2CLVA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm8 peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Distinct orientation of the alloreactive monoclonal CD8 T cell activation program by three different peptide/MHC complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 72
structure length 278
sequence length 278
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2clvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2clvA01
2ARJB 5IG7B 4GBXD 3QXVA 4IOSD 3UTTD 3T0EC 3KPRD 1AP2B 1KIUA 2H6PA 3E8UL 5I8OL 5C2UB 3CZFA 4K8RL 1T89A 4YUEH 3HAEG 1FPTH 1BEYL 3HI6H 3QUYD 2NTFB 4IDLA 3MNZA 4I0KA 3H9HA 4PRBA 5GISH 4OF3A 4YR6B 3BUYA 1AGFA 1JL8A 4QRTA 3HKFA 3TCLB 4OGXL 5J3HD 2BOCB 5B38B 2PCPA 5J4MA 3QEGH 3MRLB 1YUHB 1I3RA 1PGRB 4FQ2H 4JRXB 4PRNB 2WWMD 4FQXB 3AMLA 2E6PA 4HUXA 4UTBH 3GI8H 1A6TB 1HINL 2AEQL 4M43L 4LSQH 3RGVD 1MFAL 1X6NA 5A40E 4QXGH 4QHUB 3DIFA 3PGFH 1BZ9A 3MNWA 1U8KB 1DN2A 1HHJB 1T1WB 4NZDA 2J88H 3IXTA 5IW3A 3ULSA 4WUUD 4NQCA 1LK3L 2YSSB 1U8LA 2VXTL 3FOMB 2FX9L 2DQJL 4WDIA 2NX5A 2PR4L 4XMKH 3ZDZF 5EC1A 1QFUL 1OGTA 4GAJH 3WIFB 5F3HA 3ULVF 4G80B 2WINA 4K23H 1BQLL 3QI9B 2GKIA 4F7CB 5DVOA 3EDEA 3SDYL 1C5DA 2EDXA 3S36X 4MWFA 3ALWA 2BY1A 3RWIA 1Z9MA 2BCKB 2R1WA 1ZGLA 4QTHA 1QSVA 4C56D 3IDYC 4A6YL 3AREA 4OBSA 1SM3L 1MEXL 3DRTA 4YAQA 5DMYA 1NUNB 1KXVC 2D31B 3OHXA 3KPOB 4PJHA 4OLVH 5E6IA 4LASH 2HVJA 1SEBB 2QLVB 4JZOA 3K81A 4BZ2L 5E95B 1VACB 1OT1A 5FGBA 4ELKA 2P4AB 1KIQB 4PGJA 3KVQA 1P7QD 3ARZA 1KJ3H 3HPJA 4LLAA 1QA9B 2DBJA 3TN0A 1SVCP 3MV9A 1T0MB 4MVBD 2IH1B 4RWHA 4P9ML 4MA7H 4GW5A 3FMGL 5F6HJ 4QWWC 3OR6B 5I19H 3GSXB 1JF1B 3CC5B 4OFVA 2VLJD 5ITFA 2VLLA 1I3VA 4ZOCA 2C1OB 3T3ME 1C5BH 3GM0A 3ARTA 3VFUB 2CLZA 2D9QB 2OJZL 4EI5B 4ODWB 4Y4HC 2RFXA 3V7MA 3U1SL 3D18A 1YN7B 2W65A 2DKUA 1F11A 4G42B 4RZCB 3DHJA 2G75B 4R4ND 3U4AA 4ODUB 2P5ED 3L7FB 1ED3B 2WWKT 5D1ZA 5GRUH 4AEEA 1BJ1H 3NVQA 5DJDB 4Y7MA 3B9AA 4ODVL 3QAZB 5ADOH 2HFEB 3BKML 32C2B 3SE4A 2BSTA 2HWZH 1T5XB 4XPHH 1N8ZA 1MREH 1G7HB 2BERA 5TF1L 5C09D 1UJ3B 1YEKH 3FB5A 1T04A 3S4SA 4HPOL 2FX8L 3I85A 4OF0A 4MNQA 4M8QB 1FRGL 2QQLL 2V5TA 2CKBL 5HVHB 3ZT5A 5LGJB 5HI3D 5FK9B 5A3IC 2XTJD 1KC5L 2XACC 1MCWW 3BE1H 4OLZH 5I0ZA 2QSTA 4NCC2 4QCIB 2R9HD 2X9XA 4U49A 3P4LA 4XVUC 3U30B 5C70A 5KSBB 1BVZA 3GKWH 2W07A 3TFKD 1G9NL 3MLVL 3QRGL 3QFJB 4J1UA 4M3KB 3GKZA 1NLDL 4G5ZH 5IMOA 1RV6X 4Z6AT 2NY2C 4G6FB 5DO2D 5TDNB 3BDBA 4C54A 2NNAB 1LNUB 1UH2A 3IU3B 3T0XA 5FUZL 3QIWD 3C8DA 2I07B 2CJUL 1T4KB 3MA9H 3SGJC 5KSBE 1G6RH 3SE9H 4U6TA 1KEGL 1ZMYA 1WVZA 4GRLA 1HXMA 2NXZC 1JNHB 3QFJE 4G3YH 5EN2B 4EZMA 5JPMA 1H3TA 3C5JA 4OSUH 2ZSVB 4NHUB 4NQXB 4UT7L 1GOFA 5DQDL 2PTTB 3U4BL 1OAZL 4Y4FA 1Y6NR 5C0EB 3GMOA 5LGKA 5DJZA 1MCPL 4LHUA 1I1AC 4X4XA 1TVHB 2VLKA 2ZUXA 4ZUVA 2RIKA 4LLVB 3ZKQD 1S7TB 4NYLB 2VDPL 1UZ6F 2VR9A 4IRJB 5FAAA 2VH5H 3BGMB 4YDIL 3WNMA 3A6BL 4Y5VC 4WY7L 5IB4B 5H37H 1CXKA 2LU7A 2L4OA 3O3BA 5TGBA 3MV8A 5TPWH 5BO1H 3ZT6A 4BFIA 5FCSH 5HGHB 5I16A 4DGVL 2G2RA 3OTTA 2ESVA 3VXMA 1TJIH 1N64L 