2CLPA

Crystal structure of human aflatoxin b1 aldehyde reductase member 3
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
323
structure length
323
Chain Sequence
b'RPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVAHECPNYFR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
publication title Crystal Structure of Human Aflatoxin B1 Aldehyde Reductase Member 3
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 114
structure length 323
sequence length 323
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2clpA00
4R9OA 2PDGA 1C9WA 3Q67A 3LD5A 1YNPA 3COTA 4GQGA 3NTYA 2IQDA 2BGSA 1S1RA 4XK2A 4WDWA 4FAMA 4JTDA 3CASA 2HVOA 2ISFA 1MI3A 4LBSA 4PRTA 3ONBA 4WRHA 1EL3A 4WDXA 2I17A 4JTRA 4XZHA 2WZTA 4GA8A 4XVEA 4GCAA 2INZA 1PZ1A 5AZ0A 4ASTA 4NKCA 4JQ2A 1RY0A 3GHSA 2FVLA 1XJBA 1XF0A 3BUVA 4L1WA 4F40A 3N6QA 1S2AA 4QXIA 5C7HA 3WCZA 2HE5A 1GVEA 3MC5A 2PDLA 3BURA 3UZYA 2PDYA 1T40A 5AZ1A 1LWIA 1X96A 1IEIA 3GHRA 1FRBA 2HV5A 4IJRA 2FZBA 3R94A 4WDUA 3V0TA 4PRRA 1Q13A 3LQLA 1R38A 4WDTA 4EXBA 3LUTA 4MHBA 3UP8A 2AGTA 3V35A 1VBJA 2DUZA 4YU1A 4LB3A 3V0SA 2DUXA 3UYIA 2PDQA 1JEZA 2PFHA 2IPGA 4JTQA 4H8NA 1OG6A 3V36A 4ZFCA 5LIXX 3UZXA 4XAPA 2IQ0A 2IKJA 4JTAA 4QBXA 1YE6A 4PUUA 4DBWA 5HNTA 2IKIA 1LQAA 3N2TA 1ZGDA 4XO7A 3EB4A 3UFYA 2IPJA 2PDJA 3CV7A 4IGSA 3CAQA 1XGDA 2PDMA 1HQTA 4XZIA 3UZZA 3UGRA 1QWKA 3WBYA 2IKHA 2WZMA 5HNUA 5LIWX 4QX4A 3VXGA 2BP1A 3F7JA 2IS7A 2F2KA 3BCJA 4JQAA 1Z9AA 3B3DA 3LZ5A 2P5NA 2IPWA 4XZLX 2F38A 5JH2A 1EKOA 3WBXA 4I5XA 1AH0A 1Z3NA 4JIRA 4LB4A 1PZ0A 2PDWA 1US0A 3S3GA 2PDBA 2PDNA 3M4HA 3R6IA 3WBWA 3FJNA 1YNQA 5LIYX 1RALA 3FX4A 2HEJA 1AZ2A 1Q5MA 4YVPA 3CAVA 3UZWA 4XO6A 4L1XA 1ADSA 4H7CA 5HA7A 1ZUAX 5KETA 4FALA 4LBRA 2PDIA 3R58A 3R8GA 2PDCA 4Q3MA 4DBSA 4QR6A 3C3UA 2ALRA 1A80A 2ACUA 3CMFA 3QKZA 3U2CA 3EAUA 2A79A 2FZ9A 3O3RA 2ACQA 3GHUA 2NVCA 2PDHA 3H7UA 2R24A 4WGHA 3V0UA 1ZSXA 1M9HA 1EXBA 2CLPA 2HVNA 3LBOA 4GIEA 3LEPA 1S2CA 1YE4A 3ONCA 1QRQA 2QXWA 3P2VA 3LNMA 1Z89A 4YS1A 2IPFA 1SM9A 4Q7BA 3DOPA 3LN3A 3T42A 1AZ1A 4LAUA 2J8TA 4XVDA 3G1RA 3LENA 1T41A 4JQ4A 1VP5A 4FA3A 2PZNA 3CV6A 4WEVX 3Q65A 3GUGA 1UR3M 1K8CA 2DV0A 1HW6A 2ACSA 4OTKA 2PDKA 3DN5A 3ERPA 3H7RA 4JIHA 4DBUA 3D3FA 1PWLA 2PDXA 3M64A 4HBKA 4AUBA 2PDUA 2HDJA 3RX2A 4JQ3A 5M2FX 2PF8A 3BV7A 4EXAA 2C91A 1X97A 4XZMX 3R7MA 3GHTA 1AH4A 3UWEA 3H4GA 4JTCA 2FZDA 4IJCA 3RX3A 4YVXA 4JIIX 1AH3A 4GABA 3M0IA 3G5EA 3KRBA 1Z8AA 1EF3A 2PDPA 4DZ5A 2VDGA 4FZIA 4PR4A 2ACRA 1MZRA 3O0KA 2FZ8A 3UG8A 3LQGA 3R43A 2INEA 2PEVA 1IHIA 4PUWA 5JH1A 4XZNX 2PD9A 1AFSA 4G5DA 2PDFA 1J96A 4JQ1A 4YVVA 3RX4A 1MRQA 2NVDA 1PYFA 1ZQ5A 2IKGA 2R9RA 5DANA 3EB3A 5LIKX 5LIUX 4GACA 2HE8A 1RY8A 3LZ3A 2I16A 1S1PA 2PD5A 4RPQA 3MB9A 4LAZA 4ICCX 1PWMA 4GQ0A 3WG6A 2BGQA 1X98A 2FGBA 4HMNA 3R8HA 4PMJA
chains in the Genus database with same CATH superfamily
2NWSA 3C6CA 3RPMA 4GXMA 2VOMA 3CZGA 4P8XA 3WKZA 2BS9A 1FOBA 2FLIA 3M0ZA 3NQCA 2DT2A 1UQYA 4Q8PA 2CHNA 2DH3A 4JHOA 3LTPA 1ME9A 1S1RA 5A8NA 4GQBA 1S5MA 4KPLA 1JCLA 2WO5A 4LNYA 5DMNA 4MKSA 2GUBA 3CIVA 1MI3A 1JNDA 1NF7A 4J3UA 3FXYA 3GC2A 4PRTA 5FJPA 3KEHA 1OBAA 1T8XA 3QJAA 1TTIA 2QJHA 2VEKA 3FFSA 3C52A 3ZVIA 5CGMA 3NEVA 3NZRA 3VIIA 3T05A 2Z1VA 4E5TA 1W3LA 4GCAA 4DWSC 4HVXA 4PTVA 4KCTA 1XLLA 4MDPA 1CECA 4XBJA 1HG3A 5DBTA 3BLPX 1VHCA 3CV2A 3WJZA 2G3FA 2TRSA 3ARQA 1FCQA 4F79A 4ZR8A 1DJQA 4AWEA 2P53A 3EPMA 3VKJA 1ICSA 2WWCA 3UR5A 3FY1A 3QZAA 2I5QA 3KUMA 1E70M 2C19A 4FX7A 1HL8A 3DIPA 1A5KC 1RUSA 3UPWA 5IM51 1LOQA 3GDTA 5I23A 3VABA 1IEIA 4OU1A 4XTDA 4Q4PA 3QF0A 3IIOA 2POTA 3SAZA 2Z6JA 2ZXQA 1RVKA 4UFHA 3QTGA 4GG9A 5JBFA 2GK1B 3PTQA 4MKVA 1FWIC 3PN8A 1AD1A 3CK5A 1CX9A 3NM3A 4S23A 1TPH1 3GZAA 3H7VA 5FF3A 1P0BA 2NV1A 2X1TA 1WDRA 3W7IA 3W81A 2VGGA 2DZXA 4FLOA 1ZPTA 3R0DA 3GQYA 2PGFA 5D32A 2E5CA 1MMFA 1SR0A 3CUJA 1VPQA 2BASA 1SZEA 2ZBTA 3DG6A 5CPLA 2BMBA 3UFYA 3TN4A 4AZ7A 2EG6A 4GX8A 3V4BA 6TAAA 1QNQA 1IZJA 4EWJA 2RJHA 2NQZA 4Z2JA 1WDPA 2OB3A 3P6LA 4Z1DA 4XZIA 4AEFA 4X9SA 3AS1A 2YL5A 2V0TA 2IMRA 1JIBA 4CQBA 5HR6A 3I65A 5A2BA 4ERGA 2C1IA 4Q8UA 4EPEC 2WB5A 3QMRA 4R7JA 1BKHA 2AMGA 4JTFA 3CZEA 4M3PA 3U3HA 4DRSA 4P7LA 4ZO6A 1NFPA 4CD4A 1DIOA 5EYWA 2XHYA 1Q3NA 1LL4A 1AQMA 4QJ1A 4I5XA 1AH0A 4LJ3A 4EANA 1YDOA 2OU4A 2BOGX 1E1EA 2VUYA 3PJWA 2UY3A 5CPNA 2XISA 4PCSA 3I7RA 3V1PA 1JFXA 3N4EA 4Y8EA 1RJRA 3MS8A 1TQXA 2YSWA 4X9YA 3PJTA 1XLJA 4C7DA 3THAA 1KFJA 2INFA 2BVWA 4B5VA 1GK8A 2A3BA 4AIEA 5I77A 3AUOA 3R0UA 2FB2A 1SJAA 2PCQA 3BMWA 3UT0A 4DBSA 6ENLA 4YTQA 4BI7A 3GKAA 2G8ZA 3CMFA 2VC5A 3THDA 2XIQA 3KM8A 3OG3A 4QDPA 4RX0A 3PANA 2OQYA 5TD4A 1WZLA 5DFAA 2QR6A 4AWTA 3W1TA 2YCKX 2KAUC 2PWHA 4CNOA 2BB0A 3K4DA 4BHYA 3M0JA 3A4AA 3WZ0E 1W5QA 4D71A 1XH2A 3VIJA 2HPMA 1HO1A 4KIEA 3N9RA 3S2MA 4GIEA 4DJED 5C54A 1ENUA 3ISIX 2Y4SA 4WSJA 1WDDA 5B7ZA 4NXSA 3L0NA 2QXWA 4HSHA 4A8RA 1G4TA 3D46A 4A2SA 2V67A 3RK8A 4UQEA 4Z0SA 2QGYA 3SIZA 2D69A 4B15A 3W1UA 2GLKA 3IUDA 1C8XA 1VP5A 2DIKA 1W37A 1J5SA 2PLJA 4DJDD 2G3IA 4HJWA 3NQVA 2R1KA 4D6GA 3KOXA 1KD0A 1IGSA 3BW3A 1TJPA 5KMYA 2ZRZA 5D37A 4D6FA 4J9JA 1K6AA 4B3ZA 5A3HA 1XLAA 