2CLPA

Crystal structure of human aflatoxin b1 aldehyde reductase member 3
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
323
structure length
323
Chain Sequence
RPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVAHECPNYFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
publication title Crystal Structure of Human Aflatoxin B1 Aldehyde Reductase Member 3
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
total genus 114
structure length 323
sequence length 323
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2clpA00
2NVDA 5JH2A 4JQ3A 4H7CA 4YU1A 2R9RA 3V35A 2ACUA 1PYFA 3G1RA 4EXBA 2INEA 2IKIA 3ONCA 1ZSXA 3CASA 3GHRA 1AFSA 3WG6A 1OG6A 1ZUAX 1AH0A 4QX4A 2DV0A 3ONBA 4Q7BA 3R8GA 2PD5A 4YS1A 1QWKA 3LENA 4WRHA 4LBRA 4H8NA 2J8TA 1QRQA 5KETA 4JTRA 2DUXA 4IGSA 3EB4A 3H7UA 4YVVA 4LAZA 1IEIA 3FJNA 3UZXA 3UZZA 2I16A 3H4GA 3R58A 3NTYA 1ZQ5A 2IKJA 2IKHA 4QBXA 3WBWA 4Q3MA 2F38A 4WGHA 5HNTA 3UFYA 4L1XA 3LUTA 5JH1A 1PZ0A 3H7RA 2PDGA 3M4HA 4JQ2A 2CLPA 3UP8A 1C9WA 1XJBA 3M0IA 5LIUX 4JQAA 4PRRA 3BURA 3WBYA 4LBSA 4LB4A 4LAUA 4HBKA 2PEVA 4PMJA 3UGRA 1MZRA 2IPWA 4DBWA 4GA8A 2FZ8A 1US0A 2NVCA 3LZ3A 4GACA 2PDUA 3GUGA 2WZMA 5M2FX 2FVLA 4L1WA 3UZYA 1GVEA 1HQTA 3CAVA 1X98A 2AGTA 2HVOA 4HMNA 3LBOA 4JIIX 1RALA 2WZTA 4G5DA 3CMFA 1S1RA 1LQAA 1VBJA 3BUVA 4FZIA 4JTCA 4JTQA 2IS7A 2BP1A 4YVXA 3EAUA 4GABA 4XZHA 3UYIA 3WCZA 3MB9A 4JQ4A 2PDLA 3F7JA 3RX2A 5AZ0A 4PUUA 1EL3A 5HA7A 2FZBA 1YE4A 4XVDA 3KRBA 2PFHA 2PDBA 2FZ9A 4FA3A 3CV6A 3GHSA 3FX4A 1Q5MA 4WDWA 3B3DA 1AH4A 4XZLX 3LEPA 3VXGA 3V36A 2PDWA 2F2KA 3LNMA 3COTA 4AUBA 2C91A 1IHIA 1YNPA 3LZ5A 5HNUA 4WDXA 2PDJA 4DBSA 4XZMX 3C3UA 3BCJA 3N6QA 2R24A 3D3FA 3LD5A 5LIWX 5LIYX 4XO7A 4IJRA 1A80A 1UR3M 1PWLA 1X96A 2HE5A 1K8CA 4XK2A 4XZNX 4QXIA 2PDPA 1S1PA 5C7HA 4GCAA 3R6IA 3UZWA 3BV7A 1X97A 1EF3A 2INZA 4DBUA 3GHUA 2PDXA 3Q67A 5LIXX 3R43A 2PDYA 2HEJA 2P5NA 3R7MA 3N2TA 4WEVX 4QR6A 2BGQA 3ERPA 1Z3NA 4JTDA 3LQGA 2PDHA 2ACRA 4PRTA 2ACQA 4LB3A 3CV7A 2PDFA 2PDQA 4WDTA 3P2VA 2HDJA 4DZ5A 1M9HA 2ACSA 1EKOA 3EB3A 5LIKX 3LQLA 1YE6A 4JIHA 2ISFA 4ICCX 4XVEA 3GHTA 1HW6A 1EXBA 1PZ1A 3G5EA 2PF8A 4WDUA 4FAMA 2IQDA 3UWEA 4JTAA 2BGSA 4OTKA 2A79A 4PUWA 1T40A 2FGBA 1XGDA 3LN3A 4RPQA 2PDNA 3R8HA 3V0SA 1Z9AA 2HV5A 4GQGA 5AZ1A 4GIEA 2IPFA 3RX3A 2IQ0A 1SM9A 2HE8A 1S2CA 3QKZA 4EXAA 3S3GA 1PWMA 2PDIA 1AZ1A 1YNQA 3V0TA 3R94A 4FALA 2IPJA 4GQ0A 4R9OA 4XO6A 2PDKA 4XAPA 4F40A 1Z89A 2FZDA 2VDGA 1RY0A 2ALRA 2DUZA 3DN5A 2IPGA 1AH3A 4NKCA 4YVPA 1Q13A 1J96A 1JEZA 3M64A 1AZ2A 3O0KA 4JQ1A 1XF0A 1R38A 3U2CA 1ZGDA 3CAQA 1MI3A 3V0UA 1VP5A 1RY8A 3MC5A 2PD9A 3WBXA 4JIRA 1ADSA 2IKGA 4I5XA 4XZIA 1FRBA 4IJCA 3T42A 3O3RA 3RX4A 4ZFCA 4MHBA 4ASTA 2QXWA 2PDMA 2PZNA 2I17A 4PR4A 3UG8A 1Z8AA 2HVNA 2PDCA 3Q65A 5DANA 1T41A 3DOPA 1S2AA 1LWIA 1MRQA
chains in the Genus database with same CATH superfamily
4A8RA 2NVDA 1GPFA 4O0QA 3VDAA 2PGRA 3SO7A 1XGZA 4HHHA 2V82A 2X0HA 1I9CB 2VELA 4EXBA 3EDFA 2INEA 5K9XA 4Z0JA 3ONCA 3CASA 1AFSA 1GG1A 2YBUA 2VENA 3UY7A 2WVVA 3W02A 4F0LA 2DV0A 4L4LA 4L65A 1REQA 4LW7A 1OZQA 2X09A 5CEWA 4W9TA 3PJUA 1OD0A 3GXNA 4Z17A 1VBRA 3WUBA 2V2DA 2DQXA 4NZFA 3L9CA 5BRPA 4KIRA 1QRQA 2DUXA 3UWYA 4LAZA 4J3VA 4KERA 3THAA 3AI0A 3VC5A 1RD6A 4HGXA 1RVKA 4J3UA 1YTKA 1FBAA 5I3GA 4IHCA 2PWDA 4CU7A 1FWFC 1GEHA 2IMRA 1WAWA 1UCWA 2OGYA 3BLIA 1HJWA 5D02A 3CM4A 4LWWA 3S6DA 2YPIA 1TZZA 2QUMA 3I6EA 3UXIA 2PA6A 4NYUA 4XBJA 3NR0A 1EPXA 1A5SA 3MKCA 5E9XA 5IHRA 4JQ2A 4A29A 7PTDA 1Q8JA 4DZIA 5LIUX 1F76A 3W23A 1SO6A 3SW6A 2VUNA 2GGGA 1VYPX 1JIBA 1UUQA 2PEVA 1OZMA 4E6MA 3CL6A 3BMXA 2P88A 1YTDA 4CGTA 4WKFA 1B3VA 5BYWA 3NO3A 5HMDA 4YTTA 1VR6A 1JI1A 2W62A 1BFNA 2PTDA 3BC9A 1UZ1A 2DZPA 1UH4A 1P0KA 4KIEA 1E56A 2QCDA 3MV11 3IJIA 3GSMA 3H2AA 4D6DA 5AYIA 4TMBA 2VQTA 4MWAB 3VOIA 1PEZA 2W3ZA 3UQNA 3HTWA 3WF3A 2HVOA 1RALA 1KR0A 3KHDA 3UGVA 3CHDA 1BKSA 4JTCA 4R85A 1TE6A 1B4KA 1T0OA 1XUZA 3ANYA 2TRSA 2IS7A 1S39A 1BEUA 3EAUA 3AUOA 5C9ZA 5AZ0A 3B0UX 2CPUA 2V69A 1E1CA 2GUYA 3UVAA 3PBMA 5MKGB 1W0MA 5E1QA 4S38A 2WYSA 2TPSA 2O4QA 4LFYA 1TTJA 4NF7A 3IARA 1QO5A 4HNNA 3N25A 4RZ5A 4AUBA 3BVJA 2W0UA 3ABZA 4R53A 3MWCA 1IGWA 5IDIA 3NXFA 4GJ1A 4ZQCA 4A4AA 1XLHA 2ABBA 3CPGA 1OT1A 3W1PA 2VMFA 3I7RA 3WNMA 1M1BA 1YDYA 1QPNA 2ZX6A 2P76A 1OBAA 5FF4A 3HN3A 4EPDC 3F1QA 1A80A 5TF0A 4A21A 3LHWA 3OZYA 1K8CA 3OO2A 2QDEA 3D46A 3SQMA 5DY2A 4XK2A 3ARVA 2WNZA 4EACA 4MZ1A 3A21A 5G1MA 3W1LA 3W0KA 1BF2A 1AUSL 5H8UA 3H24A 3BG5A 4R88A 2DH2A 3DZ1A 4P7LA 4ZE4A 1LQ0A 2G4JA 3BGJA 1TPUA 1H41A 4MADA 4PEEA 3MYPA 2W6RA 3EXRA 2PDYA 1C7SA 3MVTA 1JAEA 1TPFA 3UWZA 5AFDA 3EZ4A 2ZBTA 2BY2A 1IT8A 4DRSA 2W61A 2QCHA 1LLWA 2RFGA 5HNNA 1KRCC 2YCLB 3LHZA 1CXFA 4WCJA 2ZRXA 1GYNA 4OFCA 2AAMA 2Q8XA 4IGMA 5EKYA 1XPGA 2FPYA 4QJ5B 3VYLA 2BFGA 1BRLA 2QW5A 1KCKA 1XLDA 3FSUA 4GH3A 3RUBL 1JZ4A 3WO8A 3GHTA 2XSAA 3HPXA 4O17A 3EXTA 4C6CA 4UNLA 1PZ1A 2PF8A 4LUYA 4YYFA 2CWNA 4QHRA 3LCXA 1CI1A 4ZQPA 4K8EA 1KBIA 3CXOA 4JL2A 5C70A 4PTNA 4ZODA 1L6FA 3U7BA 5LA0A 4OE7A 3VM7A 1QI4A 3CYJA 5FOOA 5FJIA 1PTDA 4DXKA 1C8XA 2B81A 2VR4A 1YBQB 1F7BA 5FCZA 5E0KA 4GXMA 