4EDWH 1FIGH 4GAYA 3DVNA 1I8KB 2B0SH 2NY7L 1YNTA 2VXQH 1P53A 4PP1C 3ZDZE 3OGCB 2FDBP 4PP2B 5ESVB 2O5XL 2VDMH 3I3BA 4PBXA 1ZT7B 1A4KB 1YEHH 5K9JL 4PJBA 3OAYK 4P5KB 4XBGA 3MRCA 3WE6A 3SO3C 2CPCA 3UYOD 4ZUUA 1FFPB 2E5EA 4WFGD 4Q9RH 1BBJA 1XF1A 3MLRH 3KPPA 4IOIA 3QEUB 4HFUL 4ETQA 4XHJC 2OJEB 2YRLA 3WS3A 3MR9A 3D85A 4EN3A 2A6IB 1AGCA 4KK5C 4APQC 1P4IL 1KCGC 3K8MA 3OJDA 2WBJD 4HXAL 4HIIA 4K2UH 3S3PA 3SJVD 4NC2B 4NQEA 1FJ1A 3ARGB 1CVSC 4ZUWA 5FKPA 3UTQA 2HTKD 2YPLD 3QUZA 5IOPB 5J0BA 3TVMB 3EYOA 4FXLA 4CU6A 4TUJB 1DBML 3S37L 2AQ1A 4OGAC 3MLXL 3SQOH 1SJVA 5DLMH 4FXGB 4WHYG 3PP4L 5J9PB 3T8XA 3CDYA 1FL6A 2VLRA 4Y19D 3MYJA 4LIQL 1NFDB 3KGRA 1V3LA 2IAMC 2VR5A 4MXVE 5SWSD 4PRPA 4A6YA 2ZZUT 5DVLA 2OI9C 3FO1A 3BKJH 2FJFA 4OZGE 1MJ8L 4P57A 1U3ZA 5MERA 3JWNC 4TUKH 4CN4A 4DW2H 1MCRA 1X5HA 3MODH 3NA4A 5E1AB 2YOCA 3RPKA 2EYTB 5DFVC 2XIDA 1NFDE 3ARFD 5FHBH 3LEXA 4WFHE 3VXRD 1T7VA 4AENB 3FFCA 3G6AB 2OXHA 1EHNA 1A6WH 4KRPC 6CGTA 2Y07H 1JN6A 4H8WH 4HKZA 3ARPA 3VXPB 4O9HH 1ES0A 2ID5A 1BFOA 1JE6A 2H41A 4FQ1L 4U0RC 4UINH 4M9PA 3RKDD 1AQKL 1JYVA 2XFXA 3HAEA 2R4SL 4NZRH 1KN2H 4AG4H 4JO1H 3LMJL 1T7YA 4DGIH 4JDTH 4LCWE 2C7UB 2QQNL 4PB0H 2EDLA 4H1LB 2P7TB 4JHBA 5CFHA 4X98B 4ELMF 4WW2C 1FNLA 3TYGL 1A14H 5IB1A 1A6VH 4NBZB 1CF8L 1G7PA 5D9SA 4FP8H 4I77L 1A6AA 5K33A 5JW5B 5T3XD 1ITCA 4U1IB 5JR1L 1HH6A 3WUZA 3DURA 3TBWA 3MRQB 2KH2B 5I1CL 4XP5L 1I1FB 5DJYA 5AEAA 1HHKB 2Y06H 2F19H 1NMCC 4XB8A 3SDXE 1UEYA 5CJXA 4PLKC 2J5LC 4YXHH 5IQ9B 1FBIH 2YZ1A 5IB2B 2JIXA 1NGPH 1FNEA 4B7LA 5FB8B 4OUOA 4PJDB 2CKBA 1LDSA 1GSMA 5FF6B 5EWIL 4PG2A 4XXCA 3Q1SL 4WI4A 1YEDA 1ZHNA 5CJ5A 3QNZB 4P46D 3FOLA 3UEZA 4LL9A 5C08B 5KSAD 3AS3A 1ZANH 4HKJA 1DEEB 2V6HA 4ZFZB 4X9HA 2AK1L 2YUXA 3O0RL 2A9ML 4NQDB 4NUGH 2Z92B 5M95B 2Y25A 4PJDE 4JR9L 4N8VB 5TF0A 3WXWH 3D69B 4N0YL 4AT6A 5HHOB 4MQXC 3F7VB 2ED8A 3QDJD 3MRKB 4LLUA 3NZHH 1Q1JH 1CD1B 5DF0A 5C08E 2P5WA 1I7TB 4XWGH 5C0BD 1U3YA 3BRGC 3H7BB 3ZTJH 4K9EL 4PJCA 4U1LA 3CFBA 1A9BA 3BPCA 3ERYA 1T0NA 2VO5A 4GJTB 2F54D 3FCTA 5J8OA 2IANB 2H3NB 3QWOB 1RJYA 4N8CH 1P5VA 5HHOE 5GJSH 3WFEL 3GJEB 3D3VB 4MMXC 5HD8D 4JJHA 4MJIA 5EU6B 4JKKA 2EH8L 1X9QA 2FIKB 3HR5B 3LPWA 4JHWL 1IILE 4PJXA 3TO2A 3MRIB 5E0QA 3KDMB 1MLCA 2ZOKA 2IANE 1NCWL 3RY6A 4GO6B 4BYHA 4NNXB 2BRQA 3GRWH 3G5ZA 4KUZH 5DUMH 4MJ6B 4JZJC 4U1SB 3Q6GL 1A22B 3QQ3A 4MDJA 3D3VE 4OV6F 5DYOA 5I6XC 3BP6A 3REVA 2XA8H 4E41D 2HJLB 2XKNA 3TA3D 5HYQA 5IQ7H 4Z0BL 4X7CC 1JPST 3IKCB 3ILQC 3VFNA 4FQQB 2VDRH 2EKJA 4M7LL 1M71B 2OTWA 4JRXD 1BOGA 3WS6C 1GRWA 3QUMH 2X4SB 2VDOL 2DQGL 5E8PB 3H2WA 1XAUA 4JJ5A 4ZFOB 4HFWA 1JNLL 5D96B 1FCGA 1ZXQA 5MP6H 1U0QA 3P0YH 1H15A 4L29A 1QR1B 4KVCH 1TFHA 3I6KB 3L95A 4X6EA 43CAB 2H2SD 1ZVSB 2R0WH 4FFWC 1KFAH 3CLFH 4LU5H 3ULUH 3VWKC 4L8SA 1A9EA 4Y88A 4JM2C 2ATPB 4FQIL 5D5MB 4RISH 3MUHL 1JGEA 5IWLA 3IFOA 2GK0A 5E2JA 3FB8B 3AFLA 3UJJL 3MXVH 2F8OA 4L3AA 4M93C 5C0AB 1S7XB 5DFTA 4L9LC 4ELMB 5KVDH 4U2ZA 4XC1L 3PWNB 5JHDE 3T1FB 1TZGL 5KVMC 4OD2B 4ONHB 5D5ME 4P2QB 2B20A 4Z7UE 3P9MB 1L8JA 