2CLLA

Tryptophan synthase (external aldimine state) in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
257
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 98
structure length 257
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cllA00
1AL7A 1VGAA 4BWLA 1TPH1 1GQNA 2QCCA 4MJZA 1G4PA 3DFTA 1R30A 3G1YA 4S1FA 4GE8A 4ZMGA 4RLIA 5TQLA 4XZ9A 1I8JA 2RDUA 3VE7A 4NNCA 3ATZA 1JCYA 2QCDB 1OK4A 3TC6A 2GJNA 1KM5A 4L4LA 2B7OA 1W3IA 1PS9A 5A5WA 3W7PA 2PC4A 4HNTA 1KFLA 1SO4A 3RK8A 3TNOA 2DJLA 4BR1A 3SW6A 2YXGA 2GVLA 4JDYA 1SW3A 1WOBA 3ZR4A 5FESA 1OX4A 3L67A 4ADTA 4K36A 2OT1A 3S1VA 3LTYA 2D73A 2TSYA 3LBCA 3QEZA 5LHEA 4MZ1A 4ADSA 1OHLA 3NL3A 2Y7GA 3OVPA 4FNRA 5BRBA 1I2PA 4R33A 1ICPA 3I7QA 2P0OA 1JCMP 3S5NA 2O7QA 1YLVA 4QM1A 3VNDA 1W56A 3W76A 3FKRA 1YPFA 1FUYA 3EX1A 4WX2A 4A2RA 5LGXA 1QCWA 4QITA 2RDTA 1DKWA 2OX1A 1K8ZA 1L2UA 1FXQA 1VCVA 4ZQNA 3CT7A 4FX6M 5DXYA 1XBVA 2QCEA 3GKAA 3DU0A 1TTQA 4N9CA 4RZ4A 3DFPA 5FF2A 3R89A 1Q3NA 3OVRA 4QQ3A 3R8RA 3BW3A 3CHVA 1L6SA 3UWQA 1H7NA 1QFEA 2Q8ZA 3P74A 1EP2A 2ATMA 5CPLA 3OG3A 1NF7A 3A9IA 5K4XA 2C16A 1O5XA 4M6VA 2F84A 3SY5A 5DY3A 1DVJA 5H91A 3VE9A 2NWRA 2CLFA 3GK0A 5I3JA 3IRDA 1ADOA 1DQXA 1G7UA 3GDTA 2NUWA 1WYIA 3P82A 4IOTA 1VHNA 3FIGA 4TMCA 3SSJA 4AVFA 2DZPA 5LHFA 2NV2A 3USBA 3G1SA 3PWAA 4UMBA 3NL5A 3W1RA 4AF0B 3P80A 3P84A 3S42A 4JN6A 4UTTC 2BZNA 1C29A 3B0PA 3NOEA 4LRTA 1SO3A 3LTSA 3V75A 1JVNA 3BARA 4OWGA 3EWWA 1F74A 5CPNA 3THAA 4TIMA 1CW2A 2ZA3A 3C2RA 4IWWA 5FEWA 1H60A 4PA8A 2DZTA 3IV3A 1K7EA 5C2XA 3U6WA 3I65A 4OGZA 2H3DA 2VENA 3CQ0A 3G8RA 3RF9A 3TH6A 4NXSA 1JCJA 1ICQA 2C18A 1VC4A 3CM4A 2DJXA 2RFGA 4OQVA 5BOOA 4R7JA 1KLYA 2CZFA 3L66A 1ZENA 3Q94A 3I7SA 5FI8A 3P7YA 3WK1A 4FNSA 3RU6A 4UMAA 1L9WA 1NVMA 4OHQA 1XUUA 2F7FA 3C52A 1GT8A 3BLFA 5ABTA 1OF8A 1T8XA 4ZVJA 1GEQA 1SQ7A 5F4XA 3HGJA 4MPQA 2UV8G 3FKKA 3TXZA 3TSBA 4LVFA 5KZMA 1UUMA 1YTEA 3PBYA 4M19A 1WOAA 1NSJA 3NGJA 5J5DA 1W3TA 1TTPA 5HR6A 2C6QA 3GKFA 1A50A 1VYSX 1K7FA 3LTPA 3IIPA 5U4NA 2J24A 1LOQA 2ZQ0A 1R2RA 3DI0A 1YTDA 2B7PA 1GPWA 5D05A 3M9YA 3TV8A 1JCXA 3LHZA 5L9FA 4JX6A 4KKXA 4LW7A 3LRKA 3W1QA 1L6YA 3W7CA 1B4EA 2V5BA 4LC6A 2CLOA 3L0GA 4NT0A 4UMCA 4X22A 3W7LA 1V7YA 4Y90A 1LP6A 1FDZA 1NFBA 3O63A 1MEIA 1OFRA 3UQNA 4CNNA 3L9CA 3EWXA 4O13A 5F2LA 2C15A 3M16A 4IXHA 3E49A 4RK8A 1O4UA 1EUAA 2VXNA 1TPFA 5KINA 2H8XA 1Z41A 2E5DA 5HWJA 1QR7A 1ZJIA 4HSOA 1Q6OA 2Y7FA 1RD5A 1TTJA 3CEUA 3FYOA 3W9ZA 1VS1A 3JRKA 2O7SA 4YMZA 1OFDA 1H62A 3TQKA 2YFOA 3HBLA 4NU7A 3KRUA 4JTLA 3QZEA 5HNRA 3E96A 3E12A 1PCKA 3S5YA 3W1TA 3KVMA 2CZEA 3W3OA 2H6RA 3QQ0A 3KRZA 3T78A 2ZCGA 4JICA 3LM7A 3WK0A 2PRHA 2V82A 2VEPA 1OX4B 3PUEA 3W2JA 1WA3A 5IBXC 3NVTA 4FB7A 2Z6IA 4DF2A 5GVJA 3L5AA 3CEPA 4LS2A 1ME9A 3KVLA 3QM3A 2DZSA 1E51A 2NLIA 1H7OA 2JBMA 4Z0JA 3BW4A 1GG0A 4JY8A 2VFIA 3PC0A 2NWSA 2A1YA 5TBOA 5HMSA 3TAKA 1H50A 3HF3A 3CIXA 2YZRA 1ZAIA 5AHEA 4PODA 3RLUA 1G4EA 2DORA 3PB2A 2Y61A 3W87A 1P0NA 1VYPX 1YPIA 2FJKA 4O11A 4E2BA 4PCFA 3F4WA 2VFEA 1DL3A 4NJKA 1MEHA 2PCQA 3B4UA 4MFDA 1GJPA 4IMDA 3KXQA 3N14A 2E1DA 4FEZA 2JK2A 2AGKA 4O28A 4LVDA 4OV4A 4IX0A 5F2MA 2A6NA 1R46A 2NX1A 3PULA 4RZ6A 5I3HA 3HPSA 3JS3A 4TR9A 2J6XA 3T4CA 4ADUA 2G5WA 1SZNA 2QCHA 2GQAA 5CZJA 3LLDA 1SZFA 5AHLA 3LRMA 1G7VA 2WV8A 4NJJA 2NXHA 3C6CA 5IBXA 3SGZA 3I6RA 4H4IA 2ZZ3A 4Z1BA 1LLWA 4AH7A 3W7JA 1HO1A 2JGQA 3U8GA 4DXVA 2V9DA 4CNOA 1GTHA 3DZ1A 5G4EA 4Z1DA 3W1XA 3VI2A 1LBMA 1X1ZA 2I1OA 4MYAA 1Q45A 3MW7A 3TK7A 3UWYA 2Y7DA 1T99A 3S1XA 1UASA 2QCMA 2GVJA 1OYCA 3DGRA 3HO8A 1OYBA 1OYAA 3L21A 5T26A 2YGYA 3QSTA 3BG5A 2GVGA 2WQPA 5D37A 4H6KA 2VC6A 2BLEA 4C1KA 4IQLA 1RQHA 1DJNA 4NQ1A 4ZQPA 3DAQA 1F6KA 3W70A 3M0ZA 1LM1A 3T40A 5F4SA 5DN1A 1QPNA 1OFOA 3W85A 4LWWA 4ORMA 1ZHAA 3PG9A 4UTJA 4UTKA 3THQA 3HQ1A 5D30A 3GZ3A 4YLWA 5DCBA 2V2CA 3LHYA 1QMLA 3N19B 3TMQA 1R47A 3NPWA 1VRDA 3TCEA 4R53A 2WO5A 4MFEA 4O53A 1YYAA 1IXQA 4POCA 3GXNA 3DXIA 3UWUA 1AMKA 4EVZA 1TQJA 1FXPA 3MP5A 3M7WA 3GAYA 4PH6A 4K6AA 5C6MA 1TRDA 3HG5A 1CI1A 3UPBA 3IIVA 3DHFA 3MBFA 3DKLA 4M6PA 1XCFA 5FEXA 1AL8A 4DO4A 1XKYA 2YCEA 3I7RA 4FX8A 1XI3A 1N8FA 4TO8A 3SFKA 3WJXA 3WJZA 4B5NA 1BWLA 3BV4A 4FO4A 3LCWA 3NL2A 4QISA 3TMLA 3NAVA 4ZQRA 4HNVA 4RR4A 4N6EA 1KM4A 4Q4KA 1RV8A 3G1FA 3QMTA 4YWIA 4MUZA 3HGOA 1HFBA 4CQAA 2A7RA 1GVOA 3UXAA 4DBDA 3PM6A 5KMYA 2QCNA 3QW3A 2QAFA 5LNUA 2WNNA 5D2WA 2GQ8A 3M1ZA 1ZALA 2FPYA 4QJ1A 3G1AA 5HUOA 3B03A 1W0MA 3N2MA 5HWMA 5KITA 1JCLA 3BLEA 3PG8A 3QMRA 1K02A 1KV8A 4P61A 2Y6ZA 2Y7EA 2VEKA 1HO4A 1TSIA 2E5BA 3KRSA 2Z6JA 3UWVA 3STGA 2QF7A 4E38A 3GIYA 3BK0A 3HGSA 3NL6A 4NJGA 4A2SA 4LC8A 3M5ZA 4N6FA 3WJSA 4EIVA 3A24A 3M44A 4UTHA 3G1VA 4XWUA 4ZQOA 2CLEA 4Y9AA 2P1FA 3M5VA 4AB4A 3SJ3A 4WY0F 5BW6A 4K37A 1I2QA 3TQ0A 2AAMA 5CPMA 3S5ZA 2Q8LA 1XBZA 1EWEA 1GYNA 3TFXA 1Z48A 4XTDA 4WD0A 3ABRA 2Z2UA 3H55A 5AHMA 3NQEA 4O57A 3MP3A 2ZZ5A 8TIMA 1QPOA 4A22A 2ABAA 3LXAA 5A8GA 3VKJA 2HS6A 4UIOA 4JIPA 1O5KA 1TJPA 2E6YA 1U83A 2A2IA 1WBHA 2CFFA 1QPRA 5FF0A 2YFNA 2YYUA 4GUFA 1KFKA 4BK9A 4JTIA 3G18A 4MOZA 3KFTA 4KWWA 5D2TA 3DENA 3GDRA 3NR0A 2ZA1A 1PV8A 