5GNZA 2R1KA 1D2KA 1MXDA 5DCBA 2X41A 1W3TA 5DCEA 2IPJA 1XRTA 1NQ6A 2D69A 3VTRA 2NX1A 3WL0A 4ENLA 4O10A 4ROPA 2ZFAA 1FWWA 3ARPA 5HJLA 2FHFA 4J5NA 3O63A 4QQ3A 3TA6A 4DYKA 1TTIA 4N6EA 3W84A 1YX1A 2PRHA 5LNSA 2Z7KA 5H91A 1XBYA 3LHTA 4NKCA 4LY8A 3B0XA 2W92A 2XJ7A 2WSQA 4J9JA 4AZGA 2HS8A 1Q6DA 3MTWA 1JZ6A 4JQ1A 3E5PA 4AZHA 1QJWA 3RCMA 1R38A 1ZLPA 4TR9A 3T55A 2H3DA 5ECVA 3NQGA 2Q09A 3VO0A 1E43A 4UFJA 3WH8A 2BY1A 3B03A 3VKCA 1TE1A 1PUDA 1UIPA 5AHFA 2E25A 4GVHA 2QXWA 3IIOA 2YCIX 2BVDA 5E6YA 4HTBA 1QAPA 5A8OA 2J7FA 3LA4A 4LRTA 3AXHA 3EA1A 3H8AA 3OA5A 4BFAA 3PBGA 1LROA 3GG8A 4GK8A 1A50A 3ALGA 2ATMA 3RPMA 1XIFA 3DFHA 1UR1A 4H7ZA 1FX6A 2JGYA 1W2VA 1O68A 5HBFA 3ZR6A 1C29A 2A0NA 4QDPA 1OEPA 1OG6A 2JIWA 4I3GA 3KCJA 3QEZA 4H9VA 1K8ZA 3KVKA 1WA3A 1U2YA 4OECA 3J7HA 5FSEC 2QF7A 1WKYA 1DWGM 5DMMA 5F2GA 4ZO7A 1WDSA 4MYAA 4V2XA 4H9TA 3K4AA 1B90A 4ZB2A 1XRVA 3W26A 3CQ0A 4KPLA 2NQ5A 4C6JA 4G7EB 1EGMA 3UZXA 4H2CA 5I6SA 1T5AA 4JBRA 4XD4A 1MXSA 4D8AA 3TVAA 3ZOAA 3H6OA 1QOPA 1QWGA 5F4WA 1HFBA 2O55A 1KFBA 3GIPA 3HPSA 2ISSA 4PTDA 4X22A 3SADA 2CHNA 3A5FA 5DT7A 1JUKA 5CPSA 3P61A 4D8LA 1K3UA 5BMWA 4HYWA 2Y8VA 3CBWA 1ITQA 4WQ6A 3OGVA 5KEZA 3M16A 3HZ3A 3B8SA 3GR8A 3VNJA 3MP4A 4QGCA 3WDRA 1W8SA 4BA0A 4L6OA 3GTXA 1I6NA 1BPLB 1F3WA 3LGGA 1MQRA 4DY1A 4EK7A 4QIUA 4CD8A 5A94A 4P7RA 1B30A 4PMXA 4AEEA 3IVUA 3GUGA 1TIMA 2FVLA 5DBTA 3VOFA 1L2QA 4JTUA 3WQPA 3DFSA 2V5KA 2ZC1A 4Y2WA 4HN8A 4DN1A 4M1BA 4GI9A 4ACZB 2AGTA 4R7OA 1HL9A 4DJDA 1UA7A 3OQEA 4MJ4A 1YPFA 4RNHA 1UD8A 1S1RA 1VBUA 4ZEPA 3NQCA 3GM8A 3SRHA 3TC6A 1KGXA 2ZADA 1NOFA 3M0XA 4MZYA 3WMCA 1E40A 4RK8A 3LX9A 5CC6A 1EL3A 1OYBA 3UPWA 4EPBC 2ZXDA 3GDMA 3GAYA 2D1ZA 2P0IA 1KKOA 4PMUA 3HPFA 4WK9A 3ARQA 2O9OA 2YA2A 3BAXA 3GD6A 4FIRA 5IBXA 1DORA 4PSPA 3QHMA 1KM2A 3EMZA 3LCHA 1B9ZA 1VFSA 3HQNA 4N4QA 1G6CA 2PTXA 4F0RA 7ODCA 4YPJA 1E4LA 2WB5A 4W86A 2NUXA 1N8IA 1D7KA 2Z2UA 3BLEA 4GOAA 4O18A 3LSCA 4H04A 4YYCA 2YXGA 4G1NA 2WHLA 2EQDA 4GUIA 4HD5A 1DJHA 2PWFA 4L61A 3USZA 4FK9A 5E6ZA 2J9YA 1IEXA 4JN8A 1BVZA 4RV8A 4GBDA 2H8XA 4UFIA 3B8IA 3BZJA 2A2IA 4UTFA 3AMLA 3A3XA 2VFIA 3VI2A 1XBVA 4YMZA 3CIXA 1IR2A 4QCEA 3ZR4A 5HANA 1MVYA 3WUGA 2Z29A 3E12A 4IMFA 2BB0A 3RU6A 2YDAA 3AS0A 2TAAA 1N82A 3R43A 5A2CA 1G0CA 3H2EA 4C1KA 3MI3A 4E5TA 2LLEA 3DI0A 2BDQA 3PFRA 2DIKA 4KRTA 2E28A 2XDFA 3VDGA 1BXNA 5MHBA 6A3HA 3M0KA 3TLQA 4C7FA 1VFLA 3MU7A 2PDHA 5A6JA 1SR9A 1PS9A 4F79A 3HB9A 4XKYA 1S5VA 1XSJA 1HKVA 3WK1A 4CCZA 3SDOA 3RXZA 3BLOA 5LA1A 5J5RA 1QI3A 3KCLA 4UQCA 4OBRA 1EKOA 2YYUA 3N2MA 3QY8A 3WSUA 2ISFA 2JF6A 4ZQMA 4D6CA 1XIDA 4OWGA 2JKPA 1W5OA 4Z1YA 1ZALA 3QYQA 4R33A 1GVQA 2PTZA 1B3OA 3F4WA 4KBXA 3WH6A 4NP7A 3W2UA 4E3TA 4GQGA 1JQVA 4GIEA 2OJPA 1TIWA 4IPPA 4AWUA 2IQ0A 5FESA 5D37A 1S2CA 1YXCA 1NFBA 3CJPA 1ONRA 3GBEA 2QMJA 1KFLA 4D1JA 4TMCA 1WPCA 1K4HA 4UTWA 3CZGA 5CZKA 1SUXA 4LC6A 2OTDA 4ZBCA 1A5UA 2PWEA 3MHUA 2A3HA 3FY1A 2AL2A 5FSDC 4HOWA 1Y5VA 1YQ2A 2E77A 3E9AA 3LPPA 4PTVA 1XFCA 3W85A 5BXSA 4GI8A 3OYZA 3QR3A 3DC8A 4NXKA 2OR2A 3KDOA 5CLTA 1F5ZA 1NAL1 3O0KA 3QZAA 4KCUA 4GNJA 2OODA 4DYEA 1ZGDA 3KOYA 4XD5A 2PE4A 3ZJ7A 2WWCA 4MKVA 2WJFA 3NWRA 1YDOA 3W81A 4LY4A 4UMBA 1CXHA 3DFQA 1WE5A 4A22A 3RLVA 4Y90A 1KCZA 1P0BA 4L4MA 2UBPC 3G1XA 4IXHA 2ESCA 3W1QA 4ACYA 3CUIA 3MANA 3Q65A 4QG8A 4W84A 3A23A 3NDYA 1V5XA 3SUUA 1I1XA 4I9AA 3UWWA 1S2AA 3GFYA 2Y8KA 4X0VA 1CENA 4YLWA 4JZ5A 3UG3A 3UR2A 1WZMA 4NSBA 4M80A 3HG4A 4IM4A 2VFFA 4OV9A 4IXXA 1RR2A 3VZYA 4NZ5A 3FGCA 2DZAA 4H1ZA 2QAFA 1AMYA 2ADAA 4NAFA 3PSVA 5IM51 4OHQA 1BAGA 1W17A 5CKSA 1TVNA 3ZSSA 2CLMA 3SEPA 3L7RA 1ZAIA 3UA4A 4QX4A 5EMUA 5F4SA 1ZBKA 5G1YA 3QPZA 1E9ZB 4S3JA 3CGTA 1XM3A 2C0HA 1DWJM 3HMJG 3W2MA 1TV5A 4R27A 3BANA 5D09A 3S2JA 1V0NA 3O9NA 1TFVA 4UIOA 5CSSA 1KKRA 2WNWA 1PHQA 2ANUA 4N4PA 4TTGA 4FX6M 3WQ5A 2GVYA 3NQ8A 2NX9A 4KS0A 4UCGA 4MNMA 3CEUA 3RPDA 4C1NB 3CQIA 1PZ0A 4CLMA 2ZZ6A 3PPGA 4JKLA 3TWAA 3NSXA 4WIWA 4F9JA 4U2ZA 4JTFA 1XI3A 2WCAA 3CPRA 4BZYA 3LXCA 1QW7A 3QPYA 3L5AA 2XM1A 4QISA 1OD8A 3NVDA 4E8GA 1H5YA 3FNDA 4KEZA 4DIAA 2PGWA 3VDHA 1UR9A 1QR7A 4B92A 3MV01 3LOTA 5A3HA 4MTVA 3DGBA 4MWAE 1UKPA 3WMBA 5GJNA 1HQTA 1QNRA 3AWNA 1E9LA 1QHOA 3HQ1A 3DYPA 4AZIA 1LQAA 4LUJA 1PXGA 2WHMA 4RE3A 3WEZA 3DECA 5CBIA 4AG0A 4TU1A 2QJHA 1CGWA 3MB9A 4JQ4A 3F7JA 3UWUA 2WO5A 3MSRA 3QSRA 3L4VA 4EOUA 1EJTC 1TQJA 4DWDA 3CQJA 3NQBA 4N7QA 2FZ9A 1XDMA 2XGZA 2DZXA 5AC7A 3LY0A 4LSBA 4FX8A 2CLEA 5ABFB 3RJXA 1JDEA 5CC7A 3C52A 4DJDD 4LVDA 3SUSA 3OODA 1OHLA 1DJWA 4M8UA 3G3DA 1V7AA 4DUXA 2CHOA 3M5VA 4M82A 4QAWA 5A6BD 3NZPA 2BV9A 4B9YA 1REQB 3TW9A 1ENUA 3FVDA 1BYCA 2H3BA 5AN7A 1KXQA 5AHMA 3I4EA 4BHYA 3K8MA 5FD0A 3PPCA 4DVOA 3JUGA 1ZPTA 3BLLA 3CUJA 1X1OA 3ECQA 4H00A 2EPKX 1GOQA 2E6DA 2VVSA 1CXKA 5C7HA 4IMEA 4H8VA 1V6XA 4GCAA 3TSBA 3A24A 1LWHA 1XXXA 3RAOA 1JULA 8RUCA 5K9CA 4DF2A 3H12A 4AD2A 2HK0A 2RDTA 5LXXA 1J12A 4I7WA 2Z25A 2GK1A 2E5DA 3EOSA 1E73M 3IJLA 1M03A 1Q4NX 4TO8A 3KOFA 3PZNA 4L6DA 5CSRA 3QOMA 1Y7VA 1S2WA 1T8XA 2FLIA 4LVGA 4XUGA 3P8IA 4XTIA 2E68A 3EWWA 3ARXA 5F2MA 1G69A 3L4UA 2A5HA 3AWOA 1SMDA 3NJ3A 1FWIC 3HJEA 3RM8A 1JPIA 2ACSA 2CZDA 4O4WA 