4NRRA 3V18A 3W83A 5FL0A 4ACZB 2J8FA 2VDIA 1BXCA 3RX2A 4PA8A 2DW7A 1XLFA 2D23A 1Z32X 1GTEA 2QCGA 4DBEA 1A53A 5A6SA 2GVJA 3GXTA 1W2PA 4XZMX 3AIQA 3B05A 1MZHA 5BMXA 3H4GA 9XIAA 1AJZA 3USZA 1YPXA 4BK9A 2F6KA 3TYDA 1FUYA 2HPIA 3UR2A 4ERAA 1Z8AA 1UPMB 3GDLA 2PDPA 3GW0A 3AALA 2G41A 4RW5A 4C1LA 3NO3A 4XIAA 1ISVA 1F2JA 3VE7A 4A05A 2D2GA 4GUFA 3KZSA 4AWSA 5DLCA 4FF7A 2GPTA 1XBYA 3FXGA 4WJ8A 3DERA 1RA5A 4AZHA 1Z44A 2VGIA 4GI6A 4ZOEA 1W56A 2XIOA 3NQGA 2IUZA 3B9NA 2ZVRA 5LIUX 4L6DA 1TQJA 1G1YA 4OJYA 1R7AA 3BAIA 2BOFX 3MUAA 4BZYA 4Z17A 2OKOA 3THUA 3AHTA 1A5BA 4H9UA 5LA1A 1J2WA 2PP0A 1H7XA 3SCOA 4Q4RA 4F66A 3ARYA 1PTGA 2BGNE 3W70A 3WDIA 1EYEA 2ZA3A 1O5RA 2A5HA 3Q67A 1M5WA 3NTYA 1OX6A 1KXVA 4JY8A 1E4MM 2G0WA 3GRIA 4PMVA 4LV9A 5HWNA 3OBAA 3C0SA 4KFNA 1QI4A 3ZJ7A 1GOWA 1R46A 1ITUA 5CH9A 1VFUA 4XD5A 2VL4A 4CCDA 3T0CA 3PZOA 5HATA 2POZA 1H7OA 1JDCA 2E6YA 3NO1A 3R10A 1UCWA 4TU1A 2ZE0A 4XV0A 1JYWA 1EJSC 4JTEA 1W9DM 2OGJA 1TTJA 1XIFA 5EY5A 2BDQA 4HA1A 5BOOA 4L9XA 4HCHA 2OSWA 1Q2SA 4CKQA 4AQLA 1KNWA 1SFTA 4J40A 1BVNP 4GVHA 3C2VA 4G1KA 2PDLA 4U2ZA 3CLMA 3TJ4A 1ZJAA 1T40A 5AZ1A 1OVDA 1V3HA 3IEBA 5IBXC 3NURA 5D8WA 2QEZA 1X96A 3LI0A 5CEWA 2REQA 3BANA 1XRFA 1KA9F 2ZA2A 4WDUA 3UJFA 1ISZA 1OGGA 4O52A 3L4ZA 3M43A 4JYDA 5D2WA 1AODA 3TTOA 1AG1O 4FR1A 4WZHA 1O6IA 2DVTA 1KXHA 5I5RA 1U5JA 3DFSA 2ZZ3A 1GKPA 1GGOA 2VGFA 3SQSA 3LERA 3REQA 1VQTA 2FJUB 3ABZA 3V36A 1K4GA 2XVLA 2PWEA 2QT3A 1JCMP 5A8MA 2R6OA 1FHLA 2EEXA 3W76A 5A8PA 2NX9A 4WK9A 1LG1A 4UNIA 2A6NA 1SFSA 2WHLA 4P8WA 4PODA 4Z42C 4UCGA 5LA2A 4CNNA 4GC4A 3PBYA 4EIVA 4C90A 3UG4A 3HJEA 1AQ0A 4HYWA 1HP5A 2ZA1A 3TEVA 4XD3A 1OF6A 4B5XA 1Q4WA 4PUMA 1MO0A 4K1WA 1QNRA 4JGDA 4M7TA 1JJKA 2IKHA 4Q8OA 4HU3A 2E5DA 3UCDA 3FEQA 3SJNA 3SGGA 1FFRA 1P1MA 3AI0A 3LS9A 2HJPA 2IS7A 3P8JA 4WXYA 3FA3A 4JL2A 3RN6A 4HPHA 3VOFA 2VMFA 4AVNA 4L6OA 4AAJA 4IIDA 4JTUA 4MTVA 5I6SA 5MKGA 1MXDA 4B3LA 1CLKA 4L6HA 3S83A 3G0XA 2WVVA 1A49A 1PKYA 2B7NA 4FNSA 1XDJA 3R6IA 2WJDA 2YXOA 1EXPA 5LIYX 2FJKA 3TN6A 2HNEA 3TTEA 4V15A 2WW5A 3LPGA 1I9CB 3CXOA 4IG2A 3W1RA 3H4WA 4U2YA 1BQGA 3N18A 4L61A 1FCUA 4NI3A 5DEZA 3I6RA 1F3XA 3GO2A 2WJFA 2PU1A 2PGEA 4Q8TA 1HT6A 4UFJA 4XIMA 4IX0A 5LNVA 3SFWA 3IARA 5T9CE 1GEHA 2CLEA 3GG7A 2GDQA 3PNZA 4L4OA 3U2CA 1UR2A 2HQAA 3SR7A 3AJ7A 5D9PA 4IMDA 4GNVA 1VCFA 4J27A 2YCIX 4WX2A 1UZ1A 3AHXA 4GRSA 4BR1A 4MNMA 5DCDA 1RHCA 5C9XA 3BL3A 3GHUA 4AC1X 1NJJA 4BA0A 2FH8A 3GBDA 4IMGA 3FEMA 4ORIA 3G3DA 2NV9A 1Q45A 3W2UA 3DBPA 1SFLA 5CBJA 4X63A 4DUWA 1ZRQA 4R34A 4U33A 4DJEC 1OFOA 1XLHA 5DMLA 3DOPA 4E2BA 4QTGA 4UMCA 1XH0A 5G1MA 2CPUA 1YDNA 4DZAA 4M1BA 1JAEA 1WXYA 1ONWA 3UG3A 2NX3A 3CMJA 3MUY1 3GUGA 1L6SA 4B5WA 1BTCA 2EJAA 4JIHA 2VX6A 2A3HA 4AZCB 4DJDC 4E4PA 5H8PA 1HGYA 2F84A 3H70A 3FAXA 2O9PA 3ITCA 1FWRA 2ODOA 4XZ9A 3SBFA 4LYKA 1PUDA 1SU5A 3C2FA 2NWRA 4UQAA 4J3VA 1F4AA 1VBUA 1XLKA 7PTDA 4B5TA 5HMSA 1W3TA 1B4EA 1OZMA 2DT0A 2E67A 2Q01A 3WD0A 3WDRA 1SJDA 1KBKA 1VENA 3NVDA 3RX3A 1Z7AA 4ZFMA 1QPNA 3TN5A 1J0JA 3BOXA 4ZSUA 4GQRA 4BY3A 1CZ1A 3PG8A 5GJMA 3GFYA 4GZIA 3EX1A 1US3A 4EKJA 4E0CA 1B9BA 4C7FA 3FGCA 4JL1A 4H7VA 3R0KA 3M0HA 4YTTA 4FB7A 4ZBCA 2O0TA 1J0HA 1SR9A 1MW0A 5D2YA 2XGZA 4E2DA 2KZHA 4YVVA 4CN6A 4UR9A 1BGAA 1ICPA 3ZWSA 3E1F1 3MU7A 1JD7A 1FCVA 4TVDA 4A2RA 2R9RA 2D2HA 4RXFA 4N42A 3PULA 3HPSA 1HJXA 4HN8A 1GZGA 2G3JA 3HOJA 2I16A 1CT5A 2PTDA 3PUDA 2OZTA 3MW7A 1ECQA 3AMCA 3TQVA 1JG9A 3ARPA 1LWJA 3IJLA 5JQ9A 3PJXA 3STFA 2X41A 1W9VA 1GJWA 4DO4A 3LCLA 1R3TA 3KAOA 3W1XA 2ZC8A 3KP1A 3ATZA 3ICJA 4NJHA 1J0YA 1UB3A 1EWEA 4GFSA 3EOOA 3LOTA 2OG9A 1I2OA 1KLZA 4U5IA 2ZYFA 3E2VA 6CGTA 1J12A 3BGAA 2NV2A 3ZT7A 4EPKA 5FJTA 1EL3A 3NYZA 4J2PA 3WJSA 3NPWA 1I1WA 3WELA 4JTKA 2QUMA 4IXXA 5AYXA 4OIFA 2XWDA 1LLWA 3R2GA 2Z1BA 1D8WA 1HXJA 1QVBA 3IVUA 3WL0A 3N73A 2EPHA 2PWUA 1IGWA 2GK1A 4IIEA 2DSVA 2GFTA 4JHMA 4Q7IA 3F1QA 4Y9AA 1E9IA 4E2OA 3QR0A 4MZ1A 4L1WA 3L23A 3H55A 4GKLA 3P84A 1GOIA 3W26A 5IXEA 1FWBC 3TTSA 4WXZA 3P14A 3CYVA 3TR2A 3L4XA 2ZZ5A 2UY4A 2ZX5A 3H26A 3ZR6A 1S2VA 3O16A 4URIA 4O17A 1RBAA 3OYZA 3G1XA 1HL9A 3AOFA 1XFBA 3KP0A 1AQHA 4PUDA 3VO0A 4JFUA 4GPNA 2UY2A 4JDYA 2DUZA 4WY0B 1VKFA 4H8UA 1B30A 3IPWA 4DUOA 4Z1CA 1JEZA 5E9XA 2VQUA 3M44A 3PTKA 1Y7VA 1DXIA 3N3MA 1TX2A 1OG6A 3HMCA 4BI5A 3TXVA 3BG3A 3VD7A 2JK2A 1LWHA 3B03A 4MSSA 3U4AA 4GHRA 4K36A 2YLAA 1SZNA 1VYSX 5D9OA 3HPZA 4E3TA 1DP0A 2X40A 2ZICA 3AQUA 2E6DA 1EZWA 1XGDA 1XIDA 3CPUA 3DFNA 5DX7A 3PZGA 4H9TA 1A5SA 1ECEA 1V4YA 1V7YA 2XIBA 3UR7A 5K4ZA 2DQXA 3R11A 3RU8X 4C6KA 2DQWA 4D8LA 1ZENA 1JUKA 3OOQA 1GG0A 5LIWX 3BG9A 3WK2A 3O1NA 3OEXA 2BP1A 2C3ZA 3HIJA 4P8UA 3L4WA 3PR2A 4HPNA 1UR1A 3PHAA 3ABQA 2XTKA 4AMCA 1V5XA 4HU4A 3WBXA 1EDGA 3WLTA 1TIWA 3W75A 3QR1A 1V08A 4R9XA 3FHQA 1UR0A 5AHIA 1V03A 4ERIA 2AQWA 1HIZA 2PDNA 4DPQA 1BXNA 5C70A 1CLVA 1EJTC 1YHTA 3ARRA 3HPXA 5GNZA 1G0CA 1V0NA 2PLCA 2ZZ4A 1L2UA 3WQOA 4KRZA 3CZJA 4KEUA 4H7CA 1SZGA 3M7WA 3HGRA 5HA7A 4HCLA 3QYSA 4HQVA 4ZENA 1DQXA 1HKVA 3R58A 4E3VA 4RZ5A 4PCFA 5AYIA 4PTWA 2I5IA 4AY7A 4QNWA 3UQNA 1MQQA 4HT3A 3QV7A 1THFD 3PBUA 3FVDA 3QGKC 4B3KA 1HTIA 4FO4A 1VFFA 2RDWA 4BI6A 4O10A 