4O16A 2DZVA 4HNUA 4JXCA 1FWTA 1SFJA 1YADA 2VFHA 4UXDA 2W6RA 3EKZA 1O60A 1MO0A 1VPXA 3HMJG 3DBPA 5F1VA 1M7PA 4FXSA 1W54A 4GC4A 4O1DA 4ZQMA 1TQXA 1IXNA 3D0CA 3PAJA 1D3GA 3FJ6A 5CZSA 3LV6A 4CCDA 4LVGA 1ZY9A 2BX7A 4FIRA 1F2JA 1A5AA 3V1PA 5HINA 1RZMA 3AJXA 3G1HA 5CSRA 4CLMA 4JGDA 3ABQA 4Q33A 3W7RA 1ICSA 3EB2A 5FF7A 3O6DA 1I45A 5K3VA 2ZZ7A 1XXXA 5HWNA 1QOQA 1H51A 4JTFA 1OG0A 3NM1A 5D2YA 3L5LA 4UTWA 4LOCA 3O6CA 2J27A 4WZHA 3KVKA 1TJRA 2V0TA 1TCDA 3EX4A 3OVQA 3E9AA 3M43A 2VKZG 3S0CA 4NVTA 4UTLA 5L6UA 1KTBA 3SECA 3LB0A 3IIOA 2C0AA 4O1CA 1H7XA 3W2MA 5CKSA 3T55A 1XC4A 3MI6A 4JTGA 4BI6A 4HPJA 4GBUA 4QNWA 4AHQA 5TIMA 4E2DA 5AHNA 4AHPA 4OV9A 2QJIA 3L68A 3BGGA 4UR8A 2GPTA 2ZRUA 1P4CA 3G0UA 3P5ZA 5CGQA 4CQ9A 4MZ8A 5EA9A 4S2BA 3S1WA 3PS7A 1EB3A 1J2WA 3GDKA 3O16A 1NEYA 3VCRA 5D04C 3WFAA 2ZZ6A 3O06A 1R2SA 5K4ZA 3KHJA 4LRSA 1W8SA 3A21A 1ZFJA 1LBFA 1I4NA 5D03A 1EUNA 4O15A 4RCXA 4JTUA 3LDVA 4MLRA 3NQ8A 4FHAA 3S9YA 3CPRA 3NZ1A 3EWBX 3NA8A 4AAJA 2A21A 1I2RA 3PB0A 3DI1A 4UTMA 4AHOA 1IXPA 1OK6A 4HN4A 4HT3A 1DOSA 2ZRZA 4CQ8A 4L4MA 5EY5A 3TE9A 4RKAA 3TIMA 3LHTA 4UNLA 4DBEA 3IVTA 3W1PA 3W7QA 1LORA 1RVGA 2BXVA 5G5IA 1ALDA 3NQAA 4XKYA 5EPDA 2I14A 1XBXA 1ONRA 4AXKA 5CSSA 3L65A 4GJ1A 4FF7A 3UD6A 1VHCA 1KTCA 2QCFA 3HB9A 4IGHA 1FCVA 1I2OA 1T0OA 2YR1A 5LNWA 5I3FA 2J9ZA 5DCDA 4WOQA 3W7OA 3QW4B 4MZYA 4DQWA 2W0UA 1THFD 1FCBA 2FB2A 1TPUA 4IJBA 1LOLA 1T96A 1K7XA 5EYWA 5K9XA 2E09A 3NQ7A 2RHGA 1GG1A 3QJAA 2BWGA 3RNDA 4PL2A 4QAIA 1SO5A 1W5MA 3ANYA 3B8DA 3KAOA 1EIXA 3PR2A 4N4PA 4LS1A 4FNTA 2J9YA 1K03A 3HGRA 2ZBTA 3P81A 5KTLA 4HHPA 2ZZ4A 4EOUA 3NPVA 4OT7A 4FNQA 2Y85A 4O1AA 4TU1A 4ONVA 1BKSA 1LRNA 2Y62A 3DFSA 5CZ0A 4WUIA 3K30A 4RV8A 3HPZA 1BEUA 4QSHA 5AC7A 1R2TA 3NDOA 1TV7A 4ALDA 5AC6A 3HG3A 1W37A 2QUUA 5HJLA 2FPVA 3STFA 1DORA 4DPPA 3AO0A 3ABSA 2H3BA 2OJPA 4R34A 1PIIA 1DHPA 3NQVA 3UWWA 1WX0A 3TFCA 2QR6A 1QO2A 1WAUA 3SIZA 5F2IA 3LHVA 3STCA 4NZJA 5KSWA 1Z44A 2OZ0A 3UY7A 3GDMA 3FA5A 3GVGA 4LNYA 4NUWA 1I2NA 2YW4A 1OFEA 2B0MA 2BSLA 3PBWA 2FDSA 2E6DA 2G95A 3CIWA 1M6JA 3W23A 1F05A 3W7HA 1VCGA 1Z42A 2G97A 2TYSA 4YCOA 2G96A 3IIZA 4BI7A 1AW2A 4AWUA 1X7FA 1O94A 3BO9A 1HL2A 3EWYA 3DFOA 5D02A 3MUXA 1TYGA 3TC7A 1VZWA 5HUPA 1K8YA 2H90A 4ML9A 1FWWA 1GVRA 3ZWSA 2NV1A 1OVDA 4K39A 1IXOA 2JKAA 3EXTA 4O4WA 3SGUA 4DO5A 2CWNA 4XUGA 4OBTA 1JUEA 1LBLA 3R12A 1OJXA 4E0CA 3LGEA 3W1LA 1UB3A 3QSRA 3FFSA 3QC3A 4X3ZA 3R13A 2R8WA 3W1MA 2EF9A 2Y70A 3LRLA 4FIQA 1SZEA 2H8ZA 5EKYA 5U7SA 4LVAA 2E6FA 1VLIA 3W07A 2EGZA 3JR2A 1VH7A 3QF0A 1ME7A 1SO6A 1ML1A 1H61A 1VYRA 3RLVA 4O10A 1ZCOA 1A5SA 1YTKA 3W2NA 2ZRXA 5SWUA 3ATYA 3TUUA 3NPUA 1GVSA 2E6AA 4WOZA 1ZAJA 1OX6A 4BF9A 5G1YA 3STEA 2A7NA 5K9DA 3HOJA 3W2UA 2XN1A 4O0ZA 1YXYA 3TA6A 3NQ6A 1C9DA 4IX2A 1AW5A 1TO3A 1X1OA 2HTMA 3LCIA 1WQ5A 1Q6RA 4Z1AA 2Q3RA 4YL2A 3YPIA 1FY6A 3E0IA 2R14A 3W1NA 4KFOA 1SFLA 2WSQA 3A22A 5AYXA 2X1RA 3LBMA 1LOSA 4I9AA 2CLKA 1H7RA 4O54A 4CNPA 5CG7A 2YSWA 3GNDA 6ALDA 2CU0A 1Q6QA 5G2HA 3QMSA 1UUOA 4UFJA 5FEZA 4IPJA 3TSMA 3LI1A 3OA3A 4WJEA 5LSMA 1KW1A 3UPWA 4DO6A 2FLIA 5LNVA 5LKYA 2GOUA 2FIQA 4NZFA 3C4UA 4Z1CA 1PCWA 3NQDA 4K38A 1JULA 3VFLA 1TPVA 4NJIA 4WXZA 2FQIA 4QNEA 1GVQA 2VEIA 1KBJA 2Y88A 5D09A 4MYXA 3GLCA 4JDBA 4JYFA 1Q6LA 3M47A 2V30A 3MI2A 2OMAA 3SI9A 3TW7A 3C2EA 3MHGA 3UYCA 1N7KA 3HG2A 2Q3OA 3CWNA 1DQWA 5CPOA 1QWGA 2X2GA 1TPDA 3GX9A 3QPYA 3MI3A 4XKYB 1A5CA 4X2RA 2XN2A 4ZL1A 4EWND 1B3OA 1L6WA 3DFQA 4H3DA 4UUIA 1A5BA 1SPQA 2E77A 1QPQA 2ZZ2A 4NXKA 1H7WA 2Y63A 1XUZA 2QKFA 1F6PA 1AG1O 2C14A 4LTSA 5EMUA 3MJYA 3S1UA 2ZA2A 4N02A 1J5TA 1H1YA 3P62A 3EX3A 1WDWA 2CW6A 2FB3A 4EF8A 5AB3A 3FOKA 4IXXA 3PBUA 4GFSA 3O8AA 2QJHA 3OBKA 2CLIA 3PY2A 3W1AA 3S6DA 4DELA 4GUGA 3DH7A 5BMWA 2E5CA 2Z0IA 2ZYFA 3BG3A 3IGUA 3C3NA 3W88A 3TJXA 4IMCA 1SZGA 4I7WA 3C2FA 4JTEA 3O1NA 4XTIA 1OFBA 2EPHA 2GJLA 4N4QA 1MXSA 1IF2A 3L5MA 3LERA 3WK3A 2YW3A 5C55A 1GZGA 2TMDA 3WJWA 2A6LA 4O4VA 4NX5A 3C2VA 1TB3A 2XFWA 1UBSA 4MJMA 5D2VA 2NZLA 5KZDA 3MHFA 4HPXA 2R91A 4Q32A 3TAOA 3H54A 5E0KA 5E93A 3PUDA 1S5TA 2VOMA 3LX9A 2JKPA 1G6CA 2EAWA 1RQBA 2X1UA 3DKJA 1S3HA 1BWKA 1P5BA 2A4AA 1OFQA 4IMGA 4Y8FA 2QCLA 5C54A 2DZXA 4I7UA 7TIMA 4O52A 3NG3A 2FFCA 2JKEA 3E02A 1EWDA 1FBAA 2DU2A 3IGXA 2VFFA 3G24A 1SUXA 3P61A 1W31A 2PRMA 4UTWC 3F03K 4O18A 3P60A 4LVBA 2WSYA 3GR8A 3SZ8A 4JTTA 3UZ5A 3W72A 3PBVA 4WY0A 3HPXA 1ZAHA 2A5HA 1JR1A 2X16A 3MWAA 4S2CA 2VEMA 3C56A 1KBIA 4W9TA 3P67A 1TPB1 5DELA 4A21A 4AWTA 3GR7A 3UNDA 4C1LA 1PHQA 3MO7A 3OHIA 1X6UA 1VJIA 4UFHA 2OT0A 4WQ6A 1XDMA 1H63A 1DV7A 2HSAA 4XBKA 4NNBA 1G69A 1JQVA 1LTDA 1M5WA 4K8HA 2C3ZA 1LZOA 2GUUA 5LGZA 4JTHA 1YXDA 5LZLA 1W3NA 4GUJA 1S5WA 2WKJA 2Y89A 5DBTA 3NPXA 5FF3A 4DF1A 1WV2A 5F1UA 5K7JA 5DCEA 1JCNA 3P5YA 2CZ5A 4UFLA 2TRSA 1VQTA 1TPEA 2R94A 2XN0A 1TRIA 3BW2A 4FNUA 4UFKA 2WJZA 4N9DA 1UCWA 4U28A 1TTIA 1FQ0A 3HG4A 4XBSA 4LU0A 4UNKA 3G8EA 4FX7A 4GRSA 4JX5A 3Q58A 1W5NA 1P0KA 4CCCA 4DEFA 2ISVA 1PE1A 1K3UA 2VELA 3CU2A 2LLEA 1DBTA 3NEVA 1W5PA 2CLLA 5I3KA 3R5EA 1TV8A 3PUOA 4M7SA 3MMTA 4GUHA 1XM3A 4AEOA 1EPXA 1YDNA 2Z1BA 3GNNA 3W73A 