2CLLA

Tryptophan synthase (external aldimine state) in complex with n-(4'- trifluoromethoxybenzenesulfonyl)-2-amino-1-ethylphosphate (f9)
Total Genus 98
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
98
sequence length
266
structure length
257
Chain Sequence
ERYENLFAQLNDRREGAFVPFVTLGDPGIEQSLKIIDTLIDAGADALELGVPFSDPLADGPTIQNANLRAFAAGVTPAQCFEMLALIREKHPTIPIGLLMYANLVFNNGIDAFYARCEQVGVDSVLVADVPVEESAPFRQAALRHNIAPIFICPPNADDDLLRQVASYGRGYTYLLSRSGVTGHHLIEKLKEYHAAPALQGFGISSPEQVSAAVRAGAAGAISGSAIVKIIEKNLASPKQMLAELRSFVSAMKAASR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TRYPTOPHAN SYNTHASE ALPHA CHAIN
publication title Allosteric Regulation of Substrate Channeling in Tryptophan Synthase: Modulation of the L-Serine Reaction in Stage I of the Beta-Reaction by Alpha-Site Ligands.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Lyase
total genus 98
structure length 257
sequence length 266
ec nomenclature ec 4.2.1.20: Tryptophan synthase.
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00290 Trp_syntA Tryptophan synthase alpha chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.70 Alpha Beta Alpha-Beta Barrel TIM Barrel Aldolase class I 2cllA00
4NNAA 3EKLA 1I4NA 5L6UA 1E51A 3M9YA 2QCMA 1MSSA 2J88A 5ABTA 4JYEA 3W2UA 1YADA 3LCLA 3A9IA 2VEIA 2Q3OA 2Y7GA 2C18A 3TJXA 3W86A 1B4KA 3BGJA 4Z0JA 3G24A 3LM7A 4LV4A 2BTMA 3W6YA 3PB2A 1H62A 3I6RA 1LDCA 4XWUA 3RNDA 3UXDA 2QCHA 2JGYA 4JTJA 2DZPA 1FBAA 3E96A 3G1XA 3W1RA 4DBEA 2ZZ7A 3HPXA 3G1YA 3S9YA 5K4ZA 3WK2A 3SSJA 4I7WA 3VNDA 3WJZA 4JD4A 3DENA 5DBTA 5EA9A 1JCJA 3N2XA 3W1TA 3PBVA 2VC6A 2BSLA 1VYRA 3EWBX 3KHJA 4BF9A 3W2LA 1P0NA 2GQ8A 2Y61A 1ALDA 2BLEA 3T40A 3L67A 5HQEA 2GVJA 1GVSA 1OYCA 1Q3NA 3QPZA 3W7QA 3DXIA 1ICQA 4JTUA 3W70A 4RX0A 5DCDA 1JCNA 2QDHA 2Y62A 4UR7A 3TAOA 3W7CA 2NXIA 5AHMA 1ONRA 2VFEA 1VHNA 3GK0A 5DY2A 3GIYA 3EWYA 3TSDA 1KW1A 3QM3A 2TMDA 2X2GA 3TQVA 3KFTA 3P60A 3P82A 3L68A 3LHYA 3W75A 1TPC1 4HNTA 5I3HA 4MIMA 5FESA 1Q45A 3LBMA 5AYZA 5C54A 4LVGA 3VI2A 5D2WA 3NPUA 1WDWA 1O60A 4LOCA 4O1BA 1P1XA 3H55A 5LKYA 3LCIA 4M6VA 4O54A 2P0OA 4O52A 5DBUA 3WK1A 3PB0A 4EF8A 3GXPA 2C19A 1TV7A 1LLZA 1IIHA 3THQA 4QIUA 3HF3A 3CC1A 2WSYA 3NPWA 2ZQ0A 2Z1BA 1W3TA 3S5NA 3THAA 3GVGA 4CCEA 1ADOA 5D33A 3RMJA 2DZXA 4TU1A 1GTEA 5LHFA 4XTDA 1X1OA 4MJZA 3WJYA 3P5YA 4ALDA 1LBLA 1OFDA 4PL1A 4NZJA 5F1UA 1UJPA 5SWUA 4UTWC 3TCEA 1GVQA 3H53A 2C0AA 1EB3A 3FFSA 4ZMGA 1SQ7A 1SZFA 3C8FA 3Q58A 3S6DA 2A6NA 2NXGA 1LOLA 3I7SA 3FOKA 2QAPA 3NOEA 1XI3A 2VOMA 2UV8G 4UFIA 5CSSA 3MWAA 1AW5A 3IEBA 4LRSA 1DVJA 1VGAA 3IIVA 4IWWA 3M0ZA 4P61A 2V82A 1GT8A 1BWKA 3B0PA 1X7FA 3KAOA 3DKJA 3M41A 4FF7A 4QITA 1LOSA 1DORA 4LC8A 1GOXA 5KZDA 5D38A 4JY9A 1F6PA 4K7VA 3U6WA 3TA6A 2ZRXA 1GVFA 1WOAA 1THFD 2GVLA 2YX0A 2J9ZA 2ZFAA 1GYNA 2FPVA 5H2ZA 4OWGA 3DH7A 1H51A 4FXRA 3MYOA 2VEPA 2A7NA 4WOZA 4K6AA 1K3UA 1DJQA 5FF0A 3LCHA 2NUXA 1ICPA 4GUIA 3NG3A 3T4CA 2QCEA 4HPJA 1LBMA 3M44A 3W3OA 4EVZA 1TV8A 3TNOA 1YDVA 1FY6A 4TIMA 5CPNA 4MYXA 1HFBA 4KFOA 3A22A 3TJLA 3G1HA 2XN2A 1KM1A 1Q6LA 4PEKA 4U28A 3CIXA 3MP3A 3PY2A 1XM3A 3TW7A 3KVJA 1DJNA 1G6CA 3TU9A 2FB2A 1ZY9A 1BTMA 4JGDA 1VYPX 1WBJA 4X3ZA 5HWJA 3KX6A 1TTIA 3UWVA 4YMZA 1K03A 1TPFA 4HN4A 3PUDA 4JS3A 2B7OA 4BWLA 1WXJA 2FPYA 1S5VA 2V5BA 1TPVA 1JUBA 5F2LA 4NJKA 1UCWA 4JTKA 3HGJA 3ZWSA 1P5BA 4QQ3A 3ABRA 4X9SA 1DHPA 4L4LA 4BK9A 2E09A 2E6AA 3W2NA 2DZUA 5DXYA 2HSAA 2J24A 3WK0A 3C3NA 3NXFA 3N14A 3DAQA 4Y96A 4FX6M 3GDRA 5E0KA 5IM51 1UASA 5FF4A 4MY9A 1BKSA 4AHQA 4JN6A 5D30A 4RLIA 2G95A 5I3FA 1PL9A 4E2DA 2O7SA 3W7RA 1TYGA 4CQ8A 2YSWA 2OZ0A 3EX3A 1J5TA 2Q3RA 3SIZA 3TW6A 4AMAA 3O06A 4ADTA 3DI0A 3JRKA 4NX0A 3QJAA 3VCRA 3YPIA 3C2RA 3HPSA 5L9FA 1B3OA 3CTLA 2W6RA 1IXNA 3E12A 2A21A 1TIMA 1K7XA 3CPRA 2HMCA 3MHFA 5G2IA 5AN7A 3W7IA 2C13A 3HMJG 3IVUA 3HO8A 3UWWA 1LRQA 4IPJA 2YR1A 1EPXA 1BWLA 4JIQA 4S2CA 2WSRA 3TSBA 3CEUA 1A53A 4QNWA 3U8GA 1VHCA 4OT7A 3VE9A 4WXYA 3NQ6A 2X1RA 1TJRA 1VH7A 3NQ8A 3B03A 2ZRYA 3DFSA 3W72A 4A3UA 1YDOA 5K7JA 4LC6A 1WQ5A 3GLCA 2DZVA 5FEZA 3PULA 1S5WA 2CFFA 5HUPA 1D9EA 2ZRZA 3W7DA 4ONVA 5HMSA 1EP1A 5EKYA 5HJLA 3GNNA 1Z41A 3C61A 1VLWA 4K8EA 3M5ZA 2R14A 2Y7FA 6ALDA 5G2HA 3RFAA 2A1YA 1XUUA 3BLFA 3TC6A 1C9DA 4HT3A 5I3KA 4Y6GA 3KVLA 2YZRA 1YXYA 4D2JA 1A50A 5K9XA 1FCUA 1W0MA 4GUFA 4NXKA 4MZ8A 1OFOA 1JCLA 1YYAA 5CZTA 2V2CA 1F7BA 3CLMA 3NVTA 4MFDA 3QEZA 1VS1A 3FEMA 2A4AA 3C52A 3W7NA 4LU0A 2GQAA 2AQWA 3W23A 5LNWA 4RXGA 4WJEA 3O63A 2Y63A 4WOQA 1T8XA 3LHVA 4UNKA 4HNUA 2Y88A 4XKYB 3TR2A 3W2MA 4Y8FA 1XBVA 1G4SA 2NWRA 5CG7A 5D2TA 1I2RA 2VFFA 3EEGA 4JTGA 4UTHA 2JBMA 4FNSA 4Z1BA 3CIWA 4OQVA 2AGKA 1EWDA 3RF9A 5J5DA 1VPXA 4JTTA 1KM3A 1LP6A 4IPIA 3L9CA 4MZYA 2VENA 3NPXA 1RPXA 3BLIA 4LT9A 1SW7A 4FNQA 5EMUA 3NQEA 3MUXA 5AC7A 4O15A 3B4UA 1WOBA 5F2IA 3NNTA 3DFTA 3UQNA 3QMRA 2EKCA 1H60A 3STGA 2ZA2A 1TPDA 3QW4B 2HTMA 2EHHA 3MI6A 4MJMA 1JRCA 3TKFA 4IJBA 5D2VA 3BW3A 2W0UA 1SSGA 3HG5A 1XXXA 2CLMA 4DQWA 4DEFA 1LYXA 1X1ZA 1TQJA 5AOUA 4LVDA 4BI7A 2BXVA 2CW6A 1KTNA 1SO6A 1O5XA 1LTDA 4JNMA 3HGSA 3LXBA 1DQWA 4YLWA 2DJXA 1SFJA 2PRLA 3ZFHA 4IOTA 3BO9A 3IVTA 4O57A 4E38A 3CWOX 3LHZA 4Z1AA 4POCA 1AMKA 3A23A 1XFBA 2VELA 