3SCWA 3RILA 4QJ4B 1JG9A 4J9JA 3PTMA 4XAZA 3SSZA 4R7OA 2PRHA 1V0LA 2FTWA 4NNAA 4ZXOA 3UR2A 3E6EA 4FIRA 4LUIA 5G4HC 4HPNA 1V03A 1CECA 1JR1A 2V3EA 4JEJA 2DW7A 4HHHA 3LHVA 2DW6A 1SMDA 5I2UA 2ZZ6A 3GG8A 4LS2A 3FIGA 1RLDA 6XIMA 5FF4A 2VX5A 1OADA 4C1NB 3MVIA 5GVJA 4HN4A 3ITVA 2DZVA 1IGSA 3I4EA 2NQ9A 2J27A 4OECA 5FF7A 4AHOA 3SCRA 1EJVC 3ZVHB 2B4GA 1R47A 3L2MA 5FI8A 3WK3A 4QS6A 4JGDA 3WZ0E 3MVTA 3W87A 1C9WA 3NQMA 4B5NA 3WD1A 3COTA 4GYFA 3UT0A 1UA7A 5F2GA 2VELA 1W1PA 5I3HA 3DFYA 3UEQA 2F2KA 3M43A 3W7CA 3DFTA 3PTDA 4I5XA 5A69A 1KM5A 4CEUC 1ENUA 4Q7IA 1ZALA 1Q5MA 4U10A 3IV8A 2VTFA 1AQ0A 4Q22A 3CK5A 1DJGA 1AW5A 4JKMA 3M1ZA 3UPMA 2RH9A 3DFNA 3QLDA 4MKSA 4R7JA 2PLKA 3ZSTA 4PA8A 4JYFA 4TQTA 4ZVJA 4GA8A 3N14A 5A6BA 2AMGA 4MY9A 4PMRA 2HMCA 2C6QA 3KX6A 3B03A 3V0UA 1RHCA 3G3MA 2ZTJA 4JN7A 4TVUA 3TC7A 3CPRA 1CT5A 3DGBA 1W1B1 5FJIA 4X3ZA 2F61A 1UG6A 4F9DA 3GU1A 4FXSA 2OGJA 1TO3A 4LV4A 2ZUSA 3R7MA 3CWHA 2BHZA 1V0KA 2D0GA 1FCUA 3VE9A 4DHGA 3B9AA 2QZRA 1K6AA 3NQ6A 3PZMA 3SGZA 1ISWA 4KESA 1IXQA 4TR9A 3C56A 2ZRVA 5LIUX 1VJSA 1I2RA 4C6JA 4ATWA 3ZM8A 1Q6EA 3TSMA 5HANA 3SR7A 3WF2A 4N2YA 2V0TA 2NW0A 1Q6FA 3L66A 1JRBA 3TJXA 1LM1A 3WMLA 1VP5A 7PTDA 1YHTA 3LX9A 2OTDA 1DWGM 4AHPA 1POJA 2PEVA 2XM2A 4N9EA 3AIVA 4DEFA 3VPLA 4CUCA 5CLWA 2FVLA 3UBPC 1E6ZA 3VNLA 4XG1A 3DDMA 2RKXA 1LOQA 4LYPA 3HO8A 3VDHA 4QISA 2ESCA 2BGSA 3R58A 2WHLA 4JY9A 2O7QA 3RCYA 3Q2DA 3PF3A 1MDLA 3IWPA 2OVLA 3WJWA 1W9BM 2OLSA 1I45A 4MMWA 2ON3A 3SFWA 4O18A 3CQHA 1TMLA 1KBBA 3RLVA 3SUUA 1VB9A 1G0CA 1LORA 1JYNA 3M0VA 5F2IA 1H7OA 4XD6A 1H0GA 3B8SA 3FAWA 4KCUA 1UD6A 1Q63A 4PGLA 3U4AA 1EUNA 4KBXA 3HIJA 3UJFA 4NG3A 4K7VA 4G1KA 3P60A 1W8SA 4JQ1A 1UHVA 4N7QA 1O68A 1HJWA 4FALA 4CQDA 3LI0A 1GQJA 2VQUA 3CHDA 1VFUA 