3QZ6A 3K4AA 4HU0A 4U3AA 3BW2A 3O3RA 4CEUC 2X09A 3IUIA 1S2UA 2CWXA 3V0UA 1N2VA 5AC7A 4TVCA 4ACZA 1V6WA 4F3HA 1TV5A 1WKYA 3U9IA 1O68A 2J62A 3W84A 4E8DA 2QJMA 3MZNA 1Q6RA 5CGTA 3TX9A 1OG0A 2IPFA 1SM9A 2VVNA 2OEMA 4M6QA 1XCFA 2JQXA 3WLOA 3VD3A 4H9XA 2VD9A 2DZBA 2HMCA 1CGXA 4IGNA 3UWZA 1KKRA 1EBGA 3OZMA 4RV8A 3LGEA 4FK9A 3POHA 4E6MA 1KTNA 2IW0A 3IJ7A 2RAGA 5C55A 5DMMA 1QR7A 4DWSB 1QWGA 5EGRA 1UBSA 2VWSA 1XW8A 1MW3A 1V0KA 3VIKA 3STGA 3IGHX 3ZJKA 5TAOA 3ITYA 5F2MA 1TJRA 1UR9A 4M51A 4A3YA 2Z1KA 2PLMA 3CNYA 4GUHA 4XBSA 1R85A 5LNUA 2YXXA 1UH3A 5HWJA 1H0GA 4GABA 4MAZA 1H51A 2GQ9A 3A3HA 3P8IA 4IGMA 3U8GA 1FX6A 3NPXA 1XGEA 3JZUA 1E3XA 3G5EA 1U1UA 4NHVA 1DJHA 2VDGA 1B3XA 2FIQA 2YFNA 3OBEA 4TIMA 3O0KA 1XD1A 1RCOB 1EJWC 2UZ9A 3I3EA 3MDUA 4ZA0A 2HRWA 2PD9A 2WSPA 5D2TA 4PMYA 4LOCA 2FHFA 2AL1A 1PYFA 1KCKA 4J7RA 1ZQ5A 3SCTA 4AZBA 1JCYA 3KTCA 2V3GA 2G4FA 5AKQA 2WC7A 3VDBA 5HQEA 2J78A 4N9EA 5E6ZA 5LNSA 2MANA 5C9UA 5CZSA 4QROA 2DH2A 4DF0A 3QGAC 2Z2BA 2VURA 1XIJA 2YW4A 4LUIA 4I90A 1AW5A 1WV2A 5AHEA 3M5XA 1QNOA 3L2LA 4XKMA 4MWAD 4IP4A 3TTQA 1ODZA 5BROA 4GQ0A 5M5DA 2Q3OA 3S9YA 2CLFA 1PS9A 3PK7A 2ANUA 2ZXDA 4NAEB 2NW0A 2NVAA 2ZX7A 5LNWA 3S47A 1GVOA 5DRIA 4AIBA 3M07A 1LF1A 1QPKA 3CHEA 3BSMA 3N2CA 4F9DA 4XBKA 5B7YA 3CAWA 4S2BA 5F4XA 4WDWA 1OYCA 2W6RA 5BYWA 3WQGA 3QW3A 1EIBA 2HVOA 3E0FA 4I7VA 3GX9A 1NWRA 2PP3A 3VNMA 3T2PA 4GINA 3LRKA 1T8QA 3GTXA 3TQ0A 1YKWA 5KZ6A 4UZSA 1PEZA 2J27A 4F48A 1KO0A 4Y90A 1NDWA 3S2JA 3VGHA 2GJLA 4AF0B 3CIWA 1WPCA 4N9CA 1D9EA 1C9DA 2R82A 5DCBA 2A0NA 5EL1A 3SSJA 3QYQA 4B5SA 4V27A 5DCEA 3UA4A 4HHPA 1QU4A 1IT0A 2W4XA 2V5BA 5C7HA 3WF2A 4CVUA 2Z29A 3VD4A 2X2GA 3GBEA 3EWXA 4RUBA 2J7FA 3BMVA 3O07A 2CZ5A 1XC6A 4XX6A 4HSOA 1WZMA 2IQTA 1UW9A 2HTMA 4E2VA 2JGQA 5CLWA 1BQCA 2FZBA 3WDJA 1F6PA 3R25A 3GNDA 3RLGA 1R2SA 2H90A 3MV01 1TELA 2WC3A 3SCQA 3GIQA 2V8ZA 1W0MA 4P7QA 5BWAA 1OC6A 2W91A 2AL2B 3M0YA 3TUUA 1EO5A 3UPMA 4EOUA 3NOYA 2BVYA 3KL5A 3T9PA 4LUSA 1ISYA 5LIXX 1Q2RA 5AB3A 2EAWA 1NDYA 4M5PA 4PYSA 1HL2A 3N13A 1LOSA 4MF4A 2AQVA 1BHGA 1VJSA 1PSCA 3WQ8A 4H9ZA 1CXLA 1TPB1 2YDRA 2J7BA 4PMXA 5CJNA 1PX3A 1X39A 3Q37A 3T07A 1DJNA 2XSXA 1KM2A 3FV9A 4FXFA 1Q7MA 2VEIA 6TIMA 1GKQA 3QOKA 1KM5A 1HQTA 1QWKA 1WO2A 3PJUA 1B90A 1AJ0A 5HPOA 1TTPA 3A6OA 3SUVA 2C1GA 3K1DA 1KQZA 3ARZA 1QNSA 3NAVA 4DLFA 5KEZA 2J79A 3W7QA 4RPPA 3SCWA 3ZMRA 4ADTA 1HKWA 1QI2A 4KGJA 3SN0A 3BV4A 2E6FA 3MMUA 4PCPA 4Y96A 4ML9A 1HN1A 5JMUA 3W28A 2W66A 4F2BA 3AU6A 1ZCCA 1LLZA 3M4HA 3AHZA 2WLZA 3HV8A 1ZAHA 3EB2A 4DLMA 1FKWA 1SZRA 3UYCA 3DKLA 2CESA 1WZKA 1F5ZA 3RAOA 1DWJM 2WMJA 4AW7A 4CNPA 4C6EA 4JTTA 5A6BD 1JD9A 1VFSA 4RDYA 4I6KA 3CWNA 1ZZMA 5ABGA 3F2DA 2ADAA 1R9YA 3ZFHA 2HZGA 1ME8A 1A5UA 4OVXA 3WL1A 2TMDA 2WQDA 3TCEA 4Q3MA 2G5WA 1E0WA 1CXKA 1C93A 1DWHM 1DBTA 4I7UA 3ANUA 1RJPA 4IJBA 2D2OA 2NLIA 2WC4A 3WF1A 2EG8A 2CWNA 4AZCA 7ODCA 1H2JA 4UNKA 1ZSXA 2YCJA 3WLRA 3TWBA 3HQOA 4HK5A 2VI0A 7CGTA 4KT2A 1QRQA 4Z2KA 1EEXA 4AX7A 1JNEA 3PS7A 2B0MA 1I0DA 4W88A 3V1HA 4NASA 1PB0A 1T96A 3T42A 2D20A 1RVGA 3SN1A 1JF6A 3G1RA 1R5YA 4DAIA 1KKOA 3HFTA 4OOUA 4DPPA 3H54A 4WEVX 4PTXA 5A6AA 3O06A 1DXFA 3AMGA 4ATLA 2GWNA 4ZB5A 5A6JA 2IXUA 3RITA 3VCNA 2VZVA 4AY1A 3VOGA 2EF9A 4D2JA 2QDDA 5CZ0A 1MUCA 4RW3A 4GE8A 4GOAA 4ADSA 2ISDA 3MCNA 3RYSA 2TAAA 3MUIA 1RLDA 4QCFA 1CTNA 1Q6EA 8XIMA 2PF8A 1TPC1 4JNYA 5D03A 3L4TA 1V02A 3BV7A 3GDMA 2W92A 3U2ZA 4C60A 4F2TA 1POJA 4KWWA 1M03A 1YTEA 3R7MA 5PTDA 1OFDA 4JX5A 1AH4A 5F2GA 3A9BA 4JNZA 4ATDA 1HNYA 2YYUA 3W7LA 1R9XA 4YHGA 3H2EA 3M0IA 3NOEA 3QEZA 2NQJA 1EF3A 2ZUMA 1TSIA 3F5LA 4OECA 2QZRA 3VM7A 5MF5A 1MZRA 1K6WA 3P3BA 2YFOA 3IGSA 1SJBA 3L2IA 4A8NA 1W3KA 5JH1A 1XYAA 2ZXBA 2PDFA 3L65A 3QGVA 4FF5A 4UCFA 1E3ZA 4A3RA 3VC5A 1FA2A 3TA9A 1ZBVA 3KBWA 4O53A 3RFAA 3P80A 1IWBA 1R0MA 5F4SA 1VBHA 2V6AA 3HGSA 3STEA 3BSGA 2A7NA 3MANA 4H9VA 3KCOA 2HE8A 2WBKA 1GQKA 3KL3A 4U31A 3FAWA 2HK0A 2FH6A 2YPIA 4X2RA 4MB5A 1B57A 3FVMA 1E6SM 3T0TA 2ZCGA 3DCPA 3GZ3A 1A4LA 4US5A 4HMNA 3NQEA 4MWAC 3QW4B 4PL2A 2L5HA 2VZTA 1UWRA 5ECVA 3S1XA 4HZMA 1EFZA 2XJ7A 2ZX6A 1NAL1 4H01A 2Y62A 1Q8AA 5AHMA 3L21A 4YYFA 4FX8A 4XK2A 5E09A 3PBWA 3CASA 3FSTA 1YX1A 1QATA 2ISFA 1N55A 5D9MA 3K13A 1FWSA 3CU2A 3RCMA 1A0DA 3FLUA 1XH1A 1IR2A 1GVIA 2P8CA 2XH2A 2X0SA 4N6EA 4IQLA 4XSLA 3TIMA 3MCMA 1X8CA 3MKVA 1LRTA 1J93A 4MOZA 2MUCA 1WCGA 1PCWA 1UKSA 2V9DA 1NIUA 5D9NA 4WY0A 2PF0A 3E49A 1W32A 4GFIA 1QDSA 1AMKA 4JAWA 2E9LA 1AJ2A 1XF0A 2I5GA 2XVGA 4DI8A 1S39A 4JEJA 3JRKA 1RPXA 4PB3A 3W82A 2OELA 3ELFA 4GI8A 5K4XA 3SRHA 4B5UA 1B1YA 1A0CA 2OKTA 4KWVA 5EMYA 4Q32A 1GW1A 4XUYA 1EQPA 3B8DA 1GWJA 4Q8QA 3W7RA 2XUCA 1XLBA 4LUTB 3GHRA 2HV5A 3WNPA 1SVDA 3WQEA 4UQDA 5AHNA 3GG1A 2OPJA 4PRRA 1R38A 2BWGA 4POCA 2C14A 4RNHA 1S5TA 3S6OA 1RQEA 1E0VA 2WNWA 3C2YA 2RDUA 4N6FA 4AEOA 1REQB 1J18A 5ENLA 1T99A 1S46A 4KWSA 3IJIA 2UBPC 2VCAA 1EC9A 1W9XA 3A12A 3R1ZA 1XHGA 2PAJA 3FW6A 1H50A 4DBWA 4MM1A 1NVMA 1PX4A 3SRKA 4Z2GA 5RUBA 4YMZA 4JFWA 1S2WA 2Y7EA 5I78A 1AW1A 4PC8A 1BWVA 3URNA 1LBLA 2QMJA 3CAQA 4DQWA 1EP1A 4Y7EA 1VRXA 4O0ZA 3P5YA 4GI4A 5CAKA 4EPBC 1EWDA 3GDRA 2WBGA 4UTTC 3WQ4A 