5JUVA 2VCBA 1W54A 2QCDB 5D30A 4G1KA 3TN4A 4Q8PA 4IUGA 2QYGA 2BXYA 2QCEA 3O6AA 4DJDC 2CFFA 2H9AA 2E3ZA 3QGAC 3A12A 1OCBA 4I5UA 1C92A 3CB8A 3P3BA 2FGBA 1V0KA 3UVIA 4E4FA 1M68A 2Y4SA 4JHOA 1I75A 4FNSA 4WXYA 1KR1A 4PB4A 5FJPA 4MNKA 2RDWA 4LCSA 8XIAA 3OZMA 5E9AA 1MQPA 1E1CB 5CAKA 1FFRA 4NX5A 3O15A 1R47A 3W7PA 5IBXC 6REQA 2YIHA 3R94A 3DIPA 3GNPA 5HQLA 2BHZA 5I3JA 4M56A 2VURA 1FWHC 1ICQA 3TROA 4B5SA 2J47A 1Z89A 2E1DA 1ZAJA 4A8NA 2J9XA 3DN5A 4MJZA 4O19A 3EDJA 1JGIA 1V6VA 3VM5A 4FNQA 3H4XA 1OABA 3G1VA 3R11A 3D0CA 2QS8A 1TPDA 3PBVA 2Y8UA 4AVFA 3W73A 1F07A 1ZCOA 2QJGA 1OFQA 1YRRA 5G1TA 5H8MA 2GVLA 3M1ZA 3QJAA 1E4NA 4Z2IA 3AC0A 2PD9A 3PS7A 2HQAA 5HMEA 4HU3A 2BVTA 2CZ5A 1HJXA 3KFTA 2WPGA 3QHNA 4F8XA 3HM7A 1ZAHA 1LT8A 1CXLA 1A5AA 1K7XA 5DQPA 5I3KA 2Y5JA 4UZUA 3W7CA 1TB3A 5DMNA 1H63A 4O13A 3VINA 3I65A 2BHUA 3F5KA 5AYZA 3WMLA 2R8WA 3DOPA 1QPRA 1LWIA 2J27A 4K8HA 1EGVA 2Q71A 3BMVA 3WH5A 3TCSA 4LNCA 4GFSA 1F2JA 2WWDA 5HOSA 3TEVA 2ZTKA 5I5RA 3DBNA 2HNHA 3NIYA 1MO0A 3RILA 5FF2A 3IJDA 4ZSTA 3E0LA 3R0UA 2WSPA 5DMLA 1GWJA 3UERA 4HJFA 4DUWA 1SW3A 3H70A 4YTQA 3DUGA 4WF7A 1MWOA 4HMDA 4CNUA 1TJRA 5KETA 3ZWTA 4JKKA 1E4MM 2AGKA 3WQVA 2VGFA 1UG6A 4HZ8A 1GNXA 1PKLA 3MHGA 2D2GA 4QBXA 5BOOA 1ZBVA 1B31A 4UTWC 3UXDA 5HNTA 1OCQA 3KRSA 3LG3A 3URNA 1O5XA 1MRAA 4PCPA 1J2BA 4AZBA 3IRDA 3C2YA 3E2QA 3OW1A 5GJMA 1WOAA 4A3HA 4DAFA 3M4HA 2O0TA 4NAEA 2R94A 1XJBA 3W3OA 4HP5A 5C2GA 1A0DA 4MPQA 1VB9A 4H3DA 3RDKA 4Q32A 3MJMA 1TG7A 4E4UA 2XINA 5TD4A 3P67A 3MCMA 1YEYA 5A69A 1VHCA 3NG3A 4DQWA 2Z1BA 1KD0A 3K8KA 2Y1HA 3VMNA 2I5IA 2BMBA 1OGGA 4HCDA 2GGHA 5I3FA 2FYMA 1TJ1A 4B4FA 2WZTA 4G5DA 3KBSA 4JS3A 5C54A 3TTOA 3UNDA 4C5YA 4O1DA 3SCNA 1B9BA 3NYZA 3RGTA 4HU4A 4AD5A 3T05A 5GJPA 2NSOA 4KKXA 3GKAA 5HR7A 1O6IA 1YXYA 1FWAC 3MI2A 1J79A 1ITUA 4W4QA 1OY0A 3KM8A 3DFNA 2GWGA 4XD3A 5IDZA 3CEPA 4PBGA 2XM2A 5DXXA 5JIPA 1YTEA 4FA3A 3CV6A 1D3GA 1XYMA 2VM8A 5TBOA 3G0UA 3KRZA 4GUFA 3KVMA 4FIQA 2BGNE 4ZO9A 1TA3A 2VZSA 3VDBA 2CXGA 1CGYA 3G3MA 4MY9A 5HULA 1EH9A 1CYGA 3P0WA 1W2PA 1OFAA 1QU4A 3CAKA 3AS3A 4MLJA 3W72A 3VIJA 2VFHA 3AHTA 1XGEA 2HE5A 1RP9A 1I2QA 3FVMA 1OYAA 2YBTA 3B0VC 3BW4A 3B8UA 1G67A 1T8QA 4DO4A 1PE1A 1E71M 2D23A 2PDPA 3LTPA 2D20A 4DF0A 3AYVA 3E0WA 2Z1WA 5KINA 1TCMA 2ZOXA 2V68A 2WHKA 3FA4A 3NVTA 3S5ZA 4F0MA 1Q2RA 1JDAA 1L6WA 2RJHA 1IXQA 3U6WA 2VI0A 2GOUA 5C2XA 2HS6A 4B90A 2BS9A 1FH7A 1OADA 5D04C 3QLDA 4PGLA 1ECEA 1OX4A 4OBTA 5DCDA 3BAIA 3TNOA 4PRTA 4YTUA 1KFCA 2PP0A 2X1SA 2ZUSA 4IZGA 4NY2A 2MUCA 2L5HA 2WBKA 1CLKA 3TQ0A 4QEHA 2YL9A 2CZVA 3U7VA 4KCVA 4MG4A 3HGOA 4K37A 1WUEA 3GAKA 2QJJA 2QCMA 3RRAA 3H23A 1NOWA 3BSGA 2P8CA 3PR2A 4AIBA 3REQB 1TZ9A 2WC4A 3PHAA 4D6EA 1G7UA 2OWXA 3P8JA 1BGAA 1UD2A 2UY2A 3PBUA 3L4XA 1FA2A 1TV3A 4GX9A 2YLAA 1GJWA 3VGGA 4GX8A 3VE7A 3WMSA 2DY3A 4FXSA 3W7NA 3N2CA 2E67A 2CLLA 4OKDA 1JEZA 2GWNA 2A4AA 1HX0A 3O6DA 1GHSA 1HGYA 1XF0A 1XRFA 2PAJA 1R86A 2VGBA 2FJUB 4BF7A 4C6BA 1BWKA 5BRQA 3WLOA 1AJ0A 4NZCA 1KM5A 4GUHA 1BWVA 4A3QA 3W4RA 1EC7A 4HOXA 4XBSA 2E4TA 4M6UA 3GG0A 3OZPA 4B3KA 3EDKA 4IUOA 4O4VA 1JYVA 1KO0A 1XIHA 1UKSA 2HZGA 3MO7A 4ZQNA 4Z1BA 3POCA 1GOWA 2OWWA 1OFDA 3O6YX 2FGZA 4O1AA 1W1YA 3MP5A 4IQLA 4V28A 1KFJA 3I6RA 5CZ0A 1MDLA 2OFJA 4DUVA 3EOOA 4RDWA 2ZUMA 3ITVA 4EPKA 2CZFA 1C90A 2E40A 1TWZA 4XKYB 4EE9A 2QUVA 1PYFA 2Z26A 3QBUA 4HN4A 3LNPA 2Z6IA 1Q65A 5I3DA 5EBAA 5TIMA 3WK3A 1NIUA 3WDIA 1AH0A 2P1FA 4NJHA 3TK7A 4DEFA 1OF8A 3R8GA 4WOQA 3C0JA 1LJYA 1J11A 2X40A 3TYBA 4XV0A 1A3HA 1WZAA 3LLXA 5DBUA 4IGSA 3A4JA 4YL2A 2BTMA 3BSMA 3L23A 3A6OA 2C18A 5L9FA 3F5JA 3T0AA 1I1WA 2WMFA 4B5VA 1DXFA 3DHUA 5I2UA 4DZHA 1XLCA 1F9CA 4LXFA 3LUTA 3QY7A 4B3LA 5JH1A 1AQ0A 3AFBA 1UW9A 5CPMA 5D03A 4L9ZA 3CZKA 2VDIA 2IW0A 2GDVA 3KCOA 2AL2B 3M9YA 1UD5A 4Z1AA 1EIBA 2AOSA 1KNWA 2UY5A 5EB8A 1IIHA 4CEUC 3DC0A 1E9IA 4PCNA 3LCLA 1CX9A 3PY2A 3SCTA 3CUFA 4WKHA 4MB4A 3SCVA 1TYGA 3VAVA 1RQEA 1ICSA 3PTKA 4JDYA 3APTA 3PPFA 5FJRA 3JVAA 4L1WA 3RR1A 2OQYA 3ZJ8A 4O57A 4GYKA 1E3XA 5D8WA 5AVNA 1E1EA 4AB4A 2OYMA 1M7PA 3INPA 5I23A 1ONWA 1HL2A 2ZRVA 3V7PA 4N9CA 4DXVA 4RE2A 4P8UA 3XINA 1GOOA 3TQVA 5EGRA 1VEOA 1XQLA 2GUUA 3AUJA 1H1ZA 1V3LA 3MZ2A 2V2CA 4NRRA 1ZFJA 4NZJA 1Q66A 3FX4A 1AJ2A 1K6AA 1LUCB 5HMSA 3LNMA 3W7RA 3LBMA 4IOTA 3C4UA 3FGCB 3HG2A 4NAFB 2FHCA 3LK6A 1RUSA 4I6VA 4US5A 4PTWA 4JICA 2I5GA 1UUMA 4PUEA 2CKSA 4ZQRA 3D3FA 2Q02A 4IISA 3E49A 4C65A 4XO7A 3W37A 4KEVA 3DERA 1UR3M 2I1OA 4PL1A 1XKJA 3QHOA 1U5JA 3WNNA 4HB7A 1KBJA 2WOQA 3UWVA 3DENA 3W87A 5E0FA 3BJFA 4B4HA 4US6A 2O9TA 4JX6A 1JCNA 2GLKA 3G1DA 5GNXA 3R25A 1KM3A 3QW4B 1DVJA 3G1SA 1DTNA 1FHLA 3BV7A 3UZ5A 2VJXA 3QV7A 3SUTA 4LGXA 1GCYA 1P7TA 1ZY9A 1HJVA 4DAIA 4S3CA 1V6WA 3A64A 4FSAA 3M5ZA 3W9ZA 4IG2A 3APGA 4DO6A 1HJQA 1JVNA 1YW1A 3O6CA 3WDJA 1J0HA 2NUWA 4RNFA 2W91A 3SURA 3C56A 4E38A 3GDBA 1UH2A 1EDGA 2BODX 4CQBA 2XH7A 4IP7A 2ZUUA 2J4GA 2VVNA 4J3TA 4HMCA 4I9MA 5AC5A 1OC6A 2Z00A 5EMLA 4IGHA 3QV6A 2BSLA 3PP7A 2F9RA 4FX7A 1EJVC 4O8AA 3N12A 3ITGA 4ICCX 5ABGA 2QCGA 4Z2HA 5MKGA 1FWCC 2OGJA 3S2NA 3BWWA 4D6HA 3NXLA 1UBSA 2GQ9A 2WHJA 3CZJA 1E0WA 4PUWA 1O12A 3OPSA 1X1NA 5AC8A 4GQRA 