4JTQA 4XAYA 2Y1HA 3EOSA 1WOBA 1P48A 3RPDA 2PB1A 1DWJM 5L6UA 3UCDA 2HVOA 4FEZA 1GZ1A 3BC9A 1HO1A 4REQB 4FLSA 2BX7A 4HMEA 3QVQA 2V68A 4NU7A 4P7RA 4IUOA 2J8TA 5C8BB 4ADTA 5EU9A 1H62A 4LBSA 3SRFA 1EB3A 1UQYA 1TB3A 4GQBA 5HR6A 4QAWA 2WMJA 4AAJA 2GJRA 4DXVA 3CEPA 2HDJA 2OX1A 5A8PA 1I1WA 4OU1A 4M0XA 4WSHA 3RNDA 3VGFA 4J3XA 3WH8A 1U5HA 1UUOA 1FHVA 3RPTA 4X60A 3IIVA 4QIUA 4H3DA 2X1SA 1QOQA 2XM1A 1RALA 2XIJA 3QR3A 5DRIA 2PDNA 1HKMA 2F6XA 5BOFA 3LN3A 4QAIA 2H8XA 5LIYX 1RVKA 3CPUA 2DZBA 3RR1A 3WLKX 2GUUA 3PNZA 3QYSA 4PTWA 4V1YA 1CW2A 4FS9A 1DIOA 3S5YA 1MRAA 1ODZA 3LY0A 3CMJA 4ZB2A 4PL2A 1J5SA 3EWWA 4FR1A 3E0LA 3KHDA 3VXGA 3B8DA 1C8QA 3K4AA 4V2XA 1XH2A 4ZE4A 1A5OC 4JTFA 5A1AA 4NUWA 1RZMA 3W27A 3A6OA 2BVTA 1J0IA 1EH9A 4FAMA 3OOQA 3NSXA 3F5KA 1A0CA 1OCJA 4IX2A 4HZMA 3OHMB 5F2MA 3ECQA 4IJCA 2VCAA 4M51A 3VGBA 1SO6A 2ZXDA 3LCWA 3W2NA 3AU2A 4FLQA 5H1WA 4RDYA 3KBSA 1JAEA 4O4WA 2UY3A 3TC3A 1EYEA 3I7SA 3D0CA 3TYZA 2C71A 4TVDA 4YIWA 2WNZA 3A23A 1X1NA 3G1YA 1HJQA 5DRCA 2PUZA 3SN1A 3WMBA 3KDOA 4N9CA 7REQA 1XX1A 4E4UA 1SO5A 3BLPX 1E40A 1CNVA 2AQVA 2GK1A 3N73A 4QJ3B 3VOCA 3AZTA 3CV2A 3LENA 2PC8A 4L4PA 1WOAA 4GX8A 1OGBA 1R3YA 4GQGA 4DZHA 4DI9A 3NWRA 2OG9A 3S2JA 2I14A 2VENA 5AOUA 1XI3A 2IUZA 2IQTA 2IS7A 1IYXA 4ENLA 3NNTA 1VYRA 1MXGA 1CXHA 2WSYA 3RITA 3S2NA 3W1LA 5CJNA 2NX9A 3VDCA 1PDZA 3FXGA 4NL1A 5DCBA 4AXKA 3GXPA 3V3WA 4K8EA 3S6TA 1XGZA 4ZOBA 2OJPA 1E15A 1KFKA 2XFFA 2VL4A 3O05A 5CJMA 1U30A 3LGDA 4A8LA 4MJ2A 3K13A 1GOOA 3VGDA 5G4EA 1OEPA 1AL8A 4B5UA 4OV9A 1TX0A 3SJNA 3W88A 3ARUA 5K9DA 4B92A 3OTRA 3BL3A 2DZPA 1Q6DA 3UZWA 1HKKA 4UTFA 2TAAA 3OZOA 1H60A 2PTXA 1BRLB 2R94A 3VNYA 3N17A 1E71M 1GTHA 2WC7A 4CNPA 2PWFA 4Z2LA 4JAWA 3VIOA 3CQ0A 3WLNA 4C5YA 1UC5A 2XVKA 3E2SA 2YA1A 