2CLPA

Crystal structure of human aflatoxin b1 aldehyde reductase member 3
Total Genus 114
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
114
sequence length
323
structure length
323
Chain Sequence
RPATVLGAMEMGRRMDAPTSAAVTRAFLERGHTEIDTAFVYSEGQSETILGGLGLRLGGSDCRVKIDTKAIPLFGNSLKPDSLRFQLETSLKRLQCPRVDLFYLHMPDHSTPVEETLRACHQLHQEGKFVELGLSNYAAWEVAEICTLCKSNGWILPTVYQGMYNAITRQVETELFPCLRHFGLRFYAFNPLAGGLLTGKYKYEDKDGKQPVGRFFGNTWAEMYRNRYWKEHHFEGIALVEKALQAAYGASAPSMTSATLRWMYHHSQLQGAHGDAVILGMSSLEQLEQNLAAAEEGPLEPAVVDAFNQAWHLVAHECPNYFR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structure of Human Aflatoxin B1 Aldehyde Reductase Member 3
rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords AFLATOXIN B1 ALDEHYDE REDUCTASE MEMBER 3
total genus 114
structure length 323
sequence length 323
chains with identical sequence B, C, D, E, F, G, H, I, J, K
ec nomenclature
pdb deposition date 2006-04-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00248 Aldo_ket_red Aldo/keto reductase family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.100 Alpha Beta Alpha-Beta Barrel TIM Barrel NADP-dependent oxidoreductase domain 2clpA00
2FGBA 4L1WA 2BGSA 3S3GA 2F2KA 2PDIA 4ICCX 3WG6A 4PUWA 3NTYA 5LIUX 2PDQA 2A79A 3DOPA 2P5NA 4RPQA 4FA3A 4H7CA 1XF0A 2IQ0A 4EXAA 3BV7A 3CMFA 2PDFA 1AZ1A 2QXWA 4JQAA 1MI3A 3R58A 3UG8A 1AFSA 2F38A 3B3DA 1EF3A 2FZ9A 3M64A 4JTAA 2PZNA 4XZMX 3N6QA 3RX4A 4JIIX 5LIKX 4YVVA 1XJBA 2IQDA 3H7RA 4G5DA 3EAUA 3MC5A 4DBSA 4F40A 1EL3A 4PR4A 2HVOA 4FALA 3FJNA 4YU1A 1RALA 4PRTA 3P2VA 1A80A 1Z8AA 2IPJA 3ERPA 4AUBA 1FRBA 4JQ1A 2PDMA 1PWMA 2FZDA 2IPFA 3LBOA 4PMJA 1T41A 1US0A 2ACRA 4MHBA 1EXBA 2DV0A 1VP5A 1X98A 5HNUA 3ONCA 3UWEA 4EXBA 2C91A 4FZIA 1Q13A 1MRQA 4JQ2A 3BURA 5AZ1A 1JEZA 1PYFA 2PD9A 3WBYA 1M9HA 4PRRA 1X97A 5JH2A 1IHIA 4XVEA 1T40A 3Q65A 2PDHA 1OG6A 3CV6A 3LN3A 3UZZA 3F7JA 2WZMA 1ADSA 1Z3NA 5LIWX 1UR3M 4XZNX 1GVEA 3WBXA 1AH3A 2IKGA 2INEA 1PWLA 4DZ5A 3KRBA 3LQGA 4DBUA 3CAVA 4YS1A 2PDJA 3UP8A 2BGQA 2ACUA 4XO7A 3LD5A 3R94A 4XVDA 1YNQA 2PEVA 3Q67A 3T42A 3VXGA 2DUXA 3V36A 2FVLA 3V35A 1PZ0A 4L1XA 1YE6A 4JQ4A 2NVCA 4JIRA 2IPGA 4JTQA 5DANA 4Q7BA 4LAUA 3LEPA 3O0KA 1S2AA 3ONBA 2AGTA 3R6IA 3EB3A 2ACQA 4XZHA 2ISFA 3LQLA 4WEVX 4LB3A 3UYIA 4HMNA 1Z89A 3BUVA 4WRHA 1S1RA 4LAZA 1Z9AA 5LIXX 4DBWA 4YVPA 2PDYA 2NVDA 3U2CA 5HA7A 1K8CA 1AH4A 3GHSA 4XZIA 4WDXA 5KETA 3R8GA 3R8HA 1ZQ5A 1ZGDA 3LUTA 4WDTA 1YNPA 3UFYA 1XGDA 1RY0A 4XK2A 3R43A 4XAPA 1HQTA 5AZ0A 2PDXA 2R9RA 2IS7A 4WDWA 2PDKA 1Q5MA 4IJCA 3GHUA 4I5XA 2I16A 3H4GA 4ZFCA 4PUUA 3LZ5A 5C7HA 2DUZA 1AH0A 2VDGA 1C9WA 3CASA 3M0IA 4JTCA 4XZLX 4LBRA 2PD5A 4Q3MA 3UZXA 4JTRA 2PDWA 4XO6A 2FZBA 1QRQA 2PDPA 2R24A 4GA8A 3M4HA 3MB9A 3UZWA 2PFHA 3LZ3A 3QKZA 1R38A 1PZ1A 3UGRA 3LENA 4R9OA 2HDJA 4NKCA 1IEIA 3GHRA 5HNTA 2PF8A 1EKOA 3EB4A 4GCAA 3DN5A 4GIEA 1HW6A 3FX4A 3RX2A 3R7MA 2HE8A 2HE5A 2ALRA 2FZ8A 4GQGA 1ZSXA 4WGHA 3V0TA 3V0SA 2CLPA 2PDUA 1S2CA 2HEJA 4H8NA 3COTA 1X96A 2I17A 4FAMA 2IKJA 3V0UA 1AZ2A 2INZA 1S1PA 4JIHA 4LB4A 2HVNA 2PDLA 4QR6A 1MZRA 4JTDA 3RX3A 2ACSA 4IJRA 5JH1A 3WCZA 1J96A 2IKIA 4ASTA 1QWKA 2PDBA 1RY8A 4IGSA 3GHTA 4GQ0A 3D3FA 5LIYX 4LBSA 3C3UA 4JQ3A 3BCJA 3N2TA 3G5EA 4HBKA 2IPWA 2IKHA 4GABA 3H7UA 3GUGA 3WBWA 1SM9A 1VBJA 1LQAA 4QX4A 4QBXA 4OTKA 2J8TA 3G1RA 2PDGA 4QXIA 3O3RA 4WDUA 1YE4A 2HV5A 3LNMA 2BP1A 3UZYA 4YVXA 2WZTA 2PDNA 4GACA 1ZUAX 2PDCA 3CAQA 3CV7A 5M2FX 1LWIA
chains in the Genus database with same CATH superfamily
3VOFA 3S42A 3FKKA 1CCWB 1J12A 3FJLA 4W84A 3UA3A 3IJ8A 4TTGA 2F2KA 4IIHA 1TV8A 2XN0A 3GXNA 1BRLB 3W02A 4HZ7A 2ZDSA 3UETA 2HXTA 3SZ8A 3EKLA 4X9SA 1VFMA 3PR2A 3DU0A 1G94A 1EHAA 3WL0A 5ABGA 1GGOA 3CU2A 5BRQA 3GG8A 4J3ZA 4PFHA 1O94A 1BG4A 2QGYA 4JTAA 3MJYA 1E9ZB 1MW0A 1F73A 4X3ZA 2QAFA 3C8NA 3VGBA 2EAWA 2DT2A 5AYYA 3GTFA 3PPCA 4XAYA 1DE6A 4S3DA 1DQUA 3W7JA 5GPRA 4LVFA 4XTDA 2E1WA 8XIAA 1ME7A 5I3JA 4IIFA 4DYJA 1XCXA 4KMQA 3AYVA 1CWYA 3AIUA 5C7VA 3B40A 2IPJA 1DJHA 4R33A 3ERPA 1XBZA 1ZBCA 4AUBA 4BZYA 4HK5A 4QAWA 2IPFA 3AQUA 2ZX5A 2ACRA 3BZGA 2G5WA 4NJIA 5FF3A 1EDGA 3HQ1A 1GOXA 1UD6A 3QV7A 1UR2A 3J7HA 3SDOA 1JDEA 4LRSA 3M1ZA 2A3EA 2JQXA 1SJAA 2PD9A 1TPUA 1RPXA 3LI0A 2X09A 4DJDD 3THQA 4DBEA 2XIMA 1KB3A 1LL4A 3KXQA 2XM1A 3VU2A 3TSDA 4RL3A 3HPZA 1QNQA 2GGIA 2ZRYA 4LYKA 1M41A 4C1NB 3OHIA 4TV5A 1DIOA 5A8MA 2YB4A 3WBEA 1TQXA 2QV4A 4PUNA 3N4EA 3EWWA 2PGWA 3WNKA 4LS0A 3HN3A 3L21A 5HMDA 1DXFA 2PI6A 2OLSA 4M6UA 3BGJA 2V5CA 3DKJA 4XAFA 1WQ5A 1NF7A 5A8NA 2WSYA 4MJZA 1S5NA 2OZ3A 1WBJA 1BXNA 1KM0A 3ZSSA 3ARQA 3LLXA 2Q02A 3QV6A 4PCNA 3LGGA 4J9JA 3LRKA 4LAUA 6PTDA 4DUWA 5I78A 4PFMA 2QDEA 4FI4A 3A23A 4ADUA 4BY3A 3PNZA 2ACQA 5A8GA 4AY8A 2Q8LA 2DORA 1PJ9A 1GOKA 3GO2A 4WK9A 5BU6A 3TKFA 1KM3A 4BI5A 4MF4A 1NF0A 3SCQA 3KBSA 5LXEA 1R7OA 2YCLB 3WJZA 1V93A 2QCDA 2OB3A 2OLHA 1H5VA 1EC9A 4H2HA 3HBLA 3KHJA 1O12A 4HN4A 4AB4A 3UWYA 3ZVHA 3O15A 1LF1A 1NJJA 1ICSA 2XN1A 1HJUA 3B0PA 4KFOA 2TMDA 2XWDA 2Z26A 5LNRA 2HCVA 1V6WA 3SJ3A 4JX4A 3I3BA 1U1UA 2NXIA 4DZHA 1J0JA 2FDMA 3BOFA 4H01A 4RZ6A 3EX2A 4IXHA 5K9XA 1NTHA 1J2BA 3WF0A 3QGVA 4KERA 3GS6A 3OP2A 3LB0A 4HCDA 2I56A 2ZA3A 4U2YA 3SO7A 3R0UA 1MXGA 