1JPFA 2ORBH 4S2SA 4XBPA 4Z7WA 4YDJA 5H35A 4C57C 4M6OH 2CDFA 3WNLA 1DBKH 5C0AE 4EBQH 1J1XL 5T3ZE 5I9QC 5KS9B 1ZLVK 5I75C 4NT6A 3MJ9A 1XF3B 2FD6H 4OKVA 5BZWB 1P84K 3TNNB 3I9GH 3EYUL 4GS7B 3SKJH 2FB4L 2BHZA 4G6JL 2ZNXA 3H0TA 5BJTB 1BVLA 4P59H 4LNVA 3RL1B 1DQDL 3VI4F 3CCHB 1E28B 3A0OA 3EJYC 2DYPB 1V7MH 5KS9E 3BAEL 1H3PH 1MJUL 1K4CB 3RA7L 3FT4A 3TV3L 1DUYB 3PWPE 1SBSL 1A2YA 3CH1A 3JSSA 1PG7H 1J1PH 2XWJB 2X09A 5C8JA 3RU8L 2IFGA 1X4ZA 4EIZC 3QJHA 2X89D 4XPGL 5TQ0L 4NFCA 5DXWA 1R3IL 4HLZH 1PG7W 3BN3B 1H3VA 4G9DA 4Y4KA 4Z0XA 3IU4H 1AXSB 1T21B 1UXSA 3ZZ1A 5D70L 5E1HB 3FQNB 1KYOK 4P2RE 2BVEA 4BH8B 3MCLL 4UNUA 3O8XD 3T2NL 8FABA 4GKNB 2W60B 1M7XA 3DXAD 1AJ7L 4ZNEE 3U2SB 3AB0C 1P9MA 4NSKA 5ISZA 3SE8H 1EMTL 4M6NL 3PNWA 5JW4Q 4LLDB 3EDFA 1S9WB 1ZHKA 5D7KE 3U6RA 3W0WA 2EXWD 2AERT 4IRSA 4QHLB 2JJVA 3EO1A 4L8BA 5FYJD 4XZUA 3U79A 1H0DA 5EZOL 5EIIB 2MMXA 4RMWA 4YHMH 1RI8A 1JK8B 2FECL 3JZ7A 1U42A 3PHSA 2BFVH 2AAVA 5C86A 2MHAB 3S36L 5SX5H 5ICXA 2DQIL 1MHHB 1T80A 4Z77B 1FZOA 2LVCA 4X4ZA 3PQYB 4HJGB 4Y1AA 5CLWA 5CD5C 3C5SB 3B9EA 4JFDB 4R4FL 4HUNB 1CXIA 4NO0B 2E9IA 1HKLH 3C8HA 5EU3B 4CADB 4Y5XB 4XTRD 3E6FB 3GBMH 2AJSH 2D7OA 1YJDH 4Z78B 3BW9B 4OF5A 4PY8J 4XVJH 5L2KE 5IEHB 3JTSB 1SYSB 4XVTL 4O51B 1S9YA 3PQYE 3I6LD 5DJ6B 2BOBB 3GFUA 4FQHA 2H2PC 3GIVB 3QQ4A 4JFDE 3U83A 2NY4C 1FL5A 3OKMA 3RDTC 4PJ8C 1S78C 2FX7H 1CVRA 2P8PA 1JWMB 4KJYA 5KG9B 1ZA3A 1P4LB 4X5WB 1IEAA 4NKDB 1IBGL 3NCYP 3O2DH 1BJ8A 3MLZL 1VESA 2DLEA 4XCNA 3B9KB 4JFXA 3HZKA 5D7JC 4HKBB 2B4CL 2EH7L 1KCSH 3B4NA 3KJ6H 4P3DB 5A43C 2V7HB 1KF9B 3TYFB 4BA8A 2AEWA 2F5AH 1BQUA 5FFLA 4UV7H 3KR3L 3ULVD 1CZ8H 2ADGB 4AH2A 5GS0H 5AYUL 4IOFD 1XZ0A 5C3TA 1NCNA 1EJOL 2R56H 3IETB 1BVKA 4RBPH 1NFIA 5LWYL 3T2QA 3QHTC 4N8PA 4KZDH 1K4DA 1NC2A 2W38A 1Z9OA 3R8BB 4UILH 2BDNL 4PJ9A 5K93A 3GBNL 3FHQA 1ORQB 4M7JH 1GJIA 4NO5B 2V5MA 1FNSH 2EE2A 4XRCA 3VFOA 4L3CA 3WKML 1PSKL 3UO1L 1U95A 4Q7DA 3KHOA 4CMMA 4BH7B 5IG7A 3S96B 1IAOB 1MRDL 1KLFA 1MI5A 3CUPA 3ZTNL 3NPSC 2XRAH 2RAMA 5AUMB 3V0VB 3BGFC 3QULB 2NTFA 2XG5A 4FFZL 5CIPA 2EIZB 3NTCL 4KKBD 4O4YL 3M45A 3MJ7A 3ARDD 4DVRH 3U0TA 4HUWB 5BV7B 2VQ1B 5DEFA 1VFOA 4XCFH 1UM6H 4JZNA 1CD8A 2YC1B 2NW2B 1PKQB 1BJ1J 5DI8B 3SDDC 3HE7C 1MFBH 1Y18A 3MRLA 1YUHA 1LP9E 3I84A 4OUUA 1R0AL 5E8OB 2V2TA 1KTRL 4OM1H 2NZ9D 4R97B 4C83A 4N5EA 2CK2A 2E8YA 1L0XA 1J1OL 1PKQE 4ODXA 4L4JA 2X1OA 1T1WA 3UDWA 4D9RE 1CE1H 2EEBA 1PAMA 4GSDL 4BELD 2QADB 2YSSA 3WNOA 1DBJL 1QACA 1ADQH 3FOMA 5IBLD 4OD1H 4Z95L 4QRUA 3RWHB 2R15A 4W70A 2C3HA 1RUQH 3VGFA 2K3TA 4KQ3L 3GEWB 4TNWF 1GZPA 1A4JA 3IAQA 4F7CA 2UZIH 3V5DB 4JO2H 3ETBF 5IVZB 2APFA 5AZ2L 1VFBA 3LHPL 2HT4D 3DMMC 2Y1VA 4MHHG 1X6LA 1U8IA 3OKKB 1YEIH 2X10A 4KXZI 3WIHH 3SOBL 5E6YA 1TJHL 5DEZA 2VITB 1ZHLB 2YUWA 4O2EA 3MACH 2Z4QA 5GIRB 2VZTA 5AZEH 4TNWK 1QSEB 4I9WD 1BWMA 2FEDC 5TDOA 4QRPB 3W9DA 1FQ9C 3JV5A 5JTWA 4OI9A 1HCFX 1OF2A 3DGCR 5FYKD 4UT6L 4YDVB 3WNNA 1QA9A 5GJTH 1WV7T 5I66B 2DRUA 5FO9B 1HYRC 2APXA 4NRYB 5C9JB 3R8QA 5F7DB 1L0YA 4ZXBC 1T20B 2PYED 1QSEE 3F7YA 