2YJQA 3QV9A 4HA3A 4L9YA 3E96A 4FR6A 3NG3A 3NWRA 5T91A 4K8HA 5A69A 1ZS2A 3NGJA 4QIUA 4DF1A 1TG7A 1TPVA 3TKFA 4DXXA 1O4UA 4HTBA 4FI4A 5HMDA 1F3EA 4CN4A 1JPMA 1TJ2A 2PSNA 3RCNA 5AC4A 3NSXA 1VJIA 1JZ6A 3E2RA 2E68A 3G1VA 2Z1SA 4NJGA 1CIUA 4PFHA 3WLPA 5IOBA 3W7GA 2A85A 4ZEPA 4JTIA 5HDRA 3CAVA 4L1XA 3QN3A 3WH9A 3SCVA 1QHZA 1BSLA 4IPNB 3DU0A 3TYZA 3O6CA 3F5JA 3KW3A 1BWLA 3GYCA 1RV8A 1NH6A 2QCEA 3DKJA 4R3UA 3LCIA 1DIKA 1I2PA 5K2ZA 2YB1A 1A5LC 1EH9A 3HM7A 3MWCA 1PX8A 1FY6A 4QHRA 1LUCB 3BQ5A 3ES8A 4DWSA 1OD8A 3NM1A 3EX3A 3ARXA 4CGTA 4S3AA 4H6EA 1PIGA 1HZYA 1E73M 3B4UA 2DZPA 3FKRA 4NAFB 4V28A 3NDZA 3LHVA 2X30A 1I0BA 2OVLA 2JBMA 4CCCA 1DL3A 1X7FA 2VEMA 3C2RA 5A6MA 1OC5A 4NILA 3T1GA 4S3EA 3AXIA 1O1ZA 3ENLA 3W2JA 4QRNA 3S2LA 1UR8A 3WQ6A 2DSWA 4KERA 3ME3A 2QULA 3VZZA 3M6YA 3VTRA 2XGBA 3BDKA 1G7UA 1PVNA 1YIXA 2Q02A 4HBKA 1XX1A 4IMEA 1KM6A 2BBFA 4JQ3A 1KBIA 5BRQA 4CQCA 4GZ7A 4JEQA 3PZMA 3AIUA 2HXUA 2JF6A 4P7NA 4RDWA 3QTPA 1OSEA 1TPWA 1MNSA 4QM1A 4KRUA 2JALA 4A29A 1XWYA 1SO4A 1YLVA 3CUFA 1C7SA 2E7FA 1Q7ZA 3WLNA 3LU2A 1GQJA 1K9EA 2WZIA 1IWAA 3ARWA 3FCPA 2RFGA 1QMLA 2J7DA 2PEVA 1KBLA 2V69A 1IXNA 1R2RA 1V3JA 4LS2A 2WHMA 4HMDA 1TA3B 1UJPA 4NAEA 1I4NA 3CB8A 1PKLA 3A4WA 5T9BG 3RX4A 3POCA 5H8UA 4Z08A 3U0HA 1FXQA 2WSQA 3GWQA 1ONEA 1YDYA 4D6HA 1TV4A 4LY8A 4YYCA 2ZADA 3H2OA 1K70A 5C2GA 1HVQA 4DEFA 4A4AA 3CGTA 4JFSA 1Y65A 1WZAA 2WMIB 4GACA 1I6NA 1IXPA 1XUZA 3C4UA 3WLJA 1UG6A 2X7VA 4CQ8A 4LFYA 3B8VA 4MPKA 1D3HA 3GY1A 1JQVA 5LSMA 3KHDA 1VYPX 3OYXA 1ZY9A 4AF0A 4W93A 3VOJA 4R9OA 5FA5A 3W71A 2D3NA 3BW4A 3W22A 3ATYA 3MKKA 3AXMA 5LA0A 2E25A 3NSNA 4NJIA 4CNTA 4O1EA 1BWKA 4EXQA 1VHNA 1GQNA 1M1BA 3F4NA 4LBSA 4RNJA 3ONBA 4K6AA 1FWCC 1V3MA 3KWSA 3EWZA 4GA8A 4IMFA 3ITXA 2W27A 1W1VA 3WD1A 2AKZA 2VTFA 1BAGA 1DVJA 3I6TA 4DZIA 1EDTA 5AZ0A 5HK4A 2A3CA 4NKCA 5KINA 3MBDA 2AAAA 1AA1B 2AL2A 2W5FA 3WJYA 4KW2A 1H11A 3BUVA 2PUZA 1EJUC 3PUOA 1S2AA 4Q4OA 3MQTA 3SRFA 2NUYA 1EGZA 1EJVC 1XINA 3P5ZA 3BURA 1GHRA 1Q6QA 1WP6A 2EJ1A 2WYSA 3MYPA 3MI6A 3ZT5A 3MHUA 1TCDA 4LCSA 3MDWA 3E5BA 1XV8A 4AZGA 3LTSA 1UJQA 3E6EA 4MHBA 5I06A 1NF0A 2D2JA 1Y5WA 2DUXA 3M47A 4FXJA 3VIHA 4C6OA 3FJ4A 3N12A 2D73A 3OJGA 1CXIA 5EPDA 3TNBA 4ZFCA 1R9ZA 4O19A 1DORA 4AXKA 2QIIA 3GUWA 3S2NA 1IT7A 5A95A 2XVPA 4U3CA 1BLIA 3B9DA 4PMZA 4GYPC 4LY4A 4FXSA 5CBIA 4P7OA 4R33A 3RR1A 2EKCA 4CCZA 4IP7A 3ANYA 1FWWA 2BXYA 4R85A 1L8NA 5KTLA 3N9KA 4IWWA 2E9MA 4AHQA 2F7FA 1XXXA 2P50A 1OX4B 3N2MA 2WMKA 5CKSA 4CQ9A 4DUVA 4GC3A 1ODUA 3GR4A 2CLOA 3UXLA 2RH9A 4MFDA 1TMQA 1NSJA 1KRAC 4GUIA 1PHQA 1LJYA 1W2VA 3U57A 1SZFA 1RCQA 5XIAA 3CHDA 1PZ0A 4WIWA 3NJ3A 2ISSA 5JIWA 3KTXA 3PF3A 1IIGA 1A5NC 5G1YA 3LCXA 3DYMA 5CJ5A 1FHUA 2Y88A 4JYFA 4MUPA 2QHAA 2C18A 1ONRA 1GONA 5HUPA 5HJYA 4MFEA 3UY8A 3AHYA 1V93A 2VX7A 3G8EA 5BU9A 3QQ0A 5A8QA 1H49A 4FMVA 2YZ5A 5DN1A 1Q6FA 4CEXC 1VFOA 2YBTA 4GXPA 3C3UA 3N3TA 4P61A 3PZ9A 4A6GA 4M24A 2DIJA 9RUBA 1VGAA 4P8VA 4CD5A 4QSFA 1A3XA 2ACQA 1OF8A 2O9TA 3N1AA 1M7JA 4WGHA 1PJ9A 2PODA 5HULA 3NL6A 2CC0A 1Q63A 1K9TA 1EOMA 5D09A 1R30A 2C79A 1W1B1 3TYEA 2VCCA 2WM1A 1Z89A 2OQHA 2RKXA 4GNJA 2RUSA 4FNUA 4O1CA 1AZ1A 2ZRWA 3W7CA 3RU6A 3NDYA 2YBUA 1R6WA 4EK7A 2VGBA 1OFBA 2PWGA 2XM1A 3T2QA 4XD4A 5REQB 2RGLA 5FJOA 3ZLHA 3CUXA 4ZXLA 1UR3M 2DT3A 5AN7A 4UTIA 1O1HA 5IBXA 3IV8A 1TB3A 1PDYA 5T26A 4BF9A 1UZ4A 1PWLA 3CLWA 2VEPA 2PDXA 2QV5A 2BVTA 2Y89A 3N15A 3HTWA 4TXEA 4UMAA 3EXSA 4NNAA 1U1JA 4ZE4A 1GPFA 3T4CA 4AHPA 1OINA 2R1LA 1VLIA 1LCOA 2J8GA 1X1OA 3WFLA 2OOGA 3AZSA 3S5YA 3SCRA 3UD6A 1QFEA 3WQWA 5JU6A 4JIIX 1CGVA 3GFZA 3WDQA 4OBTA 1UP2A 3QQWA 3QHMA 3M46A 4QAWA 3KRBA 3LLXA 1H3GA 4PL1A 3VD9A 1DKWA 3VMOA 4PR4A 2V81A 2VWTA 1I75A 1GOKA 2YL9A 3IVTA 3CJPA 2GYIA 4AD2A 2E1DA 3W2NA 1IYXA 4QDMA 2CW6A 5BW6A 3GNOA 2FHCA 4KWUA 3G1YA 1RPKA 1OHLA 3ZQ9A 3TDFA 4JHZA 4LF1A 1NY1A 3T6CA 4ROQA 1OYBA 4QNEA 3HA1A 2ZX9A 4ILSA 2AOSA 4Z2HA 2YA0A 2O92A 5BRPA 4GCXA 4NZ1A 3AIWA 3M9YA 1PWMA 3EX2A 3ZLGA 4GY7A 1J0ZA 2AQOA 2ZRXA 3UG5A 4J3TA 3I4KA 4Q8NA 1QK2A 2PDGA 3ALGA 4O18A 1GT8A 4G7FA 3NQBA 4HNTA 3K8LA 3COTA 3A4XA 4UFKA 1SPQA 5LXEA 3DFTA 3CHVA 4GIYA 3RILA 1K8XA 3LHYA 3KVMA 8CGTA 2XH4A 3CEUA 4MKNA 1XLIA 1U5VA 4LUJA 4A21A 3W3OA 1UP0A 2I17A 1KCLA 4DWDA 4ECLA 2JIWA 3N19B 4I6VA 4LUTA 4N9DA 3NQ7A 1VFTA 4X3ZA 4AXNA 4V1XA 2WK2A 2FDSA 3TOYA 4Z1YA 2QCCA 2PRHA 4WUIA 3W7OA 2VR2A 4JQ2A 4U10A 1CEOA 1TWSA 5FSEC 1ZBKA 2QCMA 2JEPA 1RY0A 4WJEA 4IFOA 1G6CA 1REQA 2WSRA 3LPOA 3PPCA 3VGDA 3GW3A 3W24A 4IHCA 2OYKA 2GL5A 3HN3A 4DM1A 1GVYA 3GXNA 4DJEA 2DVXA 2PDYA 3WLIA 3ARVA 2R14A 1LWIA 1T5AA 5FF4A 5DY3A 1FFQA 4PUJA 4LC6A 4MMWA 1XRVA 4DJDA 1EZ2A 2DDXA 2NXGA 1U5HA 1VEOA 2WANA 2CBVA 1XP3A 5AECA 3LPPA 4O4VA 4G9PA 3IIVA 1G01A 3T08A 3AZRA 1DJWA 3N34A 4ZTYA 1RD5A 4HOXA 4QG6A 7TIMA 2IQ0A 3O6DA 4DHGA 2CETA 1BPLB 5HNTA 3EEZA 1LBMA 2FTYA 4EP8C 5AVNA 2YL6A 4LYRA 3RO8A 1FBAA 1ZGDA 3KBMA 4K7VA 2ZC1A 2QCNA 2GGIA 5BWFA 1WQ5A 2WNQA 3TSDA 4BEUA 3ZR4A 2DT1A 3IRSA 1NOFA 4S3DA 2V2DA 3CZLA 3N14A 3OIXA 2Y7DA 2DY3A 1EIXA 3WBYA 2NXIA 3OLDA 2ZUWA 4QX4A 2CITA 1I1XA 3GB6A 3NIYA 4C6JA 3BCJA 3G1HA 3OVGA 1K8YA 4FP1A 5CPSA 1F6YA 