3UZJA 3VIFA 4GO8A 1ZJIA 1FVPA 1S3HA 3QQ1A 3DHPA 3CO8A 2XH0A 3QVQA 4J2MA 1V08A 3N2BA 5HXMA 1NSJA 1Q6EA 1P0EA 1A5CA 4N6FA 3VKAA 2PDIA 3GYEA 3IWPA 1JZ2A 1YNQA 4CQ9A 3DH7A 3IGSA 4B5UA 1H7PA 2HBVA 1J6PA 5RUBA 1JRBA 1GQNA 2CC0A 1IYXA 1JG9A 4B3ZA 4PA8A 5D32A 4S2CA 3AU6A 4F2BA 2QGYA 2DUZA 1JCJA 5A6TC 4B16A 1TRIA 1DHPA 1FCBA 3NQAA 1H60A 1PIFA 2JIEA 3IVTA 4AD4A 2BG5A 3MZNA 3HA1A 1W1A1 2O9PA 3SM0A 2PWHA 3PTMA 4IWWA 3W7DA 1TPVA 4JIRA 3EB2A 4BQ2A 2O7QA 4UTMA 1UR2A 2WXDM 4HZ7A 3VZZA 2QDDA 1VJZA 4N2YA 4D1IA 4L9YA 3T42A 3O3RA 2YCLA 4PB3A 3B8VA 3S1UA 3GIYA 3A5VA 2Q8ZA 5JBFA 2VEGA 2EPHA 1A4LA 1RVGA 3VKBA 5MF5A 3C3NA 4LV9A 4LF2A 4PR4A 2W66A 3N2XA 5D2YA 2VUYA 5FF7A 1QNVA 5CG7A 3I4KA 4Q4MA 1PHWA 2EPNA 5T26A 3MW7A 1UC5A 3IJ9A 4PYSA 1NP2A 2KZHA 5HUOA 1N7KA 4B2DA 2E7FA 3UPMA 2WMJA 3W82A 2GFTA 3O7UA 4Q7BA 4YS1A 2PWUA 2PSNA 3GTHA 4HNTA 1TV4A 2Q01A 4TIMA 3W07A 2PLCA 2Z1VA 3RITA 3CZLA 4ILSA 3MMUA 3AOFA 3FAWA 1O60A 3EGJA 3TONA 4F3HA 1DEDA 4QE4A 3RLGA 3W1AA 1FCQA 1V93A 1ZENA 2I16A 1KFWA 4YWIA 1T6MA 1DJXA 2WJEA 1S5WA 1NH6A 4MB3A 4AY7A 2WZIA 2E1WA 3L2MA 6REQB 2EKCA 3G6LA 3SRFA 1GEQA 1ZCCA 2A6NA 3H7RA 3UR5A 3POHA 3ZXWA 1U1HA 2FFCA 4C6FA 2CLPA 4AIOA 4M7TA 4BCEA 3OLGA 3KL0A 3U3HA 1TWIA 4HJWA 2C3ZA 3HO8A 5A2BA 1WDPA 2WVTA 2Y88A 3RO6A 2CKRA 5IFTA 1M01A 2VOMA 1UJPA 3KBNA 1B1YA 4JIQA 3NM1A 4C1LA 3O1NA 5CLWA 1VAHA 3Q37A 1LOQA 4H6KA 5C55A 3W6LA 2A21A 4LVBA 5I24A 3N9SA 1W3NA 2C13A 4XZ9A 4PUDA 2J13A 3AZRA 3TAKA 4JIIX 2BOFX 3ENLA 4GQBA 1B2YA 1IXOA 2VFGA 3CMFA 2J25A 3BL3A 1DXEA 3ABQA 3BUVA 3STPA 2VP8A 4NZ3A 2JEQA 4HK7A 4CNNA 1ZBCA 1VFFA 4LBUA 1F4HA 1WB0A 3BLKA 1W9XA 2FZMA 2Z28A 3ZYZA 1W1PA 3WNOA 1BYAA 4S3EA 3E2VA 3VNKA 2PFHA 1TCDA 3MS8A 4E2BA 1V6YA 3TW6A 1EDTA 1ALDA 4Y9OA 4NI8A 1GTEA 3LEPA 3MKKA 5EYWA 4U5KA 2C91A 1TJ2A 2ICSA 4MUPA 5HK4A 3NEVA 4N9BA 3A9BA 4JTTA 4QRNA 5AVHA 3JW7A 4JDBA 1ZP3A 1KC7A 4TX8A 1G7VA 2BOEX 2Z24A 1GOIA 1EDQA 2OELA 2VWTA 3SCUA 1UQZA 3LDVA 1FWEC 3MBFA 3VMOA 3WJWA 4JX5A 1W5MA 2Z0IA 1HJSA 4FLQA 4Q8VA 4UTHA 1E15A 3GBDA 3RFAA 4B5WA 4TOQA 1XLFA 3KWXA 2OB3A 4PCFA 4NU7A 1IT0A 4XAYA 1KM0A 3DKJA 2QIWA 3N9KA 1I0BA 2HEJA 3GDTA 3GZAA 3P60A 3R7MA 3VU2A 3IK4A 4Z2GA 1NELA 1BKHA 4JY9A 4PUKA 3GC2A 4ACZA 3W1MA 1SW7A 1WX0A 1FKWA 3CT7A 5AY7A 4OT7A 2J79A 2VX4A 4NRSA 4UMCA 2ACRA 4JIEA 4WSHA 1HKMA 4S23A 3EDDA 3FDGA 1MSSA 2OX4A 4H6EA 4QNWA 4HPHA 1GUVA 4GI6A 1XIGA 4H19A 3LQLA 4XIMA 4JIHA 4TUFA 2R1NA 1SJCA 1M7XA 3N18A 3L66A 3H55A 5AC6A 1MEHA 3GIQA 4MWAD 4E3VA 4S3GA 3E1F1 3R2GA 1KM1A 2WM0A 4J3XA 4LNYA 5I03A 2DVUA 2GQAA 3LN3A 1JZ7A 3LPOA 2HV5A 3WLLA 4IIFA 2WVUA 5JU6A 2OVLA 2PPGA 3WENA 3QKZA 5CGMA 3FYYA 1GQJA 1V02A 3OU8A 4GC3A 3T6CA 1K77A 2WCSA 3OBAA 2JGQA 4FALA 4MY8A 1K7FA 3MI6A 1GHRA 1ZZMA 4PMYA 4FXFA 5T8GA 4UTJA 3THCA 2PODA 1JCLA 4XAPA 3SGZA 4XG1A 2QV4A 5AHIA 4AVOA 3A47A 4E4PA 3TXVA 3C8FA 1J0YA 3EPMA 5AHNA 3FJLA 4IP5A 1VFOA 3JR2A 3QXBA 4K7YA 4ZOEA 3ANVA 1ME7A 2CLKA 1QI5A 1RD5A 3E2SA 4NZ1A 4X2PA 4DWSA 2VCCA 4XWUA 2YR1A 1O1ZA 4C7DA 4QQUA 3DFYA 3UXLA 3W7OA 3C2RA 4IIDA 2IKGA 4I5XA 2D0GA 3M7WA 1NOUA 3F2DA 2QLYA 2JK2A 4MFEA 1W9BM 2HXUA 3BJTA 2WM1A 5I09A 3ES8A 4JOMA 3A4XA 4ZFCA 3FHAA 3GG1A 1OK4A 3G1YA 3LI1A 4DJED 2Z1XA 4DZAA 2ZX5A 1PL9A 1XD0A 4ADSA 4M1RA 4MWAC 5EL1A 2G37A 4D72A 2WSKA 3N9RA 1JJKA 2XIJA 3IV8A 6ENLA 2NXHA 1I45A 5CGTA 1FWJC 4D6IA 1EJSC 3W38A 2ABAA 1HL8A 5FEWA 2NUYA 3UJ2A 3QV9A 3HV8A 3KEHA 2DSZA 1XINA 3GXMA 1PJ9A 2BVWA 1MNZA 1AL8A 4ROQA 4Q8UA 1LTDA 3VGBA 4S3BA 2CXEA 4O8RA 1QO2A 4KWUA 3GYCA 2XSXA 3UYCA 3AISA 3SQLA 3ICJA 2QQ6A 3ZO9A 4D6GA 3EA2A 3V5FA 4A3UA 4UTTC 5IHSA 5D38A 2HK1A 3DX5A 4V27A 3GW0A 5LKYA 1KCLA 3AMCA 4HHPA 3TTEA 1CNVA 4BI5A 4C6KA 4WHBA 3IIXA 4LV4A 1B3WA 4W88A 5A6SA 4C7GA 1V3HA 2A1YA 5BXTA 1CTNA 1XC6A 3THQA 4ERAA 4KFPA 1JYXA 1AMKA 4QS5A 4JAWA 4AISA 4TV6A 1B57A 1D3CA 4DJEC 3UGRA 4PMJA 1F4AA 2OSYA 4M7SA 4GGHA 1R3YA 5FJTA 4YWSA 2PLJA 1S5MA 2E9MA 4K1GA 2W27A 1XYCA 1VRDA 1DQWA 1PAMA 1XLIA 3R0DA 1GJUA 2VR2A 4I9TA 3GR7A 1ONEA 1FDZA 1TELA 1UH3A 4W85A 1KLYA 2ZC8A 1JF6A 1GOXA 1OCJA 3TAOA 2Y24A 2QPXA 1ML1A 3UJEA 3GUWA 3S6TA 3HGSA 2FB3A 2PUZA 4QAIA 4W8LA 1XLMA 3MDWA 1XFBA 1WKDA 3G18A 4C6LA 3UYIA 4FF5A 2R1LA 2VZTA 3CV1A 1X6UA 2RGMA 2VRQA 3HQPA 1JUBA 4XVDA 1VJSA 1VZWA 3BG3A 4S2BA 1LBLA 3BO9A 1OSEA 1LLZA 4QG6A 4AMCA 4GBUA 3KVJA 1AH4A 4LS1A 1F05A 1UPPA 1TJ0A 3EKGA 1JF5A 2OOGA 3PWGA 4RX0A 4HCLA 4XAFA 5KZMA 1MW2A 1VQTA 3TJXA 1AD4A 1NWSA 1FWDC 1XC4A 4LCRA 4PFMA 1Y5XA 5G2WA 3M0VA 4UQEA 4BQ3A 3II1A 3QGVA 4NQ1A 1R87A 5F1VA 4POCA 3EDEA 3BCDA 3DXIA 3BQ6A 5CZSA 1V0LA 3EWDA 3QRHA 3QMTA 4AZ7A 2BWGA 3OB8A 2C7FA 1EOMA 1DJQA 3MUIA 4XZNX 3W7LA 5HMFA 1IE7C 2XVLA 4JTKA 1RCXB 3WELA 3WKZA 4LJ3A 3WK0A 1HTIA 3MDUA 1J0ZA 1X39A 3K5XA 2GVEA 4OV4A 4BWLC 4K38A 2E9BA 4V15A 1PX4A 3RLHA 3W86A 6TAAA 1DJYA 2G8ZA 5J04A 2J7EA 1JFHA 3FAXA 1U5HA 2CBIA 1V7YA 1KM6A 2YW4A 4OVXA 1PCWA 1JXKA 4I5RA 4WEVX 1K4GA 2VGIA 2J8GA 1EJWC 2WJDA 4LUSB 2C8NA 4LEQA 5A6MA 4Q8MA 1ZB5A 3RM4A 1E55A 4CD6A 2YL8A 2GDQA 1FP9A 3VNYA 4WDTA 1LT7A 2J7BA 3R8RA 2EAWA 3MUCA 5CZTA 3CUHA 3EB3A 2YL6A 5EMJA 3AMKA 4UFLA 1VPXA 2CHRA 1J9YA 2PWGA 3VGEA 