2CLLA

Tryptophan synthase (external aldimine state) in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
257
Chain Sequence
b'ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 98
structure length 257
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cllA00
3GAKA 4M7SA 3TQ0A 3LV5A 5EMUA 2GUUA 3DKLA 3HPZA 3T78A 2VFHA 2FJKA 1OFRA 3PVFA 1H7NA 3ANYA 4GRSA 4IMEA 3LB0A 3V1PA 3LDVA 3PSVA 3DFTA 3LTSA 3CIWA 5HUPA 3P81A 2VC6A 1YTKA 2FQIA 4O13A 4UIOA 1X1OA 4DF2A 1Q6OA 1OFEA 3CB8A 3NL6A 4TX9A 1GTEA 4TO8A 3NZ1A 4O1BA 3W7DA 3VFLA 2IQTA 1G7UA 4BI6A 1NAL1 5LNUA 1AL8A 4JX6A 2A6LA 3NOEA 4JIQA 5K9CA 1ICPA 1YPFA 4UR8A 2VOMA 5CSRA 3L21A 5E0KA 4W9TA 4O12A 1LYXA 1GJPA 2ZRWA 3I7SA 4DO4A 2X1RA 3CM4A 5U4NA 3NPWA 3DFPA 4NUWA 4LVDA 1AW1A 3QZEA 2C6QA 2GJNA 3O1NA 1PCKA 1O95A 3LCLA 2J9ZA 3F4NA 3GB6A 3IVTA 2DZTA 2GVJA 3O07A 3P7YA 5AC8A 3HG5A 1JCNA 1KBIA 3LTYA 2YSWA 4ZMGA 3PBUA 2VXNA 1YXYA 3KAOA 4YCPA 1XUUA 4BF9A 1ZAJA 3TUUA 1JVNA 2B4GA 1H7RA 1TV8A 2ZZ3A 2XN2A 1T0OA 2VFDA 3NPXA 2Y7EA 1TO3A 3KHJA 4HPJA 4Z0JA 2ZBTA 1S3HA 3M5VA 2ZA3A 3C56A 3MUXA 1V5XA 1SO3A 1W5PA 4QNEA 4UTTA 2DZPA 3NQEA 4MY8A 5HQEA 5BMWA 4ADTA 2FPTA 1FX6A 1I2OA 4HT3A 5HULA 1OYBA 3MBFA 5G1TA 4UFLA 3EKZA 4YMZA 3MYPA 2C13A 1JUKA 2FB2A 4OGZA 3C0JA 3G1SA 1EUAA 1TPEA 5AYYA 3U2OA 2WNNA 4MFDA 4O10A 5U7SA 1EUNA 4XBSA 4GUFA 4AHQA 3STEA 4WZHA 3W2KA 4Y6GA 3RMJA 3A23A 5AYXA 1NF0A 5EL1A 3L2IA 2G5WA 5LNWA 4PCFA 1N55A 3L5MA 1H60A 3UWUA 2E6DA 4FX7A 1ZALA 2C0AA 2WSYA 3QRHA 3CT7A 3W2LA 1F76A 1H7OA 4WY0F 1K7FA 3W1UA 3B05A 4ICNA 2TYSA 3NQ7A 4O8RA 3W23A 3T55A 3MP4A 3LI1A 1LOLA 3ELFA 4N02A 3M6YA 4NX0A 2LLEA 4LUIA 2BLEA 4JYFA 3O15A 3ATYA 1LM1A 3P5YA 4CNOA 1H1ZA 4X22A 4B5NA 3W22A 3G3DA 3WK3A 2VFIA 2H90A 2DJXA 4O54A 2V5BA 3GNDA 4UC5A 1B4EA 1PE1A 1N7KA 5TBOA 1W1ZA 4NJJA 1BKSA 4JGDA 4UFIA 3LXAA 5KINA 1JCLA 2H3DA 2CLKA 5A8GA 1AG1O 3STFA 2C15A 2QJHA 1S5TA 2E68A 2ZQ0A 4NJKA 4KWVA 3Q58A 3FYOA 2CLOA 3FOKA 3CWNA 1G4PA 3PB2A 1TPDA 3KOFA 3W83A 4RK8A 3IGXA 1DJQA 5KZEA 5L6UA 5HWNA 3CHVA 1TRIA 1IXPA 2G95A 5HWMA 5IBXC 2YCEA 3G1FA 3DFOA 4QITA 1DQWA 3ZWSA 3B06A 2FLIA 5KMYA 1R47A 1PV8A 4HNUA 2G96A 5D37A 5DCEA 3W2NA 3DKJA 4MJZA 1CI1A 1JUEA 3HPSA 1EA0A 4O57A 4K39A 3W1NA 3RF9A 1OHLA 1X8FA 1ADOA 3L68A 3UWQA 4OWGA 5C5YA 3MMTA 1OFOA 1XBYA 2VFEA 2ZZ5A 5AHMA 1FWTA 4TMCA 4FNTA 3HB9A 3ZR4A 1VZWA 1KFKA 4MLJA 2Y62A 2A21A 4XTDA 2B7QA 2XN1A 1U5JA 4GNJA 4DPQA 1YTEA 4IPJA 1LRNA 4R7JA 3OG3A 3LHTA 1Z41A 1K8XA 1KFBA 1DV7A 1OX5A 3BO9A 1UASA 4EVZA 2QEZA 3V75A 1W8SA 3TV8A 4PFMA 4E0CA 2ZCGA 3FKRA 4MOZA 4UFKA 1T99A 4WX2A 1TREA 1AW2A 3DBPA 5LNRA 1G4EA 1YXCA 3QJAA 4IGHA 1OFPA 5G1YA 4M5PA 3QMRA 4IX0A 1F6KA 1YDOA 3TW6A 4RV8A 1SZEA 3L0KA 2YW4A 1K3UA 4AF0A 3USBA 2YX0A 2I9EA 3MYOA 4O0KA 2RFGA 3TSMA 4CLMA 3KRSA 3SZ8A 1GEQA 2ZTJA 1CW2A 1FCUA 2TSYA 1KM6A 1L6YA 4AHOA 4NXSA 2QUVA 4Q32A 3IVSA 4MPQA 1MO0A 2E6YA 3N9RA 2Z1BA 4OV4A 1I8JA 2GQ9A 1R2SA 1S5VA 3L65A 2HS8A 3GAYA 3FA5A 2YFOA 3LHUA 1H62A 4UTLA 3A9IA 1OF6A 4LTSA 1BTMA 3TX9A 3MHFA 2C1HA 3TR2A 1VCFA 2ATMA 4LC8A 3HGSA 5FI8A 4MYAA 3S1VA 2PC4A 1Z48A 3QM3A 5G4WA 3W7PA 3LCIA 2WO5A 4QQ3A 5FF0A 3TROA 3ABQA 4JDYA 4UFHA 2PE4A 1SQ7A 4UFJA 4IPIA 1WQ5A 4LNYA 4KKXA 1GQNA 3W70A 3LHZA 3TKFA 1KTBA 1OX4A 1GG1A 5EA9A 2YFNA 2Y7GA 4KFPA 3KVMA 2TRSA 2H3BA 3GXNA 5F1UA 3M5YA 3DFNA 3SR7A 4DQWA 4IMCA 1O5KA 3C3NA 3P61A 1H63A 3DHDA 2FTPA 3PBVA 2FPVA 1RPXA 4Z0SA 3P60A 1WBJA 2EKCA 2GQAA 2JGYA 3C4UA 3AO0A 4JTJA 4FB7A 3IRDA 5LGXA 1QFEA 1F74A 4KFOA 2YR1A 5C54A 1ZJIA 5AHFA 4UFMA 1QAPA 4IOTA 3C6CA 4MZ8A 4ZQOA 5I3GA 1KFLA 5SWUA 1J4EA 1XBXA 3N2MA 4HSOA 4O1DA 1W56A 3B04A 1W37A 5D03A 4ADSA 3BLIA 3NYZA 3TW7A 3EWWA 5AHLA 4K7YA 3UWWA 4Y96A 4O16A 3NL3A 2OZ0A 2RDUA 3CPRA 3VCRA 3WJXA 3OEXA 1M5WA 3DH7A 4FF7A 4R33A 2CLMA 3UZJA 5MHBA 3R8RA 5I3KA 3KFTA 3LV6A 3CWOX 4JTFA 3NGJA 2OJPA 2ZRYA 1KM0A 1K8YA 3L9CA 3TFXA 2ZA1A 3TAOA 5I3JA 5K3VA 4FNUA 4JTEA 1IGSA 2EGZA 2V2HA 3D0CA 1H51A 4LS1A 1ML1A 3HGRA 4HHPA 3P8IA 3QSRA 3UWYA 1I45A 4K37A 1HL2A 4A3UA 4A2RA 4ALDA 4O1CA 3TU9A 4GUJA 4N9EA 3NQFA 3W7HA 3P5ZA 1Q45A 4JEQA 1P0NA 4IMFA 4A2SA 1RV8A 1RQEA 1H1YA 1ME8A 1W5MA 4TMBA 3BW3A 1SO6A 4I7VA 1VC4A 3QMTA 4UTJA 3NM1A 3WFAA 3LX9A 3TC7A 1P0KA 4HPXA 2PCQA 3FYPA 3G0XA 1NVMA 3GYEA 1QMLA 5F4XA 1W54A 6ALDA 1D3GA 4DBDA 4YWIA 5HR7A 1DBTA 2H8ZA 5H2ZA 2V30A 1YLVA 4GUHA 3C2OA 3EXSA 4CQ9A 3L5LA 3EEGA 5DELA 3B03A 4UCGA 3H55A 1UUMA 5K9DA 4JTLA 1KLZA 3LCXA 4IXHA 1W31A 2HSAA 3FJ6A 4AH7A 3C61A 3QPZA 3PG8A 4MVAA 1SW7A 1VCGA 4QISA 4LY8A 3LXCA 3DGRA 5CZ0A 3LM7A 3QSTA 1NSJA 1XDMA 4Y90A 5AFDA 1WOAA 2C18A 3S1UA 3TSDA 5AC7A 3O6YX 4GUGA 1A5CA 1HO4A 5K2ZA 2B7OA 1WAUA 2NV2A 3SIZA 2P1FA 1TCDA 4UXDA 4OV9A 1XFBA 4PH6A 2X1UA 2TPSA 4O52A 4S1FA 3NQCA 3NPUA 5G2HA 4JNMA 2ZZ4A 3OVPA 2ZRVA 2W79A 4OU1A 4LV9A 1QOQA 2Y85A 4DXVA 3GNNA 2Z2UA 3NR0A 3S5OA 1TTIA 2O7QA 5LKYA 1UUOA 3W1LA 4JXCA 4CCCA 3A5FA 5F2GA 4JTIA 3P67A 5D33A 3T40A 3P84A 3N3MA 2RDWA 2I1OA 3HG3A 3DXIA 4DELA 1H5YA 3GDMA 3N19B 2QCDA 3GK0A 5FF4A 1XUZA 4JYDA 2P0OA 3TQKA 2CZDA 5DBTA 1KTCA 1A5BA 2X1SA 1GYNA 2H8XA 3PF3A 1GTHA 2CWNA 