5TIMA 1W3IA 4ZL1A 5FEXA 1O94A 3G22A 1MO0A 4NJGA 4NQ1A 2R94A 3NM3A 2V30A 4O19A 1R30A 3K30A 2NX1A 1OFAA 1YTEA 4LRTA 3IRDA 5EL1A 1KTBA 3P62A 1L9WA 2GPTA 2TSYA 1OF6A 3GAKA 4R53A 3LTPA 4YL2A 5FI8A 2DZWA 4JTFA 2EGZA 5LHEA 3USBA 1HO1A 1TB3A 5FF2A 1WYIA 3B8DA 4BWLC 4OV4A 1MEHA 1QMLA 3OA3A 5CPMA 2H90A 1T99A 3C6CA 3FYPA 5BRBA 3KRSA 4FNRA 4RK8A 2A0NA 3S1WA 2DZTA 3CWNA 4KFNA 1KFEA 5LZLA 3CB8A 2BWGA 3GB6A 3ZR4A 5CPLA 2CWNA 2E6FA 3UWQA 3E02A 3EKZA 5G2WA 3BK0A 4HNNA 3EWUA 4YXGA 4Z1DA 3SY5A 1NSJA 3O8AA 1ZAHA 1YXDA 3BVJA 2ISVA 5EYWA 4WY0B 1XBXA 3FKKA 4GC4A 4HSNA 3PUOA 4CQAA 2B0MA 2Z6JA 2CLHA 4WX2A 4N9DA 2VFDA 3NA8A 3S5OA 3SR7A 3GDTA 3UPWA 1RQEA 2QKFA 4JTSA 3MHUA 4YCPA 4JEQA 3TXZA 1AG1O 5HNRA 4OGZA 3W2KA 6TIMA 4IMDA 1RZMA 4UFJA 3OBKA 1VCFA 2ZTKA 2C15A 1OABA 4O1DA 3D0CA 4DF1A 3QQ1A 4GXMA 4HHPA 1TPH1 3W7EA 3G18A 2H6RA 1EP2A 1W5OA 1HL2A 3LGEA 3LI0A 4HKPA 2CLIA 2OJPA 4JX4A 4BR1A 3O1NA 2YCEA 4LV9A 3FA5A 2QEZA 3W1AA 5CKSA 1J2WA 3N9SA 1ZALA 1W5NA 5F4XA 1YLVA 3W85A 3W1MA 5AHLA 3OG3A 3BG5A 3QC3A 4LS1A 3HG3A 1XUZA 2WPBA 1W3NA 5IBXA 1QPQA 5KTLA 4PTNA 3QYQA 1LORA 4IUOA 2RDWA 3HIJA 3S5ZA 2X1TA 2AAMA 4M7SA 4Q4KA 1M7OA 3FLUA 1TTJA 3M5VA 4EOUA 3S0CA 2HS8A 1TPWA 3IIZA 5FEWA 1XBZA 3UPBA 1OFBA 3PR2A 3G8RA 4WD0A 4PA8A 5CGQA 1XCFA 1KFKA 3R2GA 2DJLA 4O17A 5A5WA 2JKEA 1OX4B 3LRKA 4UC5A 4N9CA 1YTDA 3E9AA 1DV7A 1GJPA 2OMAA 1NFBA 2PE4A 2W79A 1OVDA 3MO7A 4P2VA 1PS9A 3W7HA 2ZRWA 3KOFA 1K8YA 4LWWA 2H3DA 3ZWTA 1EP3A 4NJJA 3W83A 3SFKA 3GXTA 3L5MA 4ZQPA 1SO4A 1OX5A 4UTUA 1S3HA 3FKRA 4ML9A 3NQGA 4O16A 5KZEA 2ZRUA 3O6YX 3SZ8A 3DFQA 4W9TA 2CU0A 3IV3A 3M1ZA 3MBFA 3NR0A 1TTPA 4K7YA 4UTJA 1N7KA 3S8HA 8TIMA 4TMBA 2I9EA 3HJZA 4O13A 4PC8A 1TJPA 4NJIA 4ZQMA 4N6FA 3RU6A 4IX0A 4TX9A 2QAFA 5K4XA 1H7OA 4FNPA 5D2XA 4A2RA 1VCGA 3KVKA 2E5DA 2A7PA 3GDLA 3LLFA 1H5YA 2NXHA 1IF2A 4FB7A 2E5BA 2YW3A 4G1KA 3F4WA 5HR7A 3IGSA 2R8WA 1SZGA 1ZCOA 1H63A 4N6EA 5LGXA 4S1FA 1OHLA 3IVSA 5J5RA 4AEOA 1G69A 2QCDB 2ALDA 3JR2A 3UWYA 1JUEA 1G4TA 1I2NA 5DLCA 5DXXA 1PHWA 3LXAA 5HR6A 3NL2A 2VFHA 3H54A 4M7TA 3W87A 1PIIA 1C8VA 1KFBA 1LZOA 5F2MA 1SSDA 2WSQA 2OT1A 4GE8A 3SI9A 1M7PA 4C1KA 1EUAA 4FIQA 2C3ZA 5KINA 4JXCA 2JKAA 1YTKA 2Q8LA 1RQHA 1VLIA 2CLLA 1T96A 4HSOA 3O07A 2OT0A 3LHUA 3SECA 3EWXA 1OFPA 2ISSA 1FWRA 1QWGA 1SFLA 3RLUA 1C29A 1FWNA 1KBIA 1GVOA 1V5XA 2Y7EA 3PC0A 2F84A 4QSHA 1MEWA 2B7QA 2F7FA 1TPUA 4O1CA 2RDTA 1AL7A 4MZ1A 3GX9A 1TRDA 4LS2A 5D32A 3LTYA 3GDMA 5G1YA 2NX9A 3IGUA 3P81A 1ZAJA 3P8JA 2NZLA 1XBYA 4QNEA 5CPOA 1Z44A 2FDSA 1X8FA 2ABBA 3FJ6A 3NZ1A 2QJIA 3EXSA 2NX3A 3Q37A 1LCOA 4X2RA 5C5YA 2PURA 3CQ0A 3BG3A 2ZZ3A 4FX8A 4S2BA 3UYCA 1VRDA 1PCKA 5FF3A 3B06A 3U2OA 1TV5A 5HWMA 4IGHA 3NQ2A 4I7UA 3HG4A 3QSRA 4UUIA 3GDKA 1TCDA 5BOOA 1LM1A 4QJ1A 2XN0A 1G7VA 1HUVA 2TRSA 3KRZA 4NXSA 4MPQA 5KZMA 5LNVA 3TQ0A 1GPWA 1KTCA 3W73A 4RCXA 4LUJA 1H50A 2DP3A 1WX0A 1WA3A 3F4NA 4NJHA 3T7VA 2WOQA 2ISWA 1ZHAA 2IQTA 2KZHA 3NZRA 5BMWA 4WXZA 2G5WA 3PG9A 4OV9A 3TE9A 3IIPA 3LCXA 4IMFA 1CX9A 4RKAA 4CNPA 4O1AA 4KWWA 4DF2A 4LW7A 4MOZA 3TQKA 4IQLA 4EIVA 3TXVA 3TDFA 3W2JA 3HB9A 2YYUA 1M5WA 3ZS4A 2YYTA 3QZEA 3EX4A 1DQXA 1KM0A 2ZTJA 4UXDA 2ATMA 5T26A 1JR1A 3LI1A 4O10A 5KMYA 4DXVA 3SJ3A 1LROA 1L6SA 3S5YA 2VEKA 2QF7A 3EXRA 3ABOA 3QFEA 4UCGA 4N02A 3C2VA 3Q2DA 2GOUA 1FWSA 2YW4A 4I7VA 3TFXA 1J4EA 1L6WA 3C0JA 3LXCA 2RKXA 4YWIA 5H91A 1SO5A 1OF8A 2QJGA 5IBXC 1JCXA 1QO5A 3R13A 2LLEA 4FX7A 1H61A 4DF0A 4U4MA 1O95A 3I7QA 4MLJA 2FB3A 1TO3A 3CM4A 3ATYA 4PL2A 3O6CA 3G3MA 5K9DA 4NUWA 1LRTA 4GJ1A 1SUXA 2OCZA 1D3GA 1LOQA 1LRNA 4CNNA 2YFNA 5HWNA 5G5IA 3G8EA 2A2IA 2DORA 2Z0IA 3NQCA 3W88A 3N73A 4PODA 3UXAA 1JULA 2WNNA 3GR7A 4UTTA 1KA9F 4MYAA 1F76A 1U83A 5U7SA 4B5NA 5D04C 1YPIA 2E77A 2Y7DA 1SR9A 2TPSA 1DKWA 4K38A 5KITA 1EWEA 5F4SA 1H7NA 2CZDA 4XTIA 3PG8A 2I1OA 3T44A 3DFNA 5EPDA 2CLOA 4XUGA 4AF0B 2QUUA 5LNUA 4FO4A 3M7WA 2QUTA 3W7GA 1H7XA 3DGRA 1RV8A 1JCYA 2NV2A 4ORIA 5E93A 1Q6OA 3G1AA 3C56A 4FNTA 2OX1A 2ABAA 2B4GA 3BV4A 1ICSA 4LNYA 3E0IA 4UTKA 3UZ5A 3OVRA 1RQBA 4H3DA 2X30A 1B4EA 1PHQA 4AWUA 3E49A 2V81A 3W7PA 4FXSA 3WJXA 4LS0A 4QISA 4PH6A 3P7YA 4JYFA 4Y9AA 3F03K 3QSTA 1Z42A 1NF7A 1G67A 3W07A 4FNUA 5LGZA 2JKPA 4AXKA 1ML1A 1KFJA 3PF3A 1B57A 3S1VA 3CT7A 3KRUA 3OIXA 4XQ6A 4A2SA 3TFCA 1LBFA 4XKYA 5FEPA 1W5MA 1VJIA 1I45A 3OEXA 2WQPA 4O50A 5FF7A 3HPZA 1Z48A 3W1NA 1SW0A 1ZAIA 3W1LA 4CCCA 3MP5A 4KFPA 1F5ZA 4Q33A 3O15A 3GAYA 2ZA1A 3DKLA 4O4WA 1OJXA 1I2OA 4ZZ9A 1K02A 3TK7A 2B7NA 4JTIA 1OK4A 1CI1A 1FDZA 2QR6A 3T55A 1N8FA 4N4QA 4FIRA 3AO0A 1F6KA 4MY8A 2A7RA 3MW7A 3EWZA 3TAKA 5D02A 1QFEA 2NLIA 4TMCA 2ZZ2A 4ORMA 4NX5A 3QMTA 2FFCA 1W5PA 1FUYA 4UMCA 3JS3A 5C55A 2QUVA 2C6QA 3LTSA 1R47A 5A8GA 3DZ1A 3LLDA 3QPYA 1R2TA 2VKZG 3DHFA 4Q32A 2GVGA 3W9ZA 4WY0F 2WKJA 3WK3A 1VC4A 1GZGA 3LCFA 2Y70A 3G0UA 3N3MA 5F4WA 1FXQA 1T0OA 3LV5A 4H6KA 2FLIA 2ZDRA 4AAJA 3STFA 3LERA 2DZSA 2XFWA 3W76A 1TPB1 4UIOA 3PUEA 3VE7A 3KVMA 5KSWA 1FDJA 2QCNA 4O0KA 3W1PA 3MI3A 2VEMA 4KWVA 3UNDA 5BW6A 4J9JA 4RZ6A 1GWJA 2WJZA 3HGRA 2I14A 2ZZ1A 4CCDA 5U4NA 3O16A 5LNSA 2WNZA 3DFPA 3P67A 4HNVA 1H7WA 4I9AA 3VFLA 5HULA 3IIOA 1I8JA 3TMLA 3IIXA 3LRMA 3G1FA 3TC7A 2GUUA 3HOJA 3VKJA 2ZYFA 4X22A 4UMBA 4Z08A 1ZJIA 3O6DA 