3GKFA 3M4HA 1XG4A 3BJSA 1OC7A 1BWLA 1PV8A 4HYVA 4MADA 1V7YA 2R14A 3JZUA 2BFGA 4CN1A 1J9YA 1YNQA 2NSOA 1ZP3A 1EX1A 5I03A 1I60A 2JFEX 3TXVA 3BZGA 3R1ZA 2PD9A 5HUPA 4K1WA 3SO7A 1F4AA 4X9YA 8RUCA 3B0PA 4PMDA 1REQB 1MSSA 4QG6A 3WF3A 3W4RA 4EP8C 1JDFA 1KFWA 3J7HA 1ZENA 4DO4A 4GISA 1PB0A 3BQ6A 3M0XA 3P84A 4ICNA 3L12A 4H9YA 4DIAA 3TW9A 4HOWA 1BXNA 1MMFA 3DECA 4GFSA 3W7DA 1F4HA 1FUYA 4AMCA 2CZDA 2VO5A 3TNBA 2XH7A 1OCNA 2PDKA 5REQB 3URNA 3U8GA 4ZO8A 1OYBA 2NX1A 1GPWA 4PRTA 3WG6A 3G1SA 4WHBA 1XLDA 4BJHA 4JFTA 3F4DA 1DXFA 2R6OA 3WQVA 4DJFD 2P5NA 4ATDA 2FGZA 4YYFA 5CZ0A 4FXRA 3NO5A 2YGYA 4FNQA 5LNVA 1BVNP 4W9TA 3ONCA 2IW0A 2PLCA 1BQCA 3ITYA 4IPJA 3HF3A 4LRTA 3MMDA 3OLEA 4AZBA 3CTTA 4M24A 2XINA 4M5PA 3QLLA 4GQRA 3E0IA 4D6GA 1KBLA 3QR0A 1NOUA 1PXGA 1IEVA 3MO4A 2C19A 1VFLA 4EWND 4U31A 2VEFA 9CGTA 4DWSD 2REQA 2HSAA 3KBNA 3C52A 4I6VA 5D02A 4CNTA 2HK0A 3G1HA 3QGAC 2VWTA 3GK0A 4I5UA 3EX6A 2R8WA 4GRSA 3WFLA 5LIXX 4AQLA 3LERA 1Q8AA 2PWVA 1VFTA 4XAPA 2PGEA 4HKPA 3BSGA 3FVMA 1TPEA 4C6IA 3BAIA 2GJPA 4CEXC 1CZ1A 1CXEA 4NZJA 3SZ8A 2A7PA 2O55A 1R2TA 3UYIA 2FDSA 2ACUA 1KTBA 3SCUA 2O4MA 2PPGA 1ZPTA 2J24A 4PMZA 4PUNA 4UTIA 3GBDA 9RUBA 5HPCA 4L1XA 4KWOA 3CT2A 5CGMA 4LEFA 1TJ0A 3C6CA 4Z2KA 2ABAA 3W7PA 1L6WA 4YWSA 4AY1A 4HPJA 3GFYA 2EBNA 4JTRA 5A6SA 2OQHA 3ONBA 3MHGA 3L4XA 3STPA 4B2DA 3FHQA 3W1RA 4EX4A 3HMCA 2VYOA 4ZQOA 2PS2A 5FL1A 1VLWA 4UMBA 1TPC1 3N6QA 4AUBA 2H3BA 1JCXA 1GQLA 3EOLA 4W88A 2Y85A 1HW6A 3LHTA 4WUIA 3NPUA 2HVNA 2AOSA 3OQ8A 1PIFA 5BROA 4Z17A 1EGVA 1PWMA 3DUGA 5HNTA 1PKYA 1NWRA 3L5LA 3VDGA 2D0FA 2ZA3A 1XDMA 3V1PA 1VEMA 4LW7A 3WX7A 1G4TA 2QUUA 5DT5A 3APGA 4MWAC 3E74A 4AF0B 4BI7A 5XIMA 3CMFA 4MZYA 3LDVA 1C8YA 4XKYA 3KDNA 3ZT6A 3CMGA 1RY8A 4JN6A 3TW7A 3KL3A 