3GSXA 2BSED 5E5MA 1WAAF 2CR3A 4KH2A 4OZ4A 1Q8MA 2WIIA 3QIUA 2R0LH 1DL7L 2AABH 2R39A 2WQRA 2C1OA 4B7IA 3VRIB 4QHKI 3LRGA 1U93B 3WLWC 4DAGL 2ITDA 4ODWA 1I3GL 3BIAX 5DQ9A 3RAJH 3O6KH 1YN7A 3IDMB 5F9JA 4G42A 4NBYB 4NM8H 4RFNB 4ODUA 3QPXL 5EU7E 2AJXL 3JXAA 1HN1A 4MJ4A 4Q0XL 2O61B 3L7FA 1ED3A 1MCSA 3QWRA 2VE6B 1EGJL 4CGTA 3WFCH 1INDH 5K59E 3F8UB 4U31A 2Y7QB 4LARH 5BZDB 5DJDA 5F9WC 1GIGL 5D1QC 1CLCA 4K94H 1MPAH 32C2A 1VHPA 1EAPB 4IRZH 3K46A 4TYUA 4EDXA 4YLQT 5I1GL 1UJ3A 1D5XB 1JWUB 1DVFB 1U92B 1QNZH 1TLKA 3O3DA 5LGJA 3OAZK 2W0KA 3Q3GB 2NY3C 4TOYH 3P30H 1UC6A 4GH7B 4OCRH 4R2GC 5B8CB 4EXKA 2R4RH 5FM5O 5KSBA 2X4UA 4PLJC 1NEZB 1RZKL 2BSRB 3MLYL 5EBWB 5JDSB 4UU9B 5L7XH 4NWUL 2P45B 4KROD 4PJFF 3QFJA 5EU6D 4D0CB 1T6VN 3RWJB 5BCAA 2HJKB 5INDA 1LILA 5MEQB 5IV2B 3GZKA 5C7XH 2WUCL 4XP1H 4G8GB 1T03L 2FO4B 5TDNA 2NNAA 1U3HB 4DGYL 2ILLA 2NY1B 3GSQB 2NZIA 3PDOA 4GLRH 3CIQA 1HNGA 4X7DC 1JWSA 1VPOH 4YBLB 1NMAH 4ZS7H 2Y6SD 3HZMB 3G5YB 3DV4B 4HD9A 1HQ4B 2ZSVA 4EUPH 2PTTA 4Q2ZA 5E2TL 4BQCA 3C2AH 2QV2A 4Z7NE 1YPZF 1LDPH 1Q9LB 3LQAH 2GJZA 1FE8L 4F57H 4X6BA 4LQFH 2A9NL 5I8CB 4LLVA 4L5FH 4NYLA 4IRJA 3BJ91 2J3SA 5JQ6L 1U8NB 4POZC 5IB4A 3IRPX 1AO7B 2XN9B 1OL0A 2DQHH 5JA8B 3EYSL 1A7OL 4UZGA 3Q5YA 4F7PB 2MQ0A 4TSCL 5GGVL 3PIQA 3STZB 4KMLB 5MI0B 3NFNB 4HUMB 4GRLD 3O4LB 2X4RB 3OGCA 2OR9L 1AO7E 2XN9E 4PP2A 1ZT7A 3UYRL 4GMSH 3ZE2E 1N26A 4Y4FD 3RGHA 4MLSA 4LHUD 4OZFB 1I1AA 1JGDB 5HHNA 1C7SA 1N4XL 5M7QA 3O3EA 4LGSB 3QEUA 3BKCH 2HLFC 2OJEA 4P2QD 3O4LE 4Y5VA 4B53A 1NJ9A 3ECBB 1T1XA 5HJ3A 3WIIH 5IBTL 1E6JL 2HT2D 5DJ0A 2YD1A 4RMRA 3MLUL 1N6QH 3WXVH 1JZ3A 2NW3A 5IOPA 3TVMA 3KPQB 4P2YA 5F1SA 1IC7H 4OZGA 2VXVH 4XVSH 3JWDL 5ESQA 4R26L 1L7IH 4YHYB 1HHIB 3ORJA 3ARBA 3QUXB 5J9PA 1HILB 5T3ZL 4PJIF 3FQWB 1NFDA 2GYSA 2D0GA 5IK3A 1MAMH 4ONGH 4HW6A 2WUBH 3AUVA 3RKPA 1KJMB 2HT3C 1IAIM 3I02B 4NRZB 5FUOL 1ULVA 1LVEA 3MCKA 4M61A 3ARXA 2EZ0C 3C6SB 4X6CE 3H9ZA 5C0RH 4LP4A 4AQ1B 1P7KB 4EI6B 3VJ6B 4OCYH 3RL2B 2AS5M 3MV7E 2YPVL 3RJDA 4JCMA 4LCWA 4FOMA 2VLRD 4FZ8L 3AS1A 4NQUA 3EOAB 3NOIA 4M00A 4TVPD 5CAYB 2IG2H 4OQTL 2DI8A 3C6LD 1D5MB 4ORGA 3LN4B 4XP9L 3S3SA 2ENSA 2OI9A 2JJSC 1UADC 5HHXH 2C7UA 2QHRL 2P7TA 3DUSA 2EDJA 3AY4C 3RZCD 3MFFA 4PB9L 5AAWA 3V4VH 4I3RL 5LQBL 2WM0A 3SDXA 3KYNB 4J23A 1ODAA 4FG6C 4P5MB 1FG2A 3EW3B 1SJHA 1EGJA 5DMIL 1N5YL 5JW5A 1D5ZA 1QBMH 1EAJA 4OBRA 1YECL 5GGTH 3EAKA 3MRQA 4F9PA 2RBLA 1ZVHA 4HUKB 1I1FA 1KLGB 1HHKA 2HFTA 1DDHA 1YPZB 3X3GL 4OKDA 2P8MA 4NDMA 4ZFGH 5IVOA 1RZFL 2RQ8A 5IUSA 5IQ9A 3U46B 5IB2A 1CLYH 3ZHLA 5DVKA 2EIBA 1QLEL 4DFHA 1MJJA 1TPXB 3FFDA 4XWOC 4PJDA 4IIQB 5DJXB 1IGCH 4MXQD 2LV4A 3QDGB 4X6FB 3O9WC 1HEZB 3UBXG 4WW2A 4U1NB 4RIRA 1YPZE 1CFNA 3QNZA 4K7PH 1R3JB 1D7FA 5C08A 5FDWA 4ERSH 1Q9OA 4CJ1A 3BDYL 1RHFA 3VXQB 5KBNC 1I7UB 2Z92A 1NDMA 3QXUA 1KPUB 4N8VA 3SDCB 2DQEL 4U1MB 5C0IB 5FGCE 4AEIL 4XI5D 3QDGE 4XNUL 5HHOA 4WI5A 3O11B 3VCLA 3VFWA 1YYLH 1L7TH 4P99A 3F7VA 2H1PH 3MRKA 4X7FC 4HXBH 3VGAB 3U9UA 2AVGA 1I7TA 1NAMB 5IW1A 1I9EA 4IMKC 5EC2B 3RVWC 