4US5D 2ZUUA 2C19A 5BXSA 4ZO7A 3B8TA 2PDPA 3GXPA 5AHFA 3NQ6A 3R0KA 2Z24A 1P43A 1GYNA 3P0XA 4LALA 4ES4A 4GXPA 3JZUA 4JL2A 2DZVA 1RR2A 3GHRA 4AG0A 4JKKA 2PTDA 3CB8A 1SGJA 1H49A 3ABZA 2A1YA 3MYPA 2G3IA 4KH2A 3S6TA 2PE4A 3BLDA 1J01A 3SQSA 1BFNA 1OD0A 3PBVA 4CGTA 4GY7A 4HPHA 4P7RA 4CU8A 4NNCA 3QZAA 1ZSXA 5AC4A 3SADA 2FGZA 2BY2A 4GBUA 4AF0A 3CHVA 1X96A 2ISWA 1U83A 4HP5A 3CIWA 3HU7A 4A35A 2Y5SA 4WOZA 3VDCA 2XTKA 3OYZA 2CLMA 4O1BA 2INZA 1KCZA 3T09A 3A4JA 3TK7A 3WDRA 4JXCA 4KFNA 3CUIA 3L9CA 4JTDA 3F5KA 5JH1A 2C15A 4MUZA 3TYBA 1V6UA 3SIMA 4K7YA 3INPA 5DBTA 3PB2A 2PU1A 1EWDA 1NWUA 4F9JA 3GZAA 3EWYA 4L9ZA 1FWBC 1V6YA 4QCEA 1L6SA 4NVTA 3W7EA 2OT1A 5HPOA 1GYLA 4FX7A 2DSKA 3N2MA 4GCXA 4NIRA 2IKHA 5AHMA 2GFTA 4LVGA 4G1KA 4FX8A 4L4PA 2WAGA 5FI8A 3BJFA 3AXIA 4YTRA 3PP7A 1RQHA 4ZO6A 2YDAA 1R86A 3TMQA 4D72A 4IFKB 3HM7A 4ZO9A 1R87A 3QQ1A 1EGVA 4WIWA 2VFEA 2Q6ZA 1QPQA 5BCAA 3NGFA 1U1HA 1GG1A 4IG2A 2H3BA 3O16A 2BGSA 4BQ2A 1WZAA 2JF7A 1EX1A 1QMLA 1S5VA 1BD0A 2WOQA 1A0DA 1QPKA 3QW3A 2E40A 2GLKA 4UZUA 4UTIA 1AD1A 1DIEA 1P7TB 4RE2A 5CC5A 5D2VA 1HGYA 2J62A 2J66A 4TX8A 1RD5A 2QT3A 4UTJA 3B0YA 2OG9A 3WD2A 3B3DA 4FLRA 2V82A 4AFYA 4QDWA 4EPBC 2XFYA 3N6QA 2DW6A 4M80A 1ZFJA 2JGYA 1R47A 4LJ3A 4I5UA 1UZDA 2B7OA 4TX6A 3GM8A 4IMCA 3B8UA 5DFAA 4J3UA 3TCEA 3UJSA 1VPYA 5CH9A 1EL3A 5FIPA 3NWRA 4NZCA 3MI2A 4B2DD 3QF0A 3EX3A 3QR0A 1SZEA 1Z8AA 3A5VA 4C6FA 1P48A 5DMMA 1AW5A 2BHYA 2FKPA 3A3HA 4Y7EA 1N8FA 1JQXA 3LHWA 2ZA1A 4JFTA 1R3WA 3LNPA 3LBOA 3MUCA 4PMJA 4URIA 1GVSA 4WGXA 2VR4A 1US0A 4XD5A 3TROA 4RW3A 4QS5A 2F84A 3MO4A 2G97A 4TUFA 4UIOA 1NFBA 2OFJA 4J5NA 4GG9A 1IZCA 1LRTA 3AS0A 3N34A 4HHHA 2FFIA 1G7UA 3ZQ9A 4N6EA 3CZ8A 2QUUA 4F0RA 4HU4A 5IM51 1AH3A 2VUYA 2X1RA 4O4VA 4DNMA 1E4NA 1I9CB 2JFEX 2I9UA 3MUAA 3NZGA 3ITXA 3WLIA 4NRSA 2ZTKA 2PURA 3CUFA 1P0NA 2RDXA 3WLMA 4EPDC 3QHOA 2NWSA 3VIPA 5E5CA 5I06A 1BSLA 3GQYA 1UYQA 5C2GA 3VXGA 4UR7A 5D37A 2QJGA 3CUXA 3O6YX 4L1XA 3LS9A 1TV2A 1EJWC 2A7NA 1SO6A 5DCDA 5IHRA 3UPMA 4QG6A 3FEQA 3TJXA 4Z42C 1OFOA 1UR0A 3M5XA 2WZHA 1MW1A 3IRDA 2O4QA 2GJXB 1P6CA 1PO9A 1H1NA 3GC4A 4AZGA 1JNDA 2HQAA 3AMKA 4EAMA 4HHLA 5I3DA 3IK4A 3QSRA 4AWEA 3KTCA 4E2VA 1K03A 1LOQA 2VFDA 1SFTA 5DY3A 1OBAA 5C70A 2NV2A 1K8CA 4LV9A 3BGGA 3S2JA 4FNRA 3MBFA 1E4MM 4B15A 3VIMA 3T2OA 4QLKA 2JIWA 3M5VA 4ZQPA 3OEXA 3GD6A 4L9XA 3ISIX 3CV1A 4LXFA 1B3ZA 4H9VA 3LUTA 4DZIA 5JIPA 1HO1A 5DY2A 4LANA 1NIUA 3H7VA 1SW0A 4DBDA 4GO9A 4DF2A 4GINA 4H9MA 4QE5A 4GZEA 4PUMA 2O9PA 4A3YA 1GCYA 4I7WA 3DXIA 3W1PA 1LG2A 3SFKA 2J7DA 1FWGC 4QEHA 2E6YA 1E70M 1QRQA 2P1FA 1ISZA 4GKLA 1PX4A 4HMEA 2NSOA 1Z48A 3STEA 4R9OA 3KTXA 3LCGA 4NKCA 3G3DA 1RBOB 2Z2BA 3SY5A 2IMRA 2FB2A 3NL5A 3H53A 3UT0A 3KVLA 1UWQA 1A53A 2AAAA 3JS3A 3TW7A 4JKLA 1XSIA 3OZYA 2YX0A 2CHNA 2O4MA 4IQJA 4D1JA 1X8FA 3VNKA 2X42A 4QG8A 4KBXA 3CHEA 1PHQA 4KPLA 2XVLA 4OUEA 4MB3A 4WXYA 4PMRA 2HBXA 1Q3NA 3UERA 3W2NA 4YYFA 3TZNA 3LHVA 3EMZA 3OBEA 3V0UA 1TJ0A 1EWEA 4A8LA 4IQDA 4L4OA 1A4LA 2PDLA 3V18A 1Q8JA 3UY7A 2YZ5A 1R3SA 2ZFAA 4O0KA 1JYNA 3IWPA 2PBOA 1QW7A 3M41A 1KBLA 1ZLPA 5KZDA 5A6TC 4AWUA 1E9IA 5CPTA 1PIGA 1H5YA 3A4XA 1ZNNA 1XR2A 4OIFA 3D3FA 4GLEA 4FF5A 1S3HA 2CC0A 4LBSA 5LYRA 3W88A 3VUSA 5A5WA 3C3UA 2WSKA 2WVTA 4HCLA 1EJXC 2DP3A 2VZTA 4MKSA 2TRSA 3H6OA 4H6QA 4CD6A 5C2XA 3CMGA 3IIOA 4WKAA 3G22A 3LHYA 3JZEA 3WDQA 4JTJA 1KA9F 2RKXA 2AGKA 1QHPA 3GH5A 2XZ7A 2Z00A 4BKNA 4E8CA 2PGRA 4IG2B 1D7FA 1LQAA 1KTBA 3W7OA 4D8AA 4KWVA 3T9PA 4XD3A 2J8TA 5H8PA 4C1LA 1VFLA 1XRSA 1XYCA 1M7XA 3AYRA 1TCMA 4LNCA 3LTYA 4W87A 3WFAA 4LC6A 1CLVA 1ALDA 1VLWA 1ZS2A 1ZAHA 3W26A 2PDCA 5U7SA 3V1HA 3HFYA 2YB1A 2ODOA 2FJKA 4HNUA 3T4CA 5FEXA 3ARXA 4TX9A 4Z2JA 4ZL1A 1TTQA 3H54A 5I3KA 2C7FA 3DERA 3ZXWA 4H9XA 3B04A 1XYBA 5LIUX 4A8RA 1WUFA 5AYBA 5A6BA 1VBRA 3W81A 1W5NA 2CLFA 2P5NA 1RCXB 4RPQA 2O9RA 1TR9A 3MJMA 5LNWA 3W2JA 3RLUA 4JTEA 1Q6OA 1SZRA 2QJIA 2OOGA 1QPOA 1C29A 3W38A 1JXKA 2HBVA 5DEZA 1YHTA 2DT0A 3GC2A 3TN6A 3Q2DA 1QHZA 3K4DA 4NI8A 3F4NA 5G1TA 3CL8A 3SM0A 2VXNA 1SZGA 3Q94A 3H7RA 1XPGA 2X1TA 4XISA 2C0AA 3NQFA 3LLFA 3VMOA 1VIZA 1BQCA 3R25A 2ZKMX 4DI9A 4RDZA 4LBUA 5DRIA 2D24A 4M51A 3L68A 1A80A 3GVGA 4LYPA 2QS8A 5D9NA 4XAZA 4JIPA 3NSMA 2E68A 3OLIA 3N1AA 2C14A 3VIFA 5M03A 2QMJA 3QPZA 2XYLA 3TLQA 3ORWA 5FF2A 1AODA 2YCLA 3DUGA 3QN3A 8TIMA 1EJ7L 3BG3A 4JFVA 3QR1A 3IJDA 4LC8A 1EGMA 2NV9A 4AZ6A 4I3GA 1W9PA 4W86A 3W7DA 4GNKB 4P8UA 1X1ZA 2VEMA 1JCMP 1EC8A 1V79A 2EEXA 3SQLA 4J7RA 1XIMA 4ZOAA 1A5BA 2GWGA 1K9FA 2A2IA 1RH9A 3TNBA 1QU4A 3A3WA 1IR2A 3H55A 4G9PA 1PTGA 3CV6A 3DEQA 1XIHA 3PWIA 3F7JA 1GNXA 4ROQA 1KRMA 2AMXA 1ADSA 3Q58A 4JNZA 3WFZA 3SY1A 1UR3M 1NQKA 3DYPA 2ZC8A 1GORA 5IRPA 1VAHA 2QYGA 3XISA 4RXFA 1T0OA 1FWTA 2ZRWA 1Q7ZA 5LXXA 1EJSC 3TDFA 5FCZA 3A22A 3YPIA 3AXKA 5TNVA 1R7AA 2QJMA 1K9EA 2YLLA 4ZR8A 4L6DA 3UPBA 4HSOA 4LUYA 3E5BA 4C90A 3OQ8A 4IZGA 3PC0A 1Y0EA 2J7CA 3EGJA 3S5YA 4ALDA 2IPGA 3CM4A 1YLVA 4HU3A 2F2HA 3NL3A 5G4EA 3O0KA 3TQKA 3EWXA 3K1GA 5BRBA 3M0YA 2YDRA 5I09A 4NZJA 1XYMA 1BQGA 4U33A 3PAJA 1EYEA 4Z1AA 3VGEA 3VCNA 4WKFA 5CGQA 2FIQA 3GIPA 4IM4A 3O9NA 3UWVA 1YXDA 1YDVA 1GVQA 2V38A 3GTNA 3S5ZA 1N2VA 3AMDA 4ACYA 1V08A 3VD3A 3UXIA 2OZ0A 4O10A 4CCEA 4GUGA 1FHDA 