3NZRA 1OFAA 2QEZA 3MYPA 3EXRA 3W75A 4Z08A 4O1BA 4MLJA 3H53A 3QQ1A 5DBUA 2ATSA 1QDSA 3F4NA 1YDVA 1RPXA 2A7PA 3C61A 5FEPA 1KFJA 3EX6A 4FXRA 4UFIA 3M41A 3ZS4A 4IMEA 1TPWA 1F73A 1KM1A 4XQ6A 3PF3A 4K8EA 1B9BA 1GYLA 3O05A 1LROA 4OE7A 1Y0EA 3GB6A 1EX5A 5MHBA 3IEBA 4JX4A 3SR7A 4IUOA 5IM51 2V2HA 4GNJA 3CB8A 2FTPA 4JR5A 2YDAA 1F76A 2P10A 2DP3A 2V81A 1LRTA 4ORIA 3M6YA 5AYZA 1GVFA 1FDJA 2NUYA 1VCFA 5D38A 4MVAA 5K2ZA 4ZQCA 3NYZA 1VR6A 2PURA 4HKPA 3ABOA 1NAL1 1C8VA 1KM2A 2J9XA 4JIQA 3G22A 3W84A 1BTMA 4YXGA 3LHUA 1QOPA 2ZFAA 1JRBA 3LXBA 3W7KA 5AN7A 4RJEA 1M7OA 5G4WA 4UCGA 5F4WA 3N9RA 1OF6A 3KVJA 4DF0A 4ICNA 3QH2A 4Y6GA 1TPC1 1TMHA 3HIJA 1YXCA 3N2XA 3B04A 3EX2A 4GWEA 5AOUA 3IVSA 1A53A 5BNKA 2NXGA 1JJKA 2YX0A 3FJLA 3L2IA 3GDLA 3CLMA 3N34A 4WXYA 4LV4A 3LOTA 4PTNA 1KTNA 3W2KA 2NX3A 3QPZA 2J88A 2RDWA 3C2OA 5D2XA 1B4KA 3F1QA 1FWSA 5FF4A 3N9SA 3G3DA 5LNRA 1D9EA 5G2IA 3T7VA 1TIMA 3DFNA 5D32A 4N9EA 3N73A 3NQMA 4RX0A 3LCLA 4LV9A 2C19A 1KFEA 3TU9A 3WK2A 3EEGA 1FCUA 3ZFHA 1H1ZA 4K7VA 3B0VC 4QIUA 1FWRA 1XL9A 1KV5A 3TROA 4D2JA 3UWZA 4UTTA 4M7TA 5AFDA 4O17A 5H2ZA 1FWNA 3U2OA 3W7EA 3FEMA 3KOFA 2OCZA 3RMJA 3Q2DA 1SR9A 1W1ZA 1RR2A 5K9CA 5DLCA 3P8IA 1AW1A 3QRHA 1LYXA 1PVNA 3W83A 2ABBA 4M5PA 3TSDA 1JQXA 3LCHA 1OABA 3O07A 1HG3A 1P1XA 2ZRYA 3OIXA 3W7IA 1SSGA 2PRLA 1N55A 3IGSA 3W6YA 3S5OA 2B7NA 5F2GA 5D33A 1KM6A 4RZ5A 2CLMA 5HR7A 4O50A 4WY0B 5AHIA 3HJZA 2HS8A 3W74A 3FLUA 2NXIA 1J4EA 4MIMA 2ZTJA 2W79A 3W2LA 2ZRVA 2VFDA 3N3MA 1G4TA 4Z0SA 1KLZA 4UR7A 1QAPA 3G0XA 1RQEA 1EEPA 2V2DA 2ZDRA 3LI0A 1MZHA 5I3IA 5AHFA 2X30A 3QFEA 4MY1A 2QUVA 1JUBA 3C0JA 4HIBA 3LXCA 3PSWA 2ZZ1A 1KA9F 3BLIA 1SSDA 1CX9A 4NJHA 3NQGA 4IMFA 1G67A 3W86A 2WOQA 1MEWA 4HSNA 2QCDA 4UTUA 4JTSA 2B7QA 1K8XA 3W22A 4N9BA 2NUXA 3W7DA 3INPA 3QYQA 1V5XA 4JS3A 4GUIA 2DZWA 4LY8A 3W7NA 3TJLA 1OX5A 4ZZ9A 1SW7A 3G0SA 3W71A 3L0NA 4O8RA 2TPSA 1X8FA 2A85A 3I68A 5HQEA 3S8HA 5CZTA 2KZHA 4RXGA 1LRQA 2EKCA 4G1KA 2EHHA 4JEQA 1IIHA 3G1DA 2E68A 1KM0A 1PHWA 3NQCA 4YCPA 4MY8A 1NF0A 4LUIA 5DXXA 4UC5A 1AK5A 3M5XA 2DZUA 2X1SA 2C1HA 3PVFA 2WNZA 2QUTA 3BGJA 1QNVA 4JTJA 4LS0A 4TMBA 3TW6A 2ISWA 4JD4A 4KFNA 1VLWA 2FPTA 4PL1A 3DHDA 3LCFA 3NQ2A 1LCOA 3EWZA 2JGYA 3G3MA 4M6QA 1HTIA 5E1QA 4GXMA 3NXFA 2X1TA 5I3GA 1XFBA 1O95A 1JUKA 1D3HA 2V5LA 4JYDA 5EBUA 3UXDA 3EWUA 3IVUA 4AMAA 1IGSA 2ALDA 3FS2A 1H7PA 3GXPA 4OU1A 1JRCA 1GTEA 4O12A 3LHWA 2I9EA 2GQ9A 4KFPA 2YYTA 1YDOA 4JNMA 4RXFA 4UFMA 4NNAA 4BI5A 2IQTA 2RH9A 1XBYA 3TKFA 3PSVA 1QO5A 2CLHA 1HUVA 5J5RA 2HMCA 3WJYA 2CZDA 2QAPA 5HULA 1MSSA 1G4SA 5G2WA 4LUJA 1S5VA 3M5YA 5BMXA 3T44A 4AF0A 3CTLA 3OEXA 3TXVA 2VFGA 1H5YA 1F7BA 2WPBA 1UJPA 1KFBA 3LLFA 2B4GA 2RKXA 2QCGA 2WNQA 2ZTKA 1EP1A 5DY2A 5KZEA 3EKLA 3TDFA 5AYYA 1FCQA 3FYPA 3TR2A 3L0KA 3ELFA 3W7MA 3R2GA 2A0NA 4HNNA 4X9SA 1W5QA 2ZRWA 3CC1A 3MBDA 4K7YA 4CCEA 1WXJA 3C8FA 1LLZA 3TQVA 4Y96A 4O14A 1EP3A 1FX6A 4FNPA 3B06A 4JTKA 3NQFA 1ME8A 1OFPA 4KWVA 3GXTA 3G1XA 3GAKA 5C5YA 3NM3A 2QDHA 4PFMA 3TX9A 2YPIA 1B57A 1W5OA 3O15A 5AC8A 3MP4A 4I7VA 4TX9A 1KM3A 1TV5A 1SW0A 4N2YA 4BWLC 1GWJA 2C13A 4P2VA 4DPQA 2BTMA 4PC8A 4NX0A 3W7GA 3O6YX 1SU5A 2QJGA 4MKNA 1F5ZA 2NX9A 2WSRA 3UY8A 3A23A 5G1TA 3MHUA 3GYEA 3A5FA 3A5VA 3BVJA 3RFAA 2AQWA 4MY9A 3W1UA 3KX6A 4O0KA 1KFCA 1ZNNA 2ISSA 3Q37A 3ZWTA 2PE4A 3LCXA 1U5JA 1WBJA 4O19A 1PL9A 3MYOA 4IPIA 1XDLA 4A3UA 1TREA 2V8ZA 4AWSA 4LT9A 4U4MA 3BG9A 1IIGA 2QDGA 4BFAA 1DJQA 4EF9A 4PEKA 4UTIA 3EXSA 6TIMA 3LCGA 3NNTA 3B05A 1FDYA 3BPWA 3UZJA 5LNSA 3P8JA 5EL1A 3NO5A 1LDCA 1GOXA 3B0UX 3CWOX 4JYEA 1EA0A 4JY9A 3IIXA 4J9JA 3LV5A 4A29A
chains in the Genus database with same CATH superfamily
1XISA 4QS6A 4L6OA 4U31A 3BCJA 1R30A 3CH0A 3G1YA 2SFPA 3ENLA 1I8JA 4MKSA 4DB7A 4MWAA 3W01A 3AS3A 4GYKA 1KM5A 4V33A 3R0UA 1C7SA 1A3XA 5CH9A 3A47A 4S38A 2PC4A 1LG2A 4HNTA 3DECA 4XZIA 1U2YA 3VOHA 2J75A 1JYXA 1J6PA 3URAA 1XLIA 1WOBA 3ZR4A 1OX4A 1OZQA 2VGGA 3LBCA 4DJFC 4NZ1A 3ZM8A 1EHNA 4EE9A 4H7VA 1Q8AA 1ICPA 3L12A 2GDVA 3I7QA 4ZE4A 1JCMP 2F6KA 3S5NA 3IJ7A 2O7QA 1YLVA 5BXRA 1R9ZA 3T1GA 3VNDA 4MDOA 1YQ2A 3WUEA 1W56A 1E6NA 1GOOA 1PBGA 4WIWA 2PDHA 1OADA 3EX1A 4WX2A 3VGFA 1U30A 5LGXA 5A6BD 1A5KC 4D9PA 2AQVA 1UR9A 3AMLA 3CAWA 4HNCA 1FXQA 4ZQNA 4GQQA 2QCEA 4L61A 3DFPA 4IICA 5FF2A 1AQFA 2BASA 3CHVA 1L6SA 1EC8A 2O55A 3B9OA 3SSZA 5D4YA 2F84A 3VMPA 3VUPA 4MWAE 4D8ZA 2CETA 1ADOA 2ZX7A 1G7UA 5IFPA 4KETA 4E8DA 1HNYA 1VHNA 2VCAA 3BGAA 3NO3A 2GK1B 4AVFA 2DZPA 2NV2A 3G1SA 3NVDA 1F3TA 3CK5A 3N29A 3WBEA 3V1HA 2E4TA 3WQCA 4C6OA 5HMFA 4HYWA 3NL5A 3SUWA 3TYCA 2QLYA 3P84A 4F4RA 1ZSXA 4JN6A 3W6LA 4UTTC 1C29A 1IT8A 4AMCA 4PMNA 2XH0A 1EGVA 3LTSA 4Q8PA 2VMFA 3EWWA 2UY3A 2ZUUA 1V3LA 4H8UA 1H60A 5GNZA 4CU6A 4PA8A 1SZRA 4LAKA 1SJCA 3T07A 3I65A 3V18A 2H3DA 3CQ0A 3IARA 4K8GA 2OPJA 3UXLA 2AKZA 3CM4A 4HD5A 2YJQA 3AAMA 2XFYA 2RFGA 5BOOA 1S2VA 3AYRA 5A6BA 3F2DA 3MUIA 4HN8A 3WK1A 1G9HA 3CT2A 4GJIA 1DWJM 4CNSA 2OEJA 2X0YA 4UMAA 1L9WA 1XUUA 3C52A 1OF8A 1VFLA 4NILA 3QVQA 4G7FA 4PUNA 2QW5A 1IT7A 1ITQA 1YBQB 3GXFA 3KS6A 3LMYA 1WOAA 2A3AA 1MWOA 5C0QA 1W3TA 7A3HA 1TTPA 