3GMRB 1PLGL 12E8L 3MRFA 1CL7I 1NFKA 3QWOA 4OCLC 4KAQL 3NA9H 3D3VA 2WAHA 3VXOB 2UYLA 4OLWL 2LU3A 2E7HA 3OAUH 1R3KA 5EO0B 2JELL 3CZJA 5EIQA 5KOMC 3BP5B 4HS3B 4YK4B 3GI9L 7FABH 2BXZA 1WGOA 3S35H 1A0QL 3KDMA 4LSRL 2QR0A 3GMLB 5KVFL 5T5NG 1OP5H 4PJIB 3LY6A 1J05A 2VYRE 1A6PA 3ESVF 2MKWA 3NBNA 3MROA 2CDGB 2P5WD 3T4AB 2H9GA 4GG6E 1E27A 2OS7A 1QBLL 1F5WA 4P5TC 3E8UH 4UOJA 4Y4HB 5I8OH 3VXSD 4EVNB 4LSUH 1BEYH 3HUJF 4E0RA 5GHWL 4OQ1A 3MRJB 1UKTA 4H8WC 3VRJA 5ACLA 1P1ZB 4I48A 3KPLA 4MJID 3BD4A 4XC3L 4R90L 2VWEE 3CNKA 4QNPE 1BIIB 4OGXH 5L0QB 2J8UE 2NQCA 3C9NA 4NZUL 2E7LC 2DB8A 2W1NA 43CAA 5F71A 1ZVSA 1F6FB 5FECB 3CFCL 1JFQL 1CDGA 4P4KB 1XGUB 4PS4H 3RHWK 4JZJA 5JHDA 2EXYC 4HMEA 3ZDYF 5BV7L 3ES6A 3QXAB 1HINH 5D5MA 5ID0B 1VGKB 2AEQH 4M43H 1LEGA 4XH2B 2W0FB 4Z7UA 3D2UA 1MFAH 4MNGB 2PW2B 4HWZA 3GBLA 1M6OB 1I1YB 3FB8A 1QYGL 3WMSA 4WWKC 4WHDA 2CUHA 3RBGA 4F80A 1WWCA 3WLBB 1AHWB 1LK3H 2X4QA 4KK8C 3MRBA 2VXTH 5EOTA 4YO0B 1BF2A 3AMKA 3WL9A 2DQJH 5C92A 2PR4H 2CDEA 1II4E 3PJSB 3GSUB 3MUGB 4JFHD 2CIIB 3MBEB 1PEWA 1BQLH 4XNYL 1JHLH 3BPOC 4BQ8A 5KS9A 2I60H 3SDYH 3H9SB 5DDHB 3UTSB 3JWOL 2EKSA 5I1KL 2VAJA 4WHTA 3PWPA 3PL6C 4X80L 3VWKA 1S9XB 4QRPD 3OKOA 4QXTB 1SM3H 1RJZB 2Y9RT 1MEXH 1KENL 4ZUSA 1IARB 5ID1B 1NUFA 5CEZE 4P4RA 4V1DB 1E28A 1INQB 1MRCL 3QBTB 2JF1A 3H9SE 4KJPD 3F6IA 5CUSL 3UTSE 4BZ2H 1A7BA 3IDUA 3PGCB 4WU7A 4P2RA 2MTPA 1CE6B 1DN0A 4DZBB 3UTPE 4C4KO 1KG0A 3IVKA 2SEBB 4PJ5E 2BNUB 1E4KC 2VDQL 3L5WB 3UJIL 4P9MH 2AJVL 3FMGH 3QO0B 5J57B 4V1DE 4F7MA 5DD3H 3CFDA 3TBSB 5IJKA 1CFTA 3V6OC 4MS8D 5CMAB 4KKNA 1NBYB 4LEXL 1EEZB 3H9YA 3FQNA 1O0VA 1AKJB 35C8L 5I2IB 3HG1B 2OTUB 3GSNL 1AR1C 1QQDB 3ILPB 3L3GA 4JO3H 2OJZH 1W72H 4HV8A 4PTUA 1CICD 3U1SH 3DPBA 2DQFB 2RCSH 3RWDA 3O3AB 3KWWB 3P11L 1YDPA 1OTSD 4JCLA 2D0HA 3V2AR 3L3HB 4N1EA 5A1AA 3H42L 1BD2B 2CR6A 5D6DC 4OZIB 3HG1E 4Y2DB 5FA3B 1FZKB 1CTNA 1JZ5A 5CILL 1YEJL 4JG0H 4APQB 1O5DT 5DUPH 1AGDB 4UBDC 2DBLH 5EIIA 4AIXA 4ODVH 3BKMH 4NKIL 4O02L 1UQSA 4MCYB 4WTXA 4Y4KD 2MHAA 4H88L 5L2KA 3BHBB 5TF1H 1O7SA 5HI5D 3VG9C 3NPZB 3O6LL 3W81A 3PQYA 2FX8H 4JFDA 2APBA 4OZIE 1FRGH 2QQLH 2B1HL 3VXUB 2FZ3A 1QBBA 1EXUA 1KC5H 4ZO6A 1YMME 2YWZA 4Y5XA 1YN6A 3HUJB 4HWEL 2IAMB 3TH2T 3THML 5E5UB 4G8GD 3V6OE 4MB3A 3W0WD 1MH5A 5I71C 5KSVB 4O51A 2HFGL 4KPHL 1AI1L 2BOBA 2Q3ZA 2M2DA 3MLVH 3QRGH 4MAYC 5KAQG 2D0FA 1NLDH 1I85C 3VXUE 2PTUA 3VXTB 4F7TB 3ULUC 1J18A 1WBZB 1BPVA 3IJYB 3VA6A 4LLQB 5FUZH 4X5WA 3MRDA 5KSUA 2CJUH 3TF7C 5BMFL 4HX1B 4HQQL 1KEGH 5MHSD 1KPVA 3GMMB 3B9KA 3P77A 2IPUG 4P3DA 4UT7H 5DQDH 2V7HA 3U4BH 2ICCA 2ZKHL 5EA0L 1OAZH 5KVEH 4JM2F 3VD7A 1JPSL 1MCPH 3ZDXF 4YUEL 3KLSA 4RGND 4LCYA 3ALXA 3CU1A 2Q7NA 2VDPH 2VNCA 4QRRB 5C71A 3IDJB 5LGHL 4YDIH 3A6BH 2AXFA 4WY7H 3RDTA 1RIVH 3OJMB 4F7EA 4M7ZB 3BPNB 4R3SB 2GHWB 3VFTA 1OD7A 2GSIB 3OJVC 2HLAA 1K3IA 1FFOB 4PGDB 3MRMB 1I7ZA 2P43B 4HEME 1N64H 1A02N 4WI2A 1ZEAH 2NY7H 4ZSOE 4BFGA 4D3CL 1FNGA 4P48A 4MHHI 3MV11 5AUMA 3B5HA 5ETUB 1LP9A 5LBSL 5K9JH 3CPLB 3PV7A 2EIZA 1WISA 5EU5B 1NBVL 3TPUE 