4D1JA 4XTIA 4PMQA 3BLDA 1HKJA 3RLUA 3VGGA 1NELA 2VYOA 1P4CA 1QPOA 3W7KA 4KBXA 5BRBA 1VYRA 3VNKA 1OZQA 5FEPA 1EC7A 5IDIA 2WKJA 1YNQA 3GC5A 2OMAA 4Q7NA 4F0HA 3PTMA 2C1HA 1LUCA 3KLKA 4BQ5A 3UWWA 3I3DA 5LHEA 1FCBA 4NAFA 4CD8A 4YTSA 1ADOA 4HHMA 1W91A 1XIBA 4CNSA 3K1GA 3TYUA 4FXRA 1XYCA 3BWWA 2EPLX 5F1UA 3KCJA 1TJ0A 2Q3RA 2Y5SA 2B4GA 1KGUA 3ABRA 1CPUA 4GNKB 2FKPA 3B04A 3DUGA 1XL9A 4NYUA 3UZJA 1GTHA 4FOKA 2ZTKA 1XD0A 4M6PA 4MJMA 4A3QA 3HPAA 4O1BA 1W3JA 3H7UA 3XIMA 5AHFA 3GVWA 3OHIA 1JF5A 2TODA 4MWAB 2CLPA 3VE9A 4MNJA 3ORWA 1S2CA 3FKKA 4MNKA 3SY5A 1PTAA 1CW2A 3O6AA 4IUGA 2BY1A 2CU0A 1R86A 4Y6GA 4LNCA 5M3WA 3KDNA 1W31A 2BOEX 4XAYA 2NQ5A 3WQFA 1B5TA 4Y9PA 1R8LA 2Z25A 3DYPA 2DV0A 2QS8A 2Y24A 3QXBA 4OTKA 9XIMA 2YCLB 2PDKA 2I56A 4FNRA 2CNCA 3BE7A 2HCVA 4DBUA 3ZZ1A 3M1ZA 4IIHA 3S1GA 4ROPA 2ZUUA 3C0JA 2ONEA 2FPYA 4RZBA 1JRCA 1TA3A 1LG2A 1QPQA 4QJ4B 4NZFA 2VT0A 1UKOA 3PNUA 2ON3A 2DORA 1P1XA 3ARTA 1WAWA 4G6CA 5G5IA 3MZ2A 3GTHA 3VX0A 3RM9A 4IJCA 4H9MA 4B16A 1WUFA 1JR1A 3EWBX 2G97A 2WMIA 1UP3A 3FA4A 1K9FA 3W07A 1E71M 3THQA 3O63A 2BG5A 2YLLA 3WQPA 1QJWA 3B06A 5EBUA 5G2WA 3N4AA 2PP1A 4Y2WA 3VKBA 3BPWA 3W1QA 1LZOA 4F0LA 1CNVA 4RE2A 2YDSA 2NT1A 4QGCA 4NI8A 3NVTA 3APYA 4H6RA 3MUXA 4JTJA 5DXXA 1GOOA 4JTLA 4LT9A 4WJXA 3T0AA 3DHPA 3V16A 3SEPA 2ZIDA 5D38A 2EPMX 5FCZA 4AISA 3GK0A 3NQAA 1XIIA 4IX2A 2XH7A 2ZVIA 2Y0FA 1S5NA 3KVKA 4YIWA 2HWGA 4GIRA 3WK3A 3NQMA 2QUVA 4Q4QA 2WKLA 4LAZA 2Y1HA 4X22A 3CYJA 1P0EA 1DTNA 4LTSA 3U7BA 2PWVA 3W25A 2WCGA 4QISA 4G7EB 3WH5A 5HAOA 2W0UA 3PBMA 2XSAA 2P76A 1ONXA 3RDKA 1XLCA 3WFAA 4I8YA 3RNDA 2OO6A 3L12A 2Q8ZA 1PKMA 1WDQA 3R79A 3U5UA 2DIEA 5HPCA 4OGZA 1DIDA 5I0DA 1FWTA 2P3EA 5LYRA 3DHFA 4JTRA 2FPVA 5BXPA 1HKKA 1QOPA 4PB4A 3SGZA 2WZTA 1FWHC 1VIZA 1GKRA 5HUOA 4XVEA 1MYRA 2O55A 5TF0A 4ASTA 4GVGA 3DFOA 1V3KA 3DH7A 1HP4A 1UD3A 2Z00A 4XZWA 1X6LA 1YBQB 4CU8A 4X60A 4JTSA 3W85A 3QPYA 4PUKA 4I5UA 4JN7A 1OCBA 2QJJA 3FJ6A 4U5KA 3OLGA 1QHPA 4UZUA 3GC4A 2J6VA 1IEXA 2H8XA 1CWYA 2YDAA 3UESA 4O0QA 5E5CA 1DHKA 1GNXA 3P60A 2VOTA 2ZRYA 3ZSSA 1H60A 1F73A 4AZ6A 3VGEA 3P7YA 3SUSA 3LUTA 1TKKA 4I8DA 5C5YA 2GOUA 3UETA 1WUEA 2VVSA 3N11A 1P6BA 1YTKA 2J88A 3LV6A 3V0SA 1ISWA 2E40A 4PTDA 1GOMA 4FX6M 3KTSA 1OX4A 1TVLA 5BXTA 3GIPA 3UNDA 2VX5A 3KBSA 3MMDA 2PZ0A 4IIBA 4MUZA 4WR3A 1EB3A 2HK1A 1ZBCA 2IKJA 1FTXA 4JTAA 2Y63A 4J28A 4PUUA 4S3GA 5T8GA 1XPGA 3DI1A 3EDDA 3G0UA 3N2TA 3QY8A 3RJYA 3P82A 2CXEA 5FAGA 3DHUA 4XO7A 3KOZA 2PDJA 1W9PA 1UZHA 1WBJA 3S6DA 3CV7A 2WCAA 2FGZA 3T44A 1A3HA 2AAMA 3AYVA 2IXVA 4JIEA 4J4KA 1UH4A 3MMWA 3UGRA 1W5MA 4ZGYA 3EKGA 2F6XA 2WZMA 2QIWA 4JR5A 3QHOA 1SQ7A 3FSUA 4C6QA 3GXFA 1QI3A 2F2KA 4MB1A 3B3DA 3BOFA 3F4DA 3BJTA 5BMWA 3G22A 1XLMA 3VFCA 2IPWA 4MVAA 1FH7A 3CTTA 2YBVA 3CIXA 4XISA 2X1RA 3HF3A 1OB0A 3APTA 1YW1A 1OADA 1US0A 2HISA 1J79A 1DWIM 5I3KA 4TOQA 4K8EA 1JYVA 4R27A 3VZXA 5BXRA 1VCGA 4UTHA 5C8BB 5I3JA 4CLMA 3C56A 1L8PA 1XCXA 2OO0A 2BLEA 3N17A 3NZGA 3PZVA 4GY0A 4UR7A 4GYJA 3QM3A 3U7VA 3GNXA 4KF1A 2PPGA 3BOLA 4IPJA 3ZSTA 1P7TB 2EG7A 4UTLA 4JX4A 3OP2A 2Y2WA 2FHBA 5REQA 1JQXA 3P74A 1KFCA 3URQA 4MJZA 1AW2A 1XPYA 3VNDA 2BV9A 2FZ9A 2NUXA 4J1OA 4E4UA 4ZZ9A 3MHFA 1FWGC 4EE9A 3TR9A 4A3UA 5DQPA 2OSYA 3CWHA 1EPXA 3PUGA 4GO9A 1C29A 1OD0A 4N9BA 4PBFA 2J4GA 4QE5A 2BHYA 4YHEA 3WSUA 4H1ZA 3O9NA 1NP0A 4O15A 5KZMA 5DELA 2V68A 4Q7BA 3R89A 3FYYA 4NX5A 2GOKA 3TNOA 1RBOB 4RLIA 2OR2A 4LAMA 4ZQNA 3NZ1A 3AIRA 2Z4GA 2BHUA 1KBJA 2PZNA 4V1YA 3CV6A 4S3JA 1EX5A 1RLCL 1HW6A 1XIGA 1UWQA 3W00A 5CG0A 3B8UA 3SO7A 1JXJA 2UWFA 2WAGA 3S5NA 3VDCA 3W7NA 5GPRA 5G2HA 5HMEA 3F2CA 4LWWA 3S2CA 3E12A 5CPTA 2C71A 5LZLA 2H3DA 3WH8A 4AD4A 3N6JA 4QFUA 3U6WA 4LXFA 3G18A 3P0WA 2VC9A 1PPIA 1RSCA 1TJ1A 2VZUA 1SMDA 1GCYA 4MLJA 2WZEA 1XISA 1H61A 3GXDA 1J4EA 3PWIA 3D5HA 1XYLA 3BLFA 1GYMA 1O94A 3UXDA 2V2HA 3B8TA 4OWGA 2GSJA 3R8RA 2XZ9A 3LQGA 1L6GA 1IHIA 1WKEA 2X2YA 2E09A 1R3WA 1E51A 3UJRA 4JQ1A 4XAFA 1QBBA 4IPLA 1U33A 4W84A 1KFLA 2B81A 3LSCA 3NGFA 1CGWA 1W1YA 2VEFA 4LS1A 1VIWA 4UTMA 5GNYA 1EC8A 1VLWA 5I03A 3M5VA 3VAVA 1UBPC 5K9DA 4CU6A 1EO7A 1BRLB 2Z6IA 3E0WA 3U48A 3BO9A 1U2YA 4IT1A 4REQB 1AL8A 4GJIA 3GNPA 2J7CA 4IH3A 3VIPA 3WYZA 1BVZA 2FTPA 3T09A 1O5XA 1Z69A 3WG6A 2VELA 1G4PA 4W89A 3TC7A 2WJZA 3Q58A 3R4IA 4Q22A 4YL2A 3WK1A 4ZQRA 4MDOA 3LD5A 5H8MA 4D6EA 2A21A 1DOSA 3M5YA 1ZHAA 5CLTA 2HBXA 4OV4A 4KFOA 2EPKX 4D6CA 4XWUA 2VR5A 3FNDA 1DHPA 4AD3A 3B0UX 2J74A 2QJNA 4B5NA 4XQ6A 4Q8MA 1LM1A 4F0MA 1XC4A 2ZZ2A 1E6RA 3I10A 2QUNA 3L4VA 3V7PA 1M68A 1R7OA 1FWNA 5CGQA 4BQ2A 1PZ1A 3A3XA 4HP5A 3WEMA 2EBNA 1ZP4A 3ZOAA 4AY8A 2P3ZA 1KC7A 1OCJA 4XUGA 4H8VA 3Q45A 2OEKA 4QS6A 4C6CA 3HPFA 3E0VA 4IPIA 3NEHA 3RRAA 1XM3A 3D47A 1BF6A 5F7UA 3WUEA 3NL2A 1ZL1A 3KBJA 3VILA 4PZVA 1E4NA 4HD5A 2QAPA 5CG7A 2P0IA 3GR8A 3GH5A 3UXKA 4CN1A 1L6WA 1D2KA 1KGXA 1PAMA 3HG5A 2V63A 3E2QA 4PUEA 1QI5A 3G0SA 4GZEA 2V3DA 4DYEA 2XGIA 3BARA 3NR0A 1HJUA 5D2XA 2GUYA 1IXQA 2NQ9A 3B97A 2PA6A 4DO6A 1AQFA 3QVQA 3ZIZA 4G56A 2VC6A 2XN0A 1UWIA 2QF8A 1VEMA 1LQAA 3BICA 4IISA 4O50A 2Y70A 3MV11 3BLIA 4PCNA 2E5BA 3QLLA 2ZWZA 4WY0F 3TSMA 2E28A 3G1SA 4MAVA 2IPJA 