4J3WA 5FL1A 2FDSA 2RGLA 5HQEA 5D9OA 4FOJA 4CU6A 2OZ8A 3TX9A 3G5EA 3SCPA 2D2OA 3L21A 5ABFA 5DXYA 2IQDA 3JS3A 5EMMA 4XB3A 2VNCA 2WNNA 1TMLA 2CBUA 3PG9A 5CSUA 2VKZG 4RPQA 1ESWA 2YA0A 3R8HA 2OYLA 3QF0A 4JFTA 2Y61A 1K02A 1DPMA 1V8EA 4AIUA 1KRBC 1IWAA 5REQB 2V3FA 3KTXA 4Y7EA 1PWMA 1DQUA 1XR2A 3DCPA 4JD4A 4LH8A 4WOZA 4TTUA 1WYIA 1XIIA 4XO6A 1R7OA 2VZOA 4PMQA 1IXNA 3IS4A 5HWJA 1A4MA 2XN0A 4DHGA 1M65A 3Q45A 3PTDA 1RY0A 1H7WA 1XLAA 1EP3A 2VC6A 3K1GA 4YVPA 1TPC1 3IUHA 1J10A 3I7QA 5A6LA 3LRKA 4Q4QA 4O16A 3P5ZA 2Y7FA 3WQEA 1FHDA 1Q4WA 1UB3A 4PMZA 3NQ7A 2R1MA 5LNUA 3QFEA 4UQDA 2HCVA 5HWMA 5G4HC 1TPH1 5IRPA 1VP5A 2YXXA 2ZUTA 2ZUNA 4IJBA 3TZFA 2PLKA 1J0KA 1SO3A 4S1FA 1K9EA 3VCNA 4ZB0A 2VGGA 4JTHA 2PF0A 3QGKC 4H9ZA 2PC4A 1JDDA 2DFAA 3GQYA 3T44A 2EPLX 2FB2A 4ASTA 1M3UA 2X1TA 3FA5A 4GYFA 2I17A 4C6QA 3BZGA 4PN2A 1P7TB 1W56A 3RN6A 2RDUA 2OYKA 2PDCA 5DANA 5F7UA 2J24A 4JGDA 4Q4OA 4M5PA 1BQCA 5ABTA 4IG2B 3M7SA 4LYKA 4PSRA 5CJ5A 3E6EA 1AL7A 3IGXA 3VIPA 5D05A 3KVLA 1QCWA 4NHVA 3DFOA 1R6WA 5BROA 2YDSA 1S2VA 3EX6A 3MSDA 2FVKA 4AHQA 4MJ2A 1H2JA 3MY9A 3PC0A 1QK2A 1UWSA 2GUBA 3L5LA 1SFTA 1XH2A 1KBBA 5I06A 4FNUA 3GDLA 1FP8A 2PD5A 3SN4A 4E2DA 3NO5A 4FR6A 2CW6A 5DT5A 1UMLA 1TVPA 1OFEA 4ZE5A 2X05A 5CG0A 4TVCA 2OWCA 2ISVA 2HISA 1M04A 1JPDX 4DJFD 2XIQA 1TZ7A 3PK7A 2J8TA 1D7FA 2W67A 3LRLA 1BVNP 2YYTA 4JTLA 2NQJA 1DIKA 1HG3A 3DDMA 1J93A 3PAJA 4ORIA 1NY1A 1ZNNA 4GZEA 1MW1A 4DNHA 4CVUA 4DXXA 1Q6QA 3WJXA 4WGHA 3JRKA 4S3DA 2ZA2A 4FMVA 4GQQA 3LCFA 1ZJAA 2XUCA 4UZSA 5M03A 2PU0A 1RLCL 4MFDA 3RNDA 4FP1A 3C5QA 4MYXA 4QEEA 3GX9A 2A3EA 2DGAA 5CCZA 5CC3A 1HN1A 3IAQA 2J7DA 3ABXA 4LB4A 3W75A 1ONXA 4IPLA 4FHAA 3BLFA 3N4AA 1JFXA 5GPRA 1ISZA 1M7OA 2CERA 5E0CA 1IZJA 1C3FA 4GACA 4UXDA 1U22A 1WCGA 4CCEA 2JEPA 3ZMRA 3D47A 4QCFA 3RO8A 4J3SA 3IACA 2DSUA 1Z42A 1J6OA 1I4NA 3V5CA 3CAVA 1J2WA 1L6SA 1DWHM 1PZ3A 3WNPA 3PZVA 4AEFA 3O05A 2WK2A 4FPSA 1V6TA 1XP3A 3W53A 3BLPX 3ABOA 3EOUA 4HA0A 1NWRA 4UMAA 2PDLA 3LERA 2AMGA 1C8VA 2XGIA 4F0KA 2G3MA 2A6LA 1MMFA 3Q4DA 3KRBA 2WV8A 3GXTA 4DJFC 1K1DA 3THUA 4ZOAA 2Z2AA 3RPTA 3VXGA 3KBJA 3L0KA 4Y9NA 1TJPA 3UG4A 4AZ5A 2ON3A 1XH0A 2ZVRA 1RJQA 5FF0A 3CV2A 1CEOA 3LZ5A 2Q8LA 2QT3A 3T78A 3RIKA 5I3HA 4WLCA 5ABHA 4GO9A 4INFA 1E72M 4RXFA 1EO5A 2EG8A 3FA3A 5DMYA 3OLEA 1PWLA 4M81A 3KLLA 1O66A 4XAZA 3CT2A 2IXVA 4FO4A 2OX1A 2FJKA 2PC8A 1RLDA 4GJIA 4N02A 4IIEA 1F3EA 1ADDA 3RK8A 2GQ8A 4P61A 3AYSA 2IQTA 4ZGYA 2DJXA 4KT2A 4GRSA 4AZCB 3A13A 4MB1A 1W9DM 2YA1A 3TE9A 3GR4A 4E2VA 2XGBA 3DG6A 4Q4PA 4FF7A 1JR1A 3SY5A 4PUNA 1YPIA 1MYRA 1YKWA 3BW3A 2Z7GA 2B31A 1XIEA 1E3ZA 2W9MA 1J4EA 2ACQA 2NXIA 3SCQA 1YDVA 3CV7A 2PDFA 3S83A 2VXNA 2YCJA 4IP4A 1XDLA 1Q6RA 4AXKA 1R3SA 4P8VA 3W27A 3W70A 4X60A 3GG7A 1YE6A 1BXCA 1KGWA 1TX2A 3N3TA 3GNXA 3SUWA 4ZZ9A 4R9XA 1X8FA 1BLIA 2VEMA 3TOYA 4IQJA 1B5TA 3QZEA 2PRMA 4J28A 4Y9AA 3WDHA 1R3RA 5G5IA 5JBDA 3S1WA 2P10A 1T40A 1O95A 4KESA 4PMNA 3LMYA 3HURA 2E8ZA 1EQPA 3MCOA 4AXNA 2NV1A 1C93A 1XYZA 4UOQA 1Q2SA 1TSIA 5CJNA 1Z9AA 4WJ8A 4B91A 1P4CA 3FYOA 2JFEX 1VHNA 4X9YA 2EG6A 3SFWA 3EX2A 1GPWA 1ADOA 2ZA3A 3VNLA 2YBVA 2X1IA 3NA8A 3PFMA 2ZX9A 4BQ4A 1EA9C 3ARTA 1QBAA 2Y63A 3GC5A 3BCFA 2PDKA 2VT0A 3ZM8A 3H2OA 6PTDA 4F40A 1X7IA 3RF9A 4PTXA 3DBPA 4FXJA 1WKEA 2DH3A 1UWRA 1DWAM 1MI3A 4GVIA 4B9ZA 3OJGA 5SWUA 1FXQA 3B4UA 2V5LA 5FAGA 1AQFA 3KBMA 1QASA 4UNKA 1RXOB 3MQTA 3PB0A 1XV8A 3ITYA 3STCA 4Q4RA 4HHLA 5AOUA 1T7LA 2G97A 4NIRA 4JCMA 3N6HA 2XIIA 4TX6A 4IJCA 3L67A 3DHFA 4IMCA 3RX4A 4E2OA 3MCNA 2IXUA 4K36A 4FNPA 2WMKA 4CQAA 1UASA 2ZX8A 4M29A 4S39A 5A8QA 1DWIM 4PULA 4Q6XA 3VOHA 4OOZA 3VUPA 5ABEA 3NL2A 2Z27A 1V3JA 1ZS2A 3GE7A 5H8PA 1TMQA 1FWNA 2Y7GA 4HA3A 5CSYA 5C7VA 1UR8A 1XIBA 4HQVA 2EJ1A 3KL5A 1UKTA 1RCOB 3SSJA 4ZL1A 3B9DA 2A3LA 2QUUA 1OINA 1OX5A 4EX4A 5C8BB 4XAGA 1V3IA 4L1GA 1SJDA 2DZSA 2ACUA 3G1RA 1WBHA 3PZTA 4AWSA 2V63A 3Q58A 3REQA 1FDJA 3GTIA 3K30A 3WQCA 2PP3A 4LF1A 4HCHA 4KF1A 1FKXA 4GPNA 3WG6A 2ASHA 3SIZA 4JNMA 5F2LA 3QZ6A 7CGTA 4C6MA 3F5LA 5G4WA 1F73A 4CKQA 5BNKA 4Z1CA 4ICNA 1QATA 1FHUA 5KZ6A 1MZHA 1TR9A 3OG3A 3S2LA 3OLDA 2X1UA 4LBRA 4XSMA 1GOMA 1LP6A 4UBPC 3SSZA 1WV2A 1UC4A 4JTRA 3WD4A 3GH7A 2ZZ1A 3UCQA 3GLCA 4Y8EA 3R58A 2D22A 2IKHA 3L65A 3NSMA 4YCPA 1JPKA 4TXEA 2QIIA 1O7AA 1UWQA 4L1XA 3G1AA 1UA3A 3KHJA 4P7NA 1F6KA 4ZO8A 2PDGA 4NASA 2WLZA 3A22A 2XG9A 2FTWA 4QROA 1IZCA 1VS1A 1WO2A 2DPEA 4F66A 3B9EA 3BURA 2FH6A 3OOQA 3AU2A 1LL7A 1LRTA 2G41A 2GVGA 4LTSA 1PYMA 3PPHA 5FJOA 2J7GA 2AMXA 3QMSA 4HBKA 2CBVA 4Z1DA 4KFNA 4UR7A 3FJ6A 4NNBA 4DBWA 4EF8A 2FZ8A 4O1BA 2XFFA 1F6YA 3VD5A 1US0A 4GC4A 3HMCA 3AS1A 1HKIA 2ZXAA 4DWSB 3SRKA 4ERIA 1CT5A 1K8YA 4H9XA 1M6JA 2EXOA 3UZYA 1QOQA 3MUY1 4QFUA 4B5NA 5I00A 3CTTA 2FTYA 3BG9A 1ECQA 1A3XA 4KMQA 2ZTJA 1QNQA 3PZOA 5BWAA 3W74A 2PU1A 4JPGA 2H90A 4G6CA 4RE4A 3W2KA 1MFVA 1W9VA 2YDRA 4JR5A 1CBGA 3VK5A 3R79A 1GOKA 4L9XA 4EAYA 2NV2A 3W2JA 4ZXLA 2Y85A 2FZBA 3FOKA 2OLSA 3T08A 1SO4A 2OXNA 1G4PA 3G1FA 3UBPC 3DYMA 4GXPA 4ZR8A 4WDWA 4DM2A 1HP5A 3B3DA 5BOFA 2YZRA 5FA5A 2QGHA 4XSLA 3WQ6A 3ARWA 3DAQA 4U4MA 1FUYA 4JTGA 3RMJA 4DBSA 3TW7A 2V5JA 4PBEA 3N6QA 3W1UA 