5D05A 1KBJA 1WV2A 1VCVA 3NQFA 3WJWA 4ADUA 3PM6A 4ZQCA 3W71A 3IGXA 5K9CA 1FWWA 1D3HA 3NAVA 2ZZ6A 4LTSA 2CZFA 1SO3A 2Y89A 2H3BA 7TIMA 2QCFA 2ZCGA 1RVGA 2CLFA 3S42A 4GWEA 3PAJA 3B05A 5F2GA 3ELFA 3L0KA 3LBCA 3W1UA 3TROA 3B0UX 3GZ3A 2NWSA 1FWTA 2VFGA 2DU2A 1IXOA 1KM6A 5C2XA 5D2YA 4GBUA 2YDAA 2A85A 3QF0A 3STCA 3WJSA 3LX9A 3BPWA 3B04A 3W7OA 3G0SA 4MY1A 1JVNA 3NGJA 3O05A 1EEPA 4IMEA 4GRSA 4WY0A 4JICA 1Q6QA 4OU1A 3NQDA 1R2RA 1TRIA 4AB4A 2B7PA 4R34A 4XBSA 1WBHA 4NNBA 2YGYA 1OYBA 1W31A 1I2PA 2C16A 3M6YA 3LV6A 3SGZA 1K8XA 4A29A 4N4PA 4GUGA 5G1TA 4TR9A 3BLEA 3M16A 4RZ5A 3L5LA 1L2UA 1WAUA 5CZJA 3GYEA 2FQIA 5BNKA 4IX2A 4O4VA 2QCLA 3MMTA 3MBDA 2CLKA 2E68A 4UTTC 4JDBA 5LNRA 1YXCA 1KV8A 1UUOA 1SU5A 4OHQA 4O0ZA 4M5PA 4UTLA 4AHOA 3C2FA 4O11A 3LOTA 3EX2A 3BGGA 3EXTA 3LDVA 1KFCA 1IGSA 3G1VA 3M43A 3NEVA 5LSMA 2P1FA 4BI6A 5CSRA 4RR4A 4JTHA 3UY8A 1H1ZA 1Q6RA 2ZA3A 1KM2A 4O18A 1TPEA 1G4EA 1EA0A 4WQ6A 1A5SA 4N9EA 2TYSA 1R46A 4HIBA 5DY3A 3V75A 3INPA 3KXQA 1AW1A 1P0KA 3A24A 5AB3A 1DOSA 4MLRA 5EY5A 2E5CA 4RXFA 2PCQA 1F2JA 2ZBTA 1OX4A 4ICNA 2V5LA 5HINA 1L6YA 4DPQA 1VR6A 1ME9A 1F73A 3NPVA 4UFHA 1GVRA 4XBKA 1G7UA 4JX6A 3EWWA 4JTEA 3TSMA 5DN1A 4A22A 3HQ1A 1KLZA 3PBWA 3TX9A 1JUKA 2E6DA 3WFAA 4QM1A 4JY8A 3M5YA 3HGOA 4JX5A 2QCCA 4XZ9A 5DELA 1PV8A 2VXNA 4L4MA 1W56A 4JYDA 5AHEA 1O4UA 1A5CA 1QPNA 4DO4A 3N19B 4NT0A 3ABQA 1FX6A 4BFAA 1DBTA 3G0XA 1KFLA 1QNVA 4OBTA 5AC6A 4MUZA 3EX6A 3CU2A 4TO8A 4M6PA 1HO4A 2NV1A 4R7JA 4UNLA 1NF0A 1IIGA 4IXXA 1MEIA 4IMCA 1AW2A 5EBUA 4LVFA 1VZWA 3M5XA 3BARA 1QOQA 4M19A 3MI2A 1JQVA 1X6UA 2WO5A 3MP4A 4JDYA 5CZ0A 4Z0SA 4NVTA 3W7JA 3W7KA 1Y0EA 4R33A 1P4CA 3UWZA 3DI1A 3PBYA 1SPQA 4UFKA 4UFMA 1KV5A 3TH6A 4ZVJA 2WNQA 1A5BA 2PRMA 2QCDA 1DL3A 1CW2A 1UB3A 5C6MA 4QAIA 4N2YA 1R2SA 5TQLA 1K8ZA 2ZRVA 3L65A 1XDLA 1MXSA 1U5JA 1ZENA 1QPRA 3OHIA 3NDOA 4JTLA 5BMXA 3OVQA 3PWAA 4K36A 2E6YA 2NUWA 1TMHA 4Y90A 1K7EA 2V8ZA 3CEPA 2Y6ZA 3LB0A 3GKFA 1G4PA 4CLMA 1IXPA 1QAPA 5K3VA 2V0TA 2V2DA 3NYZA 2ZZ4A 3PVFA 3P80A 5K2ZA 3N2MA 3P74A 1TQXA 4O53A 2J6XA 3QH2A 4GUJA 2X1SA 3V1PA 4UTMA 3R89A 1KLYA 2VFIA 3M47A 3BW4A 3R12A 5G4EA 2EPHA 1PCWA 3G1SA 4K8HA 1W8SA 4RV8A 5HUOA 5MHBA 1LLWA 2RFGA 5CZSA 3W1XA 3PS7A 4AHPA 1HG3A 3ANYA 3UZJA 3HBLA 4E2BA 3EB2A 1VQTA 2C1HA 3W84A 3NL5A 4NZFA 3G3DA 4OE7A 3SGUA 4O8RA 2Z2UA 3FIGA 2YFOA 3C2OA 1SZNA 3L21A 1FXPA 2J9XA 1B9BA 1ME7A 3W7MA 1NAL1 1GQNA 1VYSX 3LHWA 2GJNA 1JRBA 2RDUA 1SW3A 2C14A 3I68A 1XL9A 4JIPA 2CZEA 4AWSA 2ZZ5A 3NQMA 2PC4A 3OVPA 2V9DA 1XKYA 3A21A 4AWTA 1ME8A 3QQ0A 1JCMP 5AYYA 2O7QA 3QW3A 3C2EA 3G1DA 5D09A 3DHDA 4CNOA 3EX1A 5AFDA 1JJKA 5D03A 1W5QA 1FDYA 1H7PA 3GXNA 1FCVA 1JQXA 3A5FA 3DBPA 1H1YA 1TREA 1H7RA 4IMGA 4MFEA 4MVAA 4ADSA 4O28A 4E0CA 2GJLA 1F05A 3Q94A 3I7RA 4M6QA 2FPTA 3LCGA 3MHGA 4GFSA 1NVMA 1GEQA 3HG2A 2HS6A 4KKXA 1M6JA 1QCWA 4O12A 3R5EA 5D37A 3W74A 3GKAA 2XN1A 4LUIA 2V2HA 3NM1A 3P61A 3S1XA 1OX6A 3W22A 4LVBA 5F1VA 5AC8A 3T78A 1OFRA 1NEYA 1TSIA 4DELA 3LRLA 3F1QA 1AL8A 2Q8ZA 5I3GA 4DPPA 4LVAA 3NO5A 1GTHA 2G97A 4WZHA 3AJXA 1ZNNA 4JR5A 3QMSA 4EWND 5DCBA 4IXHA 3W1QA 2FTPA 2X16A 4RJEA 3QRHA 1AK5A 2Y85A 5G4WA 1I2QA 1O5KA 1QOPA 5AHIA 1EUNA 3UD6A 3L0GA 2QDGA 1W37A 2EAWA 3RK8A 1GG1A 5AHNA 2PRHA 5DCEA 3P5ZA 1V7YA 4MKNA 4UTWA 1FCQA 4UR8A 4WUIA 1MZHA 2A5HA 3BG9A 1KM5A 1OG0A 2WV8A 3TIMA 2H8ZA 3L2IA 4RZ4A 3GR8A 2FIQA 3RLVA 4LY8A 2CLEA 4GUHA 2E1DA 1PVNA 3N34A 1A5AA 4A21A 5I3JA 3DFOA 3NQAA 3TV8A 3NQ7A 1HTIA 3P84A 3PSVA 5AYXA 1OFQA 2CZ5A 4FEZA 3GNDA 2G96A 4N9BA 1EX5A 1XDMA 3ATZA 1OFEA 4BI5A 2ATSA 2D73A 3L5AA 3N9RA 2GQ9A 2JK2A 1RR2A 3MYPA 3UY7A 3A5VA 2NUYA 1OK6A 4FHAA 2BZNA 2EF9A 5E1QA 1YPFA 3SW6A 2YPIA 5TBOA 4PFMA 3PBUA 4AF0A 3LCWA 4ZQRA 4ZQNA 1QO2A 4NNCA 1IXQA 4K39A 2X1UA 4PCFA 1UBSA 3I65A 3STEA 3FJLA 3P8IA 1XC4A 2YXGA 3ABSA 3FS2A 3CHVA 1UUMA 3W7LA 4AH7A 4YCOA 1SZEA 3NQVA 4ZQOA 1BEUA 2R91A 1YDNA 4DBDA 3LHTA 4K37A 4EF9A 4AVFA 2J27A 1KM4A 4NU7A 3S1UA 1PE1A 1W1ZA 1TTQA 4C1LA 1F74A 3TUUA 1RD5A 4Z1CA 3UWUA 4CQ9A 1FCBA 4HPXA 5AHFA 1GYLA 1K7FA 4DO6A 2P10A 5GVJA 4DO5A 1QR7A 2A6LA 2J9YA 2JGQA 1S5TA 2QCGA 2QJHA 4UMAA 2Z6IA 4GNJA 3L66A 1OYAA 2RHGA 3R8RA 3FYOA 4O14A 4UTIA 2H8XA 3MJYA 3B0VC 1GG0A 3BW2A 1EIXA 1FQ0A 1ZFJA 2RH9A 5I3IA 3DU0A 3L0NA 2BX7A 1W54A 3PSWA 1QDSA 3C4UA 4H4IA 3TMQA 1N55A 2FJKA 3NL3A 4UFLA 3NL6A 1QPOA
chains in the Genus database with same CATH superfamily
2JIEA 4DLFA 1I4NA 1GVIA 3WL0A 1MSSA 3VNZA 2J88A 5ABTA 3W2UA 3A9IA 2HV5A 1RA0A 3TJXA 3RR4A 2WM0A 2EEXA 4LNCA 3Q67A 2G3NA 2BTMA 3W6YA 5CEWA 3PB2A 3UXDA 4XAFA 2NSXA 4JTJA 2OFJA 3E96A 3G1XA 5I24A 3RILA 1K4GA 1KGWA 2VWTA 2ZZ7A 1J8VA 1JCTA 1Z6KA 5HMEA 2J7HA 4QR6A 4ENLA 4NRRA 3IJQA 4JD4A 3WMSA 3N2XA 3U48A 2AL1A 4YJ5A 5C8BB 3KHJA 4BF9A 3W2LA 1DWJM 1KCLA 4IG2B 1ALDA 3VTRA 1TA3B 5HQEA 2GVJA 1XLIA 1QBAA 3QPZA 5GJMA 5T9BG 4GCAA 4GI4A 4ZA0A 1TVPA 1FH8A 2XVGA 4S3CA 4FPSA 3FXGA 1FH9A 3RN6A 1VHNA 1I0DA 3TSDA 1KW1A 4UZSA 4EANA 2TMDA 1XIMA 3R8HA 3L68A 3LHYA 5I3HA 1XH2A 5C54A 4ZFCA 4U5IA 1JD7A 3VI2A 5D2WA 4LAZA 1O60A 5CC5A 1P1XA 4XAYA 3APGA 3LCIA 3CPUA 1UJQA 2P0OA 2P3ZA 3ABZA 3PB0A 2Y24A 4EF8A 2C19A 1IIHA 2ZXDA 3HF3A 5IHRA 3S5NA 4KMQA 4L6HA 1E6RA 2HE5A 5D33A 3RMJA 4TU1A 2PBGA 2PLKA 