4ASTA 1K1DA 1E72M 3TYEA 2QAFA 3TCEA 4RJEA 4NKCA 4YPJA 8A3HA 1JD7A 3GVVA 4L9YA 4OT7A 4PFMA 3BAKA 4YCOA 1IWPA 3NG3A 2BGQA 5JBFA 3HU7A 1PHWA 1KCXA 5ABGA 1O7AA 2CC0A 4B3ZA 5FJJA 3AU6A 2NQLA 2YZ5A 1OX4B 3RHGA 2GLKA 3W86A 3G6MA 1M9HA 3PNUA 1KRCC 4MVAA 4FO4A 1R9ZA 5C7VA 7REQB 3W37A 3G1VA 1FWHC 3G1XA 1XGDA 4W7VA 4E4PA 2DSKA 3HPXA 5TQLA 3UA4A 1F6PA 2YB1A 3LS9A 3M0YA 4JEQA 4ERAA 1D2KA 2Z6JA 3W76A 2AMXA 4X63A 3KBWA 3KZPA 3LTSA 3BLIA 2OLHA 3H2EA 1KWGA 1A5MC 1M3UA 1WP6A 3G1RA 1TTQA 3ABRA 5D30A 1NWTA 2ICSA 3VKDA 3UF9A 3R13A 1UP3A 4FA3A 3NEVA 4O1AA 5CSYA 4FF7A 4ZB0A 3TOPA 1UD8A 1B54A 1CGYA 1X97A 4PBEA 4LT9A 4PBFA 4A3RA 4FMVA 2BHYA 4NXKA 2IMRA 3MUY1 1E55A 1X1ZA 1M6JA 4KFNA 4Q4QA 5J5DA 3WFZA 1QNPA 2XISA 3TK7A 1F2JA 1SJBA 2PZNA 4HBKA 3E02A 1SZFA 2XU2A 2BY3A 3MV01 2V63A 3OHIA 1XDJA 3PWIA 3NGJA 5DT7A 3U0HA 4PN2A 3DX5A 5M03A 1TFVA 2GJXB 4B5WA 1M7XA 2CLEA 1LZOA 3EXRA 3FNDA 3GR7A 3VGHA 3WUGA 3B40A 2WMIA 3PBVA 3C2YA 4E5TA 3VOIA 3F03K 2WK2A 1H7XA 3DYOA 4AVOA 3WSUA 5HWNA 4K36A 2HBVA 3MA8A 2YBVA 4F9JA 3P5ZA 3ZLHA 2G96A 5E09A 3MUAA 1QOXA 1PBGA 3ARPA 3GZAA 4I8YA 3M9YA 3KVLA 2Y2WA 4UC5A 3UJSA 2P76A 2WZTA 1XLHA 5DLCA 1BYAA 2ALRA 3VKAA 1VFOA 3I3BA 3ZQ9A 1Q6RA 3VMPA 4N02A 5EFDA 1QHOA 4D71A 7ODCA 3B04A 2JGQA 2Q8LA 3VZYA 3JZEA 3ZR6A 3CIWA 4P8UA 5AN7A 1QW7A 4AIEA 4HK5A 1V6VA 3W6YA 2WMFA 1RK5A 3G2GA 5H8UA 3UESA 4HPGA 1PYFA 4OBRA 1IEQA 4MUZA 3FJLA 3KEHA 3NDOA 1IT0A 4H9TA 5BNKA 4RCXA 4O28A 1V3KA 3FOKA 5D33A 1BWVA 4RZ6A 2OFJA 3GW3A 1AMYA 4QROA 3TYUA 3WQFA 1MO0A 1N2VA 3T07A 1IR1A 4LC8A 2NX3A 3NA8A 4RLIA 5I3KA 3P81A 2PA6A 4WKAA 1SZGA 3WH5A 3CHVA 4AZCB 1XYAA 3BURA 4FB7A 1H61A 1RP9A 2TODA 5E1QA 4GCXA 4NRSA 4DO5A 2GVLA 4F48A 1VKFA 1PX3A 5K7JA 2HK1A 2D24A 3W1PA 4DRSA 1ONXA 3HQPA 