3MBDA 2ZDRA 1K4HA 2VOTA 4C6NA 1YADA 3OYXA 2J79A 1XD1A 3SN4A 1H7NA 1YNPA 2CESA 4UTHA 5D2XA 2VEIA 3USZA 2Y7EA 1E51A 3T8LA 4TMCA 1EIXA 4WDWA 1K8YA 4EKJA 4IPJA 5CZ0A 1Q63A 4CQCA 3OLGA 3SGGA 1WXZA 3O1NA 4R85A 2QPSA 3WLOA 2EPLX 4I9TA 2G41A 3C2YA 4QE4A 3SCWA 4BF5A 2DVTA 4JTIA 1WOAA 4W8LA 2BTMA 1L6WA 2O92A 1P0DA 1IIHA 4O1CA 1VKFA 3P82A 3RUBL 3APGA 3TH6A 1E9LA 3DECA 2A7RA 3TQ0A 4GI4A 3UZWA 2PB1A 3WD3A 2YSWA 4L64A 5DXXA 3WENA 5C55A 2PF8A 1DWJM 2WHJA 4WY0A 3ZWTA 3FAXA 1Z42A 3CO4A 2HPIA 1T6MA 4CNSA 4Y8EA 3QYSA 1OFRA 4L6OA 2FTWA 1F3TA 2DT1A 3DFPA 1BXBA 4NX5A 3MCOA 4DWSA 2EO7A 4N2YA 4GQGA 3DC8A 2RJGA 3CHDA 3LCLA 5HMEA 2GJXA 3WQPA 3EEZA 1NSJA 4V1YA 1L6YA 1SW3A 2QV5A 4US5A 4V27A 1UWSA 4LB4A 2P50A 3NPWA 5BOFA 5KZMA 2VEGA 4EVZA 3P84A 4GJJA 1V3IA 1XBYA 1US2A 1XM3A 2B4GA 3OGVA 4DWSB 2A6LA 3UVIA 2PDBA 4AH7A 1W5QA 3ZT6A 2ZOXA 3QGKC 3P74A 1ISXA 3BXWA 3IUIA 5E6ZA 1E40A 3VNLA 4AEEA 4HOXA 5D2WA 3ZJ7A 1AMKA 1SR9A 4HBKA 2GSJA 1CGYA 2W3ZA 4OV4A 3CEPA 1D3CA 4CN4A 2OQLA 3WBWA 4FOJA 4E38A 3SRHA 3ANVA 3VOIA 4DRSA 5HWNA 2QW5A 1S5TA 3PNUA 2Z1WA 3QR3A 3MKCA 1W1A1 4HSNA 1OYCA 1H3GA 1FY6A 3LNMA 7TAAA 5AN7A 1TX2A 3N14A 5EMKA 3O63A 4WY0F 1VYSX 5EMMA 2PBGA 3CAQA 2V81A 4DLMA 3DENA 1CZ1A 3A12A 2WB5A 2RH9A 2XFRA 1IQ8A 1KFKA 4OHQA 3AS3A 4UTTA 1VCGA 3GC5A 4OT7A 3GB6A 1UA3A 1JPIA 5D8ZA 4OFCA 3LRLA 4QDMA 2ZZ4A 1JI2A 2X30A 2E28A 5E93A 2PDQA 4UFIA 1OZQA 5C54A 3LBMA 4REQA 3KP1A 3SAZA 1RD6A 1UUQA 1H4PA 2V0TA 2W5FA 5C5YA 1UZ1A 1PIIA 1X8CA 1M3UA 3L4YA 3BLLA 1UCWA 1PCWA 2FHFA 4ZCWA 3LHZA 2LLEA 2YCJA 2VT0A 3AO0A 3OJGA 2PPGA 4PL2A 1EDTA 3HZ3A 1MXSA 2PCQA 3G1VA 3VOCA 4ZBCA 1KFCA 3GYEA 2ZX8A 1U2YA 3NL6A 3S47A 5BROA 1M53A 4E4FA 2E5CA 3VIOA 1RALA 5IFTA 4F0LA 9XIAA 1CPUA 3KBMA 1RK6A 4DJDC 4R7OA 1JDCA 2CW6A 1XQLA 3TWBA 1DJQA 1A5UA 2E1DA 1WDRA 1AA1B 4B5VA 1VFSA 1QI0A 2GK1A 4HPXA 5EYWA 1J0IA 4GNVA 1NDYA 3VKKA 4XB3A 1ODZA 2QJHA 4RKAA 2Y89A 3SRFA 5E9XA 2XIJA 1AJ2A 5AB3A 3EWZA 3LERA 1KFWA 2YGYA 4UQAA 1UG6A 1P5BA 3E0VA 4IX2A 3WX7A 3MZNA 3S46A 3WK1A 1OC5A 5JU6A 3C86A 1OG6A 2E77A 3HGOA 3ZJ6A 4JYFA 1G0CA 5D32A 1HZYA 4PMVA 1RQEA 1A0EA 5ABFB 4P7QA 4BK9A 2YXXA 3ARTA 3QLDA 1FH8A 1W9UA 1W37A 1TPVA 4TOQA 2IKGA 1QFEA 5DBUA 1KD0A 4ZTYA 3MVTA 2EG8A 4G56A 2PC4A 7TIMA 1VS1A 4IPPA 2Z1XA 1THFD 4OVXA 1EOKA 3DYMA 2OWWA 3PZGA 4GGHA 4OKDA 3TIMA 4NQ1A 4IIDA 1SSGA 3VE9A 3HG2A 5HJXA 5IDZA 3ABXA 4JBRA 2JF6A 4AZIA 4C6MA 3VM5A 3U6WA 2CYGA 3GU1A 3WNOA 4V2XA 1JYVA 2HXUA 3VDHA 3GDMA 4KCTA 1O1ZA 4A3RA 4H41A 2DZAA 3PZNA 4XZWA 1BF6A 4GVFA 1IR1A 2BHZA 4JTTA 1X1OA 1C8VA 3FA5A 3GXMA 2OYKA 1WE5A 1ECEA 1VYRA 2ISFA 1Q6GA 3KDNA 4NASA 4E4PA 3WK0A 3UYIA 4GD0A 1OX4B 5DQPA 1FH7A 1S1RA 4OUIA 1K77A 3IV3A 4IFRA 2XVNA 4PMDA 3VTRA 1UKOA 3W2UA 2QCLA 5M5DA 3WUFA 3MWCA 8A3HA 4KWSA 4E4UA 1LBMA 4XZIA 2TSYA 4EWND 3LPPA 4S3FA 3Q45A 3WJYA 2H9AB 2CHOA 2VM8A 2EXOA 3CHCA 1TA3A 1ZJIA 1OFQA 4HYWA 2D0FA 3C52A 4DEFA 4RPPA 2O7QA 3AUJA 3EOEA 2DH2A 2POTA 2I16A 2YFNA 3EDEA 4RK8A 5C7HA 5K9DA 3UG5A 1GEQA 2VELA 3THAA 2QEZA 3ABRA 2QDHA 1L9WA 2BOFX 1M1BA 4ATLA 2PWUA 4Q3MA 1MFUA 1MNSA 1MSSA 1UJPA 4P8WA 1D3HA 4WUIA 3VM7A 4X9YA 3QKZA 4A6GA 3TAKA 1I0DA 2F8QA 3GXFA 1EIBA 4GWEA 2OYLA 1MDRA 3II1A 4BCEA 5DCEA 3RRXA 1C3FA 3MDWA 4KT2A 1EUAA 1HW6A 2W67A 1BEUA 3OA3A 2W79A 1IXOA 2YL5A 1GJWA 3ARZA 1XGEA 2ALRA 4DO4A 3VDAA 3A64A 4C6KA 3PM6A 2A3BA 1V6VA 3MA8A 4UTTC 4GI6A 3UJ2A 4H1ZA 4WY0B 4Z0SA 4RE4A 4B5XA 3LV5A 3T78A 3SCUA 3EZ4A 4N0RA 4P8XA 3UR7A 2DJLA 3ARYA 4Q8OA 2GUYA 2I57A 2OVLA 1OADA 4K1GA 4UQBA 4H7VA 3L23A 3VD9A 1KGUA 1AL8A 4ZOEA 2Y0FA 4DVOA 1JCLA 1NFGA 4E0CA 1J96A 3ZVHB 2IKIA 5EBAA 4GFIA 1MEHA 3RPMA 3TUUA 3N9SA 3SIZA 2VGBA 2OYMA 4X61A 3KZPA 1R46A 2FMNA 3TFXA 3W1AA 3MKVA 3HA1A 4L61A 1DIKA 3PG9A 2V8ZA 4ORIA 3RR1A 4IGNA 1LLWA 4DJED 3FHQA 4CCDA 5LZLA 3G1XA 4J28A 3MVIA 1G5AA 1Y65A 3JUGA 4P61A 3RO6A 1HGWA 2GVLA 2PWVA 1VJSA 1VBJA 2OXNA 1Q6QA 3B05A 2QLYA 2DGAA 3LBCA 2VX7A 1Q6FA 3KBWA 3IJ6A 3WD1A 4MADA 1KFLA 4MNKA 3FSTA 3OLDA 3DX5A 2HV5A 1C93A 3GNRA 1O5XA 3HJEA 1CLKA 4P8VA 4XTIA 3TVAA 3PBUA 1KCXA 3RRAA 1TYGA 3I3DA 1OFBA 1VEOA 4IIGA 1R30A 5H1WA 4GVGA 2GDVA 1H7PA 2VC9A 1KLZA 2C16A 3GFXA 3EOSA 2ZC1A 3FKRA 2DZSA 5LA0A 1SFSA 4GZJA 4EACA 2WPBA 3GDRA 4AD5A 1Q66A 4XD6A 3F5JA 4UXDA 2D1ZA 5AC8A 3QV9A 3CGTA 3JR2A 2PSNA 4IGHA 4O12A 5TIMA 4C1NA 2J9XA 2ZCGA 1V3MA 2PDFA 1ZJAA 3NSXA 2GJPA 1I2QA 1CB2A 1VBUA 3N3MA 1MI3A 4NUWA 4UOJA 4HNTA 4OBRA 5J5DA 3KS5A 3QMSA 2QZRA 4DO7A 1I2PA 3RX4A 4F2UA 4JIIX 1JCNA 3G1YA 4FB7A 1GTHA 3A4WA 3BPWA 1JDAA 3GDLA 4XQ6A 2XSBA 1I6NA 3RG6A 1PKYA 3VINA 4JR5A 3EAUA 4CQBA 1HFBA 4A8NA 1SSDA 2ISDA 4JDYA 4GC4A 3D47A 2I14A 2VO5A 4Z08A 4O50A 2WBKA 4MZ8A 1H11A 3CEUA 4J3VA 3WUBA 5MF5A 3ATYA 1HL9A 3ITGA 3PBWA 5BXTA 4C7DA 1IWPA 5HDRA 2QUVA 2GQ8A 2YLAA 4EAYA 4IHCA 4LWWA 1A3HA 1AK5A 4O18A 3PS7A 1T41A 5CGMA 4FNUA 3LA4A 4U10A 3W74A 4ZENA 4Q22A 1W2VA 3QZEA 4HNCA 3EWBX 3P62A 3WLQA 1L2UA 2YYUA 4QGCA 1PUDA 4L5ZA 5EFDA 5D9MA 1OF6A 2PWFA 4Q8NA 1OT1A 4PRRA 4GUHA 2CBUA 1A5AA 3MDUA 4HN8A 1G4EA 1VEPA 3GUWA 4K37A 3O07A 4GFSA 1DV7A 3PUEA 1GKQA 2NQLA 3PZOA 4KEUA 4NZ4A 3ZSTA 1RJPA 3HURA 1GVFA 3MWAA 1XLKA 4F9DA 3UEQA 4DZ5A 2ABAA 4MB4A 1K8XA 5LKYA 1YBQA 4WF7A 1ZZMA 3C61A 3AHZA 