4XTDA 1EOMA 1GOQA 3T07A 3P5YA 1O5RA 2WK2A 1DE5A 1OQFA 2O9OA 2H9AA 3EDDA 5BXPA 1OM0A 3M0JA 1CGXA 3I6EA 4M29A 4GZJA 1XISA 3QV9A 3TCEA 3BLLA 2C0AA 3GFZA 3S4TA 3RLGA 4D8LA 2FTYA 3CUXA 2WC3A 2VZOA 1UWIA 3H2OA 4ATLA 4ICMA 3LPGA 3FOKA 3GVQA 2VOMA 4UFIA 4LRSA 3IUHA 3OBEA 1VGAA 3IIVA 3O0FA 3L4VA 4HZMA 2NLYA 3WD4A 2OOGA 2V82A 4RDWA 1BWKA 4HP5A 3ALFA 3AS3A 3WD2A 2YJQA 4QITA 4U10A 2OLHA 2PF0A 1UKOA 3BOFA 1DWAM 2WWDA 4XZMX 1F6PA 3U6WA 2ZFAA 3WNMA 1O7AA 1GYNA 2FPVA 5D8WA 3P3BA 4KEUA 4AC7C 1UBPC 1R38A 2WZTA 4GIAA 2NUXA 1Z7AA 1QW9A 2X41A 3C0SA 3KOYA 2CBJA 1V8EA 2QCEA 2FH8A 5FJRA 1WXZA 3TNOA 3A3HA 3KBSA 4EPBC 1XH1A 4MYXA 3OG2A 2YLLA 4QDMA 2BBFA 2RAGA 1QHOA 3A22A 3K4WA 6XIAA 2ISDA 1Q6LA 1B1YA 2IUZA 4U28A 2HNHA 2DV0A 3CIXA 2ZXQA 4Y9NA 3SUWA 5RUBA 3PZ9A 1XM3A 2PWVA 1WKFA 3CUJA 2ACSA 3CUGA 1BTMA 1K9FA 4PCNA 3VX1A 5CJMA 1YHTA 3KX6A 4XD3A 3UWVA 4KIEA 1TPFA 2YB4A 4XISA 2B7OA 4QEHA 1LF1A 3L7RA 2CNCA 5CC7A 2V5BA 4GLEA 5A6LA 4DB7A 1JUBA 2OZ3A 3HGJA 3VX0A 1QI5A 5C0QA 3N2OA 4BK9A 4JTAA 1YEYA 2DZUA 4WDUA 4NAFB 3ITGA 1LLOA 3N14A 1E3XA 1MWOA 5E0KA 4I8YA 1UASA 3AMKA 3GVVA 5FF4A 2VR2A 3CAWA 4G7EA 3TTSA 4PUJA 4AHQA 4MF4A 1E1CB 3RO6A 5I3FA 1PL9A 4AC1X 3BICA 2YSWA 1MQPA 1J5TA 2BVTA 3TW6A 2QUNA 3QY7A 5CPTA 5AZ1A 1P6WA 3VCRA 3YPIA 3C2RA 3HPSA 5L9FA 3VGFA 2ZOXA 2QJJA 1TIMA 1K7XA 1JYXA 3MHFA 4RL3A 5CSYA 4UQDA 2C13A 1XIFA 3UWWA 2BGSA 2YR1A 1BWLA 3M0IA 3R0KA 2WSRA 3FSUA 3TSBA 1U2YA 3U8GA 3WNLA 4KERA 1LWIA 4J40A 3T4WA 3VIKA 2ZRYA 1RSCA 3QOKA 1QJWA 4L5ZA 4J5NA 4PB5A 4A3UA 1U1JA 3GDBA 3AAMA 4J27A 3KCJA 3GLCA 5ABFB 3DBNA 2XFFA 5HUPA 3PJTA 1WCGA 1EP1A 1UR4A 5HJLA 1VLWA 2GGIA 4K8EA 4WDXA 2R14A 5G2HA 3BJSA 2A1YA 1QPKA 3BLFA 1KC7A 4GOAA 4HT3A 8CGTA 1XD0A 3S47A 3KVLA 3GU1A 4D2JA 1A50A 1FCUA 4ATDA 1W0MA 2ZC1A 4U2YA 4BA0A 4M3PA 3DG7A 2GYIA 5CZTA 3ITCA 1JNDA 3EDFA 1VS1A 1C7SA 4LU0A 2GQAA 4C6BA 3B9AA 2PDFA 1JYVA 2OQYA 3VFCA 4WJEA 2VDHA 1EDTA 4OIFA 4WOQA 1T8XA 4UNKA 2CWXA 4PUEA 3LMYA 2X40A 4BS0A 3CV7A 2PTDA 3W2MA 4Y8FA 4AZBA 5D9MA 1NJJA 2J62A 2VD9A 3EBVA 4J28A 4JFWA 4GY1A 4UTHA 4Z1BA 2AGKA 1OGGA 4L6DA 4H83A 3L9CA 4IIHA 1O68A 2VENA 3NPXA 1JPHA 2VP8A 5EMUA 4Q8WA 3NQEA 1W9VA 2VZTA 3DCPA 5A6KA 1B5TA 5HNTA 5AC7A 1WOBA 2BOGX 3UQNA 3QMRA 5HJYA 1H60A 2ZA2A 3ME3A 4IIFA 4JL1A 3VOCA 3MI6A 4MJMA 3TKFA 1M3UA 2VX4A 5DX7A 4UQBA 3WLLA 4NHVA 4CVWA 2ZX9A 4NASA 5D2VA 2IW0A 4BQ3A 1W9UA 3BW3A 4GXWA 3DEQA 3OZMA 4HMNA 3HG5A 2CLMA 1LYXA 1XCXA 2ZICA 4Z42C 1SO6A 5CBBA 4JNMA 3SIMA 3GD6A 1GW1A 3LXBA 1DQWA 2PRLA 3ZFHA 3BO9A 3UZZA 4Z1AA 1PZ1A 3A23A 1H11A 3UXKA 1W3IA 4HOXA 1O94A 4NJGA 2ZUNA 2ZC8A 5CXPA 3K30A 3BLKA 3BE7A 2Z7GA 3TVAA 1OFAA 2F9RA 1KTBA 1GJUA 2GPTA 4EACA 3M7SA 2VC5A 3ES8A 3QQWA 3LTPA 4XAGA 1TX2A 4JTFA 1QT1A 4WLCA 1VFHA 1F4HA 3USBA 1HO1A 2OX4A 4PCPA 1G94A 5HANA 3B8DA 1HKMA 1MEHA 1YBQB 4CGTA 1ONWA 2WWCA 1NQKA 4BHYA 4F2UA 7REQA 4QCFA 1E15A 4RK8A 3CWNA 1KFEA 4HHLA 3L2MA 2XFRA 3BK0A 1GKQA 4Z1DA 3U5UA 4ES4A 1HGWA 3O8AA 4D6EA 5E5CA 2ISVA 4DWSA 2XFYA 4WY0B 1XBXA 3A4JA 3FKKA 3PUOA 4CQAA 2CHNA 1JZ2A 1WKYA 2VFDA 3NA8A 3S5OA 3SR7A 2CBVA 4Q8QA 3HFTA 4JTSA 3EA2A 3TXZA 5AKQA 4OGZA 1W3LA 4WRHA 2QGHA 1RZMA 4YNGA 1O66A 3OBKA 3GSMA 4ROPA 1W1A1 3PFMA 2HZGA 3JUGA 3D0CA 1HXJA 6TAAA 5GJNA 5FA5A 4US5A 2AKMA 4HYVA 2V69A 3LI0A 2OJPA 4JX4A 3UR5A 1XYFA 4E4UA 5M17A 3KE0A 2OZTA 5F4XA 5LXEA 1O6IA 2PDJA 5AHLA 2BGQA 3OG3A 3PNZA 4MNJA 1MUCA 5DMLA 2WPBA 4B4HA 4IUGA 1W3NA 1AH3A 4IL0A 3S83A 2G37A 1L8NA 5KTLA 4Z2HA 4J3VA 3NFUA 3HIJA 1WP6A 4Q4KA 5EB8A 1DWFM 1TTJA 4EXQA 5FEWA 3KDNA 1EDGA 1OFBA 3AIRA 3PR2A 4PA8A 5CGQA 1ZUAX 9XIAA 3MWCA 2D0FA 4NYYA 4UC5A 1QNSA 3N13A 1GJPA 1BYCA 5T8GA 3MO7A 1NFBA 1UR1A 3BMXA 4MWAA 1ZB5A 1B54A 1SVDA 2H3DA 3ZWTA 3EA3A 3W83A 3SFKA 1ITQA 3FKRA 4ML9A 4O16A 3DFQA 2VCCA 3WDRA 4PSRA 1J93A 1TR1A 2HWGA 1N7KA 1J0ZA 3HJZA 2WANA 3PPGA 2WLZA 2WMIA 3GWQA 2NQ5A 2VQTA 3SY1A 4ZQMA 4IX0A 4A8RA 2Z1SA 3DFHA 4LUYA 1WZKA 4JTQA 2TAAA 1AUSL 1R5YA 3S9ZA 4AD0A 3WIJA 1GQJA 1F61A 1IE7C 1C9WA 2NXHA 7TAAA 2E5BA 3DFYA 3F4WA 3SADA 2R8WA 3PZQA 3ZLFA 4S1FA 4F79A 3IVSA 4AEOA 1G69A 3WQOA 1ZU8A 3JR2A 3UWYA 2D0GA 1CECA 2ACRA 1VIZA 3NL2A 3ZJ8A 3AI0A 3SI9A 1M7PA 2EQDA 4C1KA 1EUAA 3N1AA 2C3ZA 2IS7A 1EHAA 2ZIDA 3QGKC 1RQHA 4L1GA 4JTRA 4S3EA 4PMDA 3RCYA 4HSOA 2HQAA 2PTYA 2OKOA 3ARUA 1EJUC 1EZ2A 1PTAA 4DRSA 3TTOA 1V5XA 3PC0A 2G50A 2WJEA 1X97A 2FZDA 4GGBA 2F7FA 1TPUA 1WAWA 2J47A 4H1ZA 3V0TA 3GDMA 1P48A 3IGUA 5D8ZA 2NZLA 5HOSA 4QNEA 5CPOA 4H9ZA 4PYSA 1VBJA 5ECUA 1X8FA 2O92A 3QFWA 3W82A 3L23A 3NZ1A 2WW5A 2QJIA 3Q37A 3TR9A 5C5YA 3PPCA 4XVEA 2DPEA 3BG3A 4QLLA 1XRSA 2ZZ3A 2WHKA 1VRDA 2WCGA 2DT3A 4CCZA 1SMDA 1W1VA 3CQIA 3HG4A 5AYBA 1LM1A 4PCTA 2F2KA 4XX6A 1G7VA 3HQOA 1HUVA 3DYPA 1EQCA 5KZMA 4L9XA 1GPWA 3W73A 4RCXA 4LUJA 1H50A 1WX0A 1WA3A 4GBDA 4NJHA 1J01A 2IQTA 4ZB2A 4ROQA 2QV5A 4WXZA 4S3FA 1S1RA 3UXLA 4IMFA 1OC6A 3TLQA 1ZZMA 3N6QA 4IQLA 3QYSA 4EIVA 2FHBA 1K70A 3TDFA 6XIMA 4ZR8A 3W2JA 3WLHA 3HB9A 1CZ1A 4AIEA 3ABXA 3ITLA 1R3VA 4KCVA 3RM8A 3B9OA 1MUMA 2X1IA 4GJJA 4J3WA 5T26A 1UZ4A 1JR1A 2ZUSA 5D9PA 3W26A 4DXVA 4LFYA 1QXLA 1IEQA 3CBWA 3M6DA 2QDDA 3L4TA 3ABOA 3QFEA 3OPSA 1FWSA 3TFXA 1J4EA 3NVDA 4PB4A 4YWIA 4FF5A 1OF8A 2C0HA 3K46A 4DM2A 3EB3A 