4R9OA 1A50A 1K7FA 3IIPA 1ADSA 3U7VA 1XWYA 1POJA 5FJPA 1PKYA 1YTDA 2B7PA 3BQ6A 4V1YA 3GH7A 3I3EA 3BC9A 2IW0A 4N7QA 2V5BA 1Q4NX 3F2CA 2CLOA 4X22A 4DI8A 4Z2IA 1DIDA 1EJUC 3AIBA 2XH4A 3SRKA 3O63A 1OFRA 4DXXA 3UQNA 3AIUA 1RA0A 1V4YA 1V0LA 2C15A 3E49A 1O4UA 1ZBVA 4UB9A 2KAUC 1TPFA 1GGOA 2PGRA 3U3HA 2R82A 2J7CA 5HMEA 1ISWA 1Q6OA 3CEUA 4J4KA 4V28A 3TCSA 2INEA 3W9ZA 3H7VA 4YMZA 4QG9A 1H62A 2YFOA 1A4MA 4GVGA 1BGGA 1PCKA 3S5YA 2PDQA 3PTMA 1NWUA 3QQ0A 3EDDA 5E70A 4NF7A 3B0YA 1LT7A 4NAFB 4INFA 4UQCA 1UD2A 3OYZA 1WA3A 1DJGA 1BVNP 4JIEA 3FXYA 2XGBA 1WXYA 4RNHA 3GG7A 1LQ0A 4P8VA 3IAPA 5GVJA 3L5AA 3WQ4A 3QM3A 4M0XA 4PR4A 3VDHA 1HVXA 3KZSA 3SN4A 3DN5A 3GNRA 3QR0A 3WLMA 4GCXA 3ZJKA 3GFYA 1GJUA 4H6QA 5E6YA 3AROA 4YNGA 3HF3A 5DMYA 2EG8A 3RLUA 2DORA 1AMYA 2Y61A 1P0NA 4PTWA 1YPIA 3EA3A 4WSHA 2VFEA 3CMJA 1DL3A 1NIUA 3PPCA 3VDBA 4MFDA 2DFAA 5DMNA 1EC7A 1Y8BA 4XVEA 3WQVA 4RZ6A 2WVVB 5I3HA 3JS3A 4TR9A 2J6XA 2NQZA 1P0EA 2G5WA 1E0TA 5CZJA 4NJJA 1O12A 4H4IA 3TTSA 1OC6A 2P50A 4Z1BA 3W7JA 2WZMA 5CEWA 7XIMA 4JL1A 3DZ1A 4JQ1A 1WZLA 5FA5A 2O9OA 5G4EA 4LY4A 2EJ1A 1LBMA 1DXIA 5FL0A 1Q45A 2VJXA 1WUFA 3UWYA 3QV9A 1V7AA 2Y7DA 3V5FA 1T99A 3P0WA 1UASA 3DGRA 4U2ZA 3RX4A 5T26A 1A49A 2WQPA 3B3DA 5AC5A 3ZT6A 5D37A 4H6KA 2VC6A 1C91A 2E9LA 2WVTA 1F6KA 4ZOEA 5AZ0A 3M0ZA 7ODCA 1O5RA 1QPNA 3WQFA 3W85A 4ORMA 3PG9A 2CHRA 4B3KA 5D30A 2ZXQA 4GIRA 3D6NA 3WLQA 4IHCA 4U33A 2IPGA 1OIFA 5ABHA 2WO5A 1B0IA 3EOLA 3H4WA 3GZAA 1AODA 4LBSA 1AMKA 1VFFA 1HVQA 4EVZA 2QZRA 1TQJA 2BY0A 3M7WA 3DHUA 3GAYA 4C6BA 4K6AA 2VGFA 1TRDA 3TTOA 4HPHA 3DHFA 3DKLA 1XCFA 4DO4A 2YCEA 4ENLA 4AFYA 4R7OA 1N8FA 4WHBA 4TO8A 3WJXA 3KOXA 1U1UA 3VOJA 3NL2A 3II1A 1VFTA 4FI4A 4N6EA 1KM4A 4Q4KA 3RJYA 3SUSA 1SMDA 5M3WA 3PWGA 2C71A 2PFHA 2VDIA 4WDWA 2A7RA 4GYPA 3GNXA 4C6LA 3PM6A 1GEHA 5KMYA 3BSHA 2WNNA 4AY8A 4PCTA 1UIOA 2J7GA 3BOFA 4BEUA 1E72M 3G1AA 1OCJA 3S47A 4C60A 1DIKA 1UQYA 1JCLA 4LF2A 3CBWA 3VCCA 5TF0A 3AU6A 4US5D 4B4HA 2YBVA 4FR1A 3HGSA 4NJGA 1JDEA 3WJSA 1VPQA 4EIVA 2WK2A 3D3FA 1Z8AA 3B0XA 2CLEA 4Y9AA 1TIWA 3CAQA 3M5VA 4AB4A 4ERGA 4WY0F 4K37A 3TQ0A 2A79A 3UYIA 4D6HA 3S5ZA 4NHVA 1EWEA 1GYNA 1VBHA 4YVPA 4L6HA 1UW9A 1Z48A 3WQPA 2Z2UA 1ELSA 5AHMA 1E73M 3ZSSA 5CPSA 3LEPA 3ZMRA 2E6YA 2VWTA 1JF6A 3B9EA 1WBHA 4PUMA 2YFNA 1QW8A 4R3UA 4MOZA 5D2TA 1YEYA 3AXKA 3LYEA 1HF6A 2TODA 1RH9A 1SFJA 2ZX5A 2R1LA 1VPXA 1TWWA 4IP5A 5F1VA 2W3ZA 4FXSA 4GC4A 3TW9A 4O1DA 1PX4A 2ONEA 3PZMA 3D0CA 1QHZA 5C8BB 3LV6A 4CCDA 4IL2A 3LZ3A 2HROA 1W6TA 3KHDA 3ZLHA 2RJGA 4K1WA 1NDYA 3SCTA 4XD6A 2QNEA 3G1HA 3AJXA 5MKGA 4CLMA 4M1RA 4H2HA 1UZ1A 1UD8A 3W7RA 1I6NA 5A6TC 5C7HA 4BQ2A 3GHSA 1XLMA 2GQ3A 1AD4A 2X40A 5CBIA 3LM3A 3L5LA 4YVXA 1BRLA 3GE7A 4JPGA 4LOCA 4WZHA 3KVKA 3GSMA 2VKZG 4F3HA 4NVTA 4MGGA 1RY8A 1WZMA 5HK4A 3LB0A 1EL3A 2G3FA 3M4HA 4CD5A 1R85A 4QNWA 4J3SA 1FWGC 5AHNA 4OV9A 5CLWA 4UR8A 3BXWA 4NSBA 4MZ8A 2DIEA 4S2BA 3S1WA 3LPPA 3F4DA 2P53A 3IGHX 4H2CA 3OP2A 5M2FX 2HVOA 4CD7A 3WBXA 3ARUA 3WFZA 2ZZ6A 3KHJA 1DJHA 1W8SA 3CUIA 3VGHA 3MCNA 1ZFJA 4TVCA 4BQ3A 1NH6A 3CZGA 3NQ8A 4FHAA 1DXEA 1Q6EA 1TFVA 3EWBX 1ONWA 5A6SA 1EXPA 3LN3A 4Q4RA 1I2RA 1XPGA 3KDOA 2V67A 4UTMA 4L9ZA 4KMQA 4XUYA 4NP7A 3ARYA 1K1DA 3VMOA 5EY5A 4EACA 4PMZA 2WC3A 4XAFA 1BWVA 2BY2A 4PFHA 2CNCA 2C0HA 5EPDA 4AXKA 4NY2A 3VM7A 2PWHA 3GD6A 4GJ1A 1CBGA 2BB0A 1D7KA 3FVDA 4KCUA 2J9ZA 2QDEA 4WOQA 3W7OA 3QW4B 3ICJA 4DQWA 3PP7A 4LUTA 1XLDA 1T96A 1K7XA 2E09A 2W67A 4ZBCA 5KEZA 3R8GA 3CAVA 3RNDA 1AD1A 1SO5A 3QGVA 3T0BA 3KAOA 3AJ7A 3ONBA 1HJVA 1F3WA 3N13A 4N4PA 5EMKA 4XBJA 1K03A 3LSCA 3P81A 1Q5MA 3BSMA 1QW7A 1F3EA 4EOUA 3C0LA 4G1NA 4GJJA 2P0IA 2Y62A 5CZ0A 4C65A 4WUIA 3UXIA 3N4FA 1BEUA 1CXEA 5LYRA 4QSHA 1N2VA 1P43A 1R2TA 3MSYA 4IGSA 5AC7A 1TV7A 4AZ7A 1GOWA 3TC3A 5HJLA 2VNCA 2FPVA 2Z00A 3PPGA 4E4FA 4PMQA 5DF0A 4OFCA 3RX2A 4L56A 1QO2A 4X9YA 3AHTA 3TN6A 5F2IA 2WM0A 1W9BM 4NZJA 2OZ0A 3THDA 3GVGA 3N3TA 5H8PA 2Y1HA 2YW4A 1I9CB 3M0KA 3H26A 2FDSA 1OEPA 2OSXA 1CB2A 3VMNA 1F05A 2DY3A 1S3TC 4AWUA 1X7FA 2W91A 3T42A 2V5CA 3DFOA 3UCDA 3WDIA 3LMZA 4OBRA 1VZWA 1FWWA 2VEGA 3N6QA 2NV1A 4K39A 3VIMA 1IXOA 1RALA 3OOQA 2WMIB 4OBTA 3VD7A 4C7DA 3FFSA 3QC3A 4F2UA 4X3ZA 3ZVIA 5I0DA 1UUQA 1YW1A 1K9EA 3MVIA 2EF9A 7TAAA 4JTDA 3LRLA 1SZEA 5U7SA 4OIFA 2GSJA 2WHKA 1OCQA 4KRUA 1GYMA 4Q22A 4XVDA 3M7SA 1A0EA 4O10A 4U3CA 4A3QA 5EGRA 2A3CA 1Z9AA 4HK6A 3FSUA 5SWUA 1X6LA 4I9JA 4L1GA 2V3EA 2E6AA 5HXMA 1E15A 2ISDA 5A6KA 4BF9A 2A7NA 3M0YA 4AZ5A 4O0ZA 1YXYA 5JMUA 1B5TA 3SCSA 3NQ6A 3S83A 1A0DA 4Q4QA 1X1OA 2PWGA 1WQ5A 1QI2A 4FLQA 2R14A 2QPSA 3R0KA 4KFOA 1SFLA 2OO6A 2I57A 1LOSA 4O54A 4CNPA 1R9XA 1CGTA 2QF8A 1SFSA 3OA3A 5LSMA 3FDGA 4KT2A 4ZB5A 3ALGA 3NYDA 7REQB 4JZ5A 2OODA 4HYRA 2FH8A 4B91A 4Z1CA 4B5TA 1PCWA 1RAKA 3NQDA 3VPLA 1CB7B 4K38A 2VX6A 3WDJA 4AY7A 3VFLA 4GFIA 1TPVA 4GX9A 4WLCA 1IWBA 6XIMA 3GLCA 2V30A 2FZNA 3TW7A 3C2EA 1GZJA 4DIAA 1N7KA 3N04A 1LWJA 4LCSA 3GBEA 4MNMA 1TA3B 1A5CA 3TEVA 4C7FA 1ZBKA 5JBDA 3WL1A 2VZSA 1BYBA 3RM4A 2E77A 1XUZA 2QKFA 3B9NA 3PZQA 2G3IA 2PP0A 2WZIA 4GA8A 1JZ3A 2VC7A 1BLIA 3TYDA 1M01A 3P62A 2HRWA 