1HJVA 3PBGA 2GL5A 2BGQA 1R3YA 4ZVJA 4XO7A 3HQNA 1PBGA 9XIMA 3UWWA 1YNQA 2DFAA 5F4SA 2JKEA 2EKCA 2QPUA 3HG4A 1E6ZA 1G69A 3AISA 1WPCA 2R82A 4E8DA 1FDYA 2E9MA 3B9AA 4GY0A 3H70A 4IF2A 4WZHA 3RCMA 4JTFA 4Q7BA 2PC8A 3N12A 2OWCA 3MMDA 4PL1A 1W5OA 2WVVB 1D9EA 4CLMA 4ZOCA 1QO2A 2RJHA 4CU7A 2NQJA 4O1EA 4PEEA 1O5KA 3WF1A 3CZLA 1CBGA 4LU0A 3W7LA 4HOZA 1S2VA 2NVDA 3SN1A 4O0QA 1KXTA 3QMTA 4QAIA 1GVOA 2WNNA 3ATZA 3VZZA 1FKXA 1PIFA 3KOZA 5LGZA 2FZMA 2F6KA 3B8WA 1HKVA 4G1NA 3IJQA 4QCFA 1J11A 1W17A 4LAMA 1W1IE 2QCGA 5EU9A 2EJ1A 3W1NA 1VEMA 1XDLA 4J2PA 5D4YA 3BLKA 2OTDA 3VKJA 2PDXA 4HOWA 3ARPA 5G1MA 4ADTA 3WUEA 2IS7A 2PDKA 4I9JA 5M17A 2OPJA 5FJIA 3IGUA 2VDGA 1JAKA 3L65A 4FPSA 3E0WA 4DPQA 1V0KA 4F48A 3M0IA 1IGWA 4B2DA 1J0HA 5HMFA 4K6AA 1OJXA 3TAOA 1HJQA 1MQRA 5AHNA 3TXVA 1DQXA 2G0WA 4IXXA 5CAHA 4NHVA 3CK5A 4GISA 1IEIA 3UZ5A 3W53A 1XLAA 1RJRA 2WMGA 3SGUA 5HPCA 3W82A 2YL8A 2D2GA 3RX2A 3EWDA 5E1QA 3BLFA 1EJRC 1UUMA 3MMWA 5HJYA 4I8YA 1TVNA 1OWQA 1V6XA 1LLOA 2WM1A 4DXKA 3OLEA 4KCWA 1XINA 1PKMA 3VUPA 4WGHA 1HXJA 4WSHA 2PWHA 1H7RA 1TTIA 3IIPA 3VGGA 1C92A 3COTA 2OWXA 4JIQA 3FYOA 1H0GA 5G2WA 2YDQA 1VFUA 5U4NA 3E0IA 1QOQA 4FOUA 2WHMA 1UD8A 4MWAB 2ZRUA 2Y63A 3OG2A 1E3ZA 3VOHA 4FLSA 2QVHA 1G01A 3L0GA 1UROA 2W6RA 5LHEA 1DXIA 2Q3OA 3CUGA 5HUPA 1ESWA 1AD4A 4PBEA 4UTKA 2Z2UA 4HA4A 4YPJA 4MZ1A 3L2LA 4CD7A 1TPDA 1KQYA 3T6CA 5I02A 2OKTA 3QPYA 4JEJA 3WKZA 1QCWA 9CGTA 1CXHA 1UIOA 5C9WA 4UCFA 4J27A 3LLDA 3ZLHA 1OC7A 4YMZA 4W7UA 3W1RA 3OVGA 2PDGA 3FAWA 4F0SA 1G6CA 4UTFA 4XBKA 1DL3A 1M7JA 2C71A 4ICMA 3FJ6A 2OZTA 3MP5A 3B8SA 4MY1A 4M8UA 3R5EA 4FMVA 3W3OA 2XFWA 3EPMA 4FO4A 1CXFA 4DNHA 1Q6CA 1B57A 1KTCA 1SMDA 5MKGB 1FHVA 1LWIA 1QI3A 5BWFA 3N29A 1JCYA 4MY9A 4QLLA 3NQAA 2PDIA 4H83A 5KTLA 5AC5A 3PPGA 2EJAA 2CZEA 3NL2A 4PMOA 1VHCA 1NP0A 2CLEA 1RSCA 1OVDA 3JU2A 1HKKA 2IQ0A 3GRIA 2Y8KA 3S6DA 3OVRA 3W22A 3M5YA 3UG8A 4PSRA 2J13A 2BX7A 3M64A 4JL1A 1Z7AA 2CZFA 3W70A 3S8HA 1KM6A 4X63A 1YPFA 3MSRA 2DSUA 2VJXA 3FLUA 1HUVA 2QPXA 1B3WA 2DZXA 5AKQA 2ANUA 3U8GA 1FCQA 4ZTXA 1VFFA 2IQDA 3D0CA 1EA9C 2WMJA 2Z1SA 3VC5A 3KAOA 3VNDA 2V6AA 4F4RA 5EL1A 3NOYA 3FJNA 3ABSA 3NQ8A 3QW4B 3OZPA 3WD4A 3E6EA 3UR2A 3RM8A 1W32A 5ABTA 4GX8A 2X41A 4QJ5B 2OSXA 3D6NA 1YPXA 1B31A 1TE1A 3RNDA 3FSUA 4O14A 4C60A 4IP5A 2XHYA 3NM1A 2D73A 3SN0A 3PF3A 3IJIA 1ZCCA 4QM1A 1N82A 1R2TA 2QR6A 4Z1YA 5AVHA 1XX1A 4MHBA 1VC4A 4XUGA 1G4TA 1TKKA 2VC6A 3B0XA 3UWEA 3LPOA 1SUXA 1T5AA 2VQTA 4EXBA 1E15A 1WA3A 1B90A 3VCCA 1V77A 1J93A 3C2RA 1KWGA 3LRMA 4Q4PA 3VIKA 4HNLA 2CBIA 4GJIA 4KWUA 1BGAA 2WZEA 3I68A 4S3BA 2GGEA 4UFJA 4IUOA 1GQJA 2BASA 1PPIA 3LU2A 5AHIA 2PWEA 3HTWA 2GSHA 3EKGA 3WBXA 1V3HA 5A6SA 1X1NA 1WDQA 4S38A 5PTDA 2BY3A 3AXXA 3ZLFA 2YXGA 1PX8A 3LD5A 4QG9A 2HZGA 1UH3A 3UYCA 4S3EA 4QROA 3SURA 2WVUA 4U2ZA 3N13A 1JPMA 3ITCA 1RJQA 4HPNA 4K36A 4ZO8A 1WBHA 4CD5A 2XPKA 1W5MA 1A5NC 1KFJA 1RUSA 3WLKX 1UOKA 3VGFA 1J8VA 3EB3A 3TU9A 2JGQA 3EOOA 2H6RA 4PMNA 3BMVA 1Z89A 2WJZA 4Y6GA 4Q32A 4CQAA 1WYIA 1SZNA 2C3ZA 2W62A 4LCQA 1HP4A 1G4SA 1UPPA 1LWHA 2A3LA 6REQA 1XH0A 1W3TA 2ONEA 3AZTA 3W2MA 1XI3A 4MLRA 1E1FA 3UWZA 1LUCB 1IEXA 1R6WA 4NT0A 5IFPA 2PCEA 3A47A 4XK2A 2ON3A 1HQTA 1GPWA 2BWGA 2WLYA 3NPXA 3O06A 1FHUA 1N7KA 1TWSA 4JCMA 3VDBA 1ONEA 4NYYA 2VENA 4UFHA 2FZNA 3GW3A 4MSSA 4AZBA 4LY4A 2X0YA 1XH1A 4LUSA 3PBMA 4XZLX 2NXGA 4W5ZA 3BSGA 1IV8A 3BLIA 3W7IA 1SO4A 3WY1A 1F6YA 5C0QA 2HS8A 4FLOA 3VIIA 1BYDA 1YNYA 1VPQA 3WMBA 3O6AA 3OGSA 4Y9OA 4EANA 2ZXQA 2X7VA 1IT7A 1EBHA 2P3ZA 1GVYA 1FVPA 3QSTA 3B9EA 1GJPA 2UBPC 1B4EA 1OY0A 2OSYA 4UFLA 1PS9A 4PMXA 3T0DA 3VKAA 3AMGA 4OECA 1BWLA 2WJDA 2FZ8A 2WMHA 1H60A 4PCTA 4A2SA 4B4FA 3E0FA 4U31A 4INFA 3PB0A 2KX9A 2E09A 4D8ZA 2V63A 3H2MA 3N2XA 1DE5A 2WVVA 3M0LA 2A6NA 3NQCA 5CKSA 4A4AA 5FJOA 4M0XA 1TUFA 3WLRA 1F05A 1YW1A 1R8LA 1I1XA 3WH5A 4J1OA 3XIMA 4GOAA 1DJNA 1QK2A 3AU6A 3KBNA 3IIXA 3W6LA 1S39A 3WCZA 1TJ2A 1WDSA 3CQHA 4W88A 4ASTA 2VFFA 4DWSC 2WZIA 1UD2A 2BZNA 1UMYA 3M6YA 3U48A 3WD0A 3VX0A 1L2QA 1OCQA 1F3WA 2GQAA 1V0LA 3WLTA 1I2RA 4C7GA 5AC6A 1C7TA 4S3JA 2EPHA 5KZ6A 1XUZA 4GZ7A 3A9IA 3ECQA 3T2QA 1FWNA 1H62A 2TAAA 3I6RA 4K8EA 4LFYA 1C8QA 4GMEA 3QPEA 1UB3A 4LUSB 3NA8A 4I9AA 2XH2A 2H8XA 1MEWA 4AC7C 5LNUA 2V5KA 4QNWA 4TTUA 2HSAA 4J3WA 3CV7A 6CGTA 2VURA 2PAJA 1XKJA 4YL2A 2DZPA 4IMGA 3FHAA 5ABFA 2QDGA 3GAKA 3L5LA 1DWFM 1ECQA 4MOZA 4PUWA 1YBQB 3BLPX 1IWBA 3WLPA 4IPLA 4AD3A 2VD9A 3ENLA 1PL9A 3HQOA 1KRAC 3PBYA 2AQWA 1A3WA 2QCMA 2YCEA 4H7CA 2VDHA 4JTUA 3LG3A 3CMFA 4DELA 2ZX7A 3TFCA 1LM1A 4QDPA 4O1FA 2ZXBA 4MIMA 4DHGA 1B3XA 1J6OA 1FUYA 5CSSA 2DIJA 4UQ9A 3MUIA 2WJEA 3T07A 3DESA 3I10A 2Z7KA 3HQPA 3FN9A 1TZZA 1O68A 3S1VA 3T0TA 4CNUA 4Q4QA 4BJHA 1T96A 5CPOA 1EGZA 3MHFA 3M47A 4DBSA 3PHAA 4OJYA 4YWSA 4JFSA 4KKXA 3TTQA 1OFAA 6TIMA 1W3HA 3FEMA 1B5TA 4I7VA 4FALA 3IPWA 2BNJA 4M6QA 1V51A 3SEPA 2G4JA 1KCLA 4CN1A 2W4XA 4KS0A 2DSWA 1JZ7A 5H6HA 1Y5WA 1GW9A 3VKCA 1BVZA 1JD7A 3DIPA 3EWUA 3KS6A 1J6PA 5LA2A 3HOJA 3RILA 3DFHA 4CU6A 2G3MA 1HKJA 4OU1A 3W75A 3T08A 3UWQA 2R14A 1WUEA 2NT0A 1V03A 4KIRA 3JRKA 2CLHA 3OODA 2PDHA 2FTPA 5ENLA 3KL0A 2BLEA 1V02A 2OEMA 3IEBA 4NP7A 3GYCA 1XLHA 3W2KA 2WZMA 3GE7A 1DWHM 2OX4A 1C90A 2JBMA 5HNRA 2W61A 