2VJXA 1R7AA 2LLEA 2GVYA 1V3LA 3I7QA 3MKCA 4PL2A 3CM4A 5K9DA 1D8CA 4GJ1A 1TMLA 2V6AA 2GZXA 1LOQA 4Q4SA 2A2IA 4C6CA 4NZ4A 3PZTA 3UXAA 4AY8A 5A8NA 4UTTA 4MYAA 5I09A 1OINA 2ZXAA 3ES7A 4DO7A 5C2CA 2OEKA 2E77A 2TPSA 2YLAA 1XW8A 4ZODA 4IZGA 1VFUA 5F4SA 1H7NA 2G8ZA 1WNOA 4FAMA 3PJWA 2I16A 4C5ZA 3T44A 3T08A 1M7XA 2QUUA 4GABA 2QUTA 2ZXBA 4C1NB 1VBRA 2PDKA 1JCYA 4OBSA 2MANA 3G1AA 4FNTA 2J66A 1F3XA 2OX1A 4JCMA 3BAXA 2ABAA 1ICSA 1MXGA 1PXGA 4LNYA 1XPGA 4V2XA 3VPLA 4Q8TA 4DXKA 4UTKA 2OYLA 1PHQA 3W7PA 4WVXA 3REQB 1XYLA 3Q4DA 1D8WA 3FGCB 3VD7A 4B3LA 2YCKX 1KGXA 1CB2A 4J3UA 3FJ4A 4DJDD 4AXKA 1ML1A 1KFJA 1Y65A 3PF3A 3CT7A 1Q8AA 3KBNA 3U4FA 4XQ6A 2WMHA 4A2SA 2NQHA 3SRDA 4XKYA 4MB1A 1W5MA 2DSZA 3OEXA 1UIPA 1QI0A 3W1NA 2J7GA 3N4FA 3BQ5A 4KFPA 1S2UA 3PZGA 2V67A 2ZA1A 3VNMA 3WY1A 1I2OA 3PZNA 2B7NA 4MAZA 1HP5A 4JTIA 1OK4A 1CI1A 1FDZA 4MMWA 1BFNA 3SQLA 4MY8A 4GKTA 3EWZA 1EO7A 1WE5A 3JVAA 2NLIA 1B3WA 2ZZ2A 3UGRA 1FUYA 3AZTA 4UMCA 1A5OC 3HJEA 2ISFA 4NI8A 3UPMA 2J78A 4NZCA 3LLDA 4QROA 3QPYA 3DHFA 1EBHA 3W9ZA 4WY0F 2WKJA 3WK3A 3LCFA 2Y70A 3G0UA 4H6KA 4D6CA 3J7HA 2ZX6A 3ENLA 4J3TA 1UWAA 3STFA 3LERA 3RJXA 1W1PA 4LEFA 1AA1B 1BG9A 3KVMA 4HMEA 1AQ0A 5BW6A 4Q7NA 1VJSA 4J9JA 4GJIA 2WJZA 2I14A 5U4NA 1BGGA 4LCRA 1Q2SA 1TVNA 3VFLA 5HULA 3IIOA 3ZLGA 3HV8A 3Q45A 5B7ZA 3KZSA 3G1FA 4DZHA 4LH8A 1UKQA 2GUUA 8XIMA 1OCJA 4Z08A 1ZJIA 3L12A 1WV2A 1JF6A 1R3RA 2E7FA 3PM6A 1BVWA 4ZCWA 2Y89A 5DMMA 1O12A 7TIMA 4Q3MA 1RVGA 2EKGA 2CLFA 4GWEA 3R4IA 4A35A 3B0UX 3VD5A 3FNDA 4QAWA 1S3TC 2NWSA 2VFGA 2DU2A 4F40A 2OEMA 4K8GA 3WLSA 5I79A 3P14A 4GBUA 5JXQA 4IP7A 4XO7A 2VNCA 3WQ5A 3LX9A 3NGJA 3K4AA 3WLNA 4GRSA 4IISA 2E8YA 1J18A 2POTA 3HZ3A 3UZXA 3VDHA 1Q6QA 4OU1A 1XGZA 2PODA 1Q2RA 1XG3A 3GHRA 2V5KA 4IIGA 2B7PA 4R34A 4MKVA 4NNBA 2YGYA 1OYBA 3ZO9A 3QZAA 3E0WA 1I2PA 2QJMA 1FP8A 1UD2A 1XKJA 1UR0A 4A29A 4W8AA 2XGIA 4GUGA 4TR9A 3NEHA 3BAYA 3GYEA 2FQIA 1MW2A 3MMTA 3MBDA 3ZVIA 3H2CA 5FJUA 4OHQA 4JNYA 2AQVA 3CV1A 4UTLA 5HNUA 4AHOA 3C2FA 3LOTA 4UZUA 4YN5A 1A3XA 4V27A 3AU6A 1EJRC 4LAOA 1AJ0A 3UY8A 4WCJA 1H1ZA 3E2SA 4MB3A 1V6TA 1EA0A 2TYSA 4QLJA 5DY3A 3H23A 1KCZA 3V75A 2E25A 4AEEA 4AVNA 3INPA 3KXQA 1Q66A 1P0KA 1ZBWA 3B9EA 3CLWA 4RNJA 2CHRA 5C7HA 4B9YA 3GYCA 4D6FA 1L6YA 3BCFA 1IZCA 1GVRA 4C6MA 1G7UA 3TSMA 2UY5A 5DN1A 1OADA 4A22A 3TX9A 3R0DA 1AMYA 3WFAA 4QM1A 4JY8A 1TG7A 1UKSA 2QCCA 4L4MA 3CGTA 2DSUA 4JYDA 1ZJHA 3APTA 3OTRA 4OVXA 4DO4A 3N19B 1JGMA 1QNRA 5AC6A 3MV11 3CU2A 3KBMA 3OP2A 4TO8A 1ZQ5A 4DJFA 1XCWA 1E9IA 4AX7A 1MEIA 4R27A 4LVFA 5HQMA 5M03A 2CXEA 3AICA 5E70A 4M19A 3MI2A 4NVTA 3K1DA 4HYRA 3BMWA 1XIBA 3UJRA 3ARRA 1JFXA 1K1DA 3TH6A 1P0BA 3ZT7A 5CPSA 2WNQA 1DL3A 1AJZA 2C1GA 3WQFA 3C0LA 2FGZA 3SY8A 4MHBA 4QXIA 1XIDA 4N2YA 5TQLA 2IQDA 1K8ZA 2ZRVA 3R79A 1XDLA 1U5JA 3HMCA 4CNTA 3OHIA 3NDOA 3DC0A 5BMXA 3OVQA 3UR7A 2YL5A 3PWAA 1M41A 3GZAA 5I03A 4Y90A 2V8ZA 4XZWA 3WDHA 1OSEA 2XVKA 5JMUA 3BLDA 5FJPA 3Q65A 4CLMA 5MKGB 2ADAA 3FSTA 1BXCA 4DWSC 2V2DA 1Q6DA 3PVFA 3P80A 4O53A 1PTDA 4AD2A 4GUJA 5JBFA 4LX4A 1M68A 3R89A 1KLYA 2WNWA 3R12A 5G4EA 1W8SA 2OOFA 5C9UA 1S38A 3TW9A 4IFKB 3UZJA 3PBMA 4GZEA 4E2BA 3VGBA 1RCOB 1POKA 2C1HA 5DT7A 3QTGA 3W84A 4N7QA 4JTDA 2JALA 1KRCC 1M9HA 2ZUUA 1OEPA 2XWEA 3W7MA 1GQNA 2DIJA 2NQLA 4LSBA 2GJNA 2OGYA 1JRBA 1JI2A 4CN1A 3I68A 1R85A 2Z1VA 4XSLA 2WJDA 3NQMA 3KS5A 4HJFA 1TJ0A 5CCZA 3ARWA 3A21A 3T0DA 3QW3A 4HPNA 1XQLA 3G1DA 4JHMA 3EX1A 5AFDA 3ZT6A 2IQ0A 5D03A 4BF5A 3MKVA 1W5QA 1H7PA 1FCVA 1XLJA 3A5FA 3WF2A 1H1YA 4MVAA 4Q7BA 4BF7A 3IUDA 4O28A 2GJLA 2Y8VA 3Q94A 4M6QA 3SRKA 2FPTA 3WLRA 1NVMA 3NTYA 4ZO6A 3TA9A 3K8LA 2W61A 2P88A 3W74A 1XSIA 1REQB 3DC8A 4LUIA 3V0SA 2V2HA 1M7JA 3GU2A 3S1XA 2ZX8A 4LVBA 2BVWA 4DELA 3F1QA 1AL8A 4RE2A 3OZOA 4QE1A 4HA3A 3RRXA 1GTHA 1C7TA 1CLKA 3QN3A 3GNXA 1ZNNA 5G4WA 1O5KA 4O8AA 1W1B1 3UZYA 3O0KA 2JF7A 3PTMA 4PGLA 2PD5A 1W37A 1MFVA 5DANA 1PJ9A 3WD0A 2EAWA 1GG1A 1LG1A 1EH9A 5AHNA 4WEVX 3THCA 4UTWA 1FCQA 4H9UA 5LIWX 3VOGA 1ZGDA 2NQ9A 2BNJA 4PTDA 1J9YA 1RJRA 1Q7MA 3L2IA 3GR8A 4HU0A 1S46A 2D24A 2FIQA 2PZNA 4WDWA 4C65A 1A5AA 3QXBA 2G3FA 3TV8A 4PUNA 1HTIA 3ANUA 1PUDA 3P84A 2BGNE 5A8PA 2V3EA 1FWIC 2VRJA 3I3DA 1EX5A 1XDMA 5FKYA 2QQ6A 3AMLA 1VPQA 2NSOA 2A3CA 2W3ZA 5ENLA 1OFEA 2NV9A 1PBGA 4G56A 2JK2A 1RR2A 1ZL1A 3A4AA 3A5VA 4FHAA 3SCSA 5E1QA 1YPFA 1OC7A 4KPLA 4PFMA 3AXMA 1QO2A 1IXQA 3K13A 1N2VA 4B2DD 1UBSA 3CMGA 1CIUA 3CHVA 4UOQA 3RLHA 2D69A 4DBDA 3VDAA 4QG8A 2V38A 1V79A 4K37A 4EF9A 3VCNA 1W1ZA 3TUUA 1RD5A 2EPMX 2E4TA 3AIVA 4D8ZA 4IQJA 4HPXA 2HBVA 5BCAA 2JGQA 1ISVA 4E6MA 4ZO9A 1K4HA 4AZGA 4JKLA 2W4XA 1OYAA 3EDEA 3FYOA 4X2PA 4QS6A 4U33A 2VM8A 3N4AA 1ODUA 1H1NA 2RH9A 4M51A 2BX7A 3IAPA 1N55A 2FJKA 4J4KA 3URQA 4AUBA 2GK1A 1XSJA 5L6UA 1E51A 2QCMA 5I0DA 1CEOA 4H01A 3STPA 4JYEA 2VEIA 5IFTA 7ENLA 3AIBA 2VT0A 2BY1A 2C18A 4NZ1A 1B4KA 3GXDA 1CLXA 4Z0JA 2R1MA 3MJMA 4LV4A 3I6RA 3UZWA 3OB8A 2DZPA 1FBAA 3S2LA 4J7RA 3W1RA 4DBEA 3UJEA 5I23A 3N6JA 3M0LA 3AZSA 3G1YA 3XISA 2VMFA 3WK2A 1XV8A 4Y2WA 4CN4A 3WJZA 3KL3A 3AIQA 3W1TA 3OODA 3VDCA 2X7WA 4YYCA 1P0NA 2GQ8A 4P7LA 1W9XA 1IGWA 4AZHA 3BUVA 3DXIA 1UIOA 4TXEA 3H2EA 2QDHA 2Z25A 3VKBA 4M6UA 2E3ZA 3W7CA 4C6NA 3GHUA 4M24A 3GK0A 4QSFA 