1U1HA 4D6FA 3FOKA 3NZGA 3K1DA 2Q02A 3GC4A 3ZJ8A 1K6AA 3W1AA 3S6DA 4X60A 4AEFA 3DH7A 4HZ6A 2ZYFA 3V0TA 3C3NA 4KCVA 1Q85A 3C2FA 3BLLA 1Q6DA 4XTIA 4EP8C 2ZC8A 2GJLA 3L5MA 3LERA 1C90A 5REQB 1GZGA 1NELA 2ZIDA 3N18A 2TMDA 2G0WA 4NX5A 2QJMA 1UBSA 4PRWA 3VNMA 3RPDA 3ARPA 1E6PA 4FZIA 2R91A 4Q32A 3TAOA 3H54A 4LH8A 2FHBA 2ACSA 5C71A 3PUDA 5GNXA 1RQBA 4W93A 3T9PA 3DKJA 1Q6FA 3AICA 2PC8A 5C54A 2DZXA 7TIMA 2IXVA 4O52A 2FFCA 2FZ8A 2NT1A 2HCVA 2JKEA 3TZNA 1EWDA 1FBAA 4IMAA 5HNNA 3IGXA 2VFFA 3W82A 3G24A 1ISYA 2GYIA 3P61A 4DRSA 4HA0A 1VIWA 1H3GA 3OYXA 3F03K 2YL9A 4OECA 5E9AA 4LVBA 1T40A 3CASA 3UR8A 5AC4A 1XIFA 3W72A 3MVTA 4F40A 1PSCA 3PBVA 4WY0A 4H8NA 3WH7A 2IKJA 2B31A 2A5HA 5EMYA 3RIKA 1KR1A 3MWAA 3M07A 5EMJA 1BG4A 4J28A 2PEVA 3GXDA 4A21A 4F9DA 3E74A 3H6OA 1X6UA 4MADA 2WNWA 1KBBA 4UFHA 1S5MA 1XDMA 3SIMA 3PHAA 4NNBA 3K46A 3CJPA 1RA5A 5T9BG 2GUUA 4GOAA 3VD9A 5J8LA 2DSVA 5LZLA 4GUJA 3U2CA 4E4PA 5FF3A 1V03A 4DF1A 5DCEA 2PDIA 1JCNA 1DJYA 4UFLA 4ZO9A 3QKZA 1H2JA 3SCOA 2XN0A 1Z89A 4YTSA 4ZB2A 5HATA 2GJXB 1W1A1 4CNUA 3HG4A 4XBSA 4HTBA 5I09A 4JX5A 3D47A 2A3HA 4CCCA 3BOXA 1PE1A 3CU2A 1UA3A 6CGTA 3RU8X 5I3KA 1TV8A 2NVCA 3PUOA 4X2PA 2NQJA 5E6ZA 1XM3A 2D2GA 1LLOA 4IIFA 1FWJC 3EXRA 5C9WA 4LBRA 2I5IA 4F79A 3H53A 2VC5A 2ATSA 2ZE0A 2TAAA 1E40A 2E40A 1CECA 2A7PA 1T8QA 1TZ7A 2FMOA 1KFJA 4W8LA 5HNUA 3OQEA 4UFIA 2I5QA 3ZS4A 5XINA 1KM1A 4LB3A 1E0VA 4K8EA 4W89A 4Q4MA 3H2EA 3E3HA 1EX5A 3IEBA 4JX4A 2FKPA 3BAWA 2R1MA 4EAYA 1S2WA 4KCWA 4GNJA 5FSEC 4JR5A 4DZHA 2PLCA 1LRTA 1GVFA 1FDJA 5PTDA 1BQCA 1VCFA 5D38A 4UQAA 3FA4A 1UWAA 2GSEA 3NYZA 3R58A 2JEQA 5D9PA 3ABOA 3VOCA 2J9XA 2E8ZA 3MSGA 1BG9A 3W84A 3BCDA 5AYBA 3R7MA 4HA1A 1HL9A 3W00A 3O0KA 4M80A 3QTGA 2BXYA 4HSHA 1ONXA 4IG2A 1M7OA 1OF6A 4E8CA 3WLLA 4RNFA 3CNYA 4Y6GA 4RPQA 1YXCA 1XYLA 3EX2A 3L23A 5CBJA 3NDZA 3WEMA 1XLBA 1JJKA 3FJLA 2ACUA 3GU2A 3VDCA 3LOTA 3W2KA 2NX3A 3MT1A 3F5KA 1D8CA 3C2OA 3N9SA 3G3DA 4UQ9A 5LNRA 1D9EA 3DFNA 3V36A 1VPYA 1XLCA 1PXGA 3NQMA 2HVNA 2CCRA 1KFEA 3KCJA 1FH9A 3EEGA 1H1ZA 5DQPA 4AIOA 3ZLGA 3UW6A 3UWZA 2W61A 4M7TA 4QXIA 5AFDA 1KNWA 2OB3A 5H2ZA 3U2OA 3F2BA 4JL2A 2FHFA 1PO9A 2OCZA 2VQTA 3RMJA 2UY2A 1N82A 1KRBC 5I03A 3MKCA 2YA1A 1FP8A 3H2CA 3K4WA 4C91A 3AIVA 4FOJA 4LCRA 1PVNA 3SQMA 2QQ6A 4M5PA 3TSDA 3LCHA 2RJHA 3DIPA 1RY0A 1HG3A 1MDLA 4JHMA 1P1XA 1UD5A 3GNOA 4P7OA 1SSGA 2AL2B 2GDQA 1UOZA 2Y4SA 5D33A 3WD1A 4DUOA 2CLMA 4O50A 1HJSA 1KXQA 5H1WA 2VGIA 4NRSA 1J4EA 3GY1A 2W79A 3BAKA 4DO7A 1MFVA 3N3MA 1RHCA 4CNTA 3NOYA 2VGBA 1V6UA 1KLZA 2D22A 4UR7A 2OYKA 1WKEA 2PD5A 1XRFA 2VEFA 4H83A 5FACA 4KWOA 1EEPA 2V2DA 4W85A 2ZDRA 3LI0A 4AQLA 1MUCA 1W9DM 4JFWA 3MDUA 5AHFA 3WLKX 3LK6A 3QFEA 3NEHA 2DUXA 2VZVA 3S2JA 3VNIA 5FCZA 3LXCA 4RE4A 1SSDA 4IH3A 1BGAA 3ORWA 1YMYA 1TV2A 3RN6A 1B90A 2CHNA 2HXTA 4N9BA 4DWSC 4HOWA 3MV01 4JQ2A 3T2PA 1KBLA 3INPA 2Y2WA 1GOIA 4H9MA 1V5XA 2YA0A 5I79A 3RDKA 1DQUA 1SW7A 3P6LA 1X8FA 4PMYA 3NZPA 5CZTA 4G1KA 4W4QA 3QXBA 3PBGA 3AYVA 1KGUA 2ZUVA 2E68A 4YCPA 5TAOA 4HK7A 4BJHA 4LUIA 4X63A 4UC5A 3VOGA 1DE6A 1MQPA 4B2DA 4KCTA 1VEOA 2WNZA 2J7DA 1M9HA 1J12A 4JTJA 3BJSA 4C6FA 2D0HA 1GW9A 2HEJA 1F6YA 3IANA 2JGYA 3G3MA 4M6QA 3VKKA 1HTIA 5E1QA 1ZLPA 2J4GA 4IQEA 2XFRA 3U4FA 3UPMA 4AMAA 1IGSA 2ALDA 1G01A 3QOMA 4PSRA 3L2MA 3CMFA 1WZAA 4MKVA 1XHGA 2I9EA 4HCLA 4B5VA 1EZ2A 1EOKA 5LA2A 3R1ZA 1FWHC 4J40A 2IQTA 4LEQA 3PSVA 5J5RA 1HJWA 2ASHA 5HULA 1MSSA 4HNOA 4HZ7A 2GK1A 1NWRA 1S5VA 3NURA 4I9TA 1DYSA 5FIPA 3NDYA 1UOKA 1FH8A 3UF9A 4GGHA 3XINA 2WPBA 1KFBA 2YLAA 3LLFA 1DIOA 1OC5A 4AZIA 4IM4A 5A2AA 2J13A 3O6AA 3UVIA 2CBVA 1F61A 3WL0A 3FYPA 3TR2A 1VAHA 3ELFA 4ZFMA 3W7MA 3SB0A 6REQB 2NQHA 4FSAA 5C9XA 2VZOA 1FFRA 2ICSA 1W5QA 2ZRWA 1DIEA 1PKMA 3HU7A 3S3GA 3TQVA 2WZTA 2BOFX 1EP3A 1FX6A 2Y24A 4DXKA 3B06A 1UR2A 3NQFA 2AQOA 3B8TA 4EXQA 1OFPA 3U9IA 1BYAA 1BSLA 4L7ZA 3ITVA 4KH2A 1UH4A 4H6RA 2YOCA 3O15A 3SQLA 1TV5A 1UBPC 4G56A 4N2YA 2PAJA 3E5PA 1BYDA 4P2VA 2J7HA 4P7RA 1OM0A 4AWEA 2Y8UA 4PC8A 3WD4A 3GTIA 1YBQA 2EXOA 1HL8A 5HOSA 3A4AA 1TVLA 3T0DA 2GGJA 3PZ9A 1EPVA 2PD9A 1RP9A 3UY8A 2D69A 2P3EA 3ALFA 5G1TA 1FWAC 4QGCA 4QE5A 3BVJA 1F3XA 3RFAA 2AQWA 1O5QA 3A3WA 4O0KA 3Q37A 3FA3A 3GO2A 4O19A 2BVTA 1RBAA 1PL9A 4IPIA 1TREA 4AWSA 4U4MA 2WM1A 5FJRA 1IIGA 4BFAA 4PEKA 3IUHA 1PTDA 3IK2A 2DT1A 3EXSA 1D2KA 1M68A 4A05A 3FVMA 1C9WA 3IJ6A 1HKIA 1QTWA 4M29A 5I7GA 3GTFA 1EA0A 2YXXA 4JY9A 3GVQA 4J9JA 1TV3A 4A29A 3ONCA 1B54A 3IJQA 3LQGA 1CYGA 4BWLA 4I3GA 2F61A 1GQNA 2QCCA 1G4PA 4QTGA 3DFTA 4S1FA 1C93A 4RLIA 4QLJA 2QVNA 3ATZA 4A3HA 4E4UA 4XX6A 3GDBA 1Q66A 2B7OA 1A4LA 2XGIA 1T41A 1TZ9A 1UQZA 1PS9A 2BVYA 3CZJA 4LFYA 1KFLA 2NQ9A 1PIGA 3FX4A 2DJLA 4GZEA 4BR1A 1HGWA 3AU2A 2X1IA 2VX5A 3WH6A 2RUSA 3QYSA 4NAFA 5FESA 3L67A 3VO0A 4K36A 5LIWX 2OT1A 3S1VA 2D73A 5LHEA 3QEZA 4ADSA 3AZRA 3OVPA 2BMBA 4R33A 2RDXA 3OW1A 4IJCA 3RYSA 3WO8A 3LNPA 3N6HA 4MHBA 2YDSA 4X0NA 3W76A 3FKRA 3EMZA 1FUYA 4I90A 2FZ9A 4J2PA 3OJGA 1JI1A 3FJNA 1S2TA 2RDTA 4LYRA 3DHPA 1K8ZA 3SADA 3AUOA 2J7FA 3GKAA 4DWSB 2CKSA 5BXSA 1JZ6A 4W7VA 2HBVA 1Q3NA 3OVRA 4A8NA 2I16A 2WVVA 