3UPBA 3UPWA 2NXHA 3R12A 5G5IA 1C8VA 4I7WA 3M0ZA 3MP5A 1XCFA 4ZZ9A 1QPNA 3MBDA 4Y8FA 2BTMA 2PURA 1PVNA 1F5ZA 5BOOA 2QCEA 2CFFA 3HPXA 1KA9F 2BXVA 2ZZ7A 2CLEA 3UQNA 2ABAA 3CLMA 3O63A 1I2RA 1XBZA 4LV4A 5AHEA 2NZLA 3PWAA 1R2RA 2A0NA 4LUJA 1MEHA 1X1ZA 1KM1A 4AF0B 3GX9A 2DZXA 3TNOA 3T44A 3W1RA 1F2JA 3GDLA 3L0GA 1G67A 1KM3A 5CPOA 1EPXA 5I3HA 1FCBA 3R13A 4AMAA 1UBSA 4UTWC 4K38A 2Y61A 1LROA 1P1XA 3W7JA 3C2EA 3RK8A 5DY3A 2FIQA 1J5TA 2OMAA 4UTTC 4LRTA 3W7EA 1QO2A 4IUOA 5A5WA 1O94A 3P74A 4CNNA 5K7JA 1DOSA 4Q4KA 2QDGA 1HTIA 5D05A 1XXXA 4WD0A 1L6WA 3H53A 3TE9A 2DORA 1QO5A 1E51A 4UTKA 3W1TA 1K7XA 1D9EA 3C52A 4TR9A 2YGYA 4M19A 5AOUA 3DI1A 3S9YA 5EY5A 1OX4B 3NQGA 2EHHA 4WOZA 4Z08A 2QUTA 1JCYA 4XTIA 1NEYA 3OIXA 3GLCA 3O6CA 1FDJA 3IIPA 3NQVA 4QJ1A 2X16A 4PA8A 2EF9A 4MY1A 4TIMA 3W71A 5BW6A 4IX2A 2RDTA 4JDBA 3W7GA 1JULA 1M7OA 2DZVA 3NQ8A 1K02A 5EYWA 3B0UX 4MKNA 4DO6A 1Q6LA 3LLDA 1K03A 3PBYA 1K8ZA 1G6CA 4JTSA 4O53A 3FFSA 1FDZA 2GJLA 1TJPA 2QUUA 1OYCA 4FIRA 1OK4A 1M6JA 1R30A 1IXNA 5HJLA 4BK9A 3BPWA 3PM6A 5HMSA 3W1QA 4C1KA 1BWKA 3OVRA 3NA8A 4N6EA 2CZEA 1VGAA 4CQ8A 5GVJA 2QCLA 3GXTA 2C3ZA 7TIMA 3PULA 3E0IA 1W3NA 2E1DA 5BMXA 3HO8A 3WK0A 3M16A 4NZFA 3DHFA 3UD6A 3LCFA 3W7LA 1C29A 3MI2A 1HG3A 1W0MA 1WYIA 3TQVA 3OBKA 5F1VA 2VFGA 1O4UA 3IIOA 3W86A 4GBUA 1ME9A 1B4KA 1JJKA 4ORIA 1JR1A 3SGUA 4A21A 5IBXA 4OBTA 2JGQA 3G1AA 3NDOA 1GPWA 1W5NA 3GXPA 1ZCOA 1L6SA 4UMBA 4U4MA 4CCEA 3F1QA 2FB3A 4O17A 2QCGA 3KX6A 1VQTA 4AXKA 1I2QA 3N34A 2YW3A 2DJLA 3W75A 4D2JA 2VEKA 3TJXA 1SSDA 4LU0A 4CQAA 4JD4A 2GVGA 2YZRA 3TMQA 2NUYA 5FF2A 1F6PA 3S0CA 1F73A 4UR7A 3LRKA 2CLIA 2WNZA 2RHGA 1IXQA 1X6UA 3P80A 4O0ZA 3W72A 3T7VA 3GKFA 3BARA 1Q3NA 4K8HA 5CPMA 2WSQA 3RLUA 4M6VA 4ML9A 1GWJA 3VE7A 2GOUA 3TJLA 4POCA 1TPUA 3TCEA 3ABSA 3EX4A 3DU0A 1TTJA 2F84A 4IMDA 2YDAA 4UMCA 1GOXA 4YLWA 4WQ6A 1FXQA 5F4WA 1ME7A 4WUIA 3I7QA 3NL2A 1MSSA 2JKPA 4XZ9A 4GWEA 3IGSA 1A53A 2I14A 2EAWA 1VLWA 2FDSA 2WV8A 1V7YA 1XM3A 3PY2A 1KM2A 1EWDA 1W5OA 1ALDA 2YXGA 5CGQA 1G4SA 1MZHA 1QWGA 3QC3A 3BLEA 4L4MA 5KITA 3LLFA 3R2GA 1AK5A 1YTDA 4NU7A 3HJZA 1G7VA 3STGA 4E38A 5I3IA 4ZL1A 3HG2A 2NX1A 3GDKA 4QNWA 4M7TA 2CZFA 4Y9AA 3SGZA 3W7KA 3JR2A 4EOUA 2Y70A 3LI0A 4DF0A 2WJZA 3O06A 3RLVA 1A50A 3CTLA 3G1VA 2ZZ6A 4LW7A 2QCDB 4FO4A 3NQ6A 4LWWA 4U28A 4FX6M 5AB3A 2QR6A 2PRMA 1KTNA 1WV2A 2QCNA 2QJIA 2V2DA 5E1QA 3SSJA 1FY6A 1RVGA 3W7MA 2YYUA 1D3HA 2R14A 3PUDA 4ZVJA 1QPOA 4P61A 1SSGA 3LOTA 4RR4A 3EWBX 3DZ1A 1EP1A 1WOBA 5G2IA 5D2WA 3PS7A 4Q33A 1U83A 2A7RA 4CNPA 1A5AA 4HKPA 5LNVA 4NT0A 5LHEA 4AWTA 2ATSA 1EP3A 2Y88A 2X1TA 4LT9A 1TQJA 3W07A 1OFQA 2G97A 2H6RA 3S5YA 2V2CA 3JS3A 3OVQA 4O4VA 1XI3A 4PL2A 3HF3A 3BK0A 3NPVA 2NWRA 1AMKA 1YDVA 1LBMA 1P4CA 3EX6A 3P8JA 8TIMA 1RR2A 3Q2DA 2OT1A 2OT0A 3W88A 2CW6A 4BWLA 4K8EA 3BW4A 5ABTA 3W9ZA 1I2NA 4BI7A 3KXQA 4KFNA 1FDYA 1FUYA 4R34A 3W2MA 1B57A 3FIGA 1WBHA 1SZFA 2Z6JA 1GYLA 5FESA 4WY0A 4N9BA 4Z1BA 3W87A 1RD5A 4X3ZA 2A5HA 5TIMA 2GPTA 1RZMA 4NZJA 4QIUA 3TFCA 1TPWA 1DORA 1ZAHA 3F03K 2E5BA 2CZ5A 4TU1A 3BG3A 4LVAA 2Z6IA 4ZQPA 5KZMA 3NQ2A 3W2UA 3ATZA 3BVJA 1YADA 3VKJA 4N9CA 2NLIA 1VH7A 2Q8ZA 1FWRA 1OFBA 1J2WA 5L9FA 2BSLA 1H7PA 2Y6ZA 3KVLA 3P62A 4JICA 4Z1CA 3S1XA 3SW6A 2WNQA 4O14A 3PG9A 2VEMA 4O50A 3CQ0A 5F2MA 2ZFAA 1EWEA 6TIMA 4LRSA 5D2XA 4RZ5A 4JTKA 3WJZA 3QF0A 3W1PA 2QCMA 3PR2A 1F7BA 4S2BA 2WOQA 1VYSX 2E6FA 2V8ZA 3SJ3A 1YDNA 4NJGA 2PRHA 3C8FA 3QEZA 2TMDA 2QCCA 3GIYA 1O5XA 3LRLA 1ZAIA 5TQLA 3BG5A 3N14A 4JS3A 4I7UA 3S6DA 1LLWA 1WA3A 3W7QA 1LOQA 3R89A 2Y7DA 3DI0A 1FQ0A 1O60A 3FS2A 3W6YA 2ZTKA 1RQHA 2QKFA 3H54A 5FEZA 3G1XA 3W74A 3W73A 5FEPA 2Q3RA 1SFLA 3RNDA 4O15A 3JRKA 4RXGA 3I7RA 3QQ0A 1F05A 1M7PA 1SZGA 2OX1A 4IWWA 2ABBA 5CZTA 3E49A 1THFD 5EPDA 5J5DA 1KFCA 1TTPA 3E96A 1ZNNA 1B9BA 4DEFA 3QYQA 3EB2A 1XKYA 2PRLA 5CPNA 1TV5A 2YYTA 3G0SA 2YPIA 3GKAA 3PC0A 3UXDA 4JX4A 1I4NA 4OHQA 2DU2A 4RJEA 3W1XA 5C6MA 3G22A 5CZJA 3IVUA 1LP6A 1CX9A 4AAJA 3UNDA 1OABA 4HNTA 1SFJA 4JTUA 2DZUA 4MLRA 2GQ8A 2J9XA 3C2RA 3TDFA 1LBFA 2Z0IA 3EX1A 1OVDA 3TC6A 3WJSA 3F4WA 2AAMA 5FF3A 1PCWA 1YPIA 1ICQA 2VFFA 1LOSA 3GDRA 3HG4A 3IGUA 1SU5A 3PUOA 3S1WA 3I6RA 4XWUA 3QFEA 4K36A 4C1LA 5D38A 4NNCA 3TMLA 4RCXA 1JQXA 1TJRA 2HMCA 2C16A 3EWUA 3G1DA 2CLHA 2NUXA 4EF8A 3L5AA 4O11A 5KTLA 2Y63A 4UTMA 3SECA 3W3OA 1JQVA 4GFSA 4MZ1A 3NZRA 1ONRA 4JTTA 4HN4A 2VEIA 5EKYA 2JKAA 3WJWA 3KVKA 1KLYA 3NL5A 3E12A 1ZY9A 3WK2A 4GXMA 1LRQA 1Y0EA 4NXKA 1WDWA 4ONVA 1TQXA 3TA6A 5D30A 1VHNA 4AWUA 4M6QA 5DN1A 1YXDA 5D2YA 1EIXA 3CEPA 1JCJA 3UYCA 4UTUA 3M1ZA 1TPVA 2CLLA 4AEOA 2V9DA 1OK6A 1Z44A 1LORA 5LSMA 3L66A 4X2RA 5LZLA 3EKLA 4MJMA 4MY9A 3LHVA 5C2XA 1PHQA 2QDHA 4UNLA 2ZRXA 4PL1A 3B0VC 1UB3A 3W7OA 3M7WA 3ABRA 1AL7A 1LZOA 1W5QA 2QJGA 2VENA 3QPYA 4QSHA 5E93A 4BI5A 3HOJA 5LNSA 1PS9A 4M6PA 3UXAA 1EX5A 2Q3OA 3GVGA 4MFEA 3W7IA 4UTWA 3KVJA 4NQ1A 1DQXA 4WXZA 5CSSA 1GVOA 1TRDA 3LBMA 1YYAA 1HUVA 3NQAA 1FCQA 2NXGA 1PHWA 2WSRA 3RFAA 4N4PA 4NJHA 4MYXA 3S42A 3K30A 3VI2A 5F4SA 4H6KA 1B3OA 3M41A 2ISVA 2Y89A 4H4IA 1KV5A 4JIPA 3TH6A 3W1AA 5K9XA 3E9AA 4IQLA 4RX0A 1FWSA 