1BD0A 3VNJA 3W75A 4HNTA 4MIMA 2W92A 3LBMA 4ILSA 1EPVA 3QVQA 3W00A 3VYLA 2G3IA 4O54A 2ESCA 3ZVHB 3OGRA 2PP3A 2P8CA 5C9RA 3THQA 5HMFA 1EGVA 2PWFA 3CC1A 3NPWA 1PKNA 4JIRA 3JW7A 3WF4A 4CCEA 2XH7A 4AWEA 1WZMA 3MS8A 3UBPC 9CGTA 1X1OA 1UC4A 2G0WA 3WJYA 5AY7A 4IHCA 4WJXA 3CHEA 2YKKA 1XIHA 1UJPA 3MUIA 1ZTVA 4OUIA 3QGVA 2AL2A 3WQEA 3H53A 1J96A 1EB3A 4ZMGA 4H9TA 4R85A 1MMFA 1SZFA 1W3HA 3S6DA 4CQDA 1LOLA 1UA7A 2HE8A 3W25A 1DIEA 3I7SA 3NOEA 1XI3A 2UV8G 3EOLA 3WNKA 4D9PA 1DVJA 1EF2A 4IWWA 2EPNA 1GT8A 1R87A 1KNWA 3B0PA 3K8KA 1T5AA 3GM8A 1XX1A 1X7FA 4H8NA 3KAOA 3DKJA 3M41A 3RX4A 3FHAA 4FF7A 4HB7A 1HT6A 2OWXA 3ZXWA 2ZX5A 1LOSA 2ANUA 4LC8A 3ORWA 1GOXA 4JY9A 3WH6A 2Y4SA 4OOZA 2E67A 3CZEA 4OWGA 3NUKA 2PDWA 3WQDA 3MYOA 3R1ZA 1A47A 2BHZA 3DHUA 1LUCB 1RBAA 2EPLX 3EDJA 4K6AA 4DY1A 5BYWA 1GVYA 5FF0A 3QTPA 2Y5EA 2XUCA 2DQXA 3QZ6A 2OWWA 4NP7A 4A8LA 1RBLA 1LBMA 1MQRA 4NAEA 2YB1A 4TIMA 1W6TA 2XSXA 1CWYA 1Q6EA 2PDIA 4KFOA 4W86A 3RX2A 1JAEA 4WKHA 3BXWA 1KM1A 2Z00A 2DQWA 4WKAA 3MP3A 3PY2A 2OQHA 3S2MA 3TW7A 3KVJA 1DJNA 4GI6A 3TU9A 4HBKA 3T8QA 1UZDA 1RXOB 1ZY9A 5A69A 4HHMA 4JGDA 1VYPX 1WBJA 4BKNA 1K8CA 2WMGA 1TTIA 4FK9A 4YMZA 1DPMA 5JU6A 1OBAA 4HN4A 5D9OA 3VD9A 4JS3A 3ZSTA 4KRUA 2O9PA 2Q8XA 4IPPA 3OZPA 3DECA 3S46A 3ZWSA 4QJ4B 3OGSA 3H7UA 4X9SA 1EC7A 1DHPA 3W2NA 1IWBA 3LY0A 4I3GA 1CYGA 3C3NA 4QRNA 3GG0A 2CPUA 5IM51 1KXQA 4MY9A 1VFFA 1H0IA 4JN6A 1A5NC 2QNEA 2G95A 2P8BA 3BZGA 5REQA 4KT2A 4PR4A 1VKFA 2XH4A 1EC8A 3H22A 3GC5A 5BXTA 4ADTA 1EYEA 2F6UA 1B3OA 3VCCA 4LUTB 2A21A 1R9YA 4M56A 3ZQ9A 1M53A 3M0YA 2UBPC 3WUFA 5I02A 4XAZA 3QHMA 5AN7A 3W7IA 3HMJG 3AIUA 3HO8A 4REQA 7PTDA 4DWSD 4JIQA 4S2CA 3FAXA 3CEUA 1CGWA 3UF9A 3VE9A 3WLTA 1BAGA 4AZIA 1VH7A 2AAAA 2ZX7A 3NURA 5EFFA 4Q8NA 1S2VA 3IJ8A 2BG5A 3MVTA 1VPYA 4MB4A 1S5WA 1MRAA 3WX7A 5HMSA 5EKYA 3I4KA 3GNNA 3C61A 1XLKA 3M5ZA 3RFAA 4KGLA 3MDUA 1C9DA 3DN5A 4MM1A 5I3KA 1V0MA 3A6OA 2YZRA 5K9XA 1HZYA 3GTIA 4GUFA 1FHVA 3RITA 1J0IA 1DIOA 3UJ2A 1JPDX 3CLMA 3FX4A 2A4AA 4JL2A 2V3DA 4RXGA 4C6EA 3M0XA 4C60A 1TR9A 2ZADA 4HNUA 1SFSA 4WSKA 3T81A 5PTDA 3E0VA 2NVDA 1KBKA 5DFAA 3AHVA 1ELSA 3CS2A 2NWRA 5D2TA 4YTSA 1D7KA 2JBMA 3AYTA 4AZ5A 3LPOA 4OOUA 1EWDA 3MT1A 4PN2A 1W8GA 1UWUA 4YTRA 4MZYA 4GYPA 4ATWA 4FNQA 2WZHA 4UBPC 4RNIA 1FWDC 1IYXA 1JZ5A 1OD8A 4LF2A 1KR1A 3B40A 3DFTA 3WELA 1B3YA 5BWFA 1TPDA 2QT3A 1VRXA 4DZAA 2WVVA 2P76A 1JRCA 2QVNA 2WMFA 1TE1A 3QKEA 3G77A 3VILA 1E9YB 4XUYA 4J3SA 5TAOA 1A5MC 1QUMA 1XXXA 4DQWA 2PU0A 1US0A 4LVDA 4M0XA 2PWGA 2Z27A 3W6MA 2Y5SA 1LTDA 2OYMA 3HGSA 4NI3A 3PK7A 2I9UA 2DJXA 3CV2A 4E38A 1W1TA 3LHZA 4POCA 1GW9A 5ABEA 4GINA 5TIMA 3OLEA 3QR1A 3G22A 1RCXB 1UPPA 1R30A 3GVRA 2QUMA 5EBAA 2NX1A 2FHCA 2YXOA 1IT8A 3WQ6A 2TSYA 2PI6A 4B5WA 4R53A 4AIBA 2CXGA 2DZWA 4QLKA 4IJCA 4RW5A 4HJWA 1X8CA 3VIIA 4BWLC 5HK4A 4OV4A 2WC7A 3WLOA 4N42A 4AZ6A 2H90A 1T99A 4AISA 3CQJA 3C6CA 3PBGA 1JDDA 3VM7A 1TELA 2OR2A 2HBXA 5GNZA 3S1WA 1ZP4A 2BWGA 1XD1A 1CXKA 2E6FA 3UWQA 2OTDA 4GI9A 5G2WA 1VFLA 5A1AA 1J6PA 3EMCA 4YXGA 1E0TA 3FK4A 1NSJA 1PX4A 2Z29A 2W67A 5EYWA 5CLWA 4GC4A 3QV6A 2IKGA 1GQKA 2CLHA 1ZCCA 4N9DA 3UPWA 2PDBA 4DBWA 1AG1O 5HNRA 2JF6A 3VKCA 5TNVA 4P7NA 4RE0A 3CZ8A 5I78A 2XYLA 2YA0A 4YTUA 2VUNA 1ZBKA 4DF1A 4UQ9A 5AVNA 3QQ1A 2W91A 1EYWA 1UWTA 3H4XA 4RDYA 4YU1A 5HNNA 1TPH1 3MSDA 3W7EA 1HKWA 3KRBA 3VOIA 1CXLA 1YE6A 2CLIA 3O1NA 3FA5A 2QEZA 4LEQA 4C6LA 5XINA 4PTMA 1KCXA 4B5TA 1R3QA 1ZALA 4GYKA 1YLVA 3KBWA 3W85A 3O2LA 3ITVA 2DEPA 3HG3A 4JQ4A 1TZ7A 1TWDA 4ZFMA 1JG9A 4GQRA 1QPQA 8XIAA 3O3RA 4A3YA 3V35A 3M4HA 4IUOA 4X0NA 3S5ZA 4IG2A 2HEJA 1TA3A 1YNQA 2HS8A 3T0CA 2W9MA 1XBZA 1E6SM 4FR6A 1AFSA 1KFKA 2Q6ZA 3R2GA 2DJLA 1OX4B 3LRKA 1Q7ZA 1YTDA 1DV7A 1DTUA 1PS9A 1DJXA 3GG1A 3KCOA 2UY4A 1MNZA 3RG6A 1C8XA 3L5MA 1SO4A 3WUGA 5B80A 1SMAA 1OX5A 4UTUA 2A3AA 2QXWA 1A3WA 1D7FA 1EX1A 5KZEA 1ECQA 2ZRUA 2CU0A 3M1ZA 4LCSA 1XFCA 3NR0A 3UESA 5JQ9A 2XGBA 2I9EA 2R82A 4O13A 5C70A 4XD5A 2Y0FA 3RU6A 2A3HA 1MI3A 5K4XA 3MA8A 2D2HA 2P0IA 1H7OA 5D2XA 4ZE5A 2E5DA 3GDLA 2A7PA 1E1FA 1VFSA 1ECEA 3AS2A 1IF2A 2YW3A 1GZJA 2ZWYA 1ZCOA 1H63A 4N6EA 5LGXA 1N8WA 1EFZA 2IPGA 1OHLA 2QCDB 4H6RA 1JPKA 1G4TA 3MTWA 4ASTA 2BP1A 2GDQA 3E1F1 3B0YA 2VFHA 3TTQA 3VU2A 4CNSA 1PIIA 1C8VA 3GS6A 4KETA 1LZOA 5F2MA 8RUCA 4TVDA 3F2CA 1IR2A 4GE8A 5HPCA 4FIQA 4GQBA 1H5VA 4QG9A 3WQGA 5KINA 3IJ7A 1YTKA 3EMZA 2CLLA 1U22A 2NT0A 1FWAC 2EO7A 3EWXA 2ISSA 4G2DA 1UR3M 4YVPA 4CUCA 4Z2KA 2Y7EA 4ML4A 2IPJA 4KWUA 2OU4A 2WKLA 3DESA 2E8ZA 3ZM8A 1GOKA 4MZ1A 2IPWA 3SM0A 2CKSA 4LS2A 3LTYA 5G1YA 2NX9A 1ZAJA 3A64A 1Z44A 2DIEA 3IACA 2FDSA 2E1WA 2J4GA 3FJ6A 3NGFA 1QATA 3SQMA 1UW9A 2PCEA 1I75A 3TP4A 1IQ8A 1PCKA 3B06A 4PUDA 3NQ2A 5E9AA 5BOOA 3PZUA 2OLAA 1DJHA 4PRRA 4EK7A 3B97A 3HPFA 5C71A 4TTUA 2DP3A 1OD0A 4NG3A 4Y8EA 3UU0A 3U57A 4GY0A 4Q22A 4V28A 2KZHA 3NZRA 3C86A 5BMWA 4GO9A 4F2BA 3ARTA 1HKIA 1NIUA 1UD8A 4OV9A 1BVNP 1EEXA 1CX9A 4CNPA 2E28A 1XLEA 3MC5A 4KWWA 4LW7A 2IMRA 4Q8MA 5DMNA 1QVBA 3VUPA 5AC4A 2YYUA 4H9VA 3AHYA 2GQ3A 2CBIA 1M5WA 4NAFA 3ZS4A 2YYTA 3GTFA 4YVXA 2ZTJA 4UXDA 1IZKA 3BAIA 1ISXA 4UOZA 1JYNA 4Q8VA 4KWSA 4IM4A 2QF7A 3URAA 4N02A 1XYMA 2GOUA 3WUEA 1LL7A 1E1CA 1L6WA 1P43A 3LXCA 1PX8A 4HA1A 4S3KA 3LQGA 