1XLDA 3P61A 1KFEA 3EMCA 2ZUVA 7A3HA 4R7WA 3PZQA 3M41A 4O16A 1V6UA 4I9MA 4DBDA 3NUKA 1J6PA 1X38A 3CO4A 4QG9A 4KRTA 5J8LA 4I7WA 1V6VA 3PAJA 3T0DA 5K9XA 4DWSD 3S5OA 3IJ8A 4F0KA 1OYAA 3SGUA 2D1ZA 3IK4A 4L80A 1BSIA 2V38A 3PFRA 5JH2A 2AMXA 1SO6A 2V5KA 2PE4A 1V6YA 4TTUA 1Z3NA 5FJIA 4CQDA 1QW8A 3SUUA 3RHGA 4RZ6A 1B3VA 3RO6A 4LVFA 3W7JA 4AYGA 1DV7A 3P67A 4IFRA 2Y5EA 2PGRA 3T8LA 3B9OA 1H63A 4LALA 1XYBA 1BFNA 4M8UA 1RALA 4RE4A 1VPXA 3GG0A 1QT1A 2RGMA 4O54A 5DT7A 4L4PA 3LM3A 2WMHA 4HJFA 3U2EA 2GJXB 1SUXA 4F0SA 2J9YA 4MWAA 3B0VC 4NJKA 3B4YA 1G69A 2ZDRA 1J9YA 4B4FA 4PB5A 1S2TA 3HFYA 3QHNA 3MT1A 3MVTA 4J3SA 3M0VA 4OBRA 4DO7A 4L4MA 3H53A 2YL8A 4TUFA 3UWVA 3EWDA 3S9IA 4RR4A 3R8GA 1IQ8A 3RM4A 3TAKA 4J3WA 1JYNA 3OPSA 1FHVA 5KZEA 1RQHA 4TMCA 3KCLA 4RE3A 4XG1A 3TC6A 1ZAIA 2YCLA 1UHVA 1ICQA 5HWMA 3FJLA 4TTGA 1UROA 3GDBA 2GWGA 2NVCA 1ME7A 4IGHA 3VUPA 3C86A 1KM4A 1N8IA 1JGMA 3EA2A 1YE4A 2X1SA 1O7AA 2CZVA 1VR6A 3OA3A 2WQPA 5DRCA 4PMUA 4ZO9A 2YDQA 4LAUA 1SO3A 1VFMA 3W29A 1UIPA 4TMBA 5D30A 3PZTA 4UQ9A 1E1CB 4H04A 1PO9A 2BZNA 1FWFC 3RM8A 2H6RA 4MG4A 3DN5A 4O14A 1N7KA 3W9ZA 2HXTA 1WBHA 4UC5A 4V33A 2ATMA 5E0CA 3M64A 4RJEA 1ESWA 3G6LA 8XIAA 2E9BA 1SSDA 1CCWB 3MKCA 4G1NA 5HXMA 1EHNA 3GH4A 4EXAA 2XINA 3QSRA 3T55A 1V8EA 1XDMA 4S3KA 4BFAA 1ISXA 7TAAA 5LKYA 5AC8A 4MJ4A 3V3WA 1CLXA 1MDLA 3EPOA 1V02E 3L68A 1M01A 4O28A 2H9AB 4GISA 2FZMA 4AZIA 2W63A 3LCHA 2OZ3A 3WO8A 3GTIA 1IZKA 1QI0A 4M1RA 2GQAA 4FLQA 2Z1XA 3WLKX 5HBFA 3VDAA 3AXKA 3E0LA 3TYAA 4ONVA 1ZJHA 4G7EA 4LVAA 4QQUA 4L56A 4PUWA 3OLIA 4W8LA 3WF3A 1XICA 2WJEA 7REQB 3VIOA 1HKIA 3SCSA 4RV3A 3B0XA 4YLWA 4UTTA 1H62A 3PWAA 3LRLA 3F2BA 5HJXA 4RNFA 1BVWA 3EEGA 4IUOA 5EB8A 2XVNA 3KFTA 3A23A 3EOUA 3W73A 2VEGA 4QAIA 1UQZA 4O8AA 3PPGA 3LZ3A 4IG2B 5FJRA 3MHGA 4X0VA 2ZRVA 5CPQA 3WEZA 3RGTA 4C1NB 2XFYA 2Z7GA 4PFMA 3DHDA 3VU2A 1JCJA 1VBRA 2BGQA 4NL1A 2CIPA 3WLMA 4AB4A 3OGVA 2JF7A 4OUIA 4QG8A 1YBQA 2QYGA 4DYKA 3LA4A 4B9ZA 2IQDA 1E0XA 2NXHA 5EMKA 2BGSA 1IV8A 1UOKA 3IIZA 3A22A 3IJQA 3WNNA 5A6BA 4K3ZA 4PH6A 1PZ2A 4LQ1A 4NT0A 1KW1A 1XYMA 4IOTA 4O4WA 3MUZ1 1J5TA 3WQVA 3CH9A 3EMQA 1N8WA 1LLOA 3UW6A 3FA5A 1W3IA 4L64A 5U7SA 5A5WA 5DMYA 3GHSA 1OGBA 1Q65A 1RQBA 3KS5A 5CQ1A 5XINA 4ZE5A 3MP4A 3TLQA 1LYXA 5EFDA 1M6JA 4NZCA 4QLLA 1HX0A 4ICNA 3BQ6A 3WCZA 2WV8A 2W61A 4FOUA 3JVAA 2Y5JA 1G5AA 1HKMA 2WVTA 3P81A 4LH8A 2ZDSA 4X61A 4HOWA 1W6TA 3ID7A 4ZB0A 4PSRA 3VD5A 2C13A 3W6YA 3V5OA 5HJLA 2EQDA 3VIMA 2FQIA 2ZXAA 5I02A 2PTXA 2ZOXA 3L66A 5HR7A 3VI2A 2OJPA 3S9ZA 2D0FA 2GQ3A 2QCLA 1CENA 3LDVA 2DJLA 3UF9A 3UZXA 2G50A 2G95A 1JCTA 4AZ5A 1XG4A 5EMJA 1DTUA 2I14A 1GW9A 2XFFA 1S38A 2PLKA 5F2LA 3AIBA 3TJIA 4YWSA 1WDWA 1ADDA 4HNCA 2DZVA 2X1UA 4GI9A 4JIQA 1QASA 2Y7GA 4QEHA 1Q6LA 3HGJA 4GWEA 1PIFA 3VA8A 2OCZA 3PP7A 4L65A 4HIBA 1IEWA 4K39A 2BTMA 4EACA 1ZP3A 3TWAA 5KSWA 6XIMA 2ATSA 3N4FA 5HNUA 5GNXA 3IGXA 2WSKA 3FIGA 2WPBA 4JN8A 3TFCA 1NOWA 1E5JA 1XSIA 4WHBA 1M7XA 3WUBA 3MJMA 1V7AA 5ABTA 3E38A 1BYAA 4RE0A 1P7TA 1HO4A 1A5CA 1C91A 1FH8A 1J10A 4LB4A 2OGYA 5BXSA 4GIAA 1TREA 2QF7A 1IWPA 3STCA 1E40A 3D6NA 3GE7A 3KBNA 3UBPC 4XB3A 4US6A 3WF0A 3K2GA 1ZTVA 5KITA 2CHOA 2JGYA 1WNOA 2J24A 1XKJA 1JPDX 3H2CA 2PTZA 3QKEA 4L5ZA 1UD2A 4FALA 5FJUA 3ITLA 2PDIA 1B3WA 3F4CA 1XCWA 1MNZA 3L4UA 2YCEA 4K38A 4LS0A 1UD5A 4EAMA 1W1IE 2V5LA 1A80A 4FIRA 3LV5A 3CH0A 3H8AA 3MP3A 1U1HA 4LU0A 4D8AA 1CGTA 1CXEA 2BHZA 3C8FA 1E72M 4S39A 2P10A 4PMDA 4PBGA 1GHSA 4B9YA 2QVNA 3V5CA 1XYZA 2R24A 2NZLA 4D6DA 1P43A 2PRLA 5E0KA 3KHJA 4JXCA 4I3GA 3LEPA 1J2BA 2WLYA 3D0CA 2VNCA 1YQ2A 3P2VA 4M81A 5I3IA 3W88A 3LNMA 1UA3A 3NQDA 3FOKA 2VFIA 1C8QA 3HQNA 4AVOA 1DJGA 1DJZA 1XFCA 1ZLPA 1X8FA 5FF2A 2VDHA 1DWFM 4PMOA 5HINA 2AGKA 1M04A 3GNRA 5HMFA 1PE1A 3S5ZA 3A13A 4BKNA 1WKDA 2HDJA 1NM9A 4O57A 1GQIA 3W1PA 1TX0A 3IVSA 1F74A 4LV4A 4NY2A 1VFHA 5FJJA 1DQUA 1HJSA 1DWGM 4BJHA 4M29A 4IZGA 1UYQA 2FZDA 3OZOA 3ARSA 1UUOA 4M80A 4INFA 1P6CA 3S5SA 4E38A 3G1DA 5G2IA 3LX9A 2HROA 1F9CA 5KZDA 3NSMA 3GTNA 3N29A 4MYAA 4UR8A 5BU6A 1BRLA 2BX7A 3LHZA 2VFGA 3CL8A 4REQA 1JDFA 1MQRA 1C3FA 2OLHA 4GYPA 1OGSA 3ITGA 1QOXA 3GXIA 3MP5A 3O0FA 3EDFA 2W3ZA 2HS8A 7ENLA 3HO8A 3D3AA 1JULA 3CL6A 3EBVA 5FSDC 1J0IA 1ML1A 4HZ8A 2ESCA 3TJLA 2OTDA 3C0LA 1KBBA 5ECUA 5AOUA 3WNLA 1KRCC 1LQ2A 3MJYA 3WENA 4WSHA 4WKAA 5L6UA 1TE6A 4BF7A 3ES7A 1K03A 3UVAA 1DE5A 2CBUA 1W9BM 2OEJA 4RCXA 2BY2A 3KL0A 2CKSA 3VYLA 2CCRA 2PD5A 3EPNA 5EMMA 3LBCA 4ICCX 2XU2A 1W54A 3WH7A 3LMYA 3MA8A 3UY7A 4RNIA 3URBA 4UTWC 3GVRA 2RHGA 4PGLA 1B9ZA 1OJXA 3QZEA 4GBUA 3PVFA 3DGBA 3LNPA 4PMJA 3NFUA 2GVYA 4YCOA 1W5OA 2XWEA 3KS6A 1KM0A 2VD8A 3WLHA 1GPWA 3EA1A 1TCMA 3TW9A 3JZEA 4NUWA 1Y8BA 3CM4A 4GVFA 1GORA 1VS1A 2PC8A 4WOQA 3O6YX 4O8RA 4OOZA 2R1PA 3KXQA 5G1TA 4FAMA 7XIMA 3UJEA 2VCBA 3DYOA 4H83A 3SECA 4X0NA 2OQLA 4R7OA 1UC5A 4O11A 2Y8UA 2CEQA 4DUXA 1E0UA 3SRDA 1E6XM 2Z7KA 5C9WA 2Z26A 1MEHA 3VGBA 4O1AA 3W74A 5FAJA 1UD4A 1PHWA 4LVBA 3V75A 3PC0A 4J3XA 4BWLC 3AIVA 4C6BA 2G3MA 3C3NA 5I3FA 2D22A 1WX0A 3MC5A 3AUJA 4HNVA 3AYSA 4HSNA 1FWEC 5H2ZA 3BAXA 4JIPA 3W2KA 4LGXA 3TN3A 2XPKA 3VNYA 3LI1A 1XDLA 1C8VA 2YXGA 1QW9A 