3IIXA 2FFCA 2R94A 1GVQA 3A24A 4AHPA 3M5ZA 4WJEA 1JCXA 3P82A 3VE9A 3S5NA 1QR7A 5HUOA 3YPIA 4WOQA 2E6AA 2J88A 3EWXA 3ABOA 1VS1A 4E2DA 2ISSA 1FWWA 2NWSA 2V0TA 3SY5A 3A5VA 3TXVA 2QCHA 1FCVA 4ORMA 4QM1A 5BNKA 2R91A 5HINA 3TSBA 1SW0A 3M9YA 3E02A 1QOPA 2JK2A 1EEPA 3TAKA 1LDCA 1SZNA 1ZFJA 1XL9A 4FEZA 4DBEA 2XFWA 1KFJA 1TYGA 4UTIA 1SPQA 4XKYB 3NEVA 4BR1A 3INPA 1VHCA 1G4TA 4XBKA 1PL9A 2ISWA 2A7NA 4FXRA 4Z1AA 5G4EA 5D02A 3QW3A 1JCMP 1FBAA 3KRUA 1TSIA 1SUXA 4X9SA 4GUIA 4ZQMA 3QH2A 3M43A 3W7NA 4PTNA 4WY0B 2RKXA 3MWAA 1OYAA 3THQA 3G8EA 1GZGA 2DP3A 2VELA 4HNVA 4ADUA 4RZ6A 5D04C 3UY7A 3EWYA 4LVBA 4JY9A 2BZNA 4N6FA 2NX3A 4ZQNA 1PIIA 4LS2A 5J5RA 3ZS4A 2B7PA 3C2VA 5KSWA 3QQ1A 4XQ6A 1RQBA 1Q6QA 4IXXA 2HS6A 1AW5A 3G3MA 5T26A 3TIMA 5D2VA 4FX8A 3HIJA 4PC8A 1TV7A 4BFAA 5HR6A 2Y7FA 3A22A 4RXFA 1R2TA 1QNVA 2ZDRA 4YXGA 5AHIA 5I3FA 2WKJA 1KV8A 2CLFA 4KWWA 5K4ZA 4FNQA 1TMHA 3STCA 4PEKA 1P5BA 4FNRA 4AVFA 5DY2A 2BX7A 2GVLA 5DBUA 3PBWA 1MXSA 2NXIA 3UZ5A 2AGKA 2NUWA 1C9DA 4I9AA 2UV8G 4DPPA 1QCWA 3NQMA 3OA3A 1SR9A 1HO1A 3BLFA 3MP3A 1OJXA 3TXZA 1OFDA 1TIMA 5AN7A 2QAPA 1X7FA 1I2PA 1XDLA 1IIGA 4IMGA 1R46A 3ZWTA 3W85A 4J9JA 1DVJA 3NVTA 3WJYA 3NAVA 2ZA2A 2E5CA 4N9DA 3EWZA 1GG0A 3MO7A 3MHUA 1DL3A 4K6AA 1VPXA 3B4UA 3GR7A 1QPRA 3TK7A 1GVRA 3PAJA 3M44A 3R5EA 3S8HA 4JTHA 3N73A 1LBLA 4MZYA 1VCVA 4A29A 1HFBA 3CEUA 3L0NA 1XBVA 3FEMA 3MHGA 3W1MA 1GVSA 4S2CA 1L2UA 1DHPA 3KRZA 3HMJG 2BWGA 3W84A 2ZRUA 4UNKA 1EP2A 4LS0A 4JY8A 1W3TA 5HNRA 2ZRZA 2JBMA 3SFKA 1JRCA 5AC6A 4Z1DA 3N9SA 4O28A 4ZQCA 5D09A 2D73A 4O4WA 3DENA 2W6RA 3I65A 3VNDA 1KM5A 3U8GA 3LHWA 4IJBA 5AHNA 4MIMA 3NG3A 1W3IA 1WX0A 2ZYFA 3GR8A 3W2JA 5CPLA 1IXOA 1VYPX 1LLZA 3LTPA 4AB4A 1LRTA 3ZFHA 1L9WA 4O18A 3IIVA 3O8AA 3U6WA 5F2LA 1QDSA 3LBCA 4FNSA 1K7EA 4DO5A 1XC4A 2A2IA 2XN0A 5CG7A 2O7SA 2E77A 4HNNA 3HQ1A 4FIQA 1KFEA 1OF8A 2J24A 3LXBA 5KZDA 2E5DA 1EB3A 1UJPA 2V81A 3N2XA 5DXYA 3G18A 4NNBA 4JX5A 1IF2A 1FWNA 1VJIA 2CU0A 1UCWA 3C2FA 4FXSA 3QMSA 2C19A 3FJLA 3FLUA 4MUZA 4E2BA 2A7PA 3G24A 1Z42A 1N8FA 4LVFA 4QAIA 3EXRA 1TTQA 4OE7A 2F7FA 5LGZA 1MEWA 5CZSA 2QAFA 4O19A 2RH9A 3BGJA 2A1YA 4YL2A 3MI6A 4ZQRA 3HGOA 2V82A 4XKYA 3QW4B 1Q6RA 3BV4A 5C55A 4R53A 4EWND 1ZENA 2X30A 5H91A 3Q37A 4G1KA 5CKSA 4DF1A 2VKZG 1SO4A 5K4XA 1BEUA 4PODA 3MI3A 1QPQA 3M5XA 4BWLC 5D2TA 1T96A 2C14A 3NO5A 3LRMA 3NQDA 1BWLA 4UTHA 1DKWA 3S5ZA 4NX5A 2NV1A 1MEIA 3UY8A 2B0MA 1H7XA 4EF9A 3GZ3A 2DZSA 3L67A 4JTGA 1NF7A 2W0UA 3HBLA 4L4LA 1H50A 4YCOA 5FEWA 3I68A 3THAA 3CU2A 5DCDA 1VLIA 1KW1A 4FNPA 3WK1A 3PSWA 3HGJA 1LTDA 4N4QA 1H7WA 4JR5A 3W7RA 1ICSA 5AYZA 2A4AA 5LHFA 2KZHA 3EX3A 4OT7A 3M47A 4JN6A 3O05A 3Q94A 3GDTA 2DZWA 3EX2A 1H61A 1TPB1 4EIVA 5BRBA 2QCFA 2A6NA 1IIHA 1KBJA 3UWZA 4K7VA 4RLIA 4P2VA 1OFAA 3LCHA 3AJXA 3NXFA 3EXTA 3IEBA 3NM3A 2J27A 4GJ1A 4NNAA 1GVFA 1VRDA 5F2IA 5D32A 4JYEA 3G1HA 3B0PA 3B8DA 1DJNA 3DFQA 1WXJA 5EBUA 1GT8A 5DLCA 4N2YA 3IIZA 3A21A 4LVGA 2ZZ2A 4GE8A 4UMAA 2WQPA 2V5LA 1G69A 3NNTA 1T8XA 3G0UA 3LERA 5FF7A 4FHAA 3PUEA 3SI9A 2R8WA 2JKEA 3IV3A 1NFBA 2P10A 4LC6A 3UWVA 3CIXA 3FKKA 3BW2A 1JUBA 2FPYA 1FXPA 2J6XA 3LCWA 3OHIA 1A5SA 1TPFA 3PB0A 3CC1A 3T4CA 3LGEA 4OQVA 3LHYA 1S5WA 4NVTA 1OG0A 1OX6A 4HSNA 2EPHA 1TB3A 4NJIA 3BG9A 4A22A 1ZHAA 1SO5A 3G8RA 4HIBA 5DCBA 2A85A 2VEPA 1SW3A 2ZZ1A 2B7NA 3BGGA 4RZ4A 2ALDA 3O16A 1VR6A 2J9YA 2X2GA 4LOCA 4GC4A 5HWJA 3MW7A 2HTMA 4H3DA 2Q8LA 1JRBA 1VYRA 4XUGA 1TPH1 2AQWA 5G2WA 3DFSA 5DXXA 4AWSA 3DAQA 3G1YA 3W76A 1TPC1 4O1AA 3MJYA 2OCZA 4RKAA 3O6DA 1LCOA 4CCDA 3W7CA 4UUIA 2E09A 2NX9A 3RU6A 5IM51 3LCGA 5FEXA 2QF7A 2WPBA 4WXYA 1KM4A
chains in the Genus database with same CATH superfamily
3TA9A 3TQ0A 2GUUA 1NARA 3SCUA 1F61A 2PDMA 3GXFA 2VFHA 1OFRA 4AEEA 4C6OA 1BVWA 3VVGA 1TR1A 5CQ1A 3V35A 3DFTA 3LTSA 2ZE0A 2FZNA 4H7CA 2DW7A 4ZB5A 3UU0A 4K2SA 1AJZA 2QULA 4JOMA 2J7GA 4MNKA 5AVHA 1SGJA 3GY1A 3CZGA 4JX6A 2A6LA 1CDGA 2D1ZA 3QXBA 3C0LA 3L21A 5E0KA 4JTQA 4W9TA 5LYRA 4YHEA 3VTRA 4DO4A 2ALRA 2CHNA 2XH4A 3SUTA 2FMOA 4GQBA 4DJDA 2C6QA 3H4GA 3WO8A 2GJNA 4Q3MA 3O1NA 1PCKA 3PUGA 1O95A 3WH6A 4QLKA 4DXXA 3O9NA 4KRUA 1JZ4A 3OPSA 3N6JA 4LANA 3N4AA 3LQGA 5AC8A 1JCNA 2CXGA 1KBIA 2YSWA 3FA3A 5DQPA 3WQ8A 3GC2A 1JYNA 4Q4QA 4KS0A 1PKLA 2PDIA 3AOFA 2DT0A 1ZU8A 4HMCA 1EJWC 2XIIA 3PBGA 3KHJA 4Z0JA 2ZBTA 2ZA3A 4YU1A 2O0TA 3F4VA 1V5XA 1FWEC 2IXUA 3WF3A 3ORWA 3DFYA 4JKMA 4MY8A 4W4QA 5GQBA 5BMWA 1V3JA 4ADTA 1IT8A 4Z2GA 1S46A 2YXOA 1OYBA 3CAQA 3MBFA 7ENLA 3AIWA 1UWSA 4UFLA 4TUFA 1UQZA 1UOKA 1V3LA 5DRCA 3G1SA 5JVLA 3U2OA 2WVSA 4I6VA 3H2FA 1MXGA 4WZHA 3DN5A 3W2KA 4Y6GA 4LY4A 4HZMA 2CBVA 4C7GA 3NSXA 1NF0A 3WD3A 4O1EA 2R1KA 5IDIA 2E6DA 4FX7A 2WSYA 2JEQA 3BLDA 4QE1A 3SJNA 5EMMA 4WY0F 2DQWA 4ZO8A 1K7FA 1G01A 3ARVA 2Z7GA 2IPGA 2XSXA 4O8RA 4S3BA 1LQAA 3MP4A 2A3HA 1EXBA 1LOLA 3M6YA 2LLEA 3GVQA 4A3QA 3UZYA 3O15A 3ATYA 4PTDA 4CNOA 4M1BA 1W1ZA 3LXAA 1E70M 2H3DA 1T8QA 2QJHA 1FHLA 1S5TA 4OJYA 4UNIA 2CXEA 3RMEA 2CLOA 3FOKA 4XAFA 3PB2A 3KOFA 1YE4A 5JU6A 2G3FA 5L6UA 3N4FA 5HWNA 3CHVA 4EP8C 3MY9A 5IBXC 3G1FA 2ISDA 3DFOA 4QITA 3U7BA 2EPKX 4QHRA 5B7YA 