1H2JA 4GH1A 3MUCA 3SB0A 5IBXC 1JCXA 1QO5A 4C6KA 1B3ZA 3TJIA 5FIPA 3B8UA 4DF0A 2OKTA 4U4MA 1AQHA 3PJXA 2FB3A 2QF8A 4S3DA 3ATYA 3G3MA 2XIBA 4PMYA 1LRTA 1OCQA 3OYZA 1D3GA 2Z7KA 4X61A 3VO0A 4CNNA 1Z89A 3AHXA 4H04A 5G5IA 3QHOA 3NQBA 3NQCA 3L2LA 4PODA 4IIBA 1JULA 4HZ8A 3WNNA 3UNTA 4B5NA 4EE9A 6A3HA 4HVXA 1NDWA 3DIPA 1EWEA 5I00A 2P3EA 2E9LA 2I7GA 2XIMA 2P50A 4AD1A 3XIMA 4XTIA 3PG8A 2PLCA 1FWEC 1NM9A 3DFNA 5EPDA 2CLOA 5ABFA 4AF0B 3TN5A 3GH5A 5LNUA 3M7WA 1NFGA 3AISA 1RV8A 2NV2A 1Q6OA 3CAVA 1DQUA 2YZ5A 4HCLA 2W63A 4I5XA 1OZMA 1V4YA 3E0IA 1K6AA 3OVRA 1DIKA 2VRQA 3TOYA 1B4EA 3CAQA 3TN3A 4JPGA 3PHAA 4QISA 3MV01 4RNFA 4Y9AA 8A3HA 1OCNA 3OZYA 4GVGA 1NF7A 1KGUA 1PIFA 1EGMA 4HOWA 4QEEA 2JKPA 3B0XA 1KB3A 1DWGM 1GYMA 1XLDA 3OIXA 1LBFA 3COTA 3EZ4A 4WKFA 5AVHA 2AGTA 1I45A 4O50A 2PU1A 1SW0A 1U1HA 2I5QA 3MP5A 2VO5A 3OQ8A 5T9CE 2FZBA 3DKLA 4O4WA 4RE4A 4ZEPA 4K1WA 1TZ9A 3PZIA 3ECQA 2QR6A 1AJ2A 4FIRA 2VX5A 1MW1A 1I6NA 1ITXA 4ORMA 1W5PA 2QUVA 2C6QA 2XZ9A 4AG0A 3LTSA 1R47A 5A2CA 1RBOB 5A8GA 1A0CA 4IP5A 4KQNA 1KFWA 3P0XA 3H21A 2Y8KA 3V7PA 1M04A 1W17A 3WFLA 2ZVRA 2DZSA 2XFWA 5KSWA 3E5PA 1YKWA 3R58A 2QCNA 2QLYA 3MI3A 1VP5A 1ZJAA 2GOKA 3B9NA 1YMYA 3IJ6A 3R8GA 1J0JA 1GWJA 5BOFA 2JQXA 3LN3A 1MVYA 3BL3A 4I9AA 3BJTA 3LRMA 4B3KA 3U5YA 1JZ8A 3U9IA 3UVIA 1HL9A 1S5MA 4QG6A 1ZPTA 1POJA 1KBJA 3EAUA 1KWGA 4ZQCA 3RYSA 5K9CA 2PMQA 4XZLX 1YBQA 1D3HA 3NAVA 1RP8A 1HJWA 4FLQA 4P8XA 1E4NA 3T0BA 3LM3A 3MMWA 2ZCGA 2NVCA 3VUSA 1WZLA 1NH6A 2PZ0A 3S42A 3PAJA 3B05A 5CGTA 5F2GA 3ELFA 1ZJBA 3GZ3A 3OIHA 3GXIA 1XIJA 1F3EA 1KM6A 1TWIA 1PAMA 1E9LA 5C2XA 3WQ8A 2YDAA 3CK5A 1U5HA 3WJSA 1OIFA 3WFZA 5LIKX 2F6KA 3BPWA 1A80A 1W3JA 3B04A 2V63A 3G0SA 4G1NA 3T2QA 3E3HA 3O05A 5KZ6A 3G6MA 4WY0A 4JICA 3B8IA 3GXMA 3NQDA 4O1FA 1TRIA 4PBFA 4HPHA 1OC5A 1K77A 3S2CA 1IV8A 3EPMA 3M6YA 2OSWA 1GNXA 4DYKA 3DG6A 3BLEA 2NVAA 3M16A 2GDVA 5A94A 2QCLA 4LQ1A 4PEEA 5C9XA 2CLKA 3G6LA 3H70A 1DWIM 3RPMA 1UUOA 3A13A 1SU5A 3CHFA 3SCUA 3WZ0E 1ADDA 4M5PA 3WLPA 3U2CA 4LXFA 4O11A 4FA3A 3GNOA 1JI1A 3V0UA 1IGSA 1JPIA 3TYAA 2EG8A 4JIIX 5CSRA 1TJ2A 2PGFA 4QQUA 4OTKA 3K1GA 2YCIX 4H7VA 4GYPC 1Y5XA 1CLVA 2IKHA 4JNZA 1T8QA 3TQPA 1RJQA 4ZOBA 2IKJA 2E5CA 5FACA 2PCQA 1FH7A 1HW6A 4YTTA 2ZBTA 3AWOA 4HK6A 3AS1A 4ICNA 3A3WA 1V6YA 4V33A 1V03A 2WLYA 2Z1XA 2D2JA 2W62A 1E43A 3M07A 4UFHA 4XBKA 2PDQA 1FHDA 3QV8A 3GUGA 5JH2A 1DJZA 2O4QA 3F4CA 1E40A 1KLZA 1QHPA 3HQ1A 1Y5WA 3W27A 4JX5A 4OUEA 3IJ9A 2G3JA 3N18A 3T9PA 4XZ9A 3TN6A 4IFRA 1W56A 4ERGA 4LBSA 1LWJA 5E0CA 3BCJA 1K9DA 3ABQA 1FX6A 4PMVA 1JD9A 3AWNA 4OBTA 4MUZA 3CWHA 3IARA 2PWHA 1VEMA 3SCQA 4I90A 3CJPA 1XSKA 4IMCA 4GCXA 3BARA 1JQVA 3MP4A 3WQWA 3KUMA 3CV6A 1Y0EA 2INFA 2BS9A 3GHSA 4FALA 3PBYA 4HD5A 1W2PA 3FAWA 5AECA 3GQYA 4DNMA 2PRMA 3SCPA 2PDNA 5C6MA 1R2SA 2QIIA 1E73M 3L65A 2XVPA 3DX5A 1JL8A 4NZ3A 5J04A 1ZENA 1QPRA 4DAFA 3FV9A 3UA4A 3P2VA 3QBUA 3U2EA 3KOWA 4PRWA 4IJRA 1TE6A 2Y6ZA 3S6TA 4KWOA 1I1XA 3CHCA 1IXPA 1E6PA 3NYZA 4FMVA 2ZZ4A 4PMQA 3N2MA 1TQXA 5LA0A 2G4FA 2VX7A 4QBXA 4XG1A 4UTMA 4NL1A 3M47A 2X8RA 2X42A 4RV8A 5HUOA 3PS7A 3KP0A 4C6OA 5DMYA 3F5KA 3HBLA 7A3HA 3EB2A 2D20A 1E56A 2F8QA 3G3DA 1QK2A 3UG3A 4OE7A 3C2OA 3L21A 4PMUA 1TMQA 1ME7A 1NAL1 1VYSX 3L4ZA 3MZ2A 3ANVA 1R3YA 4ZTXA 1J0KA 2C14A 2PDMA 4OFCA 4JIPA 2CZEA 1QI4A 3OBAA 1XKYA 4Z2GA 1ME8A 1TWSA 2BODX 2HXUA 5D09A 4CNOA 5FD0A 5CSUA 1JJKA 4KW2A 1JQXA 3DBPA 2YCLB 1TREA 4IMGA 1H7RA 3CIVA 3MUY1 4LGXA 4DIAA 4W4QA 4WJ8A 1PTGA 1GEQA 2HS6A 4UWMA 3VKKA 2MNRA 1QCWA 2C91A 4O12A 1F3TA 1QBBA 1UP0A 3P61A 1EDQA 1K9TA 1GZ1A 5F1VA 3IANA 1YPXA 1OFRA 4WR3A 3WQ4A 4KEVA 2Q8ZA 2YA2A 4ZB5A 3NO5A 2G97A 4QJ3B 1X6NA 4H00A 3FYYA 4WZHA 3SBFA 2R1KA 3QMSA 2WJFA 5DCBA 2X16A 7XIMA 3QRHA 1P0DA 4OECA 5AHIA 3L0GA 4P8WA 3ZZ1A 4DJDC 2WHJA 2HPMA 1W9BM 4UR8A 4WUIA 3CMJA 1GEHA 2PTWA 1R0MA 4AVOA 1OG0A 3AUJA 2H8ZA 3RLVA 1XS2A 3VIJA 4GUHA 2J8FA 2E1DA 1XIGA 2W5FA 2XDFA 2X09A 3NQ7A 3EB4A 4HOZA 3PSVA 2G96A 3CUHA 2OSYA 2Q09A 1EJVC 3ATZA 2UWFA 4JAWA 2VI0A 4AW7A 3CQKA 3PP7A 3VKAA 4DN1A 4BI5A 3GH4A 3PFRA 1WUEA 2PP1A 3ITTA 4XD4A 2NUYA 2YDRA 1OK6A 1CCWB 5H6HA 1JZ4A 2CLPA 3MMDA 2PGWA 4J1OA 4PMJA 4XZHA 1KXVA 4MG4A 4S3GA 5LA1A 3NZQA 2XHYA 3BDKA 3PBUA 3UJFA 5I6SA 4ZQNA 3EOOA 1E4LA 4C1NA 4K39A 1PKMA 3KTSA 3G1RA 3AIWA 1X6LA 2HDJA 3I65A 1VF8A 3STEA 3FJLA 3WL1A 3P8IA 1XC4A 2YXGA 1QNPA 3W7LA 4AH7A 1PYMA 3LZ5A 1YDNA 4QDWA 4Q8UA 3S2NA 5G1MA 1B9ZA 2BDQA 3RR1A 4AVFA 1HKVA 4GPNA 1PE1A 2Z1WA 3E0LA 3REQA 1F74A 2PGEA 4Z1CA 1P7TB 4Z2LA 1ISWA 3FGCA 2P10A 1XQKA 1DXEA 2QCGA 3MQTA 1PZ2A 4UMAA 2Z6IA 4GNJA 4L1XA 2QULA 1UPMB 1WXYA 3L66A 4UTIA 5KETA 3C8NA 3VIFA 3EDKA 3KOXA 1EIXA 1FQ0A 1ZFJA 4H41A 1JDEA 4WGXA 5H8UA 1W54A 4UQEA 4H4IA 3NL6A 1E71M 1QPOA 3T1GA 3USZA 1DE6A 1HVXA 4NNAA 1UA3A 1G1YA 3CAKA 4EX4A 1YADA 2Q3OA 2QYGA 2Y7GA 4E8GA 3W86A 3BGJA 3G24A 3LM7A 4QDPA 3KOZA 3QLLA 1H62A 5BRQA 1LDCA 1XWYA 3BURA 4I5UA 3C0QA 2E0PA 1PKLA 1RHCA 1V3MA 2E9MA 4N0RA 1UR8A 3S9YA 1XLMA 3SSJA 3D47A 5EMMA 3RU8X 4XK2A 5E6ZA 2DVTA 3DENA 1JCJA 3V5CA 3VC5A 2VC6A 2BSLA 3AS0A 1BYDA 4FS9A 3B8TA 3EWBX 3V5FA 4TV5A 3VOHA 1LL4A 3T40A 3L67A 3UVAA 2KAUC 3W7QA 1ICQA 4LBRA 3NIYA 4CD7A 1P6CA 4TV6A 3PTKA 3W70A 3U7BA 6REQB 1JCNA 2CC0A 