1UOZA 4UBPC 1J01A 1FWDC 4R88A 1L6FA 2JKPA 4HYRA 4DJFD 1UMYA 1MUMA 3O2LA 5C2CA 2WCSA 3UP8A 3V35A 3QPEA 4YU1A 3BSHA 3MSGA 2DPEA 2LLEA 4H41A 2XFWA 4IL2A 3WLQA 4GUGA 3DFHA 3BC9A 2WOQA 5F1VA 1NQ6A 2YKKA 2ZQ0A 1N8FA 2X0HA 4H8NA 3DEQA 4EX4A 5FEXA 2CFFA 5CSSA 4S3FA 3TSBA 2NSXA 1EOKA 1T0OA 2WPGA 4PUNA 2O4QA 1XI3A 3A9IA 4TO8A 3EX4A 4JBRA 1W5PA 2YA2A 1QHOA 5D4YA 3MUCA 5DO8A 4QJ3B 3WDHA 2KX9A 3W7EA 5I24A 1CXFA 1OCQA 1EUAA 2CZFA 2J7EA 4NVTA 1FHDA 1G7VA 4FS9A 2HVMA 5C9RA 2QV4A 1KV8A 2E0PA 1C92A 3EOSA 3W38A 1R2TA 2QDEA 3USBA 3NCOA 1M41A 2GJXA 4S38A 2QUUA 5FL1A 1EP2A 2H3BA 2PURA 4EPDC 3EGJA 4UIOA 2A7PA 4KCUA 4XZLX 1R3RA 3S4TA 4KFPA 3DZ1A 3MSDA 3WJWA 2C6QA 2RDXA 4D1IA 4Z0JA 2I1OA 3C0QA 3R5EA 4OT7A 3LGDA 5M1TA 2FZNA 1M7PA 2QJGA 3AYTA 4PCTA 1UC4A 2HEJA 2CBIA 3VNJA 8TIMA 3CQ0A 2E4TA 4YVPA 4BQ3A 4EWND 1CB7B 3UZWA 3SB0A 4XO6A 1ADSA 3MMTA 5JBDA 3SI9A 3OLEA 1TO3A 2GVEA 4ZXOA 5E93A 3BJFA 4N0RA 3SFKA 1DE6A 4Q4KA 1ZUAX 2QUTA 3VCRA 1F3TA 1QUMA 4LBRA 1WKFA 2WMGA 2PBOA 2X7WA 2QQ6A 3GVQA 2QPSA 4QR6A 3WMSA 2ALRA 3VOIA 2J7GA 4ZO7A 1E1CA 3EAUA 5LGZA 3AICA 1CBGA 1BF2A 3AIEA 4W87A 1UR4A 4PTMA 1ZJBA 4OV9A 4LVGA 2YZRA 2BODX 1F7BA 4ZMGA 2SFPA 5FKYA 2R1MA 4NNCA 1W1TA 3W6MA 3MO7A 5JUVA 2VR4A 1FQ0A 4Z1AA 1G94A 4FEZA 2XH0A 2QDGA 3NXFA 3QOMA 3E2SA 3CL7A 3A64A 1KRMA 3C61A 3QLDA 3GAKA 1NWSA 4C6NA 4RXGA 4C6MA 1DQWA 1ZJIA 2XZ7A 3LENA 2CLIA 4JZ5A 2H9AA 3SY8A 1E6NA 3W2LA 3R13A 2ICSA 1MSSA 1ITQA 4LUSB 2QCDB 3LTYA 4MJ2A 4R5EA 1VB9A 4ZB2A 4AIUA 3D3FA 3T0BA 3KVLA 5CSYA 3QPZA 2DGAA 3AS3A 1D7KA 3WD3A 2OYLA 1KM1A 2Q71A 7REQA 4JY9A 4V2XA 3BAKA 1UUQA 3FN9A 1KCZA 2QMKA 4IFKB 2EO7A 3GHTA 3UWEA 4W4QA 1E9LA 1J8VA 1TUXA 2Y6ZA 1NEYA 4KMQA 4NQ1A 3WUFA 3B0YA 1C90A 4WQ6A 3OVQA 2CZDA 4FZIA 2VC7A 4Z1BA 4GJJA 1GZ1A 4C1NA 1G4EA 1W3NA 2G4JA 3MY9A 6ALDA 1S3HA 4EAYA 1W3HA 1RK5A 3UCCA 1G4SA 4GYFA 2Y8VA 3EKZA 4HKPA 1BEUA 1R3SA 2NVDA 2J47A 3W0KA 3IIPA 3UGVA 3HV9A 3PTDA 4W5ZA 3VMPA 1JRBA 1IEVA 4IICA 3DGRA 4W7UA 3VKAA 1RY8A 3IJ6A 1NWUA 4H8HA 1GVFA 3W4RA 1KFKA 3S1UA 4S3CA 1AD4A 3VOHA 1UKPA 1QBAA 1K02A 4ZOBA 3PB2A 2NUWA 1MVYA 4CQAA 4UNLA 1X98A 3N2BA 3BZJA 4EF8A 1WDSA 4BEQA 3CUIA 2ZKMX 1A5OC 2JE8A 4JFTA 3L0GA 3WY1A 1E56A 4L1GA 4H19A 4CD7A 3W37A 4ZL1A 3A24A 2NT0A 2Q8LA 5ABHA 3G1AA 4WRHA 4E8GA 1EHAA 4D8ZA 1Q6GA 4AWUA 4HNOA 1DJYA 3AXHA 1VF8A 3W7HA 4M7SA 4YN5A 1OC7A 4NZ3A 4HA4A 3T8QA 3TK7A 3LHTA 3ANVA 4QSHA 4AC7C 1OABA 5A6LA 4C6IA 5JXQA 2QCHA 3AMKA 3C2EA 1XLEA 3XINA 1TPDA 4PTNA 3EX6A 1O95A 3LBMA 4F40A 2Z27A 1JL8A 4GGHA 2JKAA 1Y0EA 1E4LA 1JGIA 3B9EA 1H7PA 3ZVHB 2P8BA 3MYOA 1IT8A 1LRQA 1DYSA 2OSXA 3S1WA 4HZ6A 2J66A 1EYWA 1RCXB 5AC5A 1EJ7L 1XQLA 5CZJA 3U2OA 3EDJA 2X05A 3G77A 1BGGA 4DJFC 4K7YA 3SIMA 3B8SA 2D3LA 1OX5A 3PFMA 4I9JA 3S46A 3QMSA 2YOCA 3BAWA 5H91A 1XYFA 2VFHA 2VQTA 1ZFJA 1IEQA 2EPNA 1XQKA 3QY6A 1Q66A 3TQKA 4QBXA 3UNTA 5A1AA 3DC0A 3H24A 4XKYB 4UQBA 4LEFA 3DG3A 3URAA 3WH6A 3UXIA 2VHLA 3EYPA 3HGOA 2J7HA 1EDQA 2F61A 2OWWA 2FPTA 3RF9A 2A1YA 4B90A 2PDMA 3RRXA 2ZZ6A 5J5DA 3ZJ8A 3BCFA 5L9FA 5HOSA 1TWZA 1W1A1 4ALDA 4CUCA 3TYBA 4GH3A 4HHHA 3TXZA 1DJIA 1X6UA 4UFLA 4YTUA 2GVLA 4K1GA 5DT5A 2OWCA 4ZO8A 5JIPA 2F38A 3IV3A 3KE0A 4MLRA 3B8WA 1IF2A 1B54A 5CJMA 5K9CA 3A47A 1JZ4A 1XG3A 4JIRA 2VUNA 4NG3A 4N02A 1R3VA 2DZAA 1K8ZA 4RKAA 2G37A 1RR2A 3S3GA 2PDBA 1KFWA 1XBXA 4DXVA 4K37A 1H1ZA 1KQYA 1V6TA 3EWYA 3JW7A 4GYKA 3QBUA 1C7TA 4XAGA 3UU0A 4YCPA 4ZQMA 4KCWA 4WD0A 1EUNA 1H5VA 3KWXA 1X6NA 1H1YA 2GGGA 3CUZA 3P62A 4LANA 1Q8JA 1JZ7A 4C7GA 3OQ8A 1PV8A 4WKFA 3RXZA 3L7RA 3SZ8A 1QW7A 2Z2AA 3F5KA 3O7UA 1GQLA 3H12A 2ISWA 3QKZA 5LHFA 3KRZA 1RK6A 2A79A 1US2A 1G67A 1YDVA 1TUFA 1GEQA 4IL0A 4PE8A 3VFLA 5A2AA 4JKLA 1R47A 3T7VA 1TMHA 4B2DA 3SCNA 5CC6A 1DEDA 1P6WA 4NZ5A 3DFQA 5CC3A 1VC4A 3GVVA 1ZALA 3JR2A 2VM8A 4W8BA 4YS1A 4P7RA 4AH7A 4O0KA 5FESA 4P5UA 1YTDA 4TR9A 4CNUA 3SUWA 1OIFA 2J13A 4H2CA 3C2OA 3VKCA 4F2UA 2HBVA 3O15A 1HJVA 2WSYA 3Q4DA 3TH6A 5CC5A 3TU9A 5SWUA 4XD6A 4GVIA 2AKMA 4AUBA 4E4FA 4FNTA 3LCFA 1JAKA 4GY1A 1A0EA 5CXPA 3EOEA 3LXBA 4UOZA 3TVAA 3OW1A 3WK0A 2VXNA 2V5CA 2DZTA 4QE4A 5C6MA 1IXOA 4YVXA 1SO5A 3W23A 3NPUA 4KETA 2A3EA 3GM8A 3ABXA 3CB3A 4A35A 4NU7A 1DIEA 3J7HA 2ACRA 2YX0A 2QCFA 1NARA 4BS0A 1J6OA 4XZNX 1OQFA 1E9YB 2NX1A 4K68A 1K7EA 4J5NA 1J96A 1MRQA 3H4XA 4HNUA 3BK0A 4ZOCA 1H4PA 1UD6A 3N9SA 4W7VA 2IKGA 4Z2IA 1YEYA 1FH9A 1U22A 3WQ5A 3ECQA 1YXCA 2NQHA 1KLYA 4IQDA 1S1PA 1XSKA 1GJUA 5BOEA 1ITXA 3LMZA 3IAQA 4LSBA 4ZODA 3AROA 2BXZA 1TPEA 5D05A 1S3TC 4DX3A 3PG9A 4UUIA 1NOUA 3T4WA 1JDAA 1Y5XA 3IRDA 2DZSA 5CSUA 1T6MA 4N7QA 2YB4A 3BLEA 1U30A 3CC1A 1TE1A 2ZZ1A 4GH1A 6REQB 1M3UA 1R87A 1WB0A 6XIAA 4UWMA 1LORA 1TMLA 5J04A 6PTDA 4WDXA 5E0FA 1P0DA 4IPPA 4DAFA 4B92A 2C0HA 1HGWA 1E4IA 1GVQA 1HVXA 3E02A 1TWIA 2Q8XA 2BVDA 1LROA 2A3AA 4D6IA 2E8YA 3BZGA 4FLRA 5CPMA 3IGUA 2GQ8A 3LG3A 2VJXA 3N2XA 5I07A 1MWOA 3CT7A 3S0CA 3AC0A 4M0XA 5HQLA 4M56A 3KOYA 1MQPA 1GVEA 5D2VA 4QCEA 3DX5A 3UZYA 2QNEA 4MPQA 5H6HA 3GLCA 4GD0A 4QLJA 4DXKA 4AD0A 2YGYA 1FRBA 1K9DA 3BLOA 4JCLA 2QGHA 4KESA 3CWOX 5D33A 3SUTA 3GKFA 3L2MA 3E5PA 3V0TA 4Z2LA 1V3LA 1SGJA 1Q13A 5C2XA 2PCEA 5BNKA 