2C1HA 1FWDC 4DWSD 5GNZA 4QE1A 1ZRQA 2BB0A 3DG6A 2PDJA 1P7TA 2P3EA 4QJ3B 3FVMA 5DF0A 1BHGA 3GLCA 1US3A 4O28A 4GQBA 3JVAA 3I7QA 1EB3A 3M0ZA 3FW6A 5A94A 2FVLA 3G6MA 3NO5A 1YE6A 4RDYA 4KRZA 3CO8A 5DANA 1RLDA 4S3KA 3PZIA 3RU8X 1GPFA 2BXZA 2QCEA 2G3NA 2VFHA 8CGTA 1KV8A 4YYCA 3ONBA 2AGTA 3HJZA 5FF4A 1ZAJA 1REQA 1XL9A 2DZUA 2G50A 4NJGA 4WEVX 1QASA 5LNVA 4A3UA 6A3HA 1WO2A 1O6IA 8RUCA 4DBWA 4NYUA 2PDYA 2DQWA 4HA3A 1VJIA 3G3MA 4RZBA 3IJLA 3MQTA 3AYSA 3BZJA 4XUYA 3M0MA 4ZXOA 3SY8A 2WCAA 1WKFA 4W8BA 2BG5A 1XFCA 4R9XA 2C0HA 3WH9A 3I3EA 2Y7DA 4LVBA 3BW3A 1NY1A 4FHAA 4MFEA 1RY0A 2GUBA 5XINA 3WL1A 4C6JA 2Z6JA 5J5RA 2R8WA 4NG3A 3PZTA 4LT9A 3V5CA 4OOZA 2Y8UA 1Q5MA 4RLIA 2ZUSA 3V5OA 4AD0A 2IUZA 4FNTA 1YDNA 4H6EA 4HU0A 3CASA 4QITA 2R94A 1J0ZA 4ZQOA 1KR0A 4Y90A 5CC6A 3RPDA 1E4IA 3GXIA 3UZXA 5CGTA 4AD1A 1ONRA 1TV5A 1KR1A 1GZGA 2H3DA 1YEYA 1W3JA 1F6KA 5H91A 3EWCA 3QJAA 1MZHA 1MUWA 3W24A 4IP7A 3L66A 3VK5A 3P93A 4JGDA 1HKIA 6XIMA 4NRRA 1SPQA 2E6FA 1EJTC 1KBBA 1DOSA 4C6DA 1ZBKA 2HE8A 3PULA 2X05A 1Q7QA 1J0KA 1KXQA 5HQLA 2HE5A 4DJDA 4F0HA 3P6LA 1JR1A 1K3UA 4IFOA 3AS1A 5HOSA 2QIIA 3NZ1A 4KFPA 3TWAA 3GG0A 3UXLA 1E6QM 1XC6A 1OYAA 2P76A 5A2CA 1B9ZA 1V3LA 3ZR6A 4C6QA 3RLGA 1IT0A 2YA0A 4ZFMA 1GOQA 1S1PA 3FV9A 4EPEC 1KKOA 1XPYA 1DVJA 2XGBA 2KZHA 1UKQA 3GNXA 1E6SM 1QHOA 2BOEX 1XIFA 3H4XA 4O13A 3CUHA 3ABQA 1NARA 4AIBA 1OIFA 3EA1A 4ZB0A 3ZJ8A 3CH0A 1E6PA 1C7SA 3P67A 3G1DA 4S2CA 2BS9A 3IS4A 5EFFA 1M03A 2VX6A 3IRSA 4CUCA 2XZ9A 4QISA 3I6EA 3B9NA 4DO6A 1HTIA 2XVPA 1EO7A 1OX6A 3G0XA 5H8MA 1PDYA 2AMGA 4J4KA 4MWAE 1T8QA 3OO2A 4ZQMA 2QIWA 4MLJA 3F2DA 3IGSA 1ITQA 1CGWA 1WX0A 1VBHA 4KWWA 4GH1A 5K3VA 2I1OA 4L7ZA 2C1IA 1EQCA 4FIRA 3DI0A 3GH4A 4RUBA 3KCOA 4AWTA 5IBXA 2A7PA 4HA0A 1KTNA 4S3AA 3CPUA 4MJ2A 2C18A 3P8JA 1XYZA 3SUSA 2BOGX 3PN8A 4UC5A 5A8OA 3NSNA 4OQVA 3SQMA 4EX4A 1BYBA 1R5YA 1A5SA 1UBPC 4ERIA 1LZOA 1YXYA 2C8NA 3L5MA 3RITA 4ICNA 1E9YB 3S3GA 1JI1A 1TPFA 1KM1A 3APYA 2YBVA 3N2CA 2X16A 2ESCA 2A79A 3TOPA 3P8IA 4Z2GA 3DFOA 3STFA 2CZDA 4ML9A 3KVMA 5IXEA 1XF0A 1S2WA 4H9UA 5ABHA 3GBDA 3M0HA 5A95A 4JQAA 1TO3A 3SBFA 3A9BA 3RR4A 2FZ9A 1V3KA 5CPLA 4A8IA 3BAKA 2ZXDA 1P0EA 4Q8TA 5BRPA 4FLQA 3WQ4A 3SCNA 3GTIA 1MVYA 1E5JA 1LDCA 5F2LA 4S39A 5FKYA 1PTAA 3A5FA 2QDDA 3WQ8A 5D2TA 1DTUA 4KETA 1KWKA 4A29A 5CPQA 1H50A 3S9YA 3P5ZA 3URBA 3VZXA 1RPKA 3ARUA 1FBAA 1QPRA 1CIUA 5K9CA 2RFGA 2D20A 4ILSA 2VTFA 4LRTA 1OGSA 3NZPA 4JQ1A 2J7GA 4O16A 3MKKA 5CSYA 4Q8VA 4AVFA 4DJEA 3MUXA 2ZRVA 1HX0A 2V3FA 5M3WA 3B0VC 4BQ3A 2VNCA 1EXBA 4UTLA 3A4AA 4MM1A 1LYXA 3RO8A 2ZWYA 4ZE5A 4ECLA 2ZQ0A 3HB9A 4KRUA 5J8LA 1ZU8A 1FOBA 2VDIA 3AIEA 1UP0A 1OF8A 1X97A 4KRTA 3V5FA 3WO8A 4ML4A 3NM3A 2DIEA 3CAWA 1O66A 2NUXA 2Y61A 1TMQA 2ZVRA 1HJWA 1TPH1 3C8FA 2ZRZA 3EXRA 3PG8A 4ZSTA 3VGDA 4E5TA 1E6NA 1S5WA 2B7PA 1XICA 3LPFA 2X2YA 4MGGA 2Q09A 1CLXA 2E67A 3K8LA 2VHLA 4JFWA 4W85A 3CL6A 1XRFA 4KEMA 3N6JA 4C5YA 3SUVA 4DX3A 4ACZA 2ACUA 4DYKA 4R53A 4W93A 4HJWA 4LVDA 4LCSA 3VD5A 1LRNA 2VEPA 1TIWA 4UFKA 3FJ4A 2PODA 3PJWA 4TXEA 2HNEA 1DKWA 4JIRA 1EO5A 3KLLA 3DFNA 2CLLA 5CQ1A 4BF9A 3KFTA 2NX3A 3N04A 1W3LA 4LEQA 7REQB 1NFPA 3QY6A 1O95A 1LL6A 4CQDA 1I0BA 1WAUA 4TR9A 1U1JA 1DHPA 1BTMA 2WSPA 2NSXA 1W8GA 3NVDA 5KITA 4A21A 1NU5A 1F76A 4YVPA 3N9KA 4D6CA 2VCBA 3VABA 3SJNA 5HA7A 3P5YA 1AH4A 1X6NA 1OQFA 1E56A 2HTMA 4PCPA 4YTUA 4MDPA 3SCPA 3GU2A 4WDXA 1XW8A 3MSDA 1BYCA 2E7FA 1XP3A 3VNMA 4HPJA 4UFMA 2FPTA 1GWJA 4P7OA 4WDTA 2E5DA 3UFYA 2NLYA 2X40A 3W00A 3NO1A 1E0WA 2XIQA 4CCCA 4O8RA 4C6IA 1E55A 1UZHA 4D71A 5BXPA 2ZZ1A 3ARRA 5FEWA 1BSIA 3NOEA 2D2HA 1FXPA 3AWNA 4A2RA 4P7NA 3VFLA 2HNHA 4WLCA 4HA1A 3M9YA 1WZLA 3SSZA 1XG3A 7XIMA 4CD4A 1PDZA 1PZ1A 1TELA 2V5LA 1D3GA 4CQ9A 1FFRA 1NWRA 1SW7A 1BXCA 4Z1BA 3U2EA 4GCAA 3S2NA 2NXHA 4IJBA 4GIEA 5CBJA 5A8QA 3R7MA 1FWCC 2NW0A 3R1ZA 1TV3A 1TPEA 4Q6XA 3DHDA 4IQLA 1K8ZA 1UC4A 2GJRA 3VIJA 3W7RA 3SCVA 1MQQA 2DZWA 3WH6A 3V0TA 3ALFA 5BMWA 1EQPA 4K39A 2C13A 1G67A 1XBXA 2YA1A 2RDWA 5A6BD 1R9YA 3NQVA 1MNZA 5GNXA 2PMQA 2XDFA 4B9ZA 3ALGA 1MEIA 2FPYA 2XH0A 1MZRA 3MHGA 1XWYA 3EA3A 1B3OA 2ISSA 3ME3A 3ID7A 4AISA 1WDPA 1N8WA 1IE7C 1BKSA 3A6OA 3P14A 4MWAA 5LIYX 1F8MA 1Q45A 2MNRA 1XFBA 4LSBA 3IV8A 1OZMA 3LCIA 1H0IA 5I5RA 2QCCA 2GPTA 1BRLA 3F2BA 4XIAA 1VRXA 1M7PA 1PHWA 3WIJA 3UR8A 4ZOBA 4JHMA 1SM9A 3UU0A 4IPNB 1W1B1 4FS9A 5TAOA 3OIHA 3G1RA 2B7QA 2B81A 4UOQA 4QXIA 3REQA 3WBAA 4H3DA 1JULA 1TTJA 3UZYA 2FHBA 1XYFA 1E6XM 2HK1A 1UR1A 3QEZA 2DZTA 1GEHA 3TR2A 5XIAA 3PPHA 3FGCA 3E3HA 3QFWA 3AROA 3HG3A 1EPXA 4GBDA 3SB0A 2V5BA 3WNLA 3L0NA 4E2DA 3NTYA 4K1WA 1TWDA 1B1YA 2PRMA 2GVJA 4EOUA 2GWNA 1R2RA 3C4UA 3WMCA 5LHFA 5HUOA 1V6TA 1SR0A 2JKPA 4BHYA 4I5RA 4GGBA 4GC3A 4Q8UA 2G3JA 3BSMA 1MW2A 1GW1A 3Q4DA 2V5JA 1W3IA 4ZQCA 1FFQA 5LIKX 1FA2A 2PP0A 1E43A 3RDKA 1HKWA 3NDZA 3BICA 2XG9A 5CPMA 5FJPA 2GJLA 1Y8BA 4QSHA 4AMCA 1AMYA 2J9ZA 4H9TA 4YN5A 2X0HA 3ZS4A 4Z2IA 3L7RA 3TN4A 2V2CA 3MC5A 4OZOA 3M5ZA 3F2CA 1MQPA 5HJLA 2CXEA 1W3NA 2DDXA 2HVOA 4W7VA 2CLKA 3VAVA 4YU1A 2QKFA 3OW1A 2GDUA 3ZR5A 3UD6A 3PTKA 5IBXC 5G4HC 1RQBA 2VVNA 4Q4MA 1LQ0A 1CXEA 1DPMA 1NELA 4I8DA 3MU7A 3WF3A 3ITLA 2J47A 3GG1A 4DAFA 3W85A 5DMNA 3R13A 3KW3A 4M81A 4HNVA 2ZE3A 4GIRA 5CG7A 