2D3LA 4EWJA 4UOQA 2EEXA 2G96A 5D37A 4GY1A 3DKJA 1M01A 1RLDA 3HPSA 2CERA 3H23A 5I7GA 1EA0A 3BLKA 1V51A 3R10A 4K39A 4Z17A 4Q8TA 1OFOA 2ZZ5A 3T0CA 5A6AA 2Z24A 4TMCA 2DIKA 2Z1KA 3ZR4A 1O5RA 1KFKA 3A4JA 3AISA 1RD6A 3BAYA 4MLJA 4NI3A 4UQCA 3VU2A 2JIWA 4L5ZA 3ABXA 4HU4A 2A21A 3BL3A 4XTDA 2XN1A 3RDKA 1U5JA 1DQUA 3TCSA 4DPQA 4IPJA 4GYPA 4R7JA 3UW6A 1K9EA 3CGTA 3U2ZA 3V75A 3TV8A 3FKRA 4MOZA 2QGYA 4BY3A 1P0DA 4WX2A 3DBPA 5LNRA 1G4EA 4IGHA 3WUGA 2FZMA 5TD4A 2OZ8A 4IX0A 3ES8A 1KWKA 2WLYA 3M6DA 3PFRA 2BFGA 5LA0A 3GC4A 2WVUA 1ZZMA 1SZEA 7REQB 4LBRA 1MUMA 1UD4A 3USBA 2I9EA 3N11A 4CUCA 7ODCA 1ISZA 4V15A 4JEJA 4U2ZA 3KRSA 5I0DA 3SZ8A 2ZTJA 3DEQA 2O4MA 3WQ6A 2VDIA 1M41A 2TSYA 2V69A 1IZKA 1KM6A 4AHOA 4HK6A 3I4EA 4NXSA 2QUVA 1NWTA 2QZRA 5JIWA 4MWAD 2GQ9A 2XINA 2FZDA 1XCWA 3NXLA 2YFOA 3LHUA 1H62A 1WUEA 2DT1A 1GOOA 3A9IA 3WDRA 3TX9A 3VO0A 1VCFA 2VZSA 4P8XA 2IKIA 3OGSA 4DJFD 4MYAA 4TTGA 2JFEX 3B8SA 2XM2A 3LCIA 4DAIA 2WO5A 3ABQA 1VFMA 2PE4A 1Z7AA 3VA8A 4IPIA 2Z29A 1XJBA 4PMYA 3RGTA 4B5UA 5J04A 3EOLA 1A3WA 5EA9A 3W02A 3CV2A 3XISA 3BICA 4J2MA 3A47A 3OYXA 3SR7A 4IMCA 3C3NA 3PTKA 4MDPA 1UC4A 2X2YA 3LPGA 3DHDA 2X1IA 1RPXA 4A8LA 3W38A 3P60A 2EKCA 1IZCA 4M1RA 4BQ4A 1BYDA 1QFEA 4KFOA 5C54A 4X60A 3FVMA 4D1JA 4IOTA 3GTNA 1WKDA 1HP4A 4ZQOA 1I1WA 3VIJA 3CO4A 4JFUA 2PGRA 4XAYA 3VFCA 1J4EA 1GOKA 3N29A 1W37A 5D03A 3WIJA 1UMYA 3KDOA 2RDUA 2RJHA 3HV9A 3CPRA 4LBSA 4A8IA 4ES4A 2J6VA 1VPYA 1DWHM 2PZNA 2CLMA 5DT7A 4US5A 3GYCA 3WNLA 1UHVA 5I3KA 2QPSA 1LUCA 3KFTA 3UWEA 2CLPA 3R79A 3NGJA 4DBUA 3GTHA 3L9CA 1A5KC 1UA3A 3TAOA 3N17A 4GNVA 1UR9A 4W88A 4FNUA 4JTEA 1V6UA 2V2HA 4BEQA 1JI1A 4FOUA 1ML1A 4HHPA 1BKHA 2VZVA 3WEMA 1R85A 5HMEA 4O1CA 4AD5A 4WDXA 3P5ZA 1Q45A 4JEQA 1RV8A 1ME8A 1W5MA 2FHFA 4LUSB 3T42A 1EQCA 1SO6A 2OO0A 4I7VA 5FCZA 3ARUA 1A3HA 3TC7A 1P0KA 2DDXA 2PCQA 5F4XA 1EC7A 5AZ1A 4MMWA 3RJYA 5FJJA 3W81A 4DBDA 4YWIA 3W29A 5H2ZA 3OTRA 4GUHA 2PU0A 4CQ9A 4ERGA 4GOAA 3GDBA 3CQJA 5DELA 3KOZA 4EACA 3B03A 4OOZA 4JTLA 1KLZA 4MNMA 4AH7A 3CHFA 4LY8A 5TAOA 3LXCA 1RA0A 1C7SA 5IOBA 3THDA 1P0EA 1XLKA 5AFDA 4E3TA 3KBWA 1RCQA 2XFRA 5BZAA 2VNCA 4GUGA 3SM0A 2BGNE 3SIZA 2P1FA 2PDFA 4YTSA 1SYTA 3PANA 2YCJA 4HJWA 1CNVA 4OU1A 2ZIDA 2DT3A 1QOQA 4FK9A 1YKWA 2QMKA 3QHMA 3ARQA 2O7QA 2J47A 5LKYA 3QGVA 4CCCA 3GNXA 3P67A 2RAGA 1V6XA 2QJJA 3O6AA 4NIRA 1CWYA 3GS6A 4JQAA 4LF1A 2ICSA 5H6HA 4JYDA 3TQKA 1H41A 2O55A 1KTCA 3HN3A 3M0YA 3UVIA 3UPBA 4DWSB 1X1NA 2NXHA 2VQTA 1CXIA 1LQ2A 3GVWA 4P7OA 3DHPA 4RZBA 2CLEA 3PWGA 3CLMA 1JNEA 4LV4A 5AHEA 4ZFCA 1B9ZA 1R6WA 4LUJA 1POJA 1CB2A 1S2UA 4XG1A 1KM1A 4AF0B 3QC0A 2YDQA 3TNOA 1EX1A 1XF0A 3GDLA 3L0GA 5CPOA 3B3DA 3C8NA 4AMAA 4Q22A 1N82A 4K38A 2Y61A 3ZT5A 1P1XA 5FJIA 3D46A 2JF7A 3EPMA 4HJFA 2HXUA 3GSMA 4UTTC 4LRTA 1SVDA 4GC3A 1QO2A 4IUOA 2PDLA 3GXMA 5A5WA 5K7JA 4Q4KA 1HTIA 2W62A 3EMCA 3KOWA 4R7WA 4WD0A 1HF6A 1J8VA 2DY3A 1LL7A 1KCLA 3M0XA 4GYFA 1QO5A 3O3RA 3EBVA 2QUMA 3MZ2A 1K7XA 4P5UA 2J7BA 4GQGA 2PDHA 5EY5A 3FGCB 4WOZA 1V02A 2GFTA 1VBHA 2INZA 1FDJA 5IFPA 1J79A 4NAEA 2X16A 1GW1A 2EF9A 3KWXA 4TIMA 2WPGA 2F2KA 4CNTA 3QR3A 4FS9A 2XM1A 4JDBA 4GVIA 3W7GA 5CSYA 5EYWA 4EXBA 1Q6LA 1K03A 3PBYA 3ANVA 4PUKA 3JZUA 1LT7A 1L0PA 2GJLA 1UWUA 1OYCA 4GJJA 1OK4A 3PZOA 1IV8A 3N2TA 3P14A 1IXNA 1L8PA 2PLKA 4H2HA 5D9NA 3W1QA 4C1KA 5CC3A 4LX4A 2ZUVA 3GWQA 5ECUA 2DIJA 4W5UA 2C3ZA 4V33A 3E0IA 5BMXA 5E5CA 3LCFA 4GFIA 1C29A 3VCCA 2FGZA 2E9BA 1HG3A 3WH9A 4LUTB 3TQVA 1AODA 4REQA 1OD8A 4GBUA 1XIJA 1JXJA 4GQRA 1OT2A 1LG2A 4IFRA 1HQTA 1FA2A 2DEPA 3REQB 3SGUA 4MJ2A 4OBTA 2QDDA 1K6AA 2ZUUA 1W5NA 4F4RA 4G5DA 4U4MA 2OGYA 3F1QA 4CCEA 4O17A 2WC7A 3EZ4A 4LUYA 1F07A 4AXKA 2XU2A 2QXWA 4RDZA 3M07A 2VX6A 1DJGA 2IMRA 2YZRA 4GIAA 1IT7A 2BOGX 1F6PA 2R1NA 1E5NA 3LRKA 2CLIA 1AA1B 2WNZA 5T8GA 3RLHA 2RDXA 4GBDA 5A6LA 4CD4A 4AEFA 1X6UA 3PJUA 3W72A 4JNYA 5CPMA 2V3DA 3VOIA 1NP0A 4DJEA 5GNYA 3EX4A 3DU0A 1TTJA 4WSHA 1XIGA 3UZZA 3IJ9A 4QLJA 3VNJA 2F84A 4WQ6A 1FWIC 1ME7A 7A3HA 1KO0A 2X09A 3LMYA 1Z6KA 4UCFA 4UZUA 4XZMX 3TW9A 4U33A 4AIBA 4MG4A 2W27A 3PY2A 1TA3A 1G4SA 5C8BB 2JQXA 3WQOA 4NU7A 1DIDA 1AMYA 1BTCA 1K9TA 1MI3A 4TTUA 4ZL1A 3K13A 4AX6A 2WHLA 3VINA 3ZO9A 3DIPA 1W1IE 3SGZA 2WLZA 1DJWA 4RUBA 3AMLA 3JR2A 3SBFA 1K8CA 3W37A 3MKCA 3AS3A 1DJZA 4LW7A 2QCDB 4FO4A 2NV9A 4L9YA 3ZR6A 3R8HA 2QCNA 3T2PA 2WCAA 2J7CA 1QASA 4ZVJA 2P0IA 4P61A 1GGOA 1SSGA 3UYIA 1IR2A 1VFUA 4N42A 4BA0A 3VGDA 3WBAA 5A6MA 3E0VA 4Q33A 1EIBA 6A3HA 1MW0A 2Z27A 1A5AA 9RUBA 3MZNA 5LHEA 4R88A 5C2GA 5CJNA 2CYGA 3RCNA 1O1ZA 3W07A 4OFCA 4BKNA 2H6RA 3EYPA 1V3HA 1XI3A 4U31A 4PL2A 1HL9A 1YDVA 1LBMA 5IHSA 4Y9OA 3Q2DA 3E2VA 4GABA 3AU2A 3VOGA 4K8EA 3BW4A 4QQUA 4L1WA 2CCRA 2PP3A 1FDYA 1SZFA 1GYLA 5FESA 4WY0A 4Z1BA 2DUZA 1X96A 2H9AA 3BLLA 1RZMA 2PTXA 4NYUA 4TU1A 2Z6IA 5KZMA 3NQ2A 3VKJA 4S3DA 2OLAA 1SJCA 4KGJA 1FWRA 1VEOA 2Y1HA 4AVOA 1H7PA 2YKKA 4HA1A 1BF2A 4HU8A 4P8VA 3PG9A 4OKDA 2YOCA 1MW1A 6TIMA 1MRAA 4LRSA 5G4HC 3UFYA 4RZ5A 4IG2B 1EJXC 4JAWA 5CH9A 3W1PA 3BURA 5A8PA 1E1CA 2WOQA 1DP0A 4NJGA 3QEZA 2QCCA 4AZCB 1O5XA 3LRLA 3BG5A 3IJIA 1EL3A 3NSMA 