2Q8ZA 3P74A 1EP2A 1UD6A 2OSYA 2VX7A 1NF7A 5K4XA 2C16A 3QPEA 4M6VA 4NZ4A 4CVWA 1DVJA 3VM5A 4DJFA 2NWRA 2J66A 2ISFA 2CLFA 2F2HA 2NUWA 1EJRC 2VVNA 1WYIA 1X38A 4IOTA 3FIGA 3SSJA 5LHFA 4G9PA 2YKKA 3PWAA 4PTVA 4UMBA 1CIUA 4AF0B 1B3ZA 1UKTA 1QXLA 5CQ1A 3WMBA 1J2BA 4PCSA 2BZNA 2ZX8A 3ABXA 2VL4A 2WVSA 2DUZA 4B15A 1JVNA 1RJQA 4OWGA 1F74A 5HA7A 3VKAA 4AZGA 3KRBA 4XZWA 4IWWA 5BRQA 4AVOA 4CU7A 1NP2A 2X0HA 2WB5A 1O1ZA 3IV3A 3U6WA 1QNRA 3V0UA 3G8RA 3RF9A 2CZVA 3CAKA 3H2NA 2WKLA 3NXLA 4B5WA 3UG8A 3KBWA 1ZENA 2D2JA 2WAGA 2HWGA 1UHVA 5E0CA 3GH5A 4S3DA 4FNSA 3I10A 3TXZA 4LVFA 1LUCB 5A8NA 1XV8A 4M19A 4MJ4A 1WXZA 5HR6A 2C6QA 4E8GA 2WSKA 4PGLA 3LTPA 1QI3A 5U4NA 2J24A 4B9ZA 5EMMA 2ZQ0A 3NCOA 1R2RA 1YNQA 5D05A 1H0IA 1UC5A 3UNTA 1MMFA 3TV8A 2ZXAA 5HPOA 1JCXA 4LYQA 3MKKA 5L9FA 3BMVA 3M0JA 3M6DA 2OQYA 4GMEA 3VGBA 3W1QA 4XG1A 3DGBA 4XD4A 3RM9A 3W7CA 4LC6A 4UMCA 4NT0A 3W7LA 1V7YA 2Z2BA 3FY1A 4IQJA 4Y90A 1RK5A 1LP6A 2Z26A 3KOWA 3SRHA 5IDZA 1NFBA 2BY3A 3PJWA 1XSJA 4CNNA 1E1EA 3EWXA 1XD1A 4RK8A 3TTEA 1RCXB 2O4QA 1EUAA 1RUSA 1Z41A 4GVHA 4GNKB 1QR7A 1TTJA 3FYOA 3AQUA 3VIHA 3AALA 2DW7A 1X7IA 2WQDA 3UG4A 1OFDA 3HFTA 3COTA 1XX1A 4S23A 4GZIA 4NG3A 3KRUA 4HK5A 1NWSA 5HNRA 3E12A 3KVMA 1R3QA 3D3AA 1XICA 3RPMA 2WLZA 4BQ5A 2YCJA 1CXLA 2V82A 4Y9PA 2VEPA 3WK0A 4FMVA 1P6WA 5IBXC 3BZJA 4FB7A 1W9UA 4OVXA 3TN5A 4DM1A 5CJNA 1BXCA 1IEWA 1E51A 2NLIA 4N0RA 1H7OA 3GHUA 1NQKA 4H01A 1W3LA 2VFIA 1E9LA 3EPNA 5TBOA 3EZ4A 1J01A 5HMSA 1XD0A 1H50A 5AHEA 1HKKA 3MMDA 1BF6A 5T8GA 3W87A 4O11A 3A4XA 4E2BA 4NJKA 1MEHA 2PCQA 1KWKA 4FA3A 3N14A 3I6EA 4WR3A 3ZYZA 4DNHA 4M81A 4IX0A 2X2YA 4JNZA 2A6NA 4MB3A 4LSBA 3RRXA 2XIJA 3PULA 3HPSA 4ADUA 4PULA 4NIRA 2QCHA 2GQAA 1O6IA 3LLDA 1FWFC 1SZFA 1FFQA 4GISA 1UR1A 3W38A 1HO1A 4XV0A 1JZ4A 4CNOA 4Z2LA 4A35A 4Z1DA 2OEKA 3V16A 1X1ZA 1HP5A 2FDMA 3TK7A 2DV0A 4DUVA 3VZYA 1OYCA 3H2FA 3HO8A 2UY5A 3L21A 3EAUA 3BG5A 3U48A 1ISZA 2PA6A 2XSXA 4JQ4A 4ACYA 1I75A 5F4SA 1QW9A 3KCLA 5DN1A 1OFOA 2FJUB 3HV8A 3SCQA 4LWWA 3FAXA 2FYMA 1JD9A 4UTJA 3THQA 3GVVA 3PFMA 3R43A 3GZ3A 3VCNA 2HVMA 1HP4A 2V2CA 2XINA 3LHYA 3TN4A 3TJ4A 3N19B 2VR5A 1CGXA 4PMJA 3GFXA 3THUA 3NPWA 3LPOA 2IMRA 4L5ZA 5I07A 2WHMA 3MSDA 2PTDA 4O53A 4E3VA 4O0QA 3MP5A 4YYCA 4GXWA 4PH6A 1XH0A 1XLFA 1FKXA 2X0SA 5FEXA 5BZAA 5BROA 3WDHA 3I7RA 4FX8A 1XI3A 1UMLA 4QDWA 3SFKA 1HX0A 4D6GA 3WJZA 3BJTA 2Z29A 4ACZB 3IUIA 1MYRA 2O9TA 3EB3A 3NAVA 1ITXA 4MSSA 4MTVA 3EPOA 3RILA 3IJ8A 1HT6A 4UOJA 4MUZA 4Q8UA 4CQAA 1TJ2A 4ES4A 4LYPA 2QCNA 3QW3A 5LNUA 2GQ8A 3M1ZA 3NO1A 2FPYA 3LNMA 3E6EA 3BLDA 5HUOA 3B03A 5IXEA 3HV9A 4MWAC 3N2MA 2XG9A 4ZSTA 5HWMA 1DJXA 5KITA 3BLEA 1EOMA 3CL7A 1XGEA 3PG8A 3QMRA 5CC3A 1KV8A 5IHRA 2VEKA 3WQDA 2E5BA 2QVHA 3KRSA 3LLXA 2Z6JA 3UU0A 5GJMA 2DH2A 3UWVA 3STGA 4MNLA 4IF2A 4UTHA 3G1VA 3PZIA 2P1FA 4ERAA 3EKGA 2JFEX 4NI8A 5D8WA 4BF5A 4MF4A 5I00A 1JDDA 2Q8LA 4XZHA 1XBZA 4XTDA 4JKKA 3NGFA 4YWSA 2I56A 2PTZA 3H55A 4FPSA 2Z28A 4O57A 3MP3A 1V8EA 4WKFA 4A22A 5BWFA 3LXAA 4S3CA 2HS6A 4F0RA 4BS0A 2CFFA 3E2SA 5FF0A 2E67A 1PJ9A 1NOUA 1KFKA 1M3UA 3KFTA 4KWWA 3GDRA 1MW2A 3U4AA 1PV8A 4O16A 2DZVA 3SRFA 2V3FA 2DDXA 2VFHA 4UXDA 4Y9NA 1L8PA 2W6RA 4J3XA 1MO0A 1M7PA 2WWDA 1W54A 3FDKA 1MQRA 1TQXA 1W3KA 1IXNA 2Z1SA 1D3GA 2CHOA 2XIQA 1TVPA 1GUVA 5JXQA 4LVGA 3UBPC 2ZICA 2BX7A 2WMJA 4PE8A 2MUCA 2WMIA 4HHMA 1RZMA 3B8UA 1XSIA 1H09A 4JGDA 5HPCA 4Q33A 3WG6A 1NTHA 4LPCA 1NY1A 3K4DA 1DWHM 4CQCA 4B3ZA 3WNMA 4JFSA 3B40A 1SVDA 1KGXA 4UTWA 1BHGA 1TJRA 3EX4A 1XH2A 3E9AA 3M43A 4CQBA 3PZTA 2VUYA 3A3HA 3CUJA 3VA8A 3SECA 4Y8EA 2C0AA 4XKMA 4GX8A 4RE3A 4H7ZA 1MRQA 5H8MA 4EWJA 2ZWYA 3T55A 2OG9A 4XAGA 4HPJA 3AXHA 4E2DA 5KETA 2C1GA 4LUYA 4I6KA 5C2CA 3VD5A 4AHPA 3CYJA 2QJIA 3BGGA 1KGWA 3T08A 3G0UA 3QOKA 4CEXC 3PZVA 2FGLA 5CGQA 2PODA 2OGYA 2P76A 3K5XA 3RR1A 3H2AA 3KL3A 3VCRA 5D04C 3D46A 2IKIA 3REQB 4LRSA 1G1YA 1LBFA 1TR1A 5D03A 3FK4A 4KPLA 1V3IA 3GXMA 7REQA 3NZ1A 3NA8A 2XM1A 2DVUA 1BKHA 4AAJA 3ABZA 4GZ7A 3PB0A 3DI1A 1RLCL 1LQAA 4HN4A 2ZRZA 4X0VA 4E5TA 3TIMA 4I5XA 3IVTA 3I4KA 1LORA 1RVGA 5G5IA 1OSEA 4UOZA 4KBXA 1PYFA 2I14A 3IK4A 1TA3A 5CSSA 3L65A 3WUBA 4BA0A 3UD6A 1TR9A 2PU1A 3WBYA 2R24A 5BYWA 3MCOA 4DLFA 4DZIA 5C9RA 3M0MA 4IFKB 5FAJA 4D1IA 3AOFA 2W0UA 3CV2A 3L2LA 4EX4A 1FCBA 1TPUA 4EXBA 4ZODA 4I5RA 2WKGA 3TYAA 1R87A 1W5MA 3VIJA 1EIXA 3PR2A 4FNTA 2J9YA 3EPMA 4HU8A 1JIBA 3HGRA 5FJJA 2ZBTA 4DVOA 5KTLA 4HHPA 2ZZ4A 5I02A 1DWIM 3NPVA 1P0BA 4OT7A 4HU0A 5REQA 1PZ2A 2J47A 2VRQA 4ONVA 2CBUA 1OD0A 1WDRA 1JAEA 2JF6A 4ALDA 3N6JA 5AC6A 1IZCA 3BOLA 3HG3A 1W37A 3UZXA 3K4AA 3STFA 3GXIA 3UR5A 4DPPA 3KL5A 4R5EA 2DQXA 2OJPA 1IEQA 2QR6A 1A5UA 4DX3A 3LSBA 1Z44A 3WQ6A 2F9RA 3GDMA 3FA5A 4PMOA 1ZTVA 2ZUMA 1X1NA 1I2NA 1OFEA 2BSLA 3OO2A 4H04A 3W7HA 1R3SA 2X05A 4YCOA 2G96A 3IIZA 2J25A 1B31A 1O94A 3E0FA 3EWYA 2GWNA 3EWDA 3P3BA 1VJZA 1FWCC 5HUPA 1K8YA 5C2GA 2H90A 4ML9A 1GVRA 2JKAA 3EXTA 4O4WA 3W27A 3N4AA 2CWNA 3T09A 3S46A 4DAFA 1IWPA 1JUEA 2GFTA 1LBLA 4PRTA 3QSRA 3KBMA 1UROA 2E28A 1MUWA 4WSJA 4FIQA 1E4IA 5EKYA 3UCCA 2J8GA 2W4XA 3CHDA 4KQNA 3W07A 1SO6A 1J5SA 2ZDSA 