2DZUA 4W7VA 1XL9A 3GZ3A 1XCWA 4Q6JA 2G5WA 1ODUA 1FWBC 2VHLA 3K2GA 2BHYA 4S3AA 3EWXA 3W7QA 2X7WA 3QSTA 3W01A 4Q22A 4RLIA 4Z08A 5C71A 2ZZ4A 3STGA 1GQKA 1UQYA 2RHGA 1JNDA 1RBOB 2WMIA 4E8DA 2EPOA 2WCGA 1G9HA 1RJPA 3S5OA 4J2PA 1KTCA 2WW5A 3R6IA 2NZLA 3C0QA 1H62A 3T9PA 3BGGA 3OGRA 4A05A 4JFUA 5LHFA 1EX5A 3GH5A 4OQVA 5JXQA 1VIWA 1I2RA 2OEMA 2OT1A 2F6XA 3C2FA 1NF0A 1UUOA 4WY0F 3WLPA 1V3MA 3OEXA 5IXEA 4Q8QA 4EANA 2X16A 4WZHA 4PCSA 2VL4A 1H61A 2POZA 3GNDA 1SPQA 2GJRA 4IH3A 1J5SA 1HKKA 1H4PA 2DZTA 4AC1X 4IQDA 2XWEA 2PP1A 3FN9A 2QEZA 1ME9A 5FJJA 1J01A 3WD0A 1NU5A 2NLIA 3NPUA 3FKRA 1HF6A 4NJKA 1N8WA 5LNVA 5C6MA 1PKNA 5DFAA 3VIOA 2G3NA 2WQPA 1J0IA 2ZRZA 4L7ZA 3NQ6A 3VKJA 3WH7A 2GGJA 1Z44A 2PBOA 1LUCA 2G3FA 3UWEA 4OTKA 1XCFA 1Z48A 4ZCWA 3V75A 3ORWA 3WUEA 3PJWA 5AZ1A 1RK5A 3OA3A 4F9DA 3U5UA 5A1AA 1V6UA 2G4FA 5DRIA 2OEJA 1E0UA 2ZX7A 1XX1A 1IXPA 1E4IA 2VX7A 3M5YA 3FYPA 3WZ0E 2Y2WA 3NQVA 3TP4A 1BF6A 3SJ3A 3WX7A 3WLNA 1AW1A 1P6BA 1QUMA 4AC7C 3CPUA 3PANA 3AICA 3VUSA 1Q13A 3W83A 3T2PA 9XIAA 2WLYA 1U83A 3M64A 2P53A 4JHZA 2FVMA 2V38A 4GNVA 3M46A 1B0IA 3QPEA 4P8XA 3IJQA 3NEHA 3BQ5A 3WBXA 3LXBA 3S2CA 2A3BA 4ZTYA 4XZIA 1EBGA 1FRBA 2QDHA 2WZHA 3VDCA 5D8ZA 1EUNA 5I02A 2PMQA 1UJQA 1YHTA 5IOBA 2A3CA 3B97A 5CXPA 1D9EA 4IICA 1P1MA 2W4XA 5A6AA 3EMCA 3LCWA 1NTHA 2NWSA 1NDZA 1R3WA 4UOJA 3QC0A 3OHMB 3VNDA 3ALFA 3W88A 2C15A 2C1IA 4YTRA 1LYXA 3CWOX 2QF8A 3K4WA 5M3WA 4U33A 5E5CA 2F6KA 4QLKA 4I7VA 4AX6A 1P43A 2V9DA 3LLDA 1US2A 2JQXA 2QKFA 2X2YA 4H7CA 2QCNA 4C5ZA 4BR1A 1W3LA 2CLIA 4F4RA 1FH9A 2DSKA 2J6XA 1JNEA 4HSHA 4WY0A 3RRXA 1IZKA 4BY3A 2XH4A 2A7NA 4IIBA 1S5NA 4GD0A 3GVQA 3TZNA 1BTCA 4N42A 1GKPA 5HJXA 2O92A 4NG3A 3KBWA 1PB0A 2VR5A 4G9PA 2CITA 3TQKA 3RM9A 3WJZA 4UFKA 4J35A 3SECA 2WZEA 1SQ7A 3WLSA 2SFPA 4BKNA 3H7UA 3PVFA 2EJAA 4YVVA 1E5NA 3GVWA 4CQ8A 4KETA 4A35A 4AF0A 3H4GA 4AHPA 2G3IA 2I57A 3P6LA 1R2TA 1DYSA 5BXRA 3MMTA 5BRBA 3R0KA 2TYSA 3GB6A 1EJRC 2Q3OA 1W3KA 1VCGA 4WKAA 3NQEA 1KGUA 3CHCA 3W6MA 3TLLA 4NILA 1L8PA 1TKKA 3GXFA 5JIWA 1QNPA 1EEPA 1PVNA 3G6MA 4AEOA 1Q7ZA 3PJTA 4Q4SA 2VZVA 4ATDA 4LYRA 1EYWA 1RBAA 1S2TA 1ZP4A 3KOZA 3QMRA 1Y65A 3N19B 3KLKA 2ZZ5A 2I7GA 1E9YB 3G24A 2VX5A 3KS5A 3F4CA 3VNZA 4IFKA 3TR9A 3W29A 2D2HA 3O0FA 5J8LA 1ZBWA 3LZ3A 1UWTA 2VCAA 3NDOA 4JYFA 3LU2A 2WZMA 2CIPA 5DRCA 3KAOA 3M6DA 5CBBA 1VYRA 4RE0A 5CPTA 8CGTA 1M7JA 2VYOA 1O4UA 4HK5A 1JQXA 4K1WA 4NUWA 5ENLA 2Z4GA 3ZT6A 3E02A 4UQ9A 4Y8FA 4BQ5A 1EA0A 1G4SA 4PMVA 3HFTA 2DVXA 3TU9A 1G4TA 3SFKA 2VEIA 1R2SA 1SGJA 2BP1A 2XH2A 3M0LA 1US3A 4PODA 3R10A 1O5RA 3RX2A 2X8RA 3AIVA 3UY8A 1FFQA 1NEYA 1OGBA 1KM4A 5T9CE 4K39A 3U48A 1LORA 2G3JA 4U5IA 1Q85A 3SIMA 1MUCA 3CMGA 4G7FA 1EXPA 2ZWYA 4IPJA 1LRNA 1KB3A 2OQHA 2FMNA 1SZEA 3VX0A 1XW8A 4GH1A 2J6VA 1GW1A 1L0PA 1GKRA 4Z2JA 1QOXA 2HPIA 2ISDA 1KCXA 4HA4A 3VFLA 4BK9A 1W3IA 5CAHA 3K1DA 1R30A 3SCRA 3FV9A 5I3IA 3WF0A 1GYLA 3L0GA 2BZNA 2B4GA 1WDQA 3W7MA 4LX4A 3LMZA 1I2OA 1LLOA 2HMCA 2QJMA 2JKEA 3WFZA 2PI6A 4QNEA 2Y0FA 4YXGA 2QJIA 3FS2A 1X97A 2WVSA 2BVYA 4DBUA 5KITA 3V1HA 1E6RA 4WR3A 2GSHA 3KDNA 5CH9A 2EF9A 2UZ9A 4JTJA 1V03A 1GKQA 3N2TA 1PKMA 5D33A 3TYCA 1HP4A 3DFPA 2F6UA 2POTA 2OCZA 3LCGA 3BOXA 4LVFA 3MO4A 1HKWA 4JXCA 1EO7A 2P3ZA 2QULA 4UFHA 3M44A 3QFWA 1W6TA 3NL3A 4XZWA 3BE7A 2R14A 4FLSA 2GJXB 1GT8A 1M9HA 4O1FA 4DI9A 1O5QA 5LIKX 4A2SA 3RCYA 1W9PA 3NZRA 4H9UA 1ICPA 4HYRA 1C7TA 4IL2A 4FLRA 2XFYA 1A5NC 3C2OA 2GGEA 2DORA 1VKFA 3UJFA 3LHYA 2BY3A 3RU8X 3BGAA 2XFWA 1YMYA 2CYGA 4F2UA 3U9IA 1MDRA 1XLGA 3IIPA 3GKFA 4A8IA 1EJ7L 2HE8A 3VIIA 3EA3A 1VLIA 3N29A 1JPHA 4XD6A 5D2WA 4KRUA 2OMAA 1AZ1A 1E6XM 1FWGC 1W5QA 1MEWA 2NV9A 2CBJA 3D3AA 3CHVA 4RZBA 2Y70A 4NYYA 4JX4A 1VFUA 4W7UA 2DW7A 1DWFM 2UV8G 4QJ3B 2OO0A 3GXPA 1BG4A 4V1YA 5HUPA 2FZDA 2I14A 1KXTA 3B06A 1AH3A 2JALA 2OT0A 1LG1A 3IUDA 5D9MA 3MMDA 2NQHA 2O9RA 5A8PA 4IIGA 4IFOA 5AYBA 3N73A 1DJGA 1YPXA 4YN5A 4CNSA 4D2JA 2C0AA 2V0TA 1W5NA 3F4DA 2WSRA 3P84A 5CPLA 2NSXA 4TVDA 1V0MA 3S9ZA 1LBFA 2ZXQA 1CLVA 1GONA 4P5UA 1ADSA 1PDYA 3EPNA 2QCLA 4OGZA 2XSBA 1XYLA 4HHMA 3LCIA 1KBKA 1R9YA 4UTLA 3AIWA 1MUMA 1CZ1A 5EFDA 3EXSA 3R1ZA 3WLTA 3NQFA 3NM3A 5AHEA 1F61A 1E70M 3QQ0A 4FNRA 1C9DA 2Y5EA 1I2PA 2UY4A 3ISIX 1P0NA 3OBKA 3ZT5A 1CIUA 3GNOA 8XIMA 5JH2A 1A5BA 4JQ3A 4H41A 5C9UA 4QJ4B 3SAZA 1EQCA 2PCQA 3TYUA 4BF5A 4Y6GA 1MW3A 4HU0A 2EG7A 1UD6A 4HPNA 4OUEA 4KW2A 1QWKA 3WNLA 4PL2A 4PMOA 3ZVHA 4KWOA 4FEZA 4UOZA 3N14A 1QK0A 4GKTA 3N04A 3SZ8A 1Q7QA 1ISYA 1S38A 1JI2A 4MNJA 2XTKA 3WD3A 1IEIA 3OTRA 1TPB1 1GVSA 2UY3A 1UMYA 2ZDRA 1V02E 1FWSA 5DELA 3N17A 1SSDA 2YZ5A 3QQWA 2F38A 4W7WA 3UFYA 4M3PA 5H6HA 2ZRWA 3O8AA 1FCVA 3W1TA 1SZFA 3D6NA 3ATZA 4O12A 4XQ6A 2BXVA 3MSGA 4KEUA 4RL3A 2DP3A 1AODA 3WBAA 4UTUA 3G8RA 4RZ6A 3ES7A 1HZYA 3T40A 1OX6A 5I07A 4ZFMA 2I9EA 1VC4A 4GA8A 3AJ7A 1CDGA 5DY3A 2X42A 1LG2A 1DE5A 1WXZA 2PDUA 1DXIA 5E70A 3NL6A 3B0YA 4D6FA 4PH6A 3VZXA 3EKZA 1SSGA 3E3HA 2GZXA 1JAKA 4H8UA 1BWLA 1FWTA 3E38A 3WJYA 1TVLA 3OIXA 4J27A 4ZOBA 4MM1A 1X98A 2VC7A 4HMNA 2C14A 1VBGA 3I3DA 4M24A 1ME8A 4NXSA 3H21A 1OC5A 4UNIA 3V18A 3SR7A 5AB3A 1YADA 1X8CA 1GK8A 3IVSA 4G56A 2QCFA 