3N14A 4JS3A 2VC7A 4I7UA 1QRQA 5DRIA 1WA3A 3S6DA 3W7QA 2Y7DA 2DFAA 1NELA 3A13A 1O60A 1H09A 5FEZA 1QNSA 5FEPA 4BZYA 3AHYA 4O15A 3BAJA 3JRKA 4RXGA 3QQ0A 1F05A 1JDEA 1SZGA 1NDVA 2HNEA 3VMPA 4IWWA 2ABBA 5CZTA 1THFD 1E5JA 2DUAA 1JL8A 3ZR5A 4XVDA 2VDGA 4GX8A 1B9BA 4OTKA 5CPNA 2A3AA 1TV5A 3G0SA 3KS5A 3UXDA 4JX4A 3UG5A 1I4NA 4DBWA 1KRCC 3ARYA 3RHGA 5CZJA 1OIMA 1CTNA 4C6BA 1CX9A 4AAJA 2R1MA 2V6AA 2OYKA 3TDFA 1SFTA 3TC6A 4Q7NA 1YX1A 3WJSA 3F4WA 4QEHA 1UP2A 4L65A 2VFFA 1LOSA 3HG4A 3IGUA 3ITCA 3PUOA 1UD2A 3F4DA 3KDNA 4CN1A 4NI8A 3VD7A 4C1LA 4LAUA 5D38A 1KKOA 1US2A 2BOFX 4L61A 1TJRA 2QGHA 2C16A 3EWUA 1HJVA 2GGGA 2W3ZA 4XKMA 1XKJA 2Y63A 1HJWA 4MZ1A 1XYBA 2QMJA 3WH8A 2WMIB 4IIEA 1CGTA 2DSUA 3WK2A 4FA3A 1PWLA 2XIQA 1Y0EA 2VMFA 4YYCA 2MANA 3V4BA 3UT0A 1VHNA 1J0YA 4AWEA 2AL1A 5D2YA 4QJ4B 2D22A 2GOKA 3LPOA 1OADA 5JUVA 1AQMA 2V9DA 1NJJA 5DF0A 4DUXA 2OLHA 2E28A 4PUMA 3GUGA 3EKLA 4MJMA 3LHVA 4AYSA 1KXVA 3OGVA 3APYA 1FHVA 4ZOCA 1ADDA 1W5QA 1BRLA 3HOJA 4FLOA 4RE0A 3UXAA 1EX5A 4V28A 3BSHA 4UTWA 3WQ5A 4NQ1A 1DQXA 1VEPA 4FXJA 1JFXA 5CSSA 1TRDA 2CETA 3L4YA 3NQAA 1A47A 1PHWA 2PWEA 4LYQA 2WSRA 3FY1A 1CGXA 1TCMA 1CGVA 1YW1A 5A95A 2SFPA 3K30A 4MPKA 3CT2A 4KPLA 4GACA 1CBGA 3W1AA 2J8TA 3E9AA 4IQLA 2BGQA 1POKA 1UA7A 2ESCA 1GVQA 3NDYA 4HA4A 1VD6A 5I02A 1QR7A 5HUOA 3YPIA 4S3EA 2E6AA 1PDZA 1EH9A 3ABOA 4EPKA 2YB1A 1ESWA 5LIKX 3SY5A 3NOYA 4QE5A 2QCHA 7PTDA 3WDHA 2R91A 1ZL1A 1QOPA 5H1WA 4QSFA 3MO4A 1XL9A 3VZYA 2D2GA 4XKYB 1FKXA 3MQTA 3EDFA 4G2DA 3INPA 1G4TA 1A5NC 3U5UA 1YBQB 6REQB 2HQAA 4MGGA 4XIMA 1PX4A 4L9ZA 4NRRA 3M43A 3W7NA 4HZ8A 1XGDA 3TWAA 2RKXA 3MWAA 1OYAA 3G8EA 4ADUA 4IGMA 4LVBA 2BZNA 5MKGA 3EDJA 3ANUA 2XZ9A 3I3BA 2B7PA 4AXNA 1KR0A 3TOPA 4Z2IA 3FJNA 2VO5A 1R3WA 1HXJA 4P8WA 1RQBA 4B15A 1KXQA 1H3GA 1UJQA 3EOOA 3TIMA 4NRSA 3HIJA 4MWAB 4PCNA 1QATA 1XH1A 4W87A 4A8RA 4RDWA 3UXIA 3N4EA 2ZDRA 5AHIA 2OSWA 1W3KA 3PAOA 3SCOA 1KV8A 3R4IA 4QBXA 2UZ9A 1BSIA 5AVNA 4FNRA 5DBUA 4ZBCA 1JXKA 2NXIA 4E4UA 4ICMA 4I9AA 1D7FA 1FHUA 3NQMA 1SR9A 4HB7A 1W9BM 1V3KA 3TXZA 2Y8VA 2PLCA 1TIMA 5AN7A 3ONBA 3B8IA 2ACUA 2XFFA 1Q4NX 1DVJA 1TJ0A 3NVTA 3NAVA 4N0RA 2E5CA 3KBSA 3L23A 1GG0A 3T05A 2OVLA 3R5EA 4JTHA 4YS1A 1LBLA 3CZLA 3L0NA 3TZFA 4AIOA 1JF5A 3W84A 2ZRUA 4L4OA 4AY7A 4ZSTA 1QNPA 3EA3A 2Q01A 5I79A 1M7XA 1JRCA 4Z1DA 1GOWA 5D09A 4L1GA 1IEIA 3G77A 2MNRA 3U8GA 4IJBA 3LHWA 3IUIA 3N6QA 2OWWA 3SADA 5AHNA 3NG3A 3KL5A 3RYSA 1YIXA 3DERA 1WX0A 2ZYFA 4IJCA 4J28A 4ZO6A 1VYPX 2V3GA 2PI6A 1AH4A 2EJ1A 1L9WA 3GVVA 5BXTA 2G3IA 3C5QA 3GHTA 3O8AA 1DWJM 5F2LA 4A4AA 2VDHA 3MMDA 3AHVA 1XS2A 1W9DM 2E77A 1UD8A 4A05A 3U5YA 4X9YA 4DAFA 1W2VA 3LXBA 2E5DA 1UJPA 3N2XA 2YL8A 3G18A 1WNOA 3FDGA 4QDWA 3SFWA 3GD6A 1XG3A 3C2FA 5G1MA 2C19A 5ABEA 5AC4A 2V3EA 4E2BA 4XZLX 1SJBA 4NF7A 3T8QA 3VAVA 2POTA 3EXRA 1MEWA 1TMLA 4JIHA 3OW1A 2RH9A 1B2YA 3K4DA 4YL2A 2PGEA 1UPMB 8A3HA 4CD5A 3TLLA 3MUZ1 3AUOA 1YNPA 3AIRA 3BV4A 3ALFA 2JE8A 1E4NA 1GOMA 2B81A 1SO4A 2YB4A 1TWDA 2HJPA 4PODA 4BWLC 5GJNA 3NO5A 2QYGA 3PZQA 4PRRA 2POZA 1KKRA 1MEIA 1UWIA 1P43A 2PTDA 1H7XA 1YEYA 3K8KA 4EF9A 1ZJBA 2DZSA 4JTGA 1VFTA 2HVOA 3FEQA 1H50A 1V8EA 2J13A 5FEWA 3I68A 3MCOA 3THAA 4C5ZA 3GH7A 1O6IA 4DZ5A 2D20A 3SCRA 3M0JA 4N4QA 1LTDA 2VZOA 3HGJA 4JR5A 3UVAA 1WP6A 4UQ9A 3HFYA 5LHFA 4M24A 1TR9A 2OPJA 2PDPA 4OT7A 3O05A 3QKEA 2DZWA 1KXHA 1C92A 1H61A 1TPB1 3A6OA 1TELA 2YCKX 1IIHA 2BVWA 3QZAA 3UWZA 4F0MA 3IJ8A 1OFAA 3GRIA 4HPNA 1U33A 4P8UA 1BHGA 1J12A 3CASA 1EOKA 2WC4A 4NNAA 2ZX8A 1CYGA 2TODA 3G1HA 3B0PA 4UBPC 1WXJA 5EBUA 2ZUTA 1Q4WA 3IWPA 2WQPA 2DZAA 3V18A 1G69A 5FF7A 5HAOA 5HNNA 1R3YA 1XYMA 2R8WA 4LC6A 5CSUA 2WZIA 2CBUA 2WZTA 4HTYA 3T07A 3OHIA 5GNZA 2YLLA 1P48A 2OYLA 4GZ7A 1OX6A 1BWVA 1FVPA 4NJIA 1SO5A 3PNZA 1PKMA 4IM4A 3ZIZA 5IFTA 4Q8UA 3BGGA 3CUXA 2ALDA 7REQA 1RSCA 3TYBA 2D0HA 3TN4A 4LOCA 2IKHA 1VYRA 4GGBA 2WBKA 4LJ3A 5CBBA 4LQ1A 3WF4A 3W76A 3LSBA 3P0WA 4CN4A 1EC9A 3LS9A 3O6DA 1JG9A 5D8WA 4IP7A 2OFJA 2HROA 5IM51 1CXLA 3RU6A 3LCGA 1QU4A 3SY1A 5AECA 2DUXA 1S2AA 1P7TB 4M7SA 3H8AA 3LV5A 3PFMA 2HCVA 4B9ZA 4GRSA 1OCNA 3M0VA 4J1OA 3DC8A 4KCTA 3LDVA 3PSVA 1J0HA 4UIOA 1HKMA 1X1OA 3NUKA 3KTSA 1PJ9A 2ZX7A 1OFEA 3NL6A 1GTEA 3GNOA 4TO8A 3VFLA 4ZOBA 1NAL1 2A3LA 4JIQA 2X0YA 5K9CA 2OWCA 3GHUA 4UR8A 2VOMA 5CSRA 3TYUA 3S9IA 4O12A 1LYXA 1GJPA 4WSKA 1WXYA 1XYLA 3B8TA 2X1RA 4U5IA 4LGXA 3KP0A 3IAPA 1GQJA 3QZEA 1DTNA 5CPQA 1GVIA 2J9ZA 2VHLA 2GVJA 1VEMA 2WB5A 3JVAA 1ZJAA 2PEVA 2VXNA 4I5UA 1E6NA 1XUUA 2V5KA 1I1XA 1PPIA 3NDZA 3W82A 5HNTA 4C6EA 1F8MA 2WMGA 1TV8A 1T0OA 3U4FA 2NQJA 3S2JA 3M5VA 4Q6XA 1DWIM 2YBTA 3ARRA 1Q6FA 6PTDA 1P1MA 1LWJA 1FWAC 4QNEA 4UTTA 2VRKA 5LA1A 2Q02A 3ITGA 3NQEA 3LN3A 1RJQA 5A8MA 2CEQA 1R5YA 3QFWA 1TWWA 4G6CA 4Y2WA 1TV3A 1YE6A 3W27A 3TWBA 4GD0A 4C6CA 5HATA 5C9RA 3EKZA 5I5RA 3MYPA 4PB5A 1DPMA 2C13A 5LXXA 1NIUA 3VM7A 3T0AA 1ZSXA 2RUSA 3LM3A 4JN7A 1LWHA 3L4WA 2BHYA 3RMJA 5AYXA 2DQXA 2UBPC 4LUSA 1KWGA 1N55A 3BJSA 3WMBA 2G3MA 3UWUA 2YCIX 1PO9A 3CT7A 1EBHA 1MQQA 1F76A 1H7OA 4WJXA 5XIMA 4QTGA 3QPEA 3OB8A 4PTVA 4DY1A 1J93A 2J8GA 2PMQA 1KFWA 3SN1A 