2NW0A 5HQMA 1ECEA 1F8MA 1A5SA 1R38A 2DW6A 4ICMA 4IPNB 3RITA 4ZTXA 4W8BA 3ATYA 1BXBA 7CGTA 1ZAJA 4IPLA 2G3NA 1KXVA 4YJ5A 1OX6A 8XIAA 2GJXA 5G1YA 3W2UA 1JNDA 1TMQA 2XN1A 3CZ8A 3NIYA 3TA6A 3QLDA 1LL6A 4OJYA 4A8LA 4IIEA 3RMEA 3OB8A 2W66A 1AW5A 1TO3A 3LCIA 3BZGA 4E2OA 2WSQA 3AWNA 3A22A 5AYXA 2ON3A 2X1RA 3LBMA 1H7RA 1PZ1A 5CG7A 3TYZA 3GNDA 1M03A 1EO5A 3QMSA 4UFJA 5FEZA 4OBSA 4IPJA 3TSMA 4JFUA 1XS2A 2X7VA 4OTKA 1KW1A 4QR6A 4DO6A 2FLIA 5LNVA 5LKYA 3EDEA 1PX3A 4EK7A 3C4UA 1GJWA 3TLLA 4WXZA 3VKBA 2F6UA 2FQIA 4GYPC 3EDJA 1GVQA 2C91A 4RNJA 2XISA 1J96A 3CPUA 2XSBA 4JYFA 3BQ5A 2OZTA 3UYCA 4XZLX 2PZ0A 4QCEA 1DQWA 5CPOA 1B2YA 3QPYA 3KLLA 4XKYB 1Y5VA 3OLIA 1ZJHA 4UWMA 2XN2A 4F0KA 3N2TA 1L6WA 3HFYA 1S5NA 4D72A 2VDHA 2QXWA 1GK8A 1SPQA 3J7HA 1QPQA 1O1HA 3AYSA 1MNZA 3F5JA 4S3KA 3NSNA 2C14A 4LTSA 5EMUA 3S1UA 5AVHA 1A3HA 4C6JA 1KCXA 1XLGA 3N4EA 1WDWA 5I78A 3PBUA 1H4PA 4GFSA 4AX6A 4PB4A 2XYLA 4MWAD 5XIAA 1J6OA 2CLIA 3N1AA 4DELA 4GUGA 4GY1A 2MANA 1FHLA 2YLLA 2O0TA 1SJDA 3W88A 3TJXA 1SFTA 1TKKA 4DNMA 4JTEA 4DZAA 3S4TA 3O3RA 1HGYA 1S1RA 1MXSA 1IF2A 3LPGA 3WK3A 3GNPA 3GFZA 3MMWA 4KEUA 5C55A 1Q63A 2OWCA 3WELA 4JIIX 2A6LA 4WSKA 4O4VA 3C2VA 2YCLB 4J3ZA 2XFWA 4NRRA 3ZXWA 3WH9A 3SO7A 3WCZA 4C6QA 4HPXA 3SM0A 4FOUA 3WH8A 2BOGX 5E0KA 1NM9A 5E93A 2FVMA 2NVAA 3GVWA 2VOMA 2Y8KA 5GPRA 2JKPA 2BFGA 3C2YA 2GUBA 2XH7A 4Q8WA 1HQTA 4DJDA 1CLVA 2YDRA 3SEPA 1S3HA 4XB3A 1BWKA 1P5BA 3MC5A 3AXXA 4GI6A 3G6LA 1WKFA 3TYEA 5CBBA 3F5LA 4QE1A 2GGIA 3JUGA 1SUXA 4IUGA 2AL2A 1L8NA 1JYVA 1IEXA 4O18A 4JEJA 2WSYA 3A4JA 3GR8A 1ONEA 2OEMA 1T6MA 1ZAHA 3ZJ7A 1JG9A 4PBEA 1XLJA 3C56A 4W9TA 2XVNA 4GBDA 4PCPA 1SGJA 1ZUAX 4XZBA 1PHQA 4O1EA 4WGXA 1VJIA 2OT0A 4WQ6A 1AFSA 1H63A 1JQVA 1M5WA 1JPKA 2WANA 4QAWA 3POHA 3CHEA 3W29A 4Q8VA 3FEQA 3HQOA 5AECA 1NDWA 1VKFA 1S5WA 2WKJA 3AI0A 1BVWA 3NPXA 3PTKA 5F1UA 3KBSA 1UP0A 1K9FA 3N11A 3P5YA 1UZDA 2VX4A 2CZ5A 3DUGA 2PDGA 2R94A 2DH3A 3BW2A 3MPGA 2WC7A 1Q2SA 2WJZA 4N9DA 1UCWA 1TTIA 1FHDA 3C86A 1FQ0A 3GG0A 2FMNA 3BAJA 3AHZA 4GRSA 1YPXA 4H41A 2C1IA 1P0KA 4DEFA 4C5ZA 2BGNE 4PTXA 2ISVA 2Q01A 2VELA 2LLEA 1MNSA 1W5PA 5I2UA 1EFZA 1XR2A 3L4ZA 3MMTA 1FOBA 4AEOA 2Z1BA 1PTGA 3QBUA 3W73A 1UR4A 2QEZA 2ZXDA 3MYPA 3IWPA 5DO8A 4Z08A 3MDWA 4YYFA 3N25A 5DBUA 4IL0A 3MY9A 3S9IA 4R85A 1YDVA 4MB5A 3C61A 2A3BA 1J0ZA 3EX6A 2Z7GA 4C1NB 4RUBA 3G6MA 3OGSA 3WFLA 2OFJA 4NYUA 3UG5A 1GYLA 4OE7A 1Y0EA 4XISA 3BH4A 5MHBA 1EEXA 1X6NA 1HJQA 2XIIA 4L64A 3SR7A 4WDTA 5I3DA 3OHMB 4GY0A 3PTQA 1AA1B 1F76A 4HVXA 3VGGA 2V81A 4P7NA 3AS2A 2G3MA 4DBWA 3E2RA 5K2ZA 4M1BA 2W92A 1UIPA 2ALRA 5EB8A 2PURA 1NAL1 3URNA 4ERIA 4QJ4B 1KM2A 1JDAA 2AMGA 3G22A 3RCMA 4YXGA 1OWQA 1XIGA 2WXDM 3LXBA 3SY1A 4UR9A 3FHQA 5G4WA 1QPKA 1XIIA 5BWAA 3N2XA 1P0DA 4GWEA 3CS2A 1I0BA 4QDMA 2YX0A 3CHFA 1Y5XA 3HURA 4OKDA 1PUDA 5KZ6A 3N34A 1MW3A 1KTNA 3QPZA 2J88A 1V3HA 2P5NA 4KWUA 3WNLA 4B92A 4E3TA 2WLYA 5G2IA 1DXFA 1KRMA 4QDPA 5D32A 2A3EA 6REQA 4O1FA 2F6XA 2RAGA 1XJBA 1FCUA 4XAPA 4H00A 4AG0A 3B0VC 3GRIA 1XL9A 1KV5A 3TROA 3STPA 4QROA 1V51A 2E3ZA 3MA8A 4O17A 1ADDA 4MNKA 4W88A 1TWDA 1M04A 1UR8A 1VFHA 1SR9A 2HXUA 1RR2A 5K9CA 1OBAA 3IPWA 3M0HA 3P8IA 1UH2A 4AD3A 3ZVHB 1LYXA 2ABBA 3D5HA 1QNPA 4E2VA 1N8WA 3CPGA 1JPDX 3W7IA 5DMMA 2PRLA 1AH4A 1ZP4A 3CUXA 1KQYA 3JU2A 2V3GA 2B7NA 5F2GA 3KL0A 4HU4A 2H9AB 5MF5A 1K6WA 3VGDA 4RZ5A 3W74A 4H9YA 3FXGA 4YTUA 3UXKA 4A4AA 5LXEA 4EXAA 4MUPA 1POKA 1MZHA 3CO8A 2YIHA 4UQEA 5CGTA 2ZC1A 1PDYA 4MY1A 3C0JA 3TVAA 1KA9F 2Z25A 1S46A 1PZ3A 4AIEA 2YDQA 3PNUA 3W86A 4C6MA 2FTWA 3AIWA 4HSNA 2BODX 1VIZA 3W7DA 2G8ZA 3K1GA 3O7UA 3DFYA 3TYUA 4H19A 4ATLA 1OX5A 1V6TA 1V02A 4AU0A 4GIAA 1CXFA 2IQDA 4AXNA 4RXGA 2EPLX 1MUMA 4C90A 1UKQA 3AFBA 4UZSA 2VVSA 1W91A 1X98A 1OCBA 4JHZA 4MY8A 1NF0A 1W3JA 5DXXA 1AK5A 2X1SA 3CQHA 1E56A 2CWXA 4ZOCA 2VD9A 1V6YA 3PVFA 3VDGA 2QUTA 3BGJA 3MQTA 1QNVA 4LS0A 1XIJA 1W9PA 4TMBA 2DT2A 1NU5A 2FPTA 3K8LA 3EOOA 2XGZA 2J77A 2PSNA 3DHDA 1BYCA 4A8IA 4XIMA 3EWZA 1LF1A 3JVAA 3ITCA 4GXMA 4ML4A 3CQKA 4DWSA 1Z32X 2X1TA 2HBXA 5I3GA 2DT3A 1O95A 1JUKA 4KEMA 3EWUA 3DG6A 4GHRA 3ARTA 4YVVA 3FS2A 4LANA 3RCNA 1EJWC 1JRCA 4QS5A 1JFXA 1E5JA 4JTCA 2GQ9A 2FH6A 4KFPA 4PN2A 4UFMA 1E1CB 2HZGA 4NNAA 4TQTA 5EMLA 2RH9A 1QRQA 1JNEA 1QO5A 3W02A 1XCXA 2HMCA 3WJYA 1E3XA 2O92A 2GWGA 3V5OA 1PWMA 4H1ZA 3S5SA 4LUJA 1CPUA 3M5YA 3PTDA 4QSFA 1KO0A 1FH7A 2R1KA 1RJRA 1V02E 4AF0A 2VUNA 3CTLA 1HKVA 2VFGA 1H5YA 1UWUA 2AKMA 1F7BA 2QPXA 3NSMA 2B4GA 1OB0A 5E09A 3CV7A 1CT5A 3OIHA 4DJED 5DANA 3WY1A 2Y5SA 2DQWA 1EP1A 5AYYA 2WHLA 3L0KA 3R2GA 4IIGA 3QR3A 2REQB 1GHRA 3HJEA 4KRTA 2VOTA 1JYWA 3ZZ1A 1PEZA 4Q8NA 1JCTA 3GXTA 4YU1A 2E9BA 1HZYA 3GAKA 2GZXA 2YPIA 1B57A 1JXKA 4TVUA 3A4WA 3H2OA 1J79A 3RO6A 4ZEPA 3MP4A 4I7VA 4JTRA 1KM3A 4B90A 4L9YA 1ISXA 2R1PA 2C13A 4NZ3A 4DPQA 2BTMA 2FVLA 1LUCA 3VIFA 4QX4A 4AY1A 5DFAA 4MKNA 2PCEA 1WAWA 9RUBA 3EOEA 1K4HA 4JBRA 3MHUA 2HNHA 3XIMA 4G7EB 1XYZA 4F2BA 4D6CA 2VT0A 1ZNNA 2ISSA 4RL3A 3LCXA 2YCKX 1C8YA 4B5UA 3MYOA 4IIDA 3H7UA 2GUYA 4A8RA 1ZPTA 5BRPA 2OQHA 3TA9A 2JE8A 2QDGA 4N42A 3VYLA 1DJQA 3CZLA 1Y7VA 