2FVLA 2Y62A 4UR7A 3TAOA 5AHMA 2VFEA 5DY2A 5GPRA 1F07A 3GIYA 2GUYA 2X2GA 3TQVA 3KFTA 3P60A 4L65A 3AOFA 2OO6A 3AFBA 3NPUA 4HQVA 4UQAA 1S1PA 4LOCA 4M6VA 4O52A 5DBUA 1EL3A 1TV7A 3WLQA 1DIDA 3MKKA 4QIUA 3SN4A 3F4DA 4E8CA 2WSYA 4B16A 3WLMA 2Z1BA 1LQ2A 1V0LA 1DXFA 4BJHA 2VWSA 1IEVA 4KH2A 1F8IA 1GTEA 4V15A 2QVHA 3N3TA 3QR3A 5LHFA 3TYEA 3KHDA 2CCRA 3F4VA 3GH7A 2J8GA 5CH9A 4E4FA 2RDXA 5BRPA 4YHGA 4ALDA 1LBLA 1OFDA 4PL1A 4NZJA 1T41A 2OODA 4DJEC 3MANA 4JOMA 1GVQA 1M01A 1OGBA 3PANA 1O1HA 3LENA 1UROA 4LUSB 1SQ7A 2PS2A 1FFQA 3Q58A 2A6NA 2NXGA 2QAPA 1LT7A 5CSSA 1MFUA 5TF0A 1A5KC 4DUOA 2O9TA 4P61A 1RVKA 3CUFA 3JU2A 2I17A 2CETA 2QPSA 2YA1A 4L9ZA 2PB1A 4QS5A 3B9DA 4AZCB 1DORA 2DUAA 3BAJA 1XRTA 3LBOA 5DEZA 5KZDA 3URBA 1GVFA 2GVLA 2J9ZA 1PKYA 4IMAA 4H8UA 4NIRA 3DH7A 1H51A 2FHFA 4FXRA 4R7OA 3BOXA 3ARSA 2JEPA 3ZJ6A 4K2SA 1QK0A 3FXYA 4HTBA 3NCOA 3LCHA 1V93A 4GUIA 3T4CA 2G41A 1FWGC 2NQZA 3M44A 4EVZA 1TV8A 1FY6A 5CPNA 5A2BA 1HKKA 4IL2A 1A0EA 3TJLA 4F0SA 4HA0A 4PEKA 3K8MA 2XPKA 2HRWA 4TVUA 5JUVA 1WB0A 3MCNA 4MAVA 2BY0A 1L8PA 1G6CA 3VIGA 4IGSA 1EOKA 4PB3A 2GFTA 1L6FA 4GIYA 3EWCA 1XIEA 4Q4QA 1K03A 3SCTA 1E4IA 1W91A 3LGDA 3PUDA 1R3SA 4U3AA 4CD5A 3VGEA 3GG7A 1BQGA 1VFOA 4XZIA 3UT0A 5F2LA 1TJ1A 4NJKA 3ABRA 1XICA 4L4LA 2E09A 1HVQA 2E6AA 4ZB0A 1J0YA 1F9CA 1X98A 3ZMRA 3E2VA 4KF1A 2J24A 1GQIA 1CXIA 4FX6M 4W87A 2FZ9A 3PPHA 4GISA 4CEXC 1XG4A 5D30A 4W85A 4INFA 4RLIA 4LBUA 4E2DA 1TYGA 4CQ8A 3ARXA 4AMAA 3O06A 4MNMA 3DI0A 3QJAA 1IXNA 3LSBA 1FTXA 1H4PA 1CT5A 2I5GA 3CPRA 2HMCA 1XRVA 3WF3A 2WXDM 4KEMA 3KDOA 4M1BA 4WSHA 3IVUA 1MUWA 5BOEA 5MKGA 1LRQA 3WDQA 1EPXA 3TYUA 5FAGA 1Z9AA 1MYRA 5HMDA 4PUWA 3UEQA 1A53A 3OLDA 1O1ZA 4QNWA 3CZLA 3WO8A 4FZIA 1VHCA 3PUGA 1Q6FA 2A3LA 3E6EA 4WXYA 4A3RA 1TJRA 3NQ8A 1RY8A 3W72A 4IFKA 5K7JA 3B3DA 4HZ7A 2DZVA 5B7YA 1GHSA 2OELA 5FEZA 2DGAA 2CFFA 4EAMA 5HATA 4ONVA 1NDYA 1N8IA 2PTXA 1NTHA 1Z41A 5BWAA 3W81A 6ALDA 4S3JA 1XUUA 3FVDA 4CQCA 4Y6GA 1YXYA 4JKKA 2F2HA 3LMZA 3RCMA 3AZRA 3WH7A 4MZ8A 1OFOA 2GSEA 1JCLA 2Y1HA 1DJYA 3V1HA 2YXXA 4Z17A 4MFDA 3C5QA 4URIA 3W7NA 2AQWA 1XIIA 2GGEA 1R86A 3LHVA 4JQAA 2Y88A 3TZFA 2OLSA 3ITXA 1E4MM 3TR2A 2O9RA 2DW6A 3W02A 3V4BA 3WD3A 2O56A 3EEGA 1V51A 4JTGA 3V36A 4FNSA 1REQA 3CIWA 3RF9A 1VPXA 4JTTA 1KM3A 3WMBA 1LP6A 1PSCA 4IPIA 2FVKA 4B5VA 4LT9A 2J25A 2Z2AA 1SW7A 2GWNA 3ARZA 1UOKA 1IT7A 4P8UA 3CASA 3MUXA 1BRLB 3B4UA 3S9IA 4HK7A 3GW3A 3FN9A 2EKCA 4A05A 1W1YA 5FL0A 4B5XA 2PAJA 4X60A 2VTFA 1C8QA 4IJBA 2W0UA 1KKOA 1SSGA 1GONA 2WBKA 3GO2A 3F7JA 3W38A 1X1ZA 1TQJA 3WF0A 4BI7A 2CW6A 3W4RA 3GNRA 1KTNA 5CZKA 3VXGA 4QCEA 2PDHA 1FKXA 3GRIA 2XSAA 1EC9A 4YLWA 1SFJA 3NJ3A 2EG6A 4I6KA 3GR4A 4O57A 3HTWA 4MB5A 4Q4RA 1XFBA 2VELA 1R8LA 4ZL1A 5FEXA 3O7UA 4NQ1A 3S2JA 3UWEA 3NM3A 3AYRA 4O19A 3SUVA 3WH5A 1AQMA 2C71A 5IDIA 4LRTA 3IRDA 5EL1A 3AC0A 3P62A 4L61A 1OF6A 3VD3A 4A3HA 5E6YA 3GTXA 4YL2A 2OEJA 2EGZA 3NSNA 2PUZA 2V3GA 4X9YA 2BV9A 1TB3A 5FF2A 1HNYA 2QW5A 3B8WA 3ZJ7A 5H1WA 1C90A 1VB9A 4H7ZA 2XISA 5CPMA 2FYMA 3FYPA 3PZVA 5BRBA 3KRSA 1Y8BA 4JQ3A 4FNRA 2XTKA 1SFTA 3MVIA 4NILA 5JBDA 4B15A 2A0NA 2RGLA 3VGDA 3CB8A 3GB6A 2HVNA 3N29A 2CWNA 1E6ZA 3CNYA 4BQ5A 1NOFA 3EKZA 3NSXA 1E72M 4JFVA 3AALA 3SY5A 4A8NA 1AZ2A 1JIBA 1TCMA 3BVJA 2GGJA 4RPQA 2VDGA 2GJXB 4HSNA 3FEQA 1UOZA 2B0MA 3W29A 2WYSA 3GC4A 3GDTA 2QKFA 5IFPA 3L4XA 3AJ7A 3UCDA 4JEQA 3N6HA 5BXRA 4S3BA 3W2KA 6TIMA 5IHSA 3MO4A 4IMDA 1XDJA 3LD5A 2ZTKA 3UCQA 1K6WA 2C15A 2IKIA 4P7QA 4QGCA 4GXMA 4PTXA 1AD1A 4HHPA 3M0VA 3G18A 2H6RA 1W5OA 3LSCA 4HKPA 5CBJA 2YCEA 2VR5A 1HF6A 2DUXA 2VZVA 4KCUA 4B92A 4CVUA 3W1AA 3NO3A 4H8HA 3FDKA 3N9SA 3VMPA 3WQPA 1HX0A 3UETA 4XBJA 1A49A 3BG5A 4EWJA 4LS1A 3N15A 1XINA 1W9DM 1VEPA 1TIWA 4PTNA 4PTWA 1LORA 1YNPA 2X1TA 2AAMA 3AMDA 4EOUA 2WB5A 1TPWA 3IIZA 1E0XA 3OGVA 3G8RA 1OG6A 4X63A 2FZMA 3UW6A 1XCFA 3APYA 5A5WA 2JKEA 2OG9A 4QP0A 3DHPA 1ZBVA 2OMAA 2PE4A 2VVSA 4P2VA 1OVDA 3W7HA 3KOFA 1K8YA 4LWWA 4GQ0A 3QC0A 1EP3A 1B31A 3GXTA 4HPGA 2QPXA 1XR2A 3AHTA 3CL8A 3NQGA 5BZAA 4GACA 3O6YX 4WK9A 2REQB 1EO5A 3ZVHA 3O9NA 2HPIA 1TTPA 4K7YA 1Q8JA 4UTJA 3S8HA 8TIMA 1X38A 1TJPA 5HDRA 4B2DA 1VENA 4NJIA 3SGGA 4N6FA 4XKMA 4TX9A 1Q65A 2QAFA 2UZ9A 2YBVA 1V3KA 2DSWA 2ACQA 4FNPA 4A2RA 2WSKA 4D8AA 1VCGA 3KVKA 2C7FA 1U5VA 1H5YA 1CNVA 4QJ5B 1T40A 2XZ7A 3S6OA 4G1KA 3KTCA 2SFPA 1MNSA 1LG2A 1SZGA 2DUZA 4DJED 4KBXA 1ZS2A 2ALDA 3LZ3A 4AQLA 2F38A 5DLCA 1PHWA 5HR6A 3LLXA 3W87A 4M7TA 2YL6A 3PTDA 1ONXA 1PB0A 3EYPA 4GC3A 1UH2A 4KRTA 1BVZA 1Z69A 3SEPA 4JXCA 4S39A 2GVEA 3IPWA 1BPLB 1VLIA 2DFAA 1TV2A 2DW7A 4HA4A 3O07A 4J2PA 2OT0A 3LHUA 3SECA 1QWGA 1SFLA 2J7CA 3RLUA 1FA2A 2VRKA 1C29A 4Q8PA 1KBIA 1GVOA 3UJSA 2F84A 5IOBA 4QSHA 3FVMA 4W8BA 3RJYA 4GVHA 1MEWA 1M1BA 2INZA 1WZAA 2RJGA 3WEOA 1AL7A 4PSPA 3R94A 5D32A 2ZUMA 1LUCA 5FSDC 1XBYA 3BCDA 1V7AA 1P1MA 4DI9A 3I6TA 3L4WA 5CAKA 3WENA 4HU8A 1UUQA 2NX3A 4GNVA 5BU6A 2PURA 3CQ0A 4DHGA 5CAHA 1KD0A 4S2BA 3UYCA 5FF3A 4G7FA 3TYZA 1TUXA 5HWMA 4I7UA 4S38A 4UUIA 1TCDA 2QV4A 4R5EA 4QJ1A 3WUBA 2XN0A 2VGBA 2YDQA 2TRSA 3KRZA 3KEHA 2V3FA 4MPQA 5LNVA 4UR9A 2GJRA 2J79A 3T7VA 2WOQA 2ISWA 2VUYA 3B8SA 1K9EA 4WIWA 1YNYA 3MY9A 1AH4A 2XIJA 1A4MA 4OJYA 3PG9A 5AC5A 3RXZA 5IXEA 4AD5A