4YNGA 4MAZA 3TYCA 3VGHA 2J77A 4N02A 2VOTA 1T7LA 3LPFA 3AIEA 3IUDA 3WQGA 2H90A 4QP0A 1PE1A 5TBOA 5JMUA 5KINA 2VCAA 3FAXA 1JCLA 4J3VA 1AG1O 1XLEA 2PUZA 4BF5A 2E68A 1B3ZA 4KWVA 3BGAA 2EPLX 1G4PA 1XINA 3BAIA 1TPDA 4RK8A 1ISYA 1QW9A 1WZAA 1IXPA 5HWMA 1BXCA 1DQWA 3B06A 4KRTA 1R47A 1PV8A 3GZAA 1UZ1A 4DLFA 4CCZA 1CI1A 1JUEA 3WENA 5FJOA 3ZJ6A 4ZXLA 2ONEA 5HOSA 1OHLA 1X8FA 1ADOA 3UWQA 4OWGA 5C5YA 1A0EA 3CQKA 1FWTA 4H2CA 1VZWA 3V3WA 2BBFA 1TZ9A 1DXEA 1VF8A 4NYYA 3UETA 2JF6A 4GNJA 3SCSA 4BQ3A 1YTEA 3CH0A 3UERA 4OIFA 1Z41A 1KFBA 1DV7A 4DWSA 1OX5A 4CNUA 5FKYA 4GQQA 1W8SA 3CNYA 4PFMA 3S47A 1YMYA 2ANUA 1IT0A 1YXCA 3QJAA 1OFPA 4HTBA 1NDYA 4M5PA 3DCPA 3QMRA 1B5TA 1YDOA 4KWSA 4DRSA 3TW6A 4RV8A 3AROA 4AF0A 2BMBA 3N15A 4WJ8A 2WM0A 3GR4A 3MYOA 3AXKA 4O0KA 4DXKA 3U3HA 5CJMA 1CW2A 1FCUA 3UA4A 1J9YA 4Q32A 4MPQA 3O2LA 1MO0A 5CPTA 4W85A 1I8JA 3FDKA 1S5VA 3KBMA 3MSYA 4V27A 3B4YA 1XRFA 3K8MA 3ARZA 1AQ0A 4TV5A 2C1HA 3TR2A 3IV8A 1J11A 3ZMRA 4LC8A 3CV7A 2BOEX 2QQ6A 3HGSA 5FI8A 3WNNA 3BOLA 2PC4A 1Z48A 3SQSA 2CZVA 3DUGA 3W7PA 3TROA 4YTRA 3FNDA 1CXHA 4GKLA 1WQ5A 1F8IA 3W70A 3LHZA 1I0BA 3TKFA 1KTBA 5FAJA 1OIFA 5HBFA 3FGCA 3WX7A 2Y7GA 1RUSA 4KFPA 2CIPA 2XG9A 4IIHA 5C0QA 1AVAA 4QGCA 4DQWA 4P7RA 1O5KA 5I78A 2FTPA 2J7EA 2P53A 3PBVA 1MVYA 1NU5A 2OB3A 2OO6A 2J66A 4H01A 3C4UA 3IRDA 3M0LA 1I9CB 3BMXA 1F74A 1X6LA 2YR1A 1L8NA 1ZJIA 3ZSSA 4N7QA 1ZP4A 5AHFA 1E6RA 3WD2A 4L56A 4DUOA 3RILA 1OCQA 1KFLA 3UBPC 5SWUA 4TVUA 3H21A 2VCCA 3N2MA 4HSOA 4O1DA 1W56A 1DYSA 1E1EA 3BLIA 3NJ3A 3EWWA 4K7YA 2B31A 2DT2A 2RGLA 4UB9A 2DH3A 3KBVA 2AQVA 3WJXA 4FF7A 1X97A 2QIWA 3TYDA 1Q7ZA 3LV6A 4X2PA 2OZ3A 4ACYA 1F3XA 1KM0A 3KLKA 3VIIA 5JBFA 4LUTA 2P5NA 1KBKA 4GO8A 5K3VA 3WLJA 1IGSA 4K8GA 2GJRA 3HGRA 1IWBA 5HMFA 1I45A 4A3UA 4A2RA 1XWYA 3REQA 2WHKA 4GGHA 1UD6A 3LY0A 5BOEA 1G5AA 4J4KA 3PZIA 2Y2WA 3S2LA 1JEZA 3W7HA 2ZX9A 1MQRA 1H1YA 3ES7A 4H41A 1PAMA 4JQ3A 3R25A 1S2CA 4QS5A 3QMTA 3NM1A 4HPXA 3G0XA 1NVMA 3PPCA 1QMLA 3POCA 3S83A 4S3FA 3KCJA 4UR9A 4MSSA 3VDHA 1D3GA 4A8NA 1BQGA 2G4FA 1DBTA 3BZJA 3IGHX 8XIAA 1YLVA 4AIEA 3C2OA 1BG4A 3EXSA 4DI8A 3NSNA 3EEGA 2DW6A 1QW8A 4UCGA 3BANA 1UUMA 1V93A 1W31A 3FJ6A 3C61A 3PG8A 1FWJC 4F0KA 1VCGA 5FJUA 3WFZA 1EF2A 2GJPA 2OLSA 2I56A 2QF8A 5BXPA 4L64A 3DGRA 5HPCA 2CHOA 5CZ0A 3LM7A 3QSTA 1XDMA 2P8BA 3E74A 1WOAA 1RPKA 2YCLB 1Q6CA 3CK5A 4JL1A 4YWSA 3GH5A 1HO4A 1WAUA 1TCDA 1VBUA 2BGSA 1Q8AA 3IACA 2X1UA 1F6YA 2EG7A 4HU0A 4S1FA 4M29A 1I75A 3NPUA 1X7IA 3FW6A 4JNMA 3CHEA 3MPGA 3XIMA 1X8CA 1S5MA 2ZRVA 3E2QA 3V0UA 3L2LA 2Z2UA 3NR0A 4GHRA 1MFVA 3S5OA 1TTIA 1UUOA 3QV8A 1Q8JA 1E6PA 4IP5A 4JTIA 3T40A 1U1UA 3T0TA 4B5SA 4CU6A 1C8YA 4DELA 2QVHA 4C6FA 1EDQA 1H5YA 1NOUA 2QCDA 3QZ6A 3GK0A 5C7HA 2A3EA 2OR2A 2ZE3A 3VKBA 1XLBA 4LFYA 3MVIA 3VNZA 1TE1A 2H8XA 3SIMA 1K6WA 4IPNB 1VJSA 2D0GA 1XLCA 3R12A 1KQYA 1C8VA 1XP3A 3M0ZA 1XCFA 1MW3A 3M7SA 3MBDA 3EKGA 4Y8FA 1PVNA 3QV6A 3MB9A 4XBJA 2ZZ7A 2ABAA 3UR5A 3O63A 1I2RA 3PWAA 3RR1A 3RRXA 2VUNA 1R9YA 1MEHA 4H83A 4D6DA 5A6BA 1W3LA 2HK0A 1F2JA 4E6MA 1G67A 4AD1A 3ZVHB 3DESA 3WLNA 2WWCA 4WK9A 5JXQA 5DY3A 1A5LC 4Q4SA 2PWVA 1VFSA 1DWAM 2OZTA 2E40A 3OZOA 3PZGA 3ITVA 1E0TA 5A8OA 1TJ2A 1GVEA 1NOFA 3P74A 1OC6A 5CGMA 4YVVA 2GDVA 4PMXA 1RJRA 1JPIA 3TTOA 3H53A 4GI6A 1DEDA 3JW7A 4YTQA 2E7FA 3K46A 2ON3A 1XYAA 4UTKA 2XVNA 2YGYA 1O66A 5AOUA 3QBUA 1HGYA 4ROPA 2VD8A 2EHHA 1XLLA 2QUTA 1JCYA 1ADSA 5I3DA 1IZJA 1NEYA 3OIXA 3O6CA 1QBAA 4XX6A 4BCEA 3NQVA 5ABHA 1XSKA 3KRBA 5BOFA 4MY1A 3UXLA 3B8UA 3ONCA 5BW6A 4AZCA 3PZTA 1JULA 2DZVA 3NQ8A 2UY2A 5FL0A 4NILA 4FI4A 3B0UX 1Z8AA 4E4FA 3TLQA 2RGMA 1G6CA 3KTCA 4O53A 1TJPA 3W24A 2QUUA 3QY6A 4EK7A 4C6MA 3PTQA 1FHDA 3BPWA 2WM1A 5HMSA 2CC0A 3MVTA 2FGBA 3NA8A 4N6EA 3UGVA 2CZEA 1PX8A 1VGAA 1AZ1A 3B9EA 2QCLA 3VYLA 3BDKA 3FSUA 1W3NA 5EMLA 3P0XA 3M16A 1TUFA 4E8DA 3W7LA 3MI2A 4PSRA 1Q65A 2QW5A 2VR4A 1W0MA 2V5JA 3CUJA 5CJ5A 3WUEA 1O4UA 3W86A 4TVDA 1LWIA 1B4KA 1Y8BA 1V6VA 1JR1A 3VNKA 1BFNA 2PDWA 3G1AA 1GPWA 1AJ0A 4BF7A 3P3BA 5CCZA 3H26A 1PKNA 1CPUA 1L6SA 4UMBA 1Q66A 1Q13A 1IR1A 2GSEA 1QNQA 1S1PA 4JQ4A 1NWSA 1T5AA 1Y65A 2XISA 1UW9A 3KX6A 1M68A 4PR4A 1I2QA 2YW3A 4D2JA 1SSDA 3U0HA 4CQAA 4EAYA 3RX4A 1E0XA 2YA0A 3T0BA 2NUYA 4GA8A 3S0CA 1F73A 2AQOA 2WMIA 5EFDA 1DJXA 1IXQA 4ZTXA 4QXIA 3UA3A 3WQCA 5GPRA 1UIPA 1Q3NA 1PIFA 1F3WA 4K8HA 3CLWA 3RLUA 1CENA 4M6VA 4ML9A 1FWCC 3CUIA 2Y5JA 3TJLA 4GY0A 4JTRA 1TPUA 3WD4A 3AMCA 5EGRA 1WZKA 1J96A 4IMDA 2YDAA 3L7RA 4GIRA 4AW7A 5HPOA 2DSZA 1HJSA 2JKPA 1A53A 2I14A 4H9MA 4IT1A 3WQEA 2WV8A 3ITLA 1EWDA 1XGZA 5CGQA 3SN0A 4F0RA 1MZHA 1QWGA 1OB0A 3KBNA 1YTDA 1LF1A 3UXKA 3STGA 1Q6DA 4M80A 4C6IA 1ZRQA 4QNWA 3F7JA 4Y9AA 3W7KA 1MMFA 4EOUA 5CGTA 4B4FA 3WLOA 3LI0A 4DF0A 5E70A 1IEWA 2ODOA 2CITA 2VT0A 5D9OA 1ODZA 3AZTA 4LWWA 4FX6M 5AB3A 3RX2A 3LU2A 1F3EA 2QJIA 1UKTA 3SSJA 3KCOA 1RVGA 3W7MA 2YYUA 3FV9A 1M65A 1D3HA 4AU0A 3M0HA 3PUDA 1QPOA 3T9PA 3LOTA 1DTUA 3EWBX 1P0BA 3PS7A 3MTWA 2YL9A 4HPGA 2Y88A 3AIVA 4ACZA 3T0DA 2X1TA 4H8HA 1B30A 3S5YA 2WKGA 2J75A 3BK0A 3HA1A 3WEZA 1A5UA 1AMKA 4RNJA 3P8JA 4EANA 1YBQA 2OT1A 