3CVHB 3FQUA 2DQDL 1KULA 4JFOA 4XBEL 2DJ4A 5F6HI 2YC1A 2NW2A 4HFUH 3UBXA 5DI8A 1H8OA 4PJGE 4UIKL 4ISVB 3PHOB 2J6EH 3ET9F 4PUBL 1R5WA 2NY0C 4BM7A 4KWUA 3BSZL 1JIBA 1JRHL 3QUXD 4OF6A 1P4IH 4NOBA 4HXAH 3RVTD 2EYSB 4LLYB 1FAKT 4I0PB 5HPMB 1C5CH 3T77A 4KK9C 4K23L 1MVUB 3HE6A 3SCMC 1DBMH 3S37H 1MI5D 3BXNB 3MLXH 3OXSB 4PR5A 4H0IA 1SBBA 3PP4H 1QSFB 3O41A 5FUCC 4UQ3A 3GHEH 2ZUYA 2MCPL 5LVEA 4LIQH 4BSVB 3BQUB 1P6FA 5T33L 3LQZA 4Y16A 4MSWA 3LKOB 3S5LB 3C60C 3JTCA 3HI1A 3OPZL 1KGCD 3FT2A 4UNVA 4AEFA 1MJ8H 4LASL 2IADB 3U7YL 1W0YT 3SDDA 2VTFA 1CBVH 4YHNA 2G5BB 3NCMA 1YA5A 1YYMH 3KLAB 1CGSL 1KNOB 5JXEC 4O5LL 5DTFA 4ZTPH 4ZDHA 3OKKA 3T0ED 1K6QL 1KB5H 3P3YA 4J2XA 3JUYA 1YJDC 1ZHLA 4S1SH 5F89B 3TO4B 5JW4R 1NSNL 2VMFA 5GIRA 4FQ1H 2P24A 5GS1B 1C5BL 3V4PH 5CEYB 1QSEA 4PRDB 1AQKH 1EERB 4BZYA 4LNRB 1UB6A 3D0VB 4GOSA 4XAWL 2R4SH 1MCCA 4C59B 5ERWB 1OD9A 1QKZL 3FQXB 4YDVA 3BPLB 3MRRB 2UWEF 3LMJH 1EDQA 2ICES 4G9FB 3GSNA 5I66A 2I9TA 5FO9A 2QQNH 4XNQA 1HWHB 3O6ML 2YXFA 4PREB 1AC6A 1H5BB 1QSZA 3VRLF 2WV3A 5JZ7C 1JZ2A 4JRWA 1HOCB 5CGYC 1CF8H 5DD1L 4I77H 25C8H 3SKUD 5JR1H 1IMHC 1U93A 1WEJL 1MREL 5JOPD 3U0WL 1QFWI 3K4AA 5I1CH 4XP5H 3IDMA 2EYRA 1X5IA 5FO8B 3QHZL 5E9DA 5IW6B 5TE7L 3ZYOA 4OLZL 5GGSB 3TIDA 4HCRL 2PO6C 2ZJSH 4L1DA 4FZEL 5BZDA 4L9LB 5EWIH 4YGAB 1FORL 1QBAA 4ZXBA 3Q1SH 3OKYA 5IFJB 1C16B 4LKCA 2GJ6E 3DSFH 3GJFA 1D5XA 1O7VA 1JWUA 1DVFA 2AK1H 3O0RH 3FQRB 2A9MH 4OLYL 1A3LL 1BLNA 1TQCC 3Q3GA 5AAMA 4N0YH 3J7HA 2BNRB 4JFEB 4OZHF 5B8CA 1IM9B 2X4OA 4UQ2A 5C0CD 5EBWA 5EZLA 3QZWB 4K9EH 3RWJA 4GAFB 1P69B 5MEQA 4NRXA 5IV2A 3WJJC 15C8L 1PW3A 5D1QA 3LKPB 2EDOA 1KT2A 4RCAA 1I75A 5DHXB 4QWWD 3WFEH 4Z7QE 3VD9A 4JFEE 2C5DC 1D9KB 4G7VL 3WUWB 5KZCD 1F58L 3BEWB 5TH2B 2EH8H 4NKQB 1RJLB 2UZYB 1ORSB 4MZ3A 2VLME 3G5YA 4XNXL 2YS4A 4JHWH 5EDXA 3DV4A 1LO5B 1HQ4A 3P9WB 1NCWH 4Y4HD 3VGHA 1XF5B 2FWOB 2XWBB 3F5WB 1JV5A 3Q6GH 1Q9LA 3DRQB 1G7IA 3VH8B 5BS0E 2VDML 5DA4A 3QA3B 2DM7A 5J13C 3NCFB 1U8NA 3OB0K 2QHLA 4J6RL 1AO7A 2XN9A 4U1GB 2CRYA 3SKNA 3C87A 3D39D 3ZE0E 4M7LH 1EEUA 1N7ML 3HRPA 3MLRL 4X99B 1OOAA 1FYTB 1J9CT 3GGWA 4UB0L 5E4EB 2VDOH 3SY0B 2DQGH 3RWEB 3UPCA 1YMHA 1ZT4B 3STZA 3TPKA 3SGDH 2YD3A 1XGPB 3NFNA 1JNLH 4MAUL 4D8PA 1MFEL 1AD0A 4LCIL 3O4LA 4HHAA 2X4RA 5CINL 5A3ID 2Z93A 3LKNA 4YHPA 1HI6B 5CIPH 3P2TA 3S34L 1FYTE 5JPNB 3ZSSA 1T2XA 1MHCB 1QLFB 5DLML 2XWTB 3O6FC 4FQIH 4XVUD 2A6DA 1FV1B 3RTQC 1CGWA 4PTTB 2UWEB 4WI7A 5GGUB 3Q5OA 3UJJH 5IEKB 4PGCB 3ECBA 2VAAB 2NY2D 1C08A 4LVHB 3BKJL 4XC1H 3LSOB 1C7TA 2PKDA 2FR4A 3FRUB 5IR1B 1WWWX 2NY4B 2NXZD 3TNMB 1QEWA 5FHBL 4KJQC 2QL1A 3WDHA 1TMCB 2LTQB 2Y07L 1J1XH 2NXYC 2L0DA 4X6CA 3WO4C 4N0FB 5I0DA 4G8EB 1I1AD 3EYUH 5B4MC 1OSZB 1EHLH 3BT2L 2FB4H 5FYJU 3RX5A 3CVIL 5TE6L 3MV7A 1KJMA 4K94C 5LAXA 2P46B 4P23B 2GW5A 5CEZL 5KJRL 3EOTL 3OL2A 1DQDH 4AG4L 5I18L 3BAEH 1MJUH 3RA7H 2O5ZL 3TV3H 1OPGL 4JVWA 1SBSH 5CSZB 3DX7B 3Q0HA 4PRIB 4CKVX 3UBXI 1RHHB 2N7BA 1AKJD 4XPGH 4MQ7B 4PP1D 5TQ0H 4GRWB 1R3IH 1UWXK 3OXRB 3RVVC 1NDGA 3EOAA 5IHZB 1TCRA 