3WCZA 3CUXA 4PUUA 1R85A 3S1XA 3CAWA 3S4TA 1KWKA 1L2UA 3QY6A 4J4KA 1GORA 3EOEA 3MP3A 5B7ZA 2Q3RA 1D8CA 1H0GA 2WC3A 1KXVA 2EO7A 4NI3A 5XIAA 3WLHA 4NNAA 3K4DA 3TSMA 3V36A 2A7PA 5KZEA 5DN1A 3LB0A 3TTQA 1AW5A 1F6PA 1E6QM 2VWSA 3ZLHA 1VBHA 2GJNA 2I56A 3LTSA 4IGNA 1PX8A 1V79A 3DG3A 1VIZA 3BCJA 4QTGA 4CD7A 5DO8A 1Y5WA 1XH1A 4XZBA 3WK2A 3ARSA 4Q7IA 4CU8A 3EEGA 3KTCA 4AH7A 4IF2A 3UNTA 1UOKA 3ZJKA 4GCXA 1X96A 1W31A 3UCCA 2J77A 1R0MA 4NJIA 2ZYFA 2OKOA 3TMQA 2MANA 1QHZA 1RCQA 4PBFA 3S5NA 3VIKA 3V5OA 5LA2A 2GL5A 4YTSA 3CL7A 4JKMA 3V3WA 2PDXA 3KZSA 5BXPA 2XN1A 4PEKA 3N34A 3BLDA 1EPVA 4KWVA 4UQBA 4PMDA 1BD0A 3AROA 1UR4A 2X1RA 5F2IA 3O16A 1UROA 3L4ZA 4JTDA 2D2JA 5AKQA 4E8CA 3W2NA 4RZ4A 4Y9PA 4LPCA 3BOFA 3L4TA 2HDJA 1C8QA 1LM1A 3GDKA 3VVGA 2QVHA 1DOSA 5LNWA 5A6BA 2DJLA 2ZE3A 1VCFA 4QE5A 2Y62A 2JF7A 1EXBA 4W5ZA 3MT1A 3L2LA 4P2VA 2PBGA 3NCOA 4WDUA 4IX2A 2DIEA 3ZR5A 2RH9A 2BGSA 3RMEA 1LQ2A 4J3ZA 2R82A 5D4YA 4GVGA 2F2HA 1W91A 4ZXOA 3DKLA 2EKGA 3CZEA 1WDRA 3NPWA 3BAYA 3ARZA 2GJLA 3M07A 4FR1A 4XTDA 4OU1A 3QN3A 4O1EA 3TUUA 1LWJA 1B3ZA 1XUUA 7A3HA 2OZTA 2Y6ZA 3N13A 3TN6A 3C2VA 3WN6A 1JYWA 1UP2A 5HDRA 4GQ0A 4TV5A 3BSHA 3MHFA 2GSJA 1HO1A 3WQDA 3LPGA 1RA5A 4CN6A 3G1HA 4IL0A 3HG3A 3L5MA 4URIA 2DDXA 1ZU8A 2VRKA 4CD5A 4B5XA 4RKAA 1XKYA 3PZMA 4FXRA 1TV2A 3MSYA 1H51A 3EPOA 3VGHA 4ZQOA 1J18A 2Z6JA 1AA1B 1IEVA 3WQGA 3EOLA 1H5VA 4QDMA 3LM7A 4I8DA 3VIHA 2J62A 3G2GA 3XISA 3TC7A 2YX0A 4C91A 3ZVIA 2C6QA 2P50A 4FLOA 2PTYA 4L6HA 3MC5A 3TYAA 4H01A 3W71A 3PBWA 3WF4A 4X61A 1I60A 2WMIB 3NDZA 4LUSA 4U10A 2E5CA 3W7EA 4JNYA 2W5FA 1XG4A 3H2FA 5KSWA 3UJRA 2HPMA 4LUTA 5D2TA 4H4IA 1F3TA 2PDMA 3TYDA 4AZ6A 3W1RA 1RH9A 1P1XA 4C6DA 3KP0A 1U1JA 2P8BA 4OOUA 4ZO6A 5LXEA 1CCWB 3LGEA 3WQWA 2GQ3A 1FHVA 3ZQ9A 4QG9A 1YDNA 2E9LA 1JDCA 3VA8A 5K7JA 4CCCA 1HJUA 2QR6A 3BW2A 1DJZA 4REQB 1GG0A 1OCNA 2WKLA 2F61A 1GZGA 1G01A 1FH8A 1ZSXA 2XISA 5D2XA 3UEQA 4D8ZA 2E8YA 4UQAA 1HT6A 1UP0A 2MNRA 1SZGA 5REQA 4GJJA 4O53A 1IR1A 4LUIA 3BTNA 1E51A 2OPJA 3TXZA 4LAKA 2TSYA 1LF1A 1EJUC 3ITCA 5BOEA 3AZSA 4LALA 2PCEA 2ZCGA 3AXIA 2DZWA 3WF2A 4C90A 1M53A 1RPKA 2ZUVA 4PUMA 1A0CA 5PTDA 2QUTA 1V51A 3H2MA 1TX0A 3UZZA 2AL1A 3DI1A 2GGIA 1PTAA 3VGFA 3HJZA 2REQB 2IKJA 3VOJA 4XBKA 4P7QA 1ISXA 2E6FA 3IANA 4HU8A 3OG2A 4DNMA 2OU4A 2WQDA 3K8LA 3H26A 3OGSA 3S5YA 2YCKX 1QVBA 3F2CA 4LYPA 4DI8A 3NYDA 1F74A 3WLRA 1OG0A 3PZIA 3WBYA 4LBSA 3YPIA 1X38A 3HIJA 5A8MA 4QJ1A 1RA0A 3DFTA 2V2HA 2J9ZA 2QZRA 2IPWA 3L2IA 2BBFA 3ZWSA 3PJXA 4WSJA 1DV7A 1WXJA 4MDPA 2AQVA 4O28A 2FIQA 3L68A 4EWJA 1SVDA 3EEZA 4W87A 4AVNA 1OF6A 2A3AA 1GVEA 1QFEA 5I0DA 2PRLA 1YXDA 3GVGA 3IRSA 3LBOA 4RJEA 3MKVA 4AFYA 1DIOA 1TR1A 2AKMA 1S46A 4ADUA 1TUFA 3RHGA 3GU2A 4U28A 3WD2A 3SCWA 1H09A 4XZHA 1UKOA 3GFZA 4L64A 3CNYA 2X2GA 5HA7A 2NXGA 1DIEA 1VCVA 4K7VA 4NL1A 5LHEA 3GHSA 1W9UA 1LOSA 3WBEA 4IFRA 1XIJA 4FS9A 3S1VA 1NARA 1Z41A 1MQQA 3VD4A 3IPWA 1BXBA 3WUFA 3PTQA 4WY0B 1IHIA 5D9NA 4CUCA 2HVMA 2WAGA 4MVAA 4JTEA 4WDXA 4JYDA 4YHEA 1JGMA 3TTSA 3UR8A 4Y9MA 1EWEA 1H50A 3HGJA 4O0ZA 1AD1A 2Z1KA 4S3KA 5U4NA 2OQLA 8A3HA 3L12A 3GXDA 4L4OA 3BH4A 2V67A 2DU2A 3S0CA 1WDDA 1CXIA 4QLJA 2DZVA 4AF0B 2RKXA 1KTBA 1H3GA 3U2EA 3U4FA 1EF3A 1D3HA 5A2AA 3KE0A 1TPWA 3UCDA 2DZBA 2ZZ2A 3TYEA 3FXYA 3N3MA 3CK5A 3EX4A 3WFAA 3Q67A 5LIXX 2PB1A 4R5EA 2HROA 2YSWA 1POKA 1K03A 2TMDA 1X1ZA 3KRUA 3AXMA 4N9DA 3OYXA 3ME3A 1W3JA 1D8WA 3PAOA 3BK0A 1LOLA 3IGUA 2VTFA 1XICA 2E6AA 2OLAA 1Z32X 3N11A 2H8ZA 4RDYA 1SR0A 2PZ0A 4IFKB 3PB2A 3VIMA 4LB3A 7REQA 4X2RA 3AHVA 4PC8A 5G2IA 3RLUA 5HINA 4F0SA 4KWSA 5EY5A 4XKMA 3T4WA 5CZJA 2Z2BA 4S3FA 4W93A 4EAMA 1H7NA 1ZJBA 3STEA 3SN1A 2DEPA 4XX6A 1U5VA 4JFVA 3PM6A 3VIGA 3NUKA 1QBBA 1NFPA 4IMAA 3GTNA 1WP6A 2E6YA 4KWWA 3SY1A 4BEQA 3WDPP 4YJ5A 3VCCA 3AIRA 3SBFA 3B8TA 1SMAA 1Q6OA 3USBA 3F2BA 3VMPA 2EBNA 1GQIA 3CS2A 1GVFA 3R4IA 1XYAA 2AAAA 2WVVB 3GVRA 4AIEA 3E96A 4EXAA 1MXGA 3S3GA 1KV5A 4PB5A 1FXPA 5I7GA 4BI7A 3AQUA 1JUEA 4P8WA 1N2VA 3OQ8A 3CL8A 5C0QA 1GJPA 5TQLA 4RUBA 1HVXA 2CCRA 1JPMA 3G22A 4AYSA 1MEIA 2V30A 2VDGA 3B9NA 2ALRA 3UXAA 3XIMA 2YXOA 3PNZA 3LM3A 3TJ4A 5BCAA 3WEOA 2AQOA 3N15A 1E0TA 1FY6A 1V3KA 1VF8A 1IV8A 4NJJA 3TNBA 2QUNA 1P0DA 3WIJA 3M41A 3UJSA 1J0JA 2OZ3A 1XBXA 4AZCA 3SUVA 1BSLA 2CU0A 1R3VA 3N2OA 4K3ZA 4PCTA 3Q2DA 3TCEA 1H49A 2NLYA 3TFCA 1OB0A 4MAZA 3BAJA 3CZ8A 1I8JA 3HQOA 4EKJA 3C0SA 5EU9A 1A47A 1TTPA 3EX3A 3EWYA 3LXAA 2OKTA 3TDFA 2C79A 3C8NA 1KW1A 3PSWA 4WVXA 3H53A 1AQHA 1A53A 5FAJA 3AAMA 5CGQA 3F4NA 1P5BA 3WQOA 1TWSA 3KUMA 3CUGA 3NGJA 1UWIA 2F84A 4IPNB 3N4FA 4IMDA 4CN4A 3TOPA 3VCRA 2R9RA 3SGUA 2VC9A 3O07A 3LHUA 2Q6ZA 4X3ZA 2IKIA 3GHRA 4EP8C 1EGZA 3HPZA 1QI0A 3VGDA 1TWDA 1Q6LA 4ML9A 3W7JA 1IEWA 3GDRA 3KOXA 2X0SA 2DW6A 4GYPA 1IQ8A 2HXTA 3G0XA 1TMHA 2QVNA 4HYVA 1U33A 4WRHA 4IPIA 3W7HA 1OWQA 1W1B1 4HKPA 3OP2A 1EC8A 3GS6A 3FEMA 1R2RA 2D3NA 2D73A 3DGRA 1JD9A 3MA8A 1A49A 4KGLA 1PO9A 3T0DA 2OOFA 3NTYA 1ZQ5A 3CO4A 4BEUA 3W7IA 4M0XA 1JDFA 4Q3MA 3QR1A 4DBDA 1IIGA 2FH8A 4NNCA 1OT2A 4K6AA 1RK6A 2NX3A 5E93A 2FZNA 2WANA 1IGSA 4XIAA 3HOJA 4QE1A 2VEKA 3UP8A 3FEQA 2WBGA 2CEQA 3AHXA 3DHDA 3ID7A 1CECA 4US5D 