4XBSA 4XBJA 2PGEA 2DVUA 3QM3A 4CD8A 3VIHA 3W84A 2J6VA 2PU0A 2WC3A 1Q6RA 4PTMA 2QULA 2Y88A 1JAEA 5IDIA 1IHIA 2DT3A 1LP6A 3R2GA 3W7MA 1JZ5A 3B4YA 4HJFA 5I23A 4DYEA 4UOZA 3FYYA 3E38A 3CLWA 4PE8A 5KZEA 2VCCA 4M7TA 1JVNA 3SFWA 3QH2A 1TFVA 3S0CA 3M44A 1FCUA 1XSKA 1NDZA 3C5QA 3UP8A 2AL2B 4QP0A 3GY1A 1UD3A 1VHNA 4F79A 4XVDA 3Q67A 3T42A 4WQ6A 3QC0A 4UTMA 1R3VA 2DUXA 3CQJA 4P7LA 3W01A 3V35A 3CJPA 2YW4A 2NVCA 1JDFA 4M1RA 3VE7A 2PF0A 1RP8A 4GNJA 1IT8A 2R1KA 2SFPA 4BQ5A 3MI3A 1KNWA 3SRDA 1S2AA 3WDIA 1H1ZA 3CUJA 4V28A 3AALA 1WOBA 1CX9A 3LQLA 4K8HA 3F4VA 1CTNA 5I07A 3QTPA 2NX1A 3TYUA 4LAZA 3TW6A 4KCUA 2NQHA 3H2AA 4D1IA 3GDBA 4Q7IA 3VNIA 4O8AA 1JZ2A 1XIBA 2O9OA 6ENLA 1POKA 5AOUA 5CLWA 4YXGA 5F7UA 2VKZG 3P60A 4PODA 5KETA 3JW7A 1GOMA 2G4FA 3R8GA 1M7OA 3KX6A 2GQ9A 1Q6LA 4UTWA 3R8HA 2VRJA 2BY0A 4FX6M 3W6MA 3MCNA 5FJJA 2O55A 3EDKA 1ICPA 3R43A 2DUAA 3UVAA 1B2YA 4UMBA 3ZJKA 5AZ0A 3ZOAA 4GYPC 3EDFA 1R3RA 2J6XA 4IMEA 2Q3RA 4ZB5A 3LZ5A 2OLAA 2VRKA 1DWAM 4H4IA 3B8VA 4AHOA 4Q33A 2F61A 1LORA 4MMWA 3AZRA 1JZ6A 2GOUA 2PDWA 2YCKX 1QW8A 1AL7A 4GQQA 2ZIDA 5TQLA 4DPPA 2WK2A 3UGRA 3QOKA 3GNNA 4M24A 2QUMA 4WJEA 4YLWA 3UF9A 4JX6A 3VZYA 3OVPA 4PGLA 2GGJA 1E0UA 4C91A 5K2ZA 5B80A 1VFTA 1ZBWA 3BDKA 2QAPA 3Q37A 4GXMA 1AQHA 1TMHA 3LMYA 5HBFA 3N4FA 1J5SA 1E73M 1OK6A 2FH6A 5CJMA 2WW5A 2V3EA 3WNNA 1O7AA 3OHMB 1DP0A 2GJNA 1DEDA 3R4IA 2I5IA 2V3GA 3WQOA 1P0BA 4JHZA 2I17A 4L9YA 2Y7FA 1FDJA 1DJIA 4JIHA 3MPGA 4HHPA 1J10A 4B5SA 2KAUC 2O0TA 4TVCA 3GNDA 4QR6A 1BG9A 1XC4A 1XQKA 1F5ZA 3NGJA 5DLCA 4U3CA 2GQ3A 5I6SA 1WV2A 1QWKA 2V2HA 1ADOA 4HZMA 1JYXA 1CENA 4HD5A 5D33A 4GHRA 3SRKA 3IVUA 3WELA 1E3XA 2R1NA 1E6RA 5GJPA 4A3HA 1RCOB 5JBEA 1UHVA 3C3NA 4G2DA 2VGIA 4TVDA 3EXTA 3S5NA 4YCOA 2Q8XA 3TTSA 3W37A 1LBLA 3EXSA 3R12A 2CERA 1XLCA 2CXGA 5H8UA 1ISYA 1LROA 1FQ0A 4OTKA 3S6OA 3DYOA 1NEYA 2Q71A 2ZZ2A 5CSRA 4GUIA 2ICSA 1ITXA 2FTYA 3T40A 1YE4A 3UZJA 1DJZA 3WN6A 2BP1A 1F74A 1E1EA 2GVEA 1ZUAX 1SVDA 1L6GA 1U30A 2QCFA 4NJJA 2FGBA 4NJHA 2E25A 4FSAA 4M19A 4CNTA 5BOOA 4DJFD 3GR4A 3NDOA 3G77A 3GNPA 4ACZB 2XFFA 4FR1A 1E0XA 3CZEA 3E02A 4E8GA 2G95A 1DIDA 3G1HA 4DXXA 3O0FA 3GFYA 1XXXA 2VP8A 4H8VA 5I2UA 4RNHA 1W54A 2VX5A 3K8KA 1UMLA 1XRVA 2PZNA 4I6KA 2OQHA 3APTA 3NURA 2NUWA 1V8EA 3QYQA 1FCBA 2YFOA 3C2OA 3VDGA 4ZA0A 4AIUA 1A5OC 2GOKA 2GK1B 3WDJA 3D46A 3PZQA 1EDQA 3VYLA 5CZSA 3K8MA 2AAMA 1VJZA 1MW3A 3QZ6A 1BLIA 3B0UX 2CKSA 4RCXA 3S2CA 2OODA 4UMCA 1RP9A 2AQOA 1IGSA 2BODX 4KWOA 2D0GA 4FP1A 1J9YA 1W91A 1EA0A 4QS6A 1VLIA 3D3AA 4W7WA 2FJUB 4IL0A 2BVTA 3QY7A 2PRLA 2NV1A 2PTYA 2DV0A 3WF4A 3ONCA 1GHRA 3FA4A 1PEZA 2C91A 3AHTA 4DM1A 1T7LA 1V4YA 2W66A 2BVDA 2Y24A 1W31A 4XD4A 4C6PA 3VNZA 4C6OA 3DBNA 1Q4WA 1UQZA 3LM3A 3W83A 1M9HA 1H41A 1TPC1 3PTDA 1T40A 3UBPC 3WNPA 3C0JA 1J18A 1I8JA 5F1VA 1YDYA 3CYJA 1VIWA 1EZ2A 3UZZA 1XBVA 2XIOA 3OOQA 1VGAA 4IPIA 4FIQA 2PWGA 5FJTA 2EG7A 3T2PA 5T26A 2ZX6A 1WNOA 5FEZA 2EKGA 4S1FA 5I0DA 3WQVA 2ZUWA 1XIGA 4IGMA 2Y7GA 1U5VA 3DFQA 3E0LA 4H9ZA 1QI5A 1R9ZA 4PSPA 4J40A 4HMDA 4LUTA 3W28A 4A22A 5EBUA 2YW3A 3AS2A 1OCBA 3WDHA 2OCZA 4Z1DA 3UXDA 4U3AA 2NQZA 1TR1A 1C9DA 2R1MA 2JIEA 2E0PA 3A21A 5M1TA 3SUWA 1IZKA 1QNRA 4K2SA 2Z1VA 4LOCA 2A0NA 5IHSA 3GIQA 1NVMA 1VH7A 3E2RA 2AQVA 4D6EA 4UBPC 5C8BB 3G0UA 1Y5VA 2AL2A 3CQIA 3MTWA 2Y5JA 1CGVA 4XX6A 4Y8FA 3GVQA 4WRHA 3VGHA 5LIXX 4D6JA 1M04A 1W9XA 3PY2A 1KC7A 3EPNA 2PLKA 3DGRA 3THCA 4JFUA 4QEEA 3RYSA 4LS2A 3T05A 3UGVA 1GK8A 2ATMA 4Y9NA 4XAPA 1TX0A 3I7RA 4F2BA 4J3XA 3TTOA 4G7FA 3KVKA 3V3WA 4E6MA 1IEQA 1IEWA 2EQDA 5D05A 3BE7A 1AH0A 1EJVC 3E74A 3OA5A 4MYXA 4NXSA 5F4XA 1G4PA 1FHLA 4DUXA 1VCFA 5G4WA 4XO6A 2VI0A 3CTLA 4NJKA 1KCKA 3GG7A 2R24A 1TMLA 4QSFA 2WMIA 3EDJA 2Y1HA 3W1TA 1JCXA 2A4AA 3W7HA 4O15A 1NH6A 5CPSA 2CBVA 2WSQA 3CIVA 4LPCA 5GJNA 3QLLA 2B31A 4EWJA 3P0WA 3D5HA 4QNEA 3W9ZA 4AF0B 3PSWA 3P61A 3W73A 4AVOA 4GIYA 5D8WA 4JIEA 3UNDA 5D38A 3FDKA 5HR6A 2P8CA 7A3HA 5D9OA 3VC6A 4UR8A 1LBFA 3W76A 2QGHA 4WD0A 3CT2A 3MUZ1 1IXPA 5B7ZA 4BQ4A 3LXCA 2HEJA 3W7NA 1PE1A 2QCNA 4FR6A 1IXQA 4ROPA 3S4TA 1KXHA 4L80A 2NQ9A 3PUGA 3W29A 3LXBA 2HVNA 3DCPA 2VC7A 3HFTA 2ACSA 3BW2A 1KQZA 4M82A 1RXOB 3P81A 3KDOA 3UXKA 3OBKA 3MY9A 1O4UA 1IWAA 2YA2A 4JTLA 2WCGA 2J7EA 1VB9A 4Q8QA 3H2FA 1H2JA 3LHTA 1Y7VA 5CC7A 3VOGA 4JQ3A 3T1GA 3G5EA 1JRBA 3TNOA 2FGLA 3QFEA 3AIWA 1W6TA 1JRCA 4XKYA 3NQ2A 4GKTA 3E2VA 1TJ1A 4IWWA 1HP5A 2BXYA 2CITA 4DUOA 2DEPA 3ZT7A 1UWUA 3VCRA 2J75A 1TB3A 3W7KA 2VFGA 1W5PA 5AFDA 1FWJC 5I79A 4MNLA 2FB3A 2OELA 3HGRA 1OG0A 4DM2A 2WZTA 4GACA 5CJ5A 5F2IA 1RAKA 3BK0A 3BTNA 2HMCA 1JFXA 2YBUA 1BWKA 4HHMA 3F4CA 2VR5A 1GQLA 4AZ7A 2DVXA 4QQ3A 3TYAA 3H21A 4UZSA 4XSLA 4ICCX 1UKPA 5D03A 1WDDA 2A21A 4GRSA 5FD0A 1BPLB 1ZL1A 4DAIA 4H8UA 3AAMA 1EX5A 5AC7A 1KBJA 1EP1A 1DJWA 4M6PA 4FXJA 3TYZA 2WPGA 1BTCA 1W1VA 2FVKA 5CBIA 4DWDA 3CNYA 4XZMX 2E6DA 3CQ0A 4CEXC 2ZE0A 1QNSA 3W4RA 1R85A 2W92A 3L4VA 3KRSA 4UWMA 3NVTA 2Q01A 1FP9A 4HVXA 1CEOA 4FXSA 3EX1A 1K70A 4RZ4A 4B5NA 1UD5A 1XLGA 3GK0A 4S2BA 3C0QA 1I75A 1F4AA 2ABBA 3AMLA 3TQVA 5REQB 3QY8A 3RHGA 6ALDA 4L4MA 4AVNA 5I7GA 1A3XA 5FESA 2NT1A 1JXJA 2OMAA 1SU5A 3FVDA 1B54A 5G2HA 1RZMA 2E8ZA 3N19B 4G8TA 5I3GA 4C7FA 3GU9A 4IFKA 3ES7A 5G2IA 