1VFOA 4UTIA 2OQLA 3B05A 1RSCA 3VNJA 2V5KA 2W9MA 4IIBA 5LNSA 3S1GA 2VRKA 3VKDA 3CV1A 1GOXA 3VC5A 1HKJA 4ZTYA 4ZO7A 4DJEA 1CNVA 3B8WA 1AL7A 1TPH1 4MJZA 1CLKA 1S2CA 4GE8A 4XZ9A 2QCDB 1OK4A 4Z42C 2GJNA 4L4LA 2QIWA 2Y5JA 1W3IA 1LWIA 3LY0A 5JH1A 3KWXA 3CB3A 5A5WA 3W7PA 4DI9A 2HE8A 2JIEA 2PP1A 3ANUA 1SO4A 3RK8A 3TNOA 3SW6A 4JDYA 2GVLA 1QBBA 1SW3A 3OZPA 5I77A 3GIPA 4KESA 1IT0A 1R7OA 1VBRA 3HZ3A 2TSYA 9XIMA 1XC6A 1QNOA 4GO9A 4ZO6A 2AL1A 3EGJA 4FNRA 5BRBA 2X41A 4U3AA 1P48A 4AZ6A 4L9XA 3WBWA 2P0OA 1VFMA 4ZCWA 4I6VA 1R86A 4QM1A 4LQ1A 4NI3A 1VP5A 1YPFA 4W86A 4OUEA 3BLKA 1JL8A 4HHHA 4TV5A 4D8AA 3W37A 4C6CA 3B9AA 3GHRA 4FLRA 5I06A 1W3HA 3CT7A 1VB9A 4LYKA 1XBVA 4PUWA 3DU0A 1TTQA 4N9CA 1KRCC 4RZ4A 5FL1A 1U5HA 1M65A 4QQ3A 3R8RA 3UWQA 5A2BA 1RLDA 3WNPA 1Q6CA 3OG3A 1ZGDA 3NTYA 1OQFA 5HBFA 5DY3A 2X7WA 4KWSA 5T91A 5I3JA 4CUCA 3IRDA 5BOEA 3TONA 3GQYA 3V3WA 3ZR6A 3QFWA 3MZ2A 4BZYA 4WDUA 1GONA 3USBA 3VNZA 1VRXA 4HPGA 1EA9C 3W1RA 4Q7BA 2XVKA 2V6AA 4UNIA 2WSPA 3WF4A 2Z1WA 2PS2A 1ODZA 4D6EA 7ENLA 3NOEA 1EJXC 2DSKA 4LRTA 3VX0A 2W27A 3V75A 4F48A 2XU2A 3SQSA 4F0LA 2OYMA 4TIMA 1CW2A 1DJZA 2ZA3A 3ME3A 1W17A 4UQDA 3DYMA 3CZEA 4H9ZA 2DZTA 1K7EA 2ANUA 3B8IA 4YN5A 2VENA 4C6NA 4HMDA 3TH6A 4NXSA 1ICQA 1GQIA 3LA4A 1PX8A 4LAOA 3NQBA 2WCAA 4R7JA 5FD0A 3AIEA 1KLYA 2VD8A 2CZFA 3L66A 4CGTA 3VGEA 4IQDA 5FI8A 1KB3A 4KIRA 5ABGA 3UJFA 1NVMA 4OHQA 4XO7A 2F7FA 3LZ5A 4GKLA 5ABTA 1T8XA 4ZVJA 1XYCA 3WD2A 3A13A 3R94A 1SQ7A 1CTNA 3QKEA 4PMXA 4MPQA 2UV8G 3FKKA 1CGUA 4YS1A 3ARZA 4ACZA 1A0CA 5KZMA 1YTEA 3PBYA 1UKSA 5HNTA 2PGFA 4RDVA 3NGJA 5J5DA 2PDMA 3WF1A 3GKFA 4H6EA 5D9MA 1EYWA 3LGDA 3W81A 1LOQA 1GPWA 3M9YA 4Z17A 2D20A 3LHZA 4KKXA 4LW7A 2QMKA 2EPMX 3L4WA 3LRKA 1L6YA 1B4EA 5I6SA 1A5NC 1EH9A 4D71A 4MG4A 5H6HA 5A8QA 3GWQA 4GACA 3N9KA 1EO7A 5F2LA 4XSMA 1V79A 1JZ8A 2IS7A 3M16A 4IXHA 4Q6XA 3IJIA 4KS0A 2OTDA 2VXNA 5KINA 3WX7A 2HE5A 5HWJA 4U5IA 3RLHA 4PUKA 1WPCA 1EBGA 1FP9A 3H7RA 1RD5A 1UKPA 5C9ZA 3WEZA 4DWDA 2PDKA 3BMXA 1VS1A 1J0IA 3FNDA 2OWXA 3TQKA 4H9VA 3SN0A 3JZUA 4NU7A 3W53A 3IJLA 1O7AA 4FF5A 3W1TA 2CZEA 3BMWA 1XINA 3W3OA 2H6RA 1XPYA 4HPNA 5BOFA 1XQKA 4RW5A 4EANA 2ZCGA 4JICA 3LM7A 2PTYA 1J93A 4Q6JA 5HJXA 1WCGA 5IFTA 2DEPA 4DF2A 1MRAA 3PZOA 3VXGA 1CZ1A 3CEPA 4LS2A 3KVLA 1E3ZA 3VIIA 4S3GA 4WGHA 3R8HA 4ROPA 2NWSA 1TELA 4ROQA 2OWWA 2NVDA 3TAKA 3ERPA 4Z2HA 3CIXA 2WZEA 4PUDA 4PODA 1G4EA 3N2BA 3QC0A 2GGEA 2FJKA 2G3JA 2F38A 2PBOA 3B4UA 1JYNA 1GJPA 1JXJA 2E1DA 2JK2A 4O28A 4LVDA 1NFPA 3EMCA 1UP2A 2P88A 5DRIA 5F2MA 1R46A 1VEMA 3WNNA 2YB1A 3T4CA 2NSOA 5IRPA 1SZNA 2OLHA 3MUAA 3PAOA 4ZXOA 5JQ9A 3IRSA 2WV8A 1ITUA 2NXHA 4CN1A 5IBXA 1E4NA 2ZZ3A 4JFVA 1LLWA 4AH7A 5J04A 2XIMA 2JGQA 1X96A 3U8GA 4DXVA 2V9DA 3W1XA 1E6QM 1K77A 3VI2A 4LJ3A 4AEEA 3MW7A 4ECLA 4GK8A 3S1XA 2QCMA 2GVJA 2Z27A 4XD3A 4CD8A 3LPFA 4CEUC 2YGYA 3QSTA 2YL6A 1K70A 1V77A 4ZQPA 1BPLB 2OZ3A 4Y7EA 2PWEA 4JNYA 4YHGA 3KTXA 2GL5A 2XZ7A 1ZHAA 3HQ1A 1PIFA 1EYEA 4ZENA 3SUVA 3QLLA 5DCBA 3REQA 4QG8A 4PRRA 4JTAA 3NZQA 3PZGA 1R47A 5A69A 1IZKA 1J8VA 1VRDA 1AQ0A 5CG0A 4PBGA 3WUGA 4MFEA 1YYAA 1IXQA 2ZXBA 4GABA 4PUEA 3DXIA 4QCFA 3UWUA 1UZHA 4HMEA 1FXPA 5C6MA 3HG5A 2J6VA 3IUDA 3IIVA 4P8XA 3MBFA 4M6PA 1AL8A 4XAYA 2INZA 2Z1XA 4B5NA 2Q09A 2JEPA 4FO4A 4GKTA 3LCWA 4QISA 4ZQRA 1Y5WA 4RR4A 4H7CA 3TWBA 1HFBA 1GVOA 2A3LA 3UXAA 4PUJA 3VTRA 4DBDA 2BS9A 2VZUA 1ZS2A 2QAFA 3QZAA 4IFKA 5D2WA 1ZALA 1IE7C 2OR2A 4QJ3B 2OSWA 1LWHA 3LUTA 4M6UA 4HP5A 3VZZA 5A6JA 1K02A 4P61A 2Y6ZA 2Y7EA 4K3ZA 1HO4A 3DESA 3L4XA 3WQWA 1JZ5A 5ECUA 2WMHA 3NL6A 4YIWA 1Z3NA 2Y8VA 1MI3A 2CEQA 3M44A 3BICA 1AJ0A 2O9PA 3TTYA 5BW6A 1I2QA 5I5RA 2AAMA 5FAGA 4HGXA 4GZJA 5HDRA 4EPDC 6TAAA 3GM8A 5FJTA 2VP8A 3ABRA 2PGEA 3CLWA 3WQEA 3NQEA 3FYYA 2ZZ5A 3T2OA 1QPOA 4AIUA 8TIMA 1VJSA 2ABAA 4ZR8A 3QHOA 4UIOA 1SJAA 1AUSL 1O5KA 1U83A 2A2IA 2EPNA 3WENA 1EC9A 2YYUA 3G18A 3DENA 3NR0A 2ZA1A 1AZ1A 2MNRA 4HNUA 1FWTA 1Z6KA 1C7TA 1M7JA 5CC7A 1C3FA 2RGMA 3AS0A 1US3A 1JPHA 1ECQA 3EKZA 3U5UA 3R4IA 1O60A 1AZ2A 4YTTA 4NKCA 5CZSA 3PAJA 3FJ6A 4ILSA 2HK1A 4P8WA 3UERA 4F0SA 4W8AA 2XWDA 2YCIX 3V35A 4AZCB 1ZY9A 3OLEA 1F2JA 3BLOA 3V1PA 2V68A 4HMCA 5CSRA 3UFYA 2HDJA 3ABQA 4UBPC 2CBJA 4LF1A 5K3VA 2ZZ7A 3SAZA 4J7RA 4Q4PA 3UVAA 1XXXA 3AZSA 3APYA 3RO8A 1QOQA 1H51A 4JTFA 1OG0A 1NP0A 3NM1A 5D2YA 2DVTA 4EAMA 3RHGA 3L4UA 3BAIA 2Z7KA 4C6DA 3G2GA 3S0CA 2CIPA 5TNVA 5L6UA 1R0MA 1BQGA 5CAHA 4CCZA 1DWFM 3IIOA 5C9UA 3W2MA 1DPMA 3GW0A 4H8HA 3VAVA 1XC4A 4JTGA 4BI6A 2PZNA 4AHQA 3EOSA 4D6IA 1REQB 4IP4A 1B3XA 4TX6A 1E4LA 3L68A 1R8LA 1NQ6A 3VD4A 2ZRUA 1P4CA 1BVZA 3P5ZA 3SJNA 3WYZA 3SY8A 3WLHA 5EA9A 2WJDA 1WE5A 3PS7A 4IT1A 1ZL1A 1EB3A 3GDKA 2Z2AA 1NEYA 3I6TA 2QJNA 3AS1A 3WFAA 4NYYA 1E9YB 1I1XA 3PPHA 1R2SA 5G1MA 5K4ZA 3A21A 3RPTA 2IPWA 3EDFA 4TUFA 4RCXA 1EZWA 3LDVA 1UZ4A 4ICCX 4MLRA 3B9DA 3S9YA 1K4GA 2OVLA 2GJRA 3CPRA 2HISA 1CGWA 2CXGA 3CUZA 1UYQA 4HT3A 2ZUSA 4L4MA 4JQAA 1J0JA 4RKAA 4LB4A 4DBEA 3W1PA 3W7QA 4LUSB 1ZJBA 3CV6A 1E43A 2ADAA 3H8AA 4QP0A 3NQAA 3GTHA 4XKYA 2Z4GA 6A3HA 2GDUA 7PTDA 2QT3A 3E2QA 1B3WA 4TTUA 2QCFA 3HB9A 5JIPA