2E67A 1WXZA 3A13A 4DWSA 2CBJA 1Q2SA 2QCEA 1C29A 2GWNA 3NXLA 4IT1A 4LTSA 4S3GA 1DEDA 4KFPA 5TAOA 4GZEA 2XHYA 2F6UA 4TXEA 3IJIA 1OF8A 1EUAA 6CGTA 1GT8A 3O2LA 4S2BA 5DELA 5KZEA 2G41A 3CUHA 1V4YA 1RD6A 2D2JA 1G4SA 3DIPA 2OO6A 3PAOA 4EF8A 1RP8A 2PDLA 3ARVA 1DTUA 2R1NA 3LSBA 3EOUA 1GVIA 2O0TA 4AC1X 4KMQA 2HZGA 4B90A 1ZCOA 3JUGA 4H6KA 1CLXA 4JTCA 5CBBA 1GG1A 4JIRA 1TZ9A 4WY0B 4S3CA 1MXDA 2BZNA 2GSJA 1FHDA 3ITGA 4YVPA 3RN6A 4IM4A 3W82A 3QOMA 1GNXA 1OHLA 3IGSA 3RUBL 1FDYA 1CIUA 3MUZ1 3ES7A 3V16A 4D6JA 4UQCA 1SFTA 2ZUVA 1XIMA 4QX4A 4LAUA 4I9JA 4K37A 1HKIA 3WBYA 1E3XA 2D2OA 4HT3A 1CLKA 5KEZA 4FLRA 2A21A 2YCKX 2ZC1A 2HEJA 1RQHA 3T2PA 4IIDA 3F2BA 1RA5A 2C1GA 3I3EA 1P7TA 4K3ZA 3NYZA 3NQ8A 3SCVA 1FVPA 1W37A 3LM7A 4Z1DA 3U9IA 4DWSC 4IG2B 2QJGA 1BG9A 2DQXA 1S2AA 3ARRA 3HN3A 2WCAA 3MKCA 3URQA 3U2OA 1GVYA 4QSHA 1ZJHA 2V69A 2VX4A 1NAL1 3WH7A 1MXSA 5A3HA 4AMAA 4LGXA 4IICA 4UTTA 5HULA 3LYEA 3H8AA 4HQVA 4ML4A 1AJZA 4QE5A 1B0IA 2WHMA 1C92A 4YLWA 2GYIA 4J35A 1ELSA 1L6FA 3C2VA 4KH2A 1KQYA 3CC1A 1PDYA 4AY8A 4UR8A 3HGRA 2XGZA 1IXPA 3O7UA 2IQDA 1PE1A 3UZJA 4DVOA 1D3CA 1XDLA 1ZBCA 4NI3A 1SO4A 2VP8A 1OCBA 3SSJA 4FLOA 1PYMA 3DN5A 2OZ8A 2XFWA 4OUEA 4OFCA 5I78A 5I6SA 1ZQ5A 3W2KA 3S8HA 3U3HA 4IIGA 3OYXA 1GW9A 1KCKA 3A12A 5M1TA 4MY1A 3CNYA 1K6WA 4QBXA 1QPNA 1VPYA 8TIMA 1Q7MA 2PTYA 2XYLA 3EPOA 4BI6A 2X0YA 4HU0A 2WLYA 1BSIA 2INEA 1TPUA 3U48A 4RZBA 1TREA 5DX7A 4PMJA 1RJPA 2E1DA 3E38A 3W7IA 1S5MA 3WF1A 1EPVA 1BTCA 2XJ7A 1TWZA 4V15A 4M1RA 1WKDA 4JPGA 3FA4A 1B90A 1S3TC 3HG4A 4CNOA 3LPOA 1M65A 1R38A 1JXJA 1N8FA 4MWAD 3B9DA 2XH4A 5E5CA 4K6AA 1SZRA 2QVHA 4JTGA 2Y62A 2ONEA 2PRLA 2YR1A 4XZLX 3TN5A 3GYEA 1VAHA 3BJFA 4IJBA 1YKWA 7TAAA 4POCA 3A22A 5T91A 3TV8A 4MPQA 4I7UA 3S47A 3T0DA 