2G8ZA 1GOOA 4GVHA 1GOIA 5T8GA 5CEWA 4WVXA 5DMYA 3G1SA 1JJKA 2BY1A 1GONA 3S1UA 3MMTA 1PYMA 1WXJA 5HNUA 2H8ZA 3RGTA 3E2QA 3W1MA 2CEQA 1XIDA 1B30A 2JEPA 4JQ2A 3W71A 5REQA 2D2JA 3BCDA 1JGMA 1PYFA 2XIBA 2CIPA 3WBYA 1QBBA 5FSEC 4B4HA 3TP4A 4NSBA 2VGGA 2EPKX 1S2TA 2BHUA 4PA8A 3THUA 2WO5A 4AYGA 3WEZA 1GTEA 1Z3NA 2XM2A 3HO8A 4ZXLA 3PJUA 4GYKA 3BANA 4CNPA 2QQ6A 4LCRA 4V1XA 3ABOA 1BWVA 2HISA 2YR1A 3V7PA 3BW4A 3U5YA 3MW7A 1P6WA 1FWEC 3WLSA 3LK6A 1ZJBA 3GXDA 1AVAA 4BWLA 4DBUA 2DIKA 3UA4A 3AU2A 1H61A 3AMCA 2E5BA 4WJXA 5DT7A 3BARA 5CC3A 3DH7A 1RLCL 4D2JA 2REQA 1W1TA 3PUOA 4FXRA 4M1BA 4UUIA 3BLEA 2PP1A 3S9IA 4JN6A 3A3XA 1M65A 1ADDA 4X60A 3VNJA 4HMCA 2WYSA 3TYDA 1DORA 3NUKA 5GVJA 4HK7A 5HAOA 3USBA 3WEOA 4JN8A 2FQIA 1QT1A 2D0HA 3HGSA 4IISA 3TCSA 1EEPA 2YPIA 4HMNA 1VRDA 2XINA 2CBJA 1GYMA 1Z9AA 4E3VA 4HU8A 5JBDA 4AD4A 3U2CA 4L6HA 2IQTA 1JUBA 5XIMA 1LOSA 2PTXA 2GGHA 2Z27A 1XCWA 4YNGA 2CWXA 4NF7A 3IGXA 1EPVA 1RBLA 1W2PA 3QBUA 1OX4A 3HPSA 1J2WA 3F5LA 1QI2A 4LAOA 3C2FA 1FWSA 3E49A 2J78A 3K5XA 1CECA 4LTSA 3OBAA 3A13A 3CBWA 2XSXA 1B3YA 9RUBA 2DUZA 3NG3A 2P0OA 4BWLC 1TJPA 1UOZA 4HB7A 4N42A 2ALDA 3NEVA 1DJGA 3KE0A 3W1XA 4IP4A 3WF2A 4JYDA 2PLJA 4GA8A 4IL2A 4BA0A 4BFAA 3L4TA 2UY2A 3MT1A 3ITYA 1K7EA 5EY5A 1A50A 2HJPA 2HDJA 2XSAA 5F1UA 3MO7A 1MXDA 1AG1O 1GQNA 3WH7A 1EKOA 4PB5A 4J3SA 1QNPA 4YTQA 3PFRA 3CWOX 3CZKA 5D04C 3FX4A 3C56A 3N17A 1SFJA 1AQ0A 3WQ6A 1TQJA 2REQB 5HXMA 1L6FA 3LSCA 2GVYA 4TVUA 3GTHA 4BI7A 2NZLA 4MYAA 1YXCA 2G3FA 2GGGA 1WB0A 4S23A 4A3QA 1RBAA 3AZSA 1K9DA 3NXFA 4FAMA 2IW0A 1Q6DA 1TIMA 1TV4A 2OR2A 3RMJA 1ZBVA 1RV8A 1CB7B 1F3EA 1QW9A 1AJ0A 3U9IA 4IJRA 2HK0A 5CXPA 2NVAA 4HSHA 1TWIA 1ZP4A 4MPQA 1X39A 1TJRA 3EEGA 3AICA 3SW6A 4EK7A 2QUNA 3LYEA 4XSMA 1E4LA 4R7JA 3WQEA 1IYXA 1YQ2A 2V30A 2ZUNA 4WR3A 5FSDC 2ZICA 1PAMA 3ICJA 5HATA 1OFDA 1FDZA 3CT7A 2Q8ZA 4XG1A 3GUGA 2VVSA 2Z4GA 3AIRA 2YOCA 1OINA 3IK2A 4QBXA 4OV9A 1QR7A 1K6WA 2L5HA 3S2MA 4PULA 3K30A 4R3UA 1QXLA 3IVTA 4N9CA 3QOMA 3HPAA 2PDNA 2D23A 4NU7A 3T81A 1M01A 3I4KA 2JEQA 3W87A 3BWWA 3RXZA 5FJRA 4JAWA 4AIEA 5J04A 2VGFA 2ZUMA 4H7ZA 2E6AA 3VA8A 1JF6A 1NQ6A 5RUBA 1BF2A 3BLOA 4IMFA 4DF0A 3QQWA 3T7VA 3KCLA 4LAKA 3VI2A 4HCHA 1QPNA 2ASHA 2OO6A 4NAEA 3NZQA 3PZUA 5K4ZA 5ABEA 4EPKA 3W1QA 1F7BA 4LUTB 4Y9PA 2QCDB 1VCVA 1UWIA 3WEMA 3OGRA 1PKLA 4AX6A 1TV7A 4KEZA 3WJSA 4JTKA 4KESA 4J3TA 3R58A 1MO0A 1EC7A 2VWTA 1HG3A 1O5RA 1C91A 3KZSA 4JDBA 7CGTA 3KTSA 2W0UA 2UV8G 2P8BA 3E1F1 2DH3A 2F7FA 4UTUA 1ELSA 1JPHA 4LQ1A 1GJUA 3KVJA 2MUCA 3L67A 4LNYA 3CL7A 4HZ8A 4F40A 1E5NA 2Y8VA 1KRBC 2RDUA 4PR4A 3TE9A 1O60A 4FEZA 3U4AA 2JE8A 1L8PA 1UUOA 1H7WA 3TZFA 2I9EA 3RM4A 1CXKA 3NYZA 5CSUA 1E0TA 2FZDA 2DSZA 5E9AA 3BJTA 1KV5A 1HO4A 5L9FA 4GY1A 4HTBA 1CDGA 3IIZA 5AHLA 3UCCA 2OX1A 1JNEA 5JUVA 1KFEA 3FNDA 1F07A 2FHCA 2BBFA 1JEZA 4PRWA 4ZZ9A 4H9YA 2CZ5A 4FXFA 1AQFA 4W4QA 3NZRA 1UP2A 3ZIZA 3LN3A 3WJWA 1UD4A 3M0VA 4PUJA 4ORMA 4PTVA 5LIWX 1P0KA 1GVEA 1UQYA 2Y70A 3EX4A 3W2LA 1DTNA 3IVSA 5ECVA 3VOJA 1I2OA 3G1AA 4IICA 4GX9A 4DIAA 1X7IA 1ISWA 5HQMA 1BKHA 5DO8A 1FWAC 2PEVA 3S83A 4PB4A 3GX9A 5CCZA 5AVNA 3H8AA 1A5MC 5I03A 3IUHA 1E71M 2X7WA 4LUJA 3V36A 2R1LA 1PZ0A 4D6DA 1F9CA 5LGXA 2ATSA 4JNYA 1R2SA 2Z6IA 1SMAA 2EPMX 1UPMB 3HMCA 4JTQA 1RK5A 4JYEA 2EHHA 5HWJA 3AXMA 3VX1A 1ONWA 3ARSA 2WHKA 4LGXA 2TPSA 3TTEA 4LB3A 3E2SA 4WOQA 1JZ8A 4W9TA 4Q4SA 1JDDA 1UR9A 3POHA 4N9BA 4S3CA 4O53A 3EYPA 3STPA 5CPNA 5A2BA 1KW1A 1DJXA 3GFZA 2CKRA 3S5OA 5FJUA 4ATWA 2YYTA 4DF1A 4FNSA 2ZZ6A 1PKNA 3ELFA 4K3ZA 5G1YA 3ZWSA 3SECA 1PVNA 3HG5A 1CGUA 2BV9A 3ZT5A 2JKAA 2BGNE 2DPEA 2OKOA 1ZP3A 5CLTA 5F2MA 1HL2A 5FAJA 4AXNA 2FMOA 3H4GA 4AZ5A 4PUUA 1QNVA 2A5HA 1S3TC 4FK9A 4N9DA 3THDA 1C9WA 3RF9A 3GNOA 4M6VA 8XIMA 1W56A 3NDYA 1NDVA 1H7OA 1LT7A 3NCOA 2PD5A 1ME9A 3PVFA 3AOFA 4RR4A 1EUNA 1U33A 1YTDA 3MCMA 1LQ2A 3I7SA 3SUTA 3V1PA 3FXYA 5E0FA 3OQEA 4C1KA 5HNTA 3URAA 2QF7A 1OFPA 2XU2A 4B3ZA 2RDTA 3H2CA 4JNMA 2OSWA 3MUY1 5A69A 2DY3A 2IXUA 1BVWA 3H26A 2WLZA 5CZTA 1JCTA 1G1YA 1QJWA 2J7HA 3FDGA 1XLIA 4DUVA 2E3ZA 3EA2A 3NEHA 4NZ1A 3WLLA 1JZ3A 1Q4NX 1H09A 2D69A 3E12A 2C6QA 3CTTA 5MHBA 1GT8A 1JD9A 2WMKA 3TN3A 3PJTA 5F2GA 4PMQA 2EPNA 1KLYA 5A3HA 4XZ9A 4MAZA 3LV6A 2O7SA 1JPKA 4XWUA 4LH8A 1CT5A 1CYGA 3OU8A 5DELA 4AEOA 4GQ0A 1AW1A 4QQUA 2E4TA 4Q8MA 4CVUA 2EG6A 1PCKA 4N4PA 1UJQA 3W1LA 1AQMA 3NQBA 1FWFC 2YCIX 2ZBTA 4ZEPA 4PEKA 4MFDA 3R11A 5AY7A 3H7UA 3MZ2A 1SO5A 3OVQA 1VENA 4WHBA 2XH7A 1QATA 1EOMA 3FY1A 4AZCB 1MMFA 5DCBA 4AIOA 3KRUA 3GDTA 1XKYA 4OGZA 3AIVA 2FVMA 4HPGA 3E9AA 3ITTA 4PH6A 3KOYA 1TPWA 5FACA 4RV8A 4GVIA 3DHFA 4D9PA 4LF1A 2WNZA 5C6MA 4JEQA 1GVIA 4LEFA 3O7UA 3C0LA 3LMZA 1B4KA 2FFCA 3BSHA 2G96A 1ZENA 1XV8A 5EGRA 4L1WA 3UG4A 3W7PA 3WQGA 1E1CA 3NPVA 3O6CA 3DOPA 2CCRA 3VNYA 1BYAA 4FA3A 3G8EA 5I00A 4X2RA 3OB8A 3LY0A 3EOUA 3WLJA 5G5IA 1D2KA 2QXWA 1AFSA 2BFGA 3EB2A 4YTTA 1FH9A 3WNMA 2R1PA 1D8CA 1AW2A 3TONA 1XLFA 2BMBA 1GKPA 5HR7A 3ARVA 3EPOA 3FCPA 2QJNA 4PCFA 1IXNA 1D7KA 4GH3A 3KLKA 4KGJA 3WYZA 4YVVA 2CU0A 1XJBA 4TU1A 3QHMA 3FOKA 1TZ9A 2AOSA 4MKVA 3NQEA 3VKDA 2QNEA 3DFTA 4PRTA 4YJ5A 4AWSA 3EOLA 1EYWA 4JOMA 1PV8A 4JY9A 4OE7A 1DHKA 1OSEA 1EXPA 1FRBA 1XHGA 2PDMA 4A05A 3N11A 4PBFA 1ITUA 