1QO3A 5GRVL 4OZHB 3LH2H 4Y8AA 5D70H 5BVJA 1D5MA 1SYVA 4M9OA 4PRIE 3AU1B 4PGZA 3MCLH 3T2NH 4X5XB 2UZXB 1DQLL 1BD2D 2HVKA 2DDQH 1AJ7H 4GRWE 1EMTH 4M6NH 1FDLH 4WV1B 4KK5D 4APQD 2Y72A 3CX5J 4CU7A 1UVQA 4OZHE 3RY5A 4P5MA 1LEKB 4NCC1 3OMZA 3HE7B 4U7MA 4HCRA 4OGAD 4LCWD 3ZHDA 2JB6B 3LQAC 4QHMA 2EC9U 5EZOH 1BZ7B 3BVNB 1KLGA 1CDUA 3S36H 1YPZA 1HWGB 2DQIH 2IAMD 4U3CA 4HDIB 4WJ5A 3TZVC 3PGDB 5DGRA 1KB9J 3LN5A 4R4FH 5HSFA 2BY0A 3L3JA 4S10A 4I18C 4U7SA 1Q1JL 2IALB 3DBXB 4BFEA 4OB5L 2ZUQC 2DF3A 1G6RA 5MEND 1S3KL 4XPBL 1HEZA 5DFVD 4N1CA 4ZD3L 1LE5B 3MUJA 4U6HA 5T1LA 5DVNA 2WSKA 4NPYB 4LCCB 4N8CL 3VXQA 4OV5A 2FJHB 2VXSL 1FN4A 4IJ3C 4U1MA 4GUPA 5DD6B 3PHQA 3O11A 1RZGA 3V7AE 2VKXA 4OFKA 4HJJH 1EV2E 5IT2L 4PDCE 4NUJA 4PJ7E 1MFNA 2NCMA 1IBGH 5DRWA 4QHNB 4Z9KB 3MLZH 3CFJB 2B4CH 2EH7H 5EC2A 4NHCH 5HYJB 3SDAB 1KBGL 2VL4A 2XZAL 4NO2B 2XA8L 5L8LB 4Q58C 2OCFD 3KR3H 3KPNA 2EICA 5AYUH 3VXOA 1EJOH 4LSTL 5FEBA 1CDHA 4CN1A 5LWYH 4G8IA 4S0UC 5JNYB 4GG6A 5IHLB 1GGUA 3NN8A 4LCUB 4TRPL 3BP5A 2BDNH 3LKSB 3GBNH 2NLJA 2PW1B 4ZAKC 2A6JA 2UY7A 1HXYB 3PV6B 2Q76B 2BVPB 2F53B 5HYJE 1B88A 3WKMH 1PSKH 3UO1H 5DHVB 3RUGF 5D6CB 3CU7A 2ICWB 1V3JA 4NQSB 2G9HB 1MFDH 4PLKD 3DLQR 1YNLL 3IGAA 3T4AA 4JFPB 1MRDH 2OK0L 2J8UA 4IMKA 1FNAA 2H32B 1TQBC 1DZBA 3PWUB 4QF1A 3AREC 1J0HA 4FFZH 5ECJE 4Z76B 1GXEA 1F6AB 1S9VB 4O4YH 4FXKB 5JUEL 2AJ3B 1P1ZA 4XCCL 1R3HB 1QFHA 1F02I 5E6IC 1NGYA 1NH6A 5HHME 1RJCA 1XH3A 1CDIA 1M1SA 4JY4A 1ZLWK 2EE3A 1QSFD 5E24E 5FECA 4TN9A 2QSCL 4HIXL 5FYKU 3WEXB 1R0AH 3CVHL 3WD5L 1KIPA 3MRPB 4FA8A 2X4NA 4TUOB 3BQUD 4K71C 4Q97A 4XP6L 4ZPTA 1VGKA 3R0MA 1MCFA 3TEUA 3ZE1E 5HDQL 5IVXB 5SWZD 2NR6C 3I9GL 3UMTA 1HSAB 1DBAL 5E7BA 5T1DH 4GSDH 1DANU 1DBJH 1KUMA 3KYKL 4HGWB 4Z95H 5D8JL 3STBA 3PJSA 4KQ3H 2CIIA 3MBEA 3L3DB 4MNHA 4XNZB 5IBUB 2IMNA 3V52L 4M03A 5IVXE 3BEVA 1DFBL 2B5IC 3TO4D 4BQ9A 3H9SA 5F1NB 4YPGA 5AZ2H 4IS6B 2WBKA 1ZT1B 1S9XA 3EDJA 1K3ZA 3DYMA 1DSFL 4ENEC 4QXTA 3QIBB 5EU4B 3D2UD 4PJ5A 1RJZA 1TJHH 4PY8I 2V2WB 3ILQD 4RFEB 5ID1A 4CMHB 4DN3H 4WWKA 4V1DA 1INQA 2OX5A 3KPMB 1XIWC 3QZWG 2R23B 1RD6A 1AXTL 4GG8B 5CHNB 2PXYC 3C5ZC 4UT6H 1CE6A 5GSRB 2KZWA 5DRNA 4OIIL 4BK4A 2SEBA 2QQQA 1VGEL 3L5WA 1DQML 3LZFL 4WI9A 5IB5B 4ZMAT 4LFHD 4CRPA 4FFWD 5C07E 2AXHA 3PWPD 4NKMA 3VFMB 4HS6B 5EZIL 3VWKD 3L9RA 4JM2D 1DL7H 1KV3A 5I2IA 3DSNA 3HG1A 1QQDA 1MQ8A 1PBYA 5L9DL 1EBAA 4H1LH 3OKLA 4DAGH 1I3GH 2PTVA 3W5MA 2KQMA 5IHUL 3O3AA 3KWWA 1FZJA 2OL3B 2AKRB 3QPXH 2AJXH 3E6HA 4JHZA 4Q0XH 5DMGD 1HKLL 5J1TC 5HDBF 5DS8B 5EOCL 1EGJH 1K8IB 1UH4A 3GBML 4OZIA 3GSRB 1LK2B 1MHEB 1E4KA 1YMMA 1GIGH 3IFNL 4MX7B 4MCYA 3V6OA 3VD4A 5D1XC 5EUOE 1ROWA 2GSGA 1Q0XL 1G7JB 2BNRD 5I1GH 2IQAB 4KI5C 2GAZA 4HWNA 1QRND 4MA3B 2Q1EA 3VXUA 1QD0A 2G5RA 3FB6A 2YR3A 1ZTXL 3EJYD 3P4NA 1XFPA 2DLFL 1UG9A 4U1KB 2WW8A 3VD3A 3QG6A 4PIRF 3RX8A 2CH8A 5EORL 3TIEB 5DZLA 1RZKH 3MLYH 4BSJA 4FHBD 4HIJA 3JV4B 1H3XA 2OP4L 4NWUH 1F3JB 2F5AL 2Q87A 1UZ8A 4LVOC 4YHLL 1T3FB 5L6YL 3O4OC 4F7TA 5J6HB 2WUCH 1JGVL 4WNQB 4KZDL 1T03H 2PUQT 2XOTA 