3K1GA 1AFSA 3D6NA 1VEPA 4XZ9A 1OC5A 2VRKA 2F6KA 1E43A 1DHKA 3HFTA 4IHCA 3AXHA 3IAPA 3LPGA 4QCEA 4IPIA 4ZO6A 2VC9A 3KM8A 4DJFC 3E2RA 3R4IA 4RX0A 3THCA 3SUTA 2VC6A 2NXIA 3KWSA 1WDPA 5FCZA 2P53A 1XQKA 1DJIA 3STFA 4TX6A 3ABZA 3GHUA 4ADUA 1S1PA 4GFIA 1W9XA 1BKSA 3RDKA 3QTGA 4M81A 1HZYA 4XISA 4QTGA 1F6KA 3M0HA 3N15A 2E77A 3PBWA 4XBKA 5C9WA 4OBTA 2P10A 3K1DA 3PB2A 4M8UA 3TROA 3FYYA 5HMFA 1RSCA 2Z28A 4IQDA 4AYSA 4DB7A 1K7FA 2ZUWA 3BPWA 3F2CA 3T1GA 4GC3A 2R1LA 3W28A 1A3XA 1S38A 1TJPA 3VNMA 3N4EA 3EB2A 3MKKA 3TX9A 3DERA 3R11A 1E4LA 1XC4A 4AC7C 2NQHA 1BYCA 1EC8A 4IMEA 1X6LA 3QXBA 1B3YA 1F8IA 2QF8A 3AOFA 4DWSB 3HURA 4GVHA 1H7PA 2XIQA 5C9RA 1XKJA 1KXTA 2FH6A 3S6OA 1S5VA 2J75A 1TTPA 1FCBA 1GVOA 3W38A 4O0ZA 4W87A 1JCLA 4OBSA 3QR1A 1TWDA 1DPMA 4F40A 4LYQA 4CD8A 4US6A 3E0WA 4J1OA 1UOKA 2E5BA 1GOXA 4AWUA 1JQVA 1P7TB 2XUCA 3W53A 4GUJA 5AVNA 4XZNX 4OJYA 3W70A 3RF9A 3L65A 3WIJA 1B4KA 4H9XA 2WSKA 3ID7A 3TH6A 4O17A 2ZRZA 2QKFA 2WNQA 4UMAA 1CLVA 3A64A 1JDAA 1W56A 1TX2A 1VHCA 3BJTA 2R1PA 1J11A 1GORA 1YADA 2HWGA 1LP6A 4KWVA 1ML1A 1E6NA 3TR9A 1EIXA 4JX5A 2NZLA 3U5UA 3WUFA 3RM8A 2GDVA 1XL9A 4DJDD 4FOUA 3ZR5A 4NJIA 1T96A 4LVFA 3PWAA 4XO7A 5JIPA 3FEQA 3OLIA 2WVUA 2YCLB 3QM3A 1IV8A 1A5KC 3AXXA 1XXXA 2W66A 4GI9A 5IDZA 1XM3A 2ZCGA 3EDEA 3KCLA 4QHRA 5FF0A 3HV8A 3OBEA 1FWRA 3CASA 4PUMA 1GG0A 3K8LA 1WDWA 2X7WA 3ERPA 4KWUA 1J18A 4X0NA 2DV0A 5G2HA 3TYBA 4X2RA 3T9PA 3VUPA 1J2BA 5DY3A 3V1HA 4B4FA 3CBWA 4NZCA 4J3ZA 3BWWA 1K7EA 2ZXAA 2QIWA 4W8BA 1ME8A 1YE4A 2HNEA 3GG1A 3MHFA 4P7QA 3UY7A 4A8NA 4EPBC 4G9PA 2E68A 4DM2A 3WBWA 3ORWA 1MEIA 2WKLA 4AZHA 1FH7A 3RR4A 4UIOA 4EAYA 1JUBA 1CBGA 5AC6A 3QJAA 1EZ2A 3WF0A 1VHNA 2AL2B 5HWMA 3KRSA 2J79A 1TPVA 4TVCA 3AJ7A 1XISA 4M6PA 4PUEA 4I8DA 3UXLA 