3IUDA 3VFCA 4ATDA 4HYRA 4QLJA 5JQ9A 3B8IA 1UWRA 3UWUA 1VP5A 3EMCA 4PMZA 1IZJA 1IEVA 4L56A 1F8IA 4PCSA 3K2GA 3VD4A 4DXVA 1GQIA 3R10A 3GKFA 4Z2LA 2DQXA 3LDVA 4N9EA 2E8YA 4QJ4B 3B97A 3NR0A 1EH9A 4XVEA 4MJMA 3KL3A 3L2IA 4WXZA 5CZJA 1A47A 3NQMA 1R3QA 1HKMA 3GWQA 3WDPP 3AIBA 5TBOA 3TX9A 3VKBA 4XZNX 1PWLA 1EBGA 1K7XA 1V0NA 3E96A 5BW6A 1V7AA 3R89A 4R27A 2C79A 4B92A 3L2MA 1ME8A 1TE6A 3IIVA 4PN2A 3RLHA 4HNOA 4YS1A 4NZ3A 3BVJA 3S1XA 3S9ZA 3EDDA 1U5HA 1GVRA 1W1PA 2A3HA 3ITVA 3M0KA 1K4GA 4RNFA 1W9BM 4LS1A 4NI3A 2Y6ZA 3URNA 4NX0A 4AW7A 2YJQA 2W91A 2VD8A 1GKRA 2WJFA 1YX1A 5TF0A 1MRAA 4YHEA 3U0HA 1OT2A 3REQB 2I5GA 3CAKA 3BUVA 3QXBA 2DU2A 1KM5A 1UH4A 4RV3A 3GZ3A 5JIWA 2ZYFA 3WMLA 3HGJA 3PZ9A 3WQCA 5I3FA 4GIAA 4MY8A 2WQDA 2BSLA 4Q4OA 3W7CA 1KBIA 3V75A 3BAXA 1ZALA 5CBBA 1J0YA 1TREA 2F9RA 1OABA 4KQNA 4R34A 4D6IA 4K38A 1JGIA 2VZUA 4OBTA 1ZQ5A 3IJ7A 1NOFA 2XGZA 3RJYA 1NM9A 2NX9A 4Q4KA 2WWCA 4O57A 4PYSA 5A6AA 3GIYA 1OCJA 1XRTA 2OZ8A 3BH4A 3QKEA 4PTDA 4MKNA 1E72M 3FK4A 2X1UA 4HT3A 3H2NA 2WNWA 1V3JA 3AC0A 4HQVA 1CW2A 4C5ZA 3MSGA 4Q4RA 2F6UA 1FWHC 1VYPX 7ODCA 4AY7A 3HPFA 1FWIC 4LBRA 3WZ0E 4WJ8A 5AYZA 2BVYA 1EHNA 4WSJA 1CNVA 1K1DA 2FH8A 3MB9A 3LZ3A 1R38A 2QMKA 3T0BA 4NY2A 3CV2A 2C1GA 1F4HA 1V7YA 4BR1A 2WQPA 3BMWA 2PGFA 4O52A 4BS0A 2OJPA 3PANA 4O1AA 4C6LA 5B7YA 3V16A 3VO0A 3NQDA 3GAYA 3DG3A 4Z17A 1DJYA 5BU9A 1KFBA 1PZ2A 3N25A 2CWNA 2PA6A 3LCFA 3IJ9A 4G7EA 2XUCA 2TYSA 3TXZA 3S5SA 1F2JA 1TRIA 3L4UA 4PTWA 1MFVA 3DFSA 4QIUA 2J77A 2OU4A 4TQTA 4H8HA 2ZZ7A 4E2OA 2CLPA 1SYTA 2O56A 2VCAA 3G1FA 1PZ3A 4NZFA 1H7XA 1PX3A 2IKJA 2BDQA 2GVGA 1TA3B 3OZMA 1AZ2A 3CQKA 1TCDA 3AFBA 4ADSA 3L5AA 3MHUA 4XKYB 3NFUA 3RX3A 3B9OA 4PB3A 3FA3A 1J79A 3QC3A 3G0SA 3FXGA 1RVGA 3QMRA 4MG4A 3TV8A 4LYRA 4NXKA 2FPVA 2VEFA 3L0KA 3HV8A 1IF2A 3QRHA 2HRWA 4FNQA 4DQWA 1IIGA 1O5QA 3C2EA 3TOYA 3ANYA 4Q8WA 3BCJA 4C6BA 4FOKA 4NAFB 1TZ7A 1ML1A 1LJYA 2OGJA 4YIWA 1VZWA 4GABA 4AYSA 5FEPA 1LWJA 2X1IA 2VRQA 3VIGA 3TQPA 3UJFA 4XZBA 3BCFA 4F66A 1XH2A 2D3LA 4M56A 4GYFA 3F1QA 1B3VA 4ENLA 2X1SA 3KRZA 4RZ5A 4FNPA 3SCSA 2MANA 1SZFA 1WZKA 1SJCA 4XIMA 1JQVA 3UPWA 3T0CA 3SSJA 5D30A 1GHSA 2QF8A 2B0MA 2J8GA 3N9RA 1ITCA 2V68A 2WHLA 3AJ7A 2DJXA 3H23A 1WKDA 4IQEA 3PSVA 3W86A 2IXVA 1CXIA 3IARA 3NNTA 4EXAA 3GXTA 1R3TA 3WQFA 1AZ1A 4IOTA 3KWXA 1XDMA 1LRQA 2F38A 3G8RA 1EF2A 1NWTA 3N18A 1P1MA 1TVPA 1WKYA 1GG0A 3AWOA 3PK7A 1BAGA 2P53A 1DBTA 2EF9A 4PC8A 5BWAA 4LF2A 2AKMA 3WMSA 1K9TA 5HWMA 1UR8A 5L6UA 1XS2A 2VZSA 1SJDA 4FF7A 4UNIA 5C71A 3W72A 1YKWA 1UKTA 3SCTA 5CAKA 4I90A 4EF8A 5DXYA 4LV4A 2XGIA 2Z7GA 4DJFA 3W23A 1X6LA 2I5QA 4AHPA 1VD6A 3G18A 1JCJA 5GJMA 1OK4A 4X0VA 1ICQA 2HWGA 2R6OA 2YZRA 3OIXA 5GQBA 2ZZ3A 5JVLA 1QO5A 2GDQA 1L0PA 4J2MA 4IIEA 2DSVA 1X98A 2D3NA 2BXVA 1X6UA 7ENLA 3ZZ1A 1QK0A 1LLZA 1U5JA 3LSBA 4FZIA 5E0KA 4AZCA 1MRQA 1LT8A 1ONXA 5AZ1A 3CYVA 5C2CA 4D6FA 3RPTA 4E2BA 5ECUA 4JTGA 4V15A 3TYEA 1LCOA 3MANA 3ITOA 3Q65A 5D9PA 4MB1A 2GZXA 2RAGA 3TW9A 3KL5A 1L8NA 3ZYZA 4X2PA 4PUKA 4QHRA 1VR6A 1YTKA 3DAQA 2INEA 1KKRA 5D02A 5LA1A 3ZLGA 4UNLA 3LXAA 4JD4A 1TSIA 1YRRA 4RDVA 1CGXA 3TC6A 1J5TA 3KOWA 1REQB 2CHRA 4QTGA 1OM0A 6XIAA 3BL3A 1OCNA 4I9MA 2RHGA 4UNKA 2VEKA 3MI6A 1DWGM 5CJNA 1NOWA 2ADAA 3IACA 3W1UA 5BYWA 2X8RA 3K4WA 2Z1KA 3RLVA 3LTPA 1TRDA 4V33A 1WP6A 4TMBA 5AYIA 3RK8A 3AUOA 2CLOA 4GPNA 4K8GA 2FYMA 1XISA 4W89A 1TWZA 2XH4A 2I7GA 1OHLA 4GO8A 4XV0A 1PSCA 3CHFA 3KM8A 3H2OA 2OEKA 1DWIM 4AX7A 4HKPA 5F4WA 2AL1A 1SQ7A 3CXOA 3WLHA 1I4NA 2VYOA 3DKLA 3O05A 2PS2A 3TJ4A 1XD0A 4H6KA 1SFLA 2WM0A 4JCLA 4WKHA 3UXAA 1V5XA 1WCGA 4YTSA 4GJ1A 4IT1A 4GI9A 1OEPA 4DN1A 4NZ5A 4AY1A 1JYWA 4REQB 4JX5A 3LCHA 5I24A 2J25A 4O17A 4I5XA 2QHAA 1NWSA 1ZJHA 3DG7A 1E0VA 3NJ3A 3VD7A 3TA9A 4ERGA 1JFHA 1FTXA 3B4UA 5C9UA 1GOWA 3OPSA 4JTCA 3U2ZA 1XLBA 5FL0A 3N3TA 4JTRA 3TSBA 1UZ4A 1QI4A 2FZBA 2GSEA 3AXHA 2HPMA 2ZTJA 3V4BA 5K7JA 5EA9A 1YMYA 3M4HA 4GZIA 3QVQA 2YDSA 4Y9MA 4M3PA 4L1GA 4P5UA 4N02A 4JN7A 4IIBA 1KGWA 2UZ9A 2J7BA 1QAPA 1RA5A 3BAIA 1DXEA 2J74A 4H19A 2J7FA 1RCQA 4GQRA 4X22A 1GZJA 3BC9A 4UR9A 3ZMRA 2PP3A 1ZCOA 1V02E 2YBTA 2RGLA 3W0KA 2J24A 4ONVA 1W8SA 3HF3A 1ISVA 5EMLA 2W63A 3EKZA 5IOBA 4MUPA 5EMYA 1PTDA 4B3KA 4P2VA 1K6AA 1P4CA 1LTDA 1RHCA 1OX5A 2ZXAA 1FKWA 3V0SA 3EMQA 4O4WA 1W1ZA 3UJRA 3P7YA 3ZVIA 3GW0A 4RNIA 1GUVA 2GUUA 5FF0A 3PWAA 3PZMA 4AU0A 4J35A 3B06A 2Z28A 3LGEA 3MSYA 3ZR4A 3CUZA 3HV9A 4NILA 4MTVA 2XVGA 5HQEA 1RY8A 3NO3A 1XLDA 2PRHA 1FCVA 3GHTA 3PWGA 3T4WA 1UASA 4O19A 4HZ6A 4CEUC 1S46A 1Q7MA 5MKGA 5KEZA 1I45A 4DB7A 4B5WA 3CH9A 2XVKA 5KSWA 5HK4A 2PTZA 2O9TA 1QOPA 3HPXA 3VMPA 4AC1X 4F3HA 4G6CA 1POJA 4B91A 4M7SA 4ERAA 2WC7A 4GK8A 3DBPA 1KRCC 3UCDA 4GXWA 4C6EA 2VR2A 1XIEA 3RAOA 1HJXA 3SGZA 3WJXA 4G7EB 4N6FA 4POCA 3MMUA 1W9DM 3K1DA 3W7GA 4YVXA 1N55A 1HF6A 5GNYA 2XN2A 5DX7A 3CB3A 3B8DA 5M2FX 3DFYA 3U3HA 1N8IA 1XLJA 4UQDA 4JS3A 1WXYA 3SI9A 3WG6A 3GVWA 4R7WA 3MS8A 1QOXA 3M46A 1MWOA 1EEXA 5TD4A 4N7QA 2WKLA 1TVLA 4B9YA 4ZODA 3TLLA 3PAOA 4BI6A 3BV4A 3B9DA 1OB0A 3GTXA 4DZAA 3BV7A 4KCVA 2RGMA 2ZRXA 2UY5A 1UKSA 2YXOA 2XISA 2XIIA 3BG5A 1LOLA 1Q2RA 1WZMA 4C65A 4F8XA 4DLFA 3WFLA 1UBSA 2DW7A 2V9DA 4LUIA 2CETA 3KBJA 1B9BA 3G2GA 4PZVA 3NQGA 3IGHX 1ZPTA