2XIMA 6REQA 1C91A 4BWLA 1Y5VA 3MUY1 1I2NA 3C3UA 4AX7A 4KFNA 3FIGA 2Z6JA 2PC8A 3TN6A 3CMJA 3VM5A 3W87A 4C60A 1RD5A 3ITXA 2A5HA 4J3UA 2CBJA 1EOMA 1WKEA 3ZLGA 4QIUA 3MT1A 1TPWA 3BE7A 3E5PA 5HDRA 3AUJA 2Y4SA 4LVAA 1B3YA 4N9CA 3U2EA 1VH7A 1PDYA 2ZUSA 5EB8A 3UJFA 1B1YA 3ZJ7A 4BJHA 2BSLA 4X61A 4MWAA 3KVLA 4MADA 2NVDA 3S1XA 4AY8A 2WNQA 1R3VA 3CQ0A 4OBRA 2Z1WA 2ZFAA 4ZE5A 4HNOA 5D2XA 4DJFA 3WJZA 4PYSA 1E3ZA 1R8LA 3ERPA 1VYSX 3BLOA 4HZ7A 2PRHA 4GKTA 4TVCA 1BAGA 3T2QA 4CEUC 4UWMA 4XD6A 1LOQA 1XLIA 2E8YA 3DI0A 1PZ3A 2Z4GA 1EFZA 2ZTKA 2QKFA 3W74A 1SFLA 3J7HA 3VDBA 2BODX 4W5ZA 4W89A 1K1DA 4U5KA 5EPDA 2J79A 2E25A 2X42A 2W67A 1XSIA 2WWDA 1XKYA 3EB2A 1OY0A 2YYTA 3PC0A 2OSXA 2PP1A 4OHQA 3T81A 2DU2A 2OEJA 5C6MA 3TTQA 4JTUA 4ZTYA 4YYFA 2DZUA 4R85A 2GQ8A 4Q7BA 4IICA 4GNKB 1XIHA 3C2RA 4GH1A 4MB1A 1JIBA 3BC9A 4RNIA 3MA8A 3VGGA 3T8LA 1PCWA 3PHAA 4PMUA 1U30A 3S1WA 3EMQA 1JDAA 6XIMA 3I6RA 2FJUB 3F5LA 1MFUA 3GNPA 2Z26A 1W17A 1JQXA 2AL2B 3N2BA 3S5SA 2OGJA 1FWFC 2D24A 3G1DA 3K5XA 2CLHA 1H11A 2ZKMX 1AQHA 1YRRA 1XQLA 3BMVA 3SEPA 2VCBA 3SECA 2WMKA 1JQVA 1M03A 4GFSA 4GZJA 3NZRA 3HM7A 1ONRA 2FDMA 2VEFA 1IQ8A 2VEIA 4WRHA 1KLYA 3NL5A 1A0DA 1JAEA 2OODA 4PBGA 4GZEA 1EF3A 1LRQA 1AD4A 2F6XA 5D30A 4DJDC 4M6QA 7XIMA 3UYCA 3CEPA 1JCJA 4XIAA 5I24A 1S2TA 2P8CA 4LBUA 3WG6A 2PF0A 2BG5A 3RPDA 3SUSA 4US6A 2PD9A 4ZO9A 2BDQA 1OC7A 2VQUA 4PL1A 3E0FA 1DXFA 1WAWA 2WQDA 4XO6A 4AD3A 2PWHA 2QJGA 5LNSA 5E93A 3GVGA 1A4LA 3KVJA 3AS0A 3WQ4A 4WXZA 1ECQA 4CNSA 3LBMA 1YYAA 4CU8A 2OU4A 2NXGA 1JI2A 4HBKA 2PS2A 4JPGA 4JFWA 4NJHA 1IEVA 4MYXA 4PUDA 3K1DA 1CGUA 3VI2A 1PZ2A 3V36A 5F4SA 3IPWA 5FL1A 3WLRA 1V6TA 5K9XA 4RX0A 5HQLA 1ODUA 3WF2A 3IIXA 1R38A 2FFCA 5BXRA 4KT2A 2EQDA 3M5ZA 3P82A 3VOCA 3VE9A 4LCRA 4LB4A 1OGSA 4MB4A 3TZNA 2GK1B 1NDZA 4E2DA 3KUMA 2ISSA 3LGDA 1M53A 1LL6A 4ORMA 3UEQA 3GUWA 5BNKA 3OYZA 4Y9MA 5HINA 1SW0A 6ENLA 2WCGA 3E02A 3M9YA 3DC0A 2JK2A 1EEPA 3TAKA 1ZFJA 3SB0A 2WJDA 4C6KA 4FEZA 2W61A 1SPQA 4PBFA 4TX8A 1UP3A 1ZTVA 4BR1A 4XBKA 4Z1YA 5ECVA 4LAMA 2ISWA 5HK4A 3MDUA 2HBVA 3QW3A 2HE5A 1JCMP 2QV5A 3LSCA 4GUIA 3AU6A 4GO9A 3THQA 2DP3A 3LNPA 3O0KA 4JY9A 4N6FA 4ZQNA 4C6NA 5J5RA 1CGWA 3T09A 2HXTA 3QTGA 3AMDA 5KSWA 2ACRA 2I17A 1Q6QA 5T91A 4FF5A 1OM0A 2HS6A 1AW5A 3EMZA 1VP5A 5T26A 3H12A 4ZOEA 1G9HA 3PBMA 1ZPTA 3TN3A 5HR6A 2Y7FA 4NP7A 2F9RA 2FVMA 4RXFA 1R2TA 1QNVA 3R0KA 2EO7A 2I7GA 2YBUA 3K4AA 1X39A 5I3FA 4XSMA 1EJVC 1P7TA 1TMHA 4FNQA 4O8AA 1P5BA 4AVFA 2ZWYA 2UY3A 2GVLA 1MXSA 3HPAA 1Z32X 3UZ5A 1ITCA 2PP0A 2UV8G 1OJXA 2CESA 2XIJA 4WKFA 1X7FA 1I2PA 3M64A 4GIYA 5FAGA 3SUWA 4Z2JA 4GYJA 3WJYA 1RAKA 2ZA2A 5B7ZA 3EWZA 3MHUA 1UG6A 1XC6A 2GGHA 1C3FA 3RX3A 3TK7A 1GVRA 4AVNA 3N73A 4HHLA 4J27A 1HFBA 3CEUA 4M51A 1XBVA 1ITQA 3URAA 3KM8A 4S2CA 4CU7A 1RY0A 1L2UA 1E4LA 5KETA 3HMJG 4JHOA 2WAGA 2BWGA 1EP2A 1W3TA 4H9TA 4QX4A 5HNRA 4HVXA 2JBMA 5AC6A 3UCCA 2R1PA 5M17A 2D73A 2FZ8A 1PZ0A 3MSGA 3I65A 3L2MA 4I3GA 3R0DA 1GKPA 4AZ5A 4QROA 1WDSA 1M1BA 3VOJA 2J7DA 4F0HA 4DYJA 3LTPA 4AB4A 3EPOA 5BU6A 3NFUA 3BAXA 5A94A 3PN8A 3LBCA 2WCSA 1K7EA 2O7SA 1GYMA 3GHSA 3EOEA 5KZ6A 2YL6A 4NSBA 4HNNA 1OF8A 4B5WA 4Q8PA 3O7UA 2O92A 4ZCWA 1IF2A 1PKYA 3URQA 2E8ZA 3SQMA 4NY2A 4XZNX 1UCWA 3FLUA 3WUBA 2A7PA 1Z42A 4LVFA 3MKKA 4KH2A 4O19A 2Y8UA 3FYYA 3T1GA 3VXGA 1S2VA 3VOHA 3BH4A 3HGOA 3H24A 3WBEA 3QW4B 4HD5A 1W3HA 3AIBA 1NQKA 5C55A 1XIDA 3ITYA 4IGSA 1ZENA 3Q37A 3L4VA 2WK2A 3N13A 3VKKA 1EJTC 1GOQA 5K4XA 1QPQA 3M5XA 3QTPA 5D2TA 2WZMA 1T96A 2BS9A 3LRMA 4BQ5A 1R3QA 3STPA 4NX5A 4FLSA 3W26A 3D3FA 1V79A 2CNCA 3QR1A 2B0MA 1ZGDA 5CEWA 4JHZA 3HBLA 4YJ5A 3QVQA 5C9ZA 4L4LA 2VEGA 3GNRA 2DVXA 1K4GA 2D2OA 2I5GA 5A6TC 1VB9A 2FZBA 1UIOA 4FNPA 4Y9PA 1WDRA 4GMEA 1GZ1A 1H7WA 3W7RA 1ICSA 3NEHA 2BY1A 3H2AA 3E3HA 3GDTA 3Q65A 5J8LA 2A6NA 2I16A 3RPTA 3BTNA 1UPPA 3RAOA 2INFA 3B0YA 3SQLA 1EJSC 5XIAA 3ZM8A 3GG1A 2GGIA 3IEBA 2J27A 5F2IA 2D69A 4DUVA 4A3RA 3B8DA 3VKCA 1XD1A 1B31A 4N2YA 3IIZA 1JDCA 3CB3A 2PAJA 1UUQA 3C86A 3V5CA 5B80A 2V5LA 4S38A 3DDMA 4WKHA 3NNTA 3G0UA 3LERA 1E6ZA 3OOQA 1FH8A 3PUEA 1RH9A 3ITOA 3PNUA 2JKEA 1E0VA 2NQLA 4WDUA 3IV3A 2P3EA 1KQZA 2Z2BA 3FXGA 1FXPA 2J6XA 4H04A 4W8BA 3CC1A 3I3DA 3BSGA 3KLLA 4XSLA 4OQVA 3LHYA 1OG0A 4EX4A 2TAAA 4OECA 5F7UA 4O0QA 4RW5A 4A22A 5D9MA 3OZYA 1ZHAA 1R87A 1KGWA 6XIAA 5DCBA 2A85A 2VEPA 5E9XA 2VWSA 4RZ4A 3O16A 3IRSA 5HWJA 5PTDA 2HTMA 4D6EA 4H3DA 1LLOA 4Q8QA 2AQWA 4KERA 4IHCA 3GFXA 4V1YA 1J0IA 1TPC1 3MJYA 3CV6A 5DFAA 1EO5A 1BYBA 2OSYA 2ZXDA 1HVXA 2E09A 2ZUWA 2C1IA 2QF7A 5HJXA 5ENLA 3EGJA 5M1TA 1V0MA 5IHRA 3NWRA 1BXBA 3BWWA 3T78A 3VD4A 3ANYA 4IMEA 1V4YA 1GONA 3GH4A 1XLAA 3V1PA 1XIMA 4ECLA 1XLHA 3CIWA 3MU7A 3P81A 2VC6A 3L4UA 2FQIA 1MDRA 3HFTA 1Q6OA 3VDAA 3CB8A 4XO7A 3W7DA 1PX3A 1G7UA 4BI6A 2XH0A 3IS4A 2XDFA 2ZRWA 3GVRA 1GCYA 3RM4A 2C71A 3MUAA 3PPFA 5HA7A 3WLHA 3DFPA 3OBAA 1AW1A 1UZDA 3LCLA 1D8CA 5DMNA 4Q8WA 4ATWA 2Y5EA 1YXYA 4YCPA 3ZXWA 4HHMA 4I5XA 3CQIA 1KD0A 4BF9A 1ZAJA 2A3BA 2HZGA 3H7UA 4DHGA 1HW6A 2VFDA 3NPXA 4EE9A 5C9XA 1S3HA 2V67A 1BVZA 3VGBA 4URIA 1H49A 3C56A 2W5FA 3H2NA 1GW9A 4M56A 1L6GA 2PDBA 