3K5XA 4K8GA 3TN6A 3JR2A 1EC9A 4DYJA 4JS3A 3BAJA 5EMKA 1YDYA 1AH0A 4BEQA 5JH2A 4GYPC 3TMLA 5DN1A 1K4HA 1EZWA 4RNHA 3FEMA 3QF0A 2EG7A 4HNTA 3M7WA 4JIQA 1BXBA 3PAJA 1JCYA 2PDIA 5D2XA 1QFEA 3UPBA 4XWUA 3RRXA 1NIUA 1OABA 3G24A 3VIJA 3IJQA 2E40A 1NTHA 1DJNA 4YHEA 1WPCA 3RGTA 4RV3A 5AYYA 2QCFA 2H3DA 3AYRA 3MUIA 1S5TA 1JL8A 4V27A 1I2NA 5A8GA 1T7LA 3LB0A 3WCZA 4PMVA 3NPVA 2V5BA 4MJZA 3IARA 4LNCA 1RBAA 5H91A 3ABOA 3NQFA 1EDGA 3VK5A 5H2ZA 4MWAB 4Y9MA 3H12A 4A22A 4NJHA 4L9ZA 2INFA 1VYPX 4C1LA 3AHTA 1YDNA 3C8FA 1GJUA 1XRVA 4JIHA 3BGGA 3W7KA 2P8CA 4MYXA 2WQDA 1W9DM 2DSZA 4LUTA 3V4BA 1TVNA 1HG3A 1E4IA 1YPXA 2V5CA 5GPRA 3PY2A 2A7RA 3VM5A 3GYCA 2DEPA 2Z4GA 4F4RA 4U2YA 1O6IA 3CIXA 2DSWA 3D47A 5BU6A 1JUEA 3S3GA 1E0TA 4H9MA 3CL8A 1AQHA 4E8DA 1OX5A 4KWSA 5AC5A 4GACA 1M53A 3S5ZA 5C6MA 2W3ZA 1VH7A 3A3HA 3D5HA 4P8WA 3VNIA 4QJ1A 1NARA 3AIEA 4FOJA 4D72A 3VE7A 4Q3MA 3L4WA 1W1IE 3VO0A 4KCWA 1UD5A 4QS5A 2FHFA 1K8ZA 4ZTXA 5ABTA 4DJFA 3S9YA 2FB3A 1O60A 8CGTA 4O57A 3OZMA 3VD4A 1GQKA 3IANA 3SGGA 1M68A 3MWAA 4YYCA 1NWSA 4JR5A 3FGCB 3GDTA 5F2LA 1LG2A 3UWWA 3MW7A 1A3WA 4KIEA 3INPA 4UOZA 3A5FA 1UD4A 1V8EA 2A0NA 1P1MA 4GQ0A 3RM4A 1ODUA 1E6XM 4YNGA 3H2CA 4G1NA 1CGXA 1UJPA 4MB3A 4FX6M 3UG4A 3BZJA 1XLMA 4L4OA 2R1KA 5LGZA 1B9BA 1XIBA 1H3GA 1YMYA 2ZA1A 4WGHA 3FFSA 1MQPA 1X7FA 2JK2A 3RCMA 1UOZA 3MBDA 2J78A 1SZNA 3ZT5A 3QEZA 1OVDA 2NUYA 5LGXA 1CGVA 2VD8A 1VBUA 2YFOA 2DVUA 1C7TA 1QOPA 2E0PA 2X1UA 4ZFCA 4ACZA 3NDYA 1JPHA 2JQXA 4Q8VA 2YA0A 3NM3A 3KOZA 3WD4A 3JVAA 1HQTA 2VZUA 2NVCA 1UKPA 1UMYA 3C0SA 3AICA 4TUFA 1YXCA 2FZBA 1Z69A 2DP3A 3BOFA 4GUGA 3I4KA 1HX0A 2OYMA 2A7NA 1OYAA 1DL3A 2BY2A 3EYPA 4HPHA 1JUKA 1JCJA 3LZ3A 3E9AA 3DBPA 1YTDA 1DWFM 2VEGA 1MFUA 2VDHA 2GGJA 4INFA 2BOGX 2ZRXA