4RW3A 3EBVA 3MUZ1 5JMUA 3NFUA 1V77A 4QP0A 2NVCA 4DF1A 5LGZA 3C6CA 1VJIA 2CLOA 1TO3A 3CQKA 4R3UA 2D0HA 2OEKA 3BAWA 1RQHA 1ISVA 4QS6A 4GY7A 3CHEA 2ISWA 4NVTA 3NPVA 3ABRA 3C61A 3M6YA 2PWVA 2XPKA 3ATYA 3EWBX 4JTQA 3LRMA 4FOKA 1XCXA 1CWYA 4AY8A 3GK0A 5B7YA 4YVXA 3W00A 3PZ9A 2EEXA 1EWDA 4R7WA 1BRLB 3UU0A 3R12A 4X0NA 2OG9A 1YE4A 4KGJA 4J40A 3NQ2A 4LS2A 1TQXA 1RV8A 4CN1A 2V81A 2CLFA 1LDCA 4UCFA 2WKJA 4C6OA 3T81A 3MJYA 2PDWA 3AIUA 3CUZA 4HPGA 1WBJA 3KX6A 3COTA 3IJ7A 4RR4A 1I0DA 2OSXA 3TKFA 4XZMX 3P93A 6XIAA 3FW6A 1EIXA 1GVIA 1XYFA 1HKJA 3S6OA 1H7XA 1EOKA 3ZVHB 4JNZA 1NDYA 4DO5A 2WJZA 3MWAA 1LZOA 3H22A 5LIYX 3T0BA 4IJRA 3HF3A 1K6WA 1PBGA 5BU6A 3TH6A 3S5SA 4RDZA 2DVTA 4HZMA 5AHLA 3N6JA 5LYRA 3NQMA 3NPXA 3WD1A 2WKGA 1NP0A 4CD4A 4LANA 1NF7A 3NZ1A 3BAKA 1XLLA 5FJUA 1PX3A 3VE9A 1KTNA 1JZ5A 1CB2A 4LVAA 3B04A 1B3YA 1B4EA 1SZNA 3M0HA 1QPOA 5C9RA 2P5NA 4H7VA 1Q6CA 2VD8A 4YNGA 1VD6A 3QLLA 2O7SA 4GMEA 3WJSA 3PWAA 4MPKA 5J5DA 3M47A 5GNYA 3HG5A 1W3HA 3LQGA 2DUAA 4MNLA 1XRSA 4HNLA 4A8LA 2AKZA 5A8GA 2YB1A 4KCTA 3AXKA 3FSTA 2JKAA 3PZUA 3GNNA 4QM1A 4BJHA 3MYOA 3OBEA 6CGTA 3N1AA 8TIMA 3PULA 4Y96A 7ENLA 4AW7A 2FKPA 3FJ4A 3TMLA 5CPQA 3VFCA 1QNOA 3R5EA 4H9YA 2YJQA 4JIPA 1DL3A 3FFSA 4FNTA 3ZLGA 3ZZ1A 2ZVIA 1UD4A 5BMXA 4FAMA 2DT0A 2V6AA 2VFEA 2P0OA 2X7VA 2XIOA 4X63A 3FLUA 4GZ7A 3UXKA 1GVOA 1TTQA 3PUOA 1S3TC 2WPBA 2PDNA 1GVRA 1JCYA 1DKWA 1PV8A 1SFLA 4HZ6A 2IPFA 5E09A 4UR8A 4A3YA 2HSAA 2F8QA 5IFPA 5JBEA 3NOYA 3QYSA 2BNJA 2OSWA 1QT1A 3QTGA 1E6NA 3C86A 4GIRA 3TJLA 1M5WA 3CH9A 3UPBA 3CWNA 2G0WA 1T99A 4NX0A 7TAAA 3P74A 1QXLA 3RYSA 3CWHA 2KX9A 3AYRA 3E0FA 2Y5SA 3NAVA 2DT3A 3TFXA 1Q45A 5CPOA 3UA3A 4YCOA 1AVAA 4B2DD 4O0KA 1OIFA 4MJMA 5LNRA 4GLEA 2ATSA 4ZVJA 3W1NA 4DB7A 1FQ0A 5JVLA 5HATA 1J96A 3AIEA 4D71A 1H11A 3WLIA 4P7OA 1SFJA 1AZ2A 3ZLFA 5FACA 1CXEA 2GPTA 3CAQA 1E6SM 3V0UA 3W6YA 1XS2A 1SW0A 4NT0A 4PFHA 4AQLA 2VD9A 1X6LA 3VKDA 2YL5A 1GZJA 1Y0EA 3DYOA 4AX7A 2EPMX 3URBA 1E1FA 3SGGA 1EC9A 3PF3A 4DO7A 1AQMA 4M6PA 1PDZA 4HK6A 1EBHA 2DQWA 4UTIA 3BJSA 5M17A 1SZRA 4GIYA 4MHBA 3LV5A 1PSCA 3KS6A 4F0HA 5HJYA 4HPJA 1VPYA 1KQZA 1G4EA 4JEQA 1J8VA 1SYTA 1CB7B 3UR7A 1MRQA 1GGOA 3GH4A 4Q33A 3IJ6A 4GVFA 3WNKA 4MDOA 4FOUA 3VABA 1X6NA 2FPVA 3QTPA 2VX6A 2PURA 1BG9A 4JEJA 5G2HA 2J7HA 5T9BG 4TQTA 5K3VA 4ZTXA 2CWXA 4QITA 3L4YA 6ALDA 1TWWA 1VLWA 3WF1A 1G1YA 2VEFA 9CGTA 2VFDA 4BF9A 2C1HA 3QKEA 4MUZA 3NURA 3UW6A 4LAOA 4M6QA 5GVJA 4H6RA 1DJIA 3JZEA 2XIBA 4CEXC 5A6KA 4E0CA 1OK6A 1XPYA 3I3EA 4PUJA 3EYPA 3VNIA 4U2YA 3BICA 4D6JA 1UR0A 3M0YA 2C1GA 1VYSX 4M19A 2Y7DA 4AHOA 3IIVA 4AD0A 1AW2A 1EYEA 4MF4A 2PS2A 1YLVA 3S46A 3ZFHA 4GNKB 2ODOA 3URAA 2VQUA 3V1PA 1R3TA 2WNQA 1C9WA 4NJGA 3K46A 3EX1A 3G0SA 1BQGA 5L6UA 4UR9A 4C60A 1WNOA 2C71A 2BOGX 4QDWA 3WL1A 1R5YA 1KA9F 1Z69A 1UKQA 3T1GA 1WDWA 1BHGA 1JXJA 5M2FX 1TRDA 1UBPC 3NOEA 2HNEA 2XN2A 5AC4A 3V16A 2R91A 3MUXA 5EA9A 2YW3A 3EWUA 3LV6A 1MFUA 3WLQA 4LUTB 4BS0A 4Q8WA 4AAJA 2Y7EA 2DSVA 2RUSA 1H7OA 2ZRYA 4AD3A 4G8TA 3B40A 3TC3A 3UT0A 3JU2A 3C2EA 1F8MA 4MOZA 2VC5A 5F1UA 1AG1O 3ELFA 3B9OA 1OIMA 3OVQA 1H1YA 2PDBA 1BVWA 5BZAA 5CBJA 3UETA 2J74A 4XZLX 5CPNA 4H9MA 5CQ1A 1E5JA 4AYGA 3CQHA 4XUYA 3I68A 2XVNA 3SN0A 3E0IA 1XSKA 1YNPA 3ITLA 2XVKA 3GWQA 1A5KC 2PGFA 4RXGA 3CLMA 1O5KA 4V33A 2PDJA 1J5TA 1ODZA 3SY8A 4L56A 1VH7A 3D5HA 2XVGA 1DQXA 4ONVA 4GYPC 4PZVA 3P14A 3H7VA 4JHMA 2R24A 2BX7A 1H0IA 5T91A 1Q3NA 1SU5A 5TAOA 3CIVA 5GQBA 1W8GA 2V5DA 3EKLA 4W8AA 2E0PA 4Q4KA 5EBUA 1RP8A 1IT7A 2YCEA 1VPQA 2XU2A 3BXWA 2CNCA 3IV3A 1EP2A 5HWNA 2X30A 1CLXA 2ZICA 3VC6A 5FEXA 1XISA 2NW0A 2OLHA 4ERGA 5EMKA 2I5QA 2ZDSA 2JBMA 4J1OA 3P81A 1IEQA 5AYYA 1KBLA 4EWND 3BARA 3KP1A 2FTPA 1VEPA 1LL6A 1L6GA 1L9WA 1AK5A 1Y8BA 4H8HA 2NT0A 4V1XA 5D9PA 3VILA 3VD7A 2JE8A 3ZT7A 2X0YA 4GYJA 2PGEA 5AECA 2E09A 1IWBA 2FGLA 5ECUA 3GO2A 1LCOA 3U0HA 1HIZA 2DT2A 1IF2A 1EEXA 1XQKA 1G5AA 2J88A 4Q8NA 3AS2A 2XWDA 4DWSD 2ZUWA 2XZ9A 4CNTA 4GG9A 1P48A 1EHAA 4CCDA 3PBYA 1W1ZA 4JTAA 9RUBA 1A0EA 4K68A 4UB9A 1R9ZA 3WQ4A 4JFWA 3IAPA 1QDSA 2YKKA 3CMJA 1A5MC 3V0SA 3S8HA 4WD0A 1UZDA 4GHRA 3GTFA 1UWUA 4JL1A 4EIVA 3H2CA 2R6OA 2V3DA 1ZJHA 1L6YA 3OVPA 3RG6A 1GYMA 2XZ7A 2CETA 3WDQA 1NDWA 1JZ8A 3DESA 1P6WA 2HRWA 3C0LA 2INFA 3GC4A 4ZSUA 2XYLA 3CIWA 2QJNA 1ZTVA 1Z6KA 1S2UA 2PTWA 5HAOA 3IGHX 9XIMA 3HPAA 4OUIA 1FOBA 3T4CA 4K2SA 1XSIA 4YIWA 2P3EA 3NSNA 1QHPA 1GZ1A 4H6QA 3PUEA 2RAGA 4DBEA 3OZOA 4CNOA 2ZE0A 4Z42C 3VPLA 5DF0A 4AWEA 5LSMA 1GVYA 3MMWA 1EP1A 3O2LA 4O11A 2ZA1A 4ZA0A 3AALA 1KFKA 1M41A 1VGAA 5BU9A 1XG3A 5A95A 5K9DA 2G96A 5CC5A 4CVWA 4MWAA 4GUGA 4D9PA 2WMGA 5C9XA 4Q8TA 5F4XA 1DTUA 5HNRA 3T8QA 2G50A 3IIZA 4DUOA 1OYCA 3P62A 2GJXA 4DWSC 4JYEA 1XLEA 2VDHA 5DEZA 2PZNA 2FFIA 4CQCA 2F7FA 3LYEA 3IK2A 3UG8A 1MUWA 1MW0A 2CESA 3FIGA 4TX9A 2GDUA 3JZUA 1WAUA 4GZJA 2ZXBA 2G95A 3ZJ6A 5HR6A 1DE6A 2A85A 4C6PA 2E5BA 2QV5A 5FF3A 3GXIA 2FPTA 1XBZA 7REQB 3M5XA 4Q7NA 1I2NA 3EMQA 1QTWA 2XFRA 4DLFA 4HPXA 3T7VA 4J7RA 1FCUA 1ZUAX 1TUXA 2B7NA 4GGBA 1Q6GA 2FQIA 3BOLA 4MY1A 3TSDA 4KCWA 4U3AA 4A6GA 4AD1A 4UTTA 3NL5A 3SJNA 3W25A 2KAUC 3H4WA 2I9UA 1H1NA 1QPKA 3WEMA 1XLKA