4B9YA 2W66A 4WLCA 5A6KA 3MV11 3OQ8A 5D4YA 5HQEA 3B9AA 3WLSA 1GEHA 2Z00A 4ICCX 2FPTA 1FX6A 1I2OA 4HT3A 4QR6A 4XV0A 3B0XA 1JGMA 3I3EA 4DZHA 4HMEA 4OGZA 3C0JA 4AD4A 4HP5A 5BWAA 5AYYA 4O10A 5U7SA 4R9XA 1EUNA 3IAQA 2DVUA 4AY1A 3STEA 3L4XA 3N1AA 3QHNA 3C0SA 5JIPA 1AUSL 3RUBL 2Q09A 1REQB 4D6CA 1UR3M 2F61A 3A23A 3WQDA 5EL1A 1XDJA 3L2IA 4A35A 2OOGA 2FTWA 2J62A 2OQYA 1H60A 1ZALA 3VGEA 2C0AA 4QCEA 4K68A 5BU9A 2OQHA 3OP2A 2HEJA 1NY1A 3RPMA 4QEEA 3ZJKA 2PD5A 4ICNA 1WO2A 1Q85A 3EA2A 3DHUA 5FIPA 3S4TA 3T55A 1NOWA 3LI1A 1W1TA 2XWEA 3F5KA 3ELFA 4K1WA 4Y9NA 3VIMA 4NX0A 3P93A 1XGEA 4JYFA 4AZ6A 1XIFA 1H1ZA 4X22A 4B5NA 3WQFA 3W22A 3WK3A 4MWAE 3WSUA 4O54A 1HT6A 2V5BA 3GTXA 1XLFA 4UC5A 1B4EA 2WJFA 1N7KA 3A4XA 4NJJA 4JGDA 1W9PA 5A8GA 2IPJA 2YCLA 4CQBA 2ZQ0A 4NJKA 3Q58A 3FYOA 3G5EA 1ZBCA 3CWNA 4JIEA 2WW5A 3BQ6A 3DG3A 3W83A 3IGXA 3A3WA 5KZEA 2OWXA 1TRIA 4B90A 2G95A 2YCEA 4HNCA 1MUCA 3ZWSA 1HL8A 4YIWA 5DCEA 1V77A 1XV8A 3R8GA 4RE3A 4AZBA 4MJZA 3ARXA 4O57A 1PXGA 4KW2A 4PMOA 3W1NA 3L68A 1C8XA 3MMTA 2WKLA 4GIEA 1XBYA 1D7KA 3ENLA 3FHQA 1GHSA 3HB9A 4IPPA 4GPNA 4ENLA 3NZGA 2Y62A 3EPNA 4JKLA 2O9PA 1WB0A 4RNHA 3VD9A 3OG3A 4Q4PA 4QLLA 4EPDC 1IWPA 1IEQA 1K8XA 1I0DA 2D3NA 3BO9A 1UASA 4EVZA 2QEZA 5FSEC 1V7AA 5AZ0A 3EDKA 1T99A 4DJEC 1UYQA 2QHAA 1A80A 3S2CA 3SCPA 3XINA 4CN6A 1UWAA 1VRXA 3IUHA 1W9VA 3UG3A 1JD9A 3WF1A 2YW4A 2YX0A 2PWUA 3MANA 2RFGA 4CLMA 1GEQA 1QK2A 3ZVHA 2UWFA 4KESA 1NP2A 2V5DA 4B92A 5JH2A 2WZEA 1L6YA 3BXWA 3IVSA 2E6YA 2Z1BA 4UOJA 2HS8A 3GAYA 3AC0A 2WVVB 3FA5A 3PTDA 4MM1A 4IIDA 1YQ2A 4LTSA 4ZB0A 1B3XA 2IW0A 4HMDA 3S1VA 3QM3A 1QHZA 2X41A 4QQ3A 5FF0A 4XZWA 4JDYA 4UFJA 2YDRA 2BY2A 3AWNA 4LNYA 2HVNA 2ADAA 1GQNA 5AYIA 3EA1A 2YFNA 3VMOA 1YNQA 2TRSA 3GXNA 5LIUX 5F1UA 3M5YA 4B2DD 3FJ4A 1M7JA 1H63A 4FP1A 2HPIA 1VPQA 2JGYA 3FN9A 4JTJA 4Q8OA 5LGXA 1JDDA 1RXOB 2E0PA 3VILA 1EPVA 4FXFA 4R9OA 3V7PA 5BCAA 1Q2SA 2REQB 1XBXA 3B04A 4ADSA 3UCQA 3TW7A 3UWWA 2QPXA 2VVNA 1S5NA 5DMLA 1GK8A 1LL4A 1TZ7A 1E9YB 3E2RA 5E09A 4RE2A 1M5WA 2WSPA 3OZPA 4KEUA 3SUVA 3ZYZA 3SUUA 4HCLA 3CWOX 4JTFA 2DZBA 3KOXA 4KIRA 2ZRYA 1GKQA 4V1XA 1K8YA 3TFXA 2ZA1A 5CC5A 2GLKA 2PF8A 3CUZA 1LG1A 3BZGA 1BXNA 2EGZA 3D0CA 4H19A 1SZRA 3UZXA 1XICA 4ALDA 1J18A 1ZB5A 2DSWA 4GUJA 4N9EA 3NQFA 4DLMA 3N9KA 4IMFA 4AD0A 4TMBA 4LYRA 3F2BA 1VC4A 3LMZA 3WFAA 2PDGA 3LX9A 4E8GA 3FYPA 2FH8A 1OCBA 1IWAA 1W54A 2AAAA 3K1GA 6ALDA 3L4TA 4JFTA 1W6TA 3D6NA 4PGLA 3UR8A 5HR7A 1OGGA 1W1B1 2V30A 2XGZA 4AMCA 3L5LA 2BVDA 3GTFA 1JYXA 4U3CA 1V03A 4B4HA 4GCXA 4IXHA 2HSAA 3QPZA 4MVAA 3G6LA 1SW7A 4QISA 1S3TC 5HNUA 4KCVA 5I77A 4DZAA 1XW8A 2PBOA 4PMQA 2P76A 2CKRA 1NSJA 2C18A 3W53A 3S1UA 3GIQA 1UH3A 3MSDA 4GISA 3O6YX 5AC7A 3GU9A 4WGXA 4B5TA 5K2ZA 2NV2A 4UXDA 1XFBA 1JNDA 3NQCA 4PCTA 2ZZ4A 3OVPA 3GC5A 4B3LA 3GE7A 5IRPA 3NTYA 1O68A 3B8VA 2Y85A 3UR7A 1AZ2A 4F2BA 2O9TA 3KWSA 4W8AA 1VFLA 4AG0A 1FH7A 4JXCA 1XYCA 5F2GA 1VBRA 3DYPA 2PTWA 3U7VA 3SRDA 2I1OA 1OD0A 4HOXA 4F2UA 3APTA 3II1A 1PTGA 2XSAA 1XUZA 1N8IA 3AMGA 4HK7A 2P0OA 2CZDA 3AS2A 5A69A 1QNRA 5DBTA 5ABFB 1GQLA 3PF3A 1E9ZB 1GTHA 3VC5A 3UPWA 4RDVA 3MP5A 4ZZ9A 5BRQA 1QPNA 3WD0A 2BTMA 2PURA 5BOOA 3BMWA 2QCEA 2CFFA 5A2BA 1KA9F 1XBZA 2RJGA 3DG7A 2XVPA 2QNEA 4Z2KA 2NZLA 1J0ZA 2A0NA 2BXYA 1X1ZA 1E43A 5A2CA 1H0IA 3UR2A 3GX9A 2DZXA 2PA6A 3T44A 3W1RA 2XIOA 5FOOA 3POHA 4MKVA 5I3HA 1FCBA 1UBSA 4UTWC 2J4GA 1AJ2A 3W7JA 3C2EA 2EG6A 1J5TA 1GHRA 1XHGA 2OMAA 4HA3A 4UQAA 2E9MA 3CHDA 3AIUA 3W7EA 3CL7A 3R1ZA 4IGNA 3WBYA 4PE8A 3SDOA 1O94A 4RPPA 4LSBA 4CNNA 5C71A 1DOSA 4EPEC 2PODA 3SAZA 2GQ3A 3JU2A 5D05A 4DNHA 3BOXA 5JBDA 4Q4OA 4W7WA 3CUHA 4F9JA 2QPUA 3TE9A 3H2OA 1K9DA 4Z42C 1E51A 3TC3A 4PBEA 4M6UA 4F79A 3W1TA 3C52A 1DIOA 4TR9A 4M19A 4L6DA 2D0FA 3DI1A 3EB4A 3S9YA 2YXXA 4PMRA 1OX4B 4YPJA 1E73M 2ZVIA 3AHZA 4IFOA 1QI5A 1SFSA 1W1YA 2C7FA 4TV6A 3GLCA 3V0TA 4YTUA 4RDYA 3ME3A 3VPLA 3AI0A 4C6LA 1QUMA 1R3RA 3W71A 4IX2A 1EQPA 4LYKA 1M7OA 1EBGA 4KCUA 1R3TA 2INEA 3AHXA 4ACZB 1KB3A 3GG0A 4I9MA 4JTSA 3ZQ9A 3BLPX 3FFSA 1FDZA 1UR8A 4JZ5A 3SURA 1OBAA 4P7QA 1M6JA 5I2UA 3PJXA 2VX5A 4BK9A 4QJ3B 2EPOA 5JQ9A 1PTDA 3L4ZA 4CQ8A 5GVJA 1JYVA 2E67A 7TIMA 5C9WA 4IIBA 3PULA 2E1DA 4NZFA 3COTA 4AZGA 3UD6A 1Q2RA 3VNLA 2VC9A 3CYVA 2J8FA 4J40A 1WYIA 1O1HA 3OBKA 3W6LA 5F1VA 2VFGA 5CC6A 3IIOA 1ME9A 2PDKA 4ORIA 4A21A 5IBXA 1LQ0A 3PWIA 2PTYA 3NDOA 1UMLA 3CAVA 5HXMA 3BCJA 4GJIA 1JZ8A 3WNOA 3GXPA 3EDEA 3VIPA 1HJQA 3QY8A 1O12A 1ZCOA 3EB3A 2AL2A 2FB3A 2GGEA 5T9BG 1IYXA 3UESA 3URNA 3KZPA 2QCGA 1X6NA 3DECA 4S3GA 3N34A 1B90A 3W75A 4DVOA 2VEKA 3TJXA 4H8VA 3GG8A 2OEKA 4I9TA 4DNMA 2GVYA 4UR7A 4C90A 4DN1A 3QN3A 3C2YA 3VGFA 2IPWA 3P80A 2GYIA 3UGRA 3QV9A 3V5FA 3WDJA 2WSQA 3A12A 1M3UA 1D3CA 2GOUA 4POCA 2NSXA 3TCEA 3ABSA 4UMCA 1Z89A 4JCMA 3OLGA 4RPQA 4OBSA 4WUIA 3I7QA 1UZ4A 1CB7B 4X0NA 4RV3A 4GWEA 3IGSA 4GI9A 4GH3A 4KBXA 1E15A 2EAWA 1VLWA 5A6JA 3V5OA 1XM3A 3MC5A 1KM2A 3WELA 4W7UA 1E9LA 2YXGA 2VC5A 1UR2A 1K77A 3QC3A 3AS1A 3BLEA 1CLXA 4L4MA 3LLFA 3S6OA 4KEVA 1W8GA 3HJZA 2L5HA 2FTYA 1MNSA 2DSVA 3RLGA 5I3IA 3HG2A 4Q8MA 2ASHA 3GQYA 4IIGA 3WD1A