4PEKA 3MBFA 3GNNA 1QAPA 1VBJA 2V3EA 2O9RA 3G8RA 2J9ZA 4W5UA 1Z6KA 5M17A 1LP6A 3CAKA 4MY9A 2WHJA 3AHVA 2BY0A 3DAQA 4XAPA 3RJXA 3WQCA 1B31A 4TQTA 1W9UA 3TQPA 4MIMA 1NDVA 2PWDA 2IKIA 5D02A 1A5AA 4RK8A 1JI1A 1RP8A 3SN4A 3EB4A 4PEEA 1F07A 4ADUA 2I57A 2DSKA 2XIJA 4CD6A 1GG1A 2A7RA 3LLDA 2R8WA 3TV8A 2DVUA 4AG0A 2E1WA 1F4HA 1TV2A 1FDJA 2OFJA 5FF7A 4UOQA 1O5KA 3GU2A 1PTDA 2I7GA 4TV5A 3W2MA 1D3CA 4K2SA 2ABAA 1B3YA 4KCVA 3AS2A 1TV3A 4RZ4A 3PAOA 4DZHA 1UMLA 3TLLA 1OCNA 2P0OA 4Q4MA 2P5NA 1JPIA 4FNQA 1WAUA 2D0GA 3GS6A 3NQFA 4JKKA 3LCWA 5GJPA 1H0IA 5GQBA 3QFEA 3JUGA 1IIHA 1FDZA 1POKA 1GJPA 2XN1A 3FJNA 4HCDA 3SCPA 5AYBA 2P88A 4ZQPA 2JEQA 2OT0A 3ITVA 1AZ2A 4GGBA 1Q5MA 1VZWA 1WA3A 3TE9A 1PBGA 3EKLA 5CZKA 4UTKA 3E3HA 2WVSA 1HJWA 1RZMA 5LGXA 3UVIA 2Z2UA 1JDDA 5TBOA 3EOLA 3PM6A 4AIOA 1XBZA 2B31A 3VMNA 3A5VA 4L7ZA 3NZPA 3BGGA 3DBNA 3AZTA 4GQQA 3A5FA 2QCDA 5B80A 3W1LA 3VGFA 4AHOA 3OZPA 3UERA 1FP8A 5DF0A 4NJJA 1SYTA 3G24A 3AO0A 4J2MA 2TPSA 2O56A 3BH4A 2O4MA 2CKRA 1XIMA 3T78A 2QDHA 3ZYZA 3W1NA 2CLLA 1OFQA 3AISA 3WBEA 2GJPA 1UWAA 2ALDA 4IFKA 4FOJA 5ABFB 2EPOA 4TX9A 4C5ZA 3VCCA 2GJRA 1X1NA 3IANA 3QV8A 1EX1A 1JUEA 1K8CA 1IE7C 1VEPA 2ACSA 1NQKA 4A8LA 2J9XA 3W86A 1Q4NX 5FF0A 3GG8A 1HUVA 3VNIA 2PB1A 3L67A 4IQEA 5M2FX 1HF6A 1SMAA 3PPHA 4MGGA 3SDOA 2ZRUA 1KFBA 4KGLA 1F61A 1F76A 4JTCA 1BG9A 1WYIA 3AU2A 2VP8A 3K46A 1B3OA 3L5AA 3NXLA 1CB2A 1W1ZA 2DW6A 4FNPA 5CZTA 1M65A 5J5RA 2QVHA 4YXGA 4ZQCA 3FYPA 3PUEA 4UOJA 3EWWA 3THCA 2ASHA 5I2UA 2F8QA 5F4WA 2EGZA 3JU2A 1ZCOA 3KX6A 3F4VA 3RPDA 3IIXA 1AFSA 2X16A 3CT2A 1PL9A 3L5LA 1O60A 1UKTA 1W5NA 1OIMA 4JCMA 2PS2A 3WFZA 1Q6OA 1XRSA 4W8AA 2PRMA 2O7QA 4UFMA 2XFRA 4OKDA 1E0TA 3ZLFA 3VKKA 2VRQA 5DANA 3TCSA 5FEWA 2VZSA 1DXEA 4H3DA 5CSRA 5I09A 3AYRA 3K4WA 4A3HA 2XM2A 3DFPA 1EF2A 3GU1A 4RPQA 4IMCA 1K3UA 8RUCA 3PWGA 4FPSA 2GVGA 2VENA 2R94A 3RMJA 3VM5A 5CCZA 3KOFA 3SM0A 2CHRA 4H2HA 1BD0A 1PYMA 2FGBA 1NU5A 1JDEA 4DM2A 5A8OA 1I2QA 1VFLA 3K30A 4D9PA 4IQJA 3NZQA 1KWGA 1K7XA 1LDCA 3KRUA 2W62A 1C9WA 2TYSA 3OO2A 4GXWA 4ZCWA 3WN6A 3Q2DA 3WMBA 2O9OA 4GQGA 4YWIA 4JN6A 1Q6DA 1OK6A 2F9RA 3CTLA 3GSMA 2W67A 3MSYA 4UTFA 4Q6JA 3ZVHA 2C8NA 4HMCA 4Q4SA 2G3NA 3TW7A 4XZHA 4NXKA 3FK4A 3QQ1A 1QO2A 1ALDA 3WNMA 3VUSA 2GJNA 3CS2A 1XRTA 5AVHA 3SCUA 1CYGA 4Y8FA 1XS2A 1O12A 3MI3A 1L2QA 5U4NA 1OEPA 3FDKA 1JZ2A 1P5BA 3PB0A 4JOMA 1XJBA 1CGYA 1Q6CA 3G1FA 2V82A 3LHWA 4WF7A 4IMAA 4ZOAA 4F4RA 4ENLA 4S2CA 4JKMA 4BCEA 3B8IA 4W7WA 3HG2A 4XKYA 1NWTA 1L9WA 1FKXA 3K8MA 2A4AA 4JFVA 1JZ8A 1V3IA 4LAKA 2XN2A 1JXKA 2X42A 5DY2A 3TTYA 4W85A 3BAJA 3BCDA 5AFDA 1TRIA 2J75A 2AGTA 2OXNA 2VKZG 3H21A 2FMOA 4MYXA 2RJGA 3CPGA 1LTDA 4MZYA 2BXVA 3PSWA 4Q33A 3DFYA 5JVLA 1XSJA 3S6TA 1TYGA 2OT1A 4LYPA 4JYEA 4ICMA 3RMEA 1VPYA 1YE6A 2ISVA 3TP4A 1FVPA 5CAHA 4X2PA 3UZ5A 1MUWA 1TZ9A 3KZPA 4PBEA 1UZDA 3W01A 3I68A 4E8CA 1NDZA 2DUAA 3BLLA 3LM7A 4Y9OA 4IGSA 1Q85A 3V5FA 1Y5VA 4PN2A 3C5QA 5A6TC 2GGHA 3CHCA 1I2RA 4HN4A 4Q6XA 1LOLA 4IIFA 4H4IA 1I2NA 1P0KA 1RA0A 3EWUA 3TOPA 2DSUA 3SY1A 1L6YA 3T40A 1YPIA 3RG6A 3S42A 3F03K 1OFRA 4AU0A 3MI2A 1JZ5A 2D24A 1TR1A 3KOWA 4M19A 3SADA 2WMFA 1TR9A 3CBWA 2BFGA 2VFDA 1Q7QA 4KEVA 2VO5A 2X1IA 5BOFA 4KWOA 3SJ3A 1H7NA 5AC6A 3HB9A 4HTYA 2Y61A 4PMNA 4GZJA 1C8YA 1TV8A 2QJIA 4C6FA 1H41A 4MWAE 3RIKA 2E6AA 1KRBC 4J3ZA 2Q09A 4H6QA 1NFGA 4ACYA 4EF9A 5I00A 2BY3A 3TZFA 1FP9A 1UPPA 1IR1A 1QOQA 5C9ZA 2PI6A 2ACUA 4YPJA 2JKEA 1BTMA 3M0LA 3RUBL 1H1NA 4HU8A 3EA3A 5EBAA 4NRSA 3DG7A 3LXCA 4C6PA 4ML4A 2DZUA 3RPTA 3LYEA 4C91A 5K3VA 4YTRA 1FWJC 1EEPA 4O1FA 4U4MA 1GUVA 4ATWA 3M5ZA 3W53A 5I3DA 1M9HA 4W9TA 1EXBA 2GDVA 3QC3A 4LCRA 3TMQA 4A8IA 4R53A 5FI8A 2HVNA 1Z42A 1B0IA 1X7IA 4JICA 3MPGA 1UUMA 3ONCA 1W8GA 3STPA 1U83A 4HMEA 4JTHA 3OHMB 3UCQA 2J25A 5A8GA 3AWNA 5A94A 3HMJG 2G96A 3BGJA 3T81A 2V30A 4C6LA 3ABSA 1YRRA 3PSVA 1E6PA 4HPXA 3ZJ6A 5F2IA 4FA3A 2FVKA 3OA5A 3WF4A 1JYXA 2Y8KA 3M6DA 3G3MA 3W1AA 1F3WA 3TZNA 2WNZA 3WNKA 1KCXA 3INPA 3GR7A 1QNPA 4HGXA 3IJ9A 3TFXA 1PIIA 1E6ZA 1HJQA 2E77A 1LL7A 4LC8A 3I7SA 3HURA 1QNVA 2GUUA 4KQNA 2R1NA 3PZNA 3TYCA 1QTWA 4I5RA 2C91A 3TAOA 4UFIA 4CVWA 1WXJA 4QITA 5DBUA 3CUHA 3MTWA 1W8SA 3GFXA 3UA3A 1AH3A 1DWAM 1M7OA 1MW1A 4LRTA 2WHKA 1XUUA 1UWTA 1PCKA 4GX9A 1XGZA 4DZ5A 2OZ8A 1MFVA 2F2HA 4LEQA 2ZZ7A 3LCGA 3L5MA 1TPUA 3VNZA 1KGWA 2Z0IA 3WBAA 3GDKA 3R43A 1UASA 4NIRA 4QE1A 1OY0A 2OODA 4C1KA 3LY0A 3LXAA 1K7FA 3UEQA 1H5YA 1P0NA 2OLAA 3LGGA 3CO8A 3AJXA 3NL5A 1D3GA 6REQA 9CGTA 2C15A 1TVNA 5A6KA 2O7SA 5LIKX 3QRHA 2PTWA 3CPRA 3XISA 1F8MA 3ZS4A 3PY2A 3VDGA 5G4WA 4CU7A 3W72A 4I9TA 3GAYA 1X1ZA 4QS5A 4XZBA 3E74A 1PDZA 3VVGA 1XR2A 2YA1A 3W7PA 4DVOA 1GVRA 3ITOA 3TROA 1VD6A 4NX0A 1FWAC 1WOBA 5HQMA 3FDGA 3M0XA 5I7GA 2XIMA 1H7WA 1UIOA 1RH9A 4IXHA 4Q8VA 4Y9NA 3WIJA 4LVDA 1JPKA 2C0AA 3GTFA 5FOOA 3W6LA 4HYVA 1OT1A 3AWOA 3IAPA 4TX6A 4YNGA 4G8TA 1F05A 2DU2A 1MRAA 4KKXA 1EPVA 1J11A 4QLKA 3RLHA 1E1FA 4LBUA 3DECA 4NZ4A 2OWXA 1BXBA 2EXOA 5CBBA 1TVPA 3VINA 3UWQA 3W27A 3PBGA 3QC0A 3M0MA 2GSHA 2INZA 4WVXA 5D04C 1KR1A 2PC4A 3M0KA 1V0MA 3ARUA 1ZNNA 4LRSA 2OZ0A 2D0HA 1NP2A 3UXAA 3OTRA 1UKQA 3WDPP 3RR4A 1A47A <