2C1PA 2XKUA 2Z31B 4DGYH 2DOCA 2X4TB 3N1GC 2W0LA 3CH8A 1U8JA 2EEDA 4EN3C 3BIKB 4HK3J 4ZO7A 3LKRB 3L3KB 4G6KL 3GSOB 4UUJB 1J87A 3QUZC 5GS2H 2JCCA 5E2TH 5SX4I 5J3HC 3MO1B 1M7DB 4L9DA 1U8PB 5BRZB 3DTXB 3VE0A 4DKEL 4N0CC 2A9NH 3MRGB 4KI5E 2AP2A 4D9QE 1EUTA 2FNBA 5JQ6H 3NGBB 3UPRB 4ZSOA 5L2JB 4MAYA 3CLEL 2HN7B 4GBXB 1YC7A 1LE9B 3KPRB 5DQJB 1HSBA 3EYSH 4ODHL 4I4WB 3GNML 1R24B 4TSCH 3DX6A 5GGVH 3TPUA 5BRZE 1I8IA 3QUYB 4MB4A 4P2OC 3MRMA 4GKZA 1K5NB 4YZFF 1UCBL 1X5GA 1ETZA 3OKNB 5CD5D 4AK1A 5GGRB 4PJGA 2VDKH 4AL8L 5HHQB 5JMRA 2OR9H 3GB7B 5FYLD 3UTTE 4BZ1L 1X5LA 3UYRH 3KPRE 5DWUH 4M4RA 1F90H 1B0RA 2X70A 3UJTH 3LV3B 1HDMB 5GGVY 3BH9A 4JREB 5F6IC 3VFSA 3CVHA 1N4XH 2AEPH 4KTYA 5A16B 5BQ7B 1OLLA 2H2PD 2IPTH 2NY4D 1KELL 3T3PF 1EVTC 3RDTD 3PHOA 4JGJA 1JTPA 1S78D 3NCCB 4PJ8D 3RGVB 1K8DB 4D2NA 5L8JB 2CMRL 3ARRA 1QR4A 5DHYA 5IBTH 4FFEX 2D9CA 2M26A 2EYSA 4LLYA 1GYAA 1IM3A 3MLUH 4I0PA 1CFVL 3GMPB 4X7TA 2BC4A 1E0OB 1P2CA 2YN5A 3JWDH 4R26H 4PRAB 4N90E 5D7JD 4L3ED 1S5HA 3HNVH 3MOQA 5T3ZH 4J3VA 4G7YL 1H3GA 2XQYK 4DVBA 4WI6A 3QNXA 3O2VL 1CFQB 2IPKA 4WUUE 4TULL 5I1DB 5C0JB 1B4JL 5LKNA 3VFVB 2VISB 3V7AG 3QXDB 4RMTA 4C56B 2GFBB 2IADA 3GM8A 5FUOH 1G1YA 5JOFB 1YC8A 2Y5TB 1MAKA 3E2HB 4X6DB 4H0GA 5GRJH 4K3DL 4U4BA 3GO1L 5I15L 2X4PA 4GRMB 4IHOB 4LP5A 5T1MB 3TGXA 5D2LA 1JGLH 3BWUC 4PG2C 3STLA 3V6ZA 1ACYH 4XXCC 3SCMA 5CP7B 4LHQB 1H9VA 2YPVH 1UKQA 4S1DD 4CDHA 1KIRB 4C56E 1DJSA 1H3WM 1CQYA 1P7QB 5BOPA 1A1MB 4FZ8H 5D7IF 2R0LL 2AABL 4H25A 1CG9B 5GS1A 1WIPA 4X6DE 5CEYA 1QLRB 3VFPA 1QP1A 3DO7A 3PF2A 1OQXA 4OQTH 3C60A 2LAGB 2XZQL 5ERWA 4HBCL 4P5TB 4XP9H 4YXLL 2V5SA 1DQQA 3TBVB 2VLJB 2J4WL 2QHRH 2W9DL 3SDDD 3HE7D 2ADIB 1KXTB 1AIFB 4PREA 1H5BA 4PB9H 5D7SL 4RAUB 3X14B 2APWA 5LQBH 1GZQA 4HH9B 5SV4A 2R1YA 4LARL 3FN3A 4P2CG 1GAFL 1JTOA 3UXFA 2J8HA 5DMIH 1N5YH 3ULUF 3MUZ1 3LRSB 3N1FC 2VLJE 3AVEA 1VCAA 4J3WA 2EDHA 1YECH 2YK1L 5SWQB 3SBWA 5K9QI 1F00I 4CVXA 4G6ML 2R2HB 5IGXL 3VWJA 5FO8A 1AFVL 3X3GH 2GJ6A 5DO2C 4DOHB 4H26B 3RY6C 5GRWA 3V6FB 3QIWC 1FO0B 1QLEH 2P5EE 3SKOA 4XCEA 3FL7A 4F9LA 5FKAB 4U6XB 2UUDK 4WFED 2HP4A 4LKXB 1VADA 5DZNA 1U8OB 2XTJB 4TQEL 3O2DA 1IQDB 2FH6A 4DOHE 3DMMD 2GITB 2IFFH 3MMEA 1MWAB 3FO9A 3NIDF 3LDBC 5C09E 5I1LB 3EO0B 4GKSA 3LEVH 3HTLX 4ZYKB 2DQEH 2F58L 4F2MB 1IE5A 1IAIL 1T7ZA 4XNUH 2CIKA 5FHAL 4S1QL 1I7RB 3PL6B 3FKUS 2XTJE 2KBGA 2FEDD 5F9AC 2FH8A 1IM9A 5E9DD 3RVUC 3BYTA 4LSPL 4M7KH 2VABA 3QZWA 2B1AL 1YEFL 1EEYA 1HE7A 4RGMB 2PO6A 2V5YA 4HT1H 1PLGH 2O26U 12E8H 1IFHL 3H3KA 5HGAB 4AEHL 5JORB 1JHTB 1XGYL 5C0DA 3P0VL 2VUOA 4DKAA 2Z35B 2F53D 5MEOA 1URLA 1UWEL 1D9KA 1TZHB 4OLWH 3V5HB 2YEZB 2CO7B 5BS0A 5D93B 3BEWA 1ND0B 5TH2A 2JELH 4JFFA 4OM0L 4UAOC 1LO5A 3GI9H 2X40A 2FBJL 4UOW1 1MCJA 1A0QH 3WLWD 1ZLVH 1OAQL 3MZTA 1J7VR 4LSRH 5EFIB 4O2FB 1WBXB 5KVFH 3G9AB 2DICA 3PWLA 2FWOA 2XWBA 3F5WA 2XICA 3N1QC 1CT8B 3DRQA 4OIBA 3KPSB 4LPTA 3MOBL 1QBLH 5F8QC 2HTKC 3LVEA 3BX7C 5I30L 1UXWB 2GTWB 3UC0H 3WJJA 3PABA 5D1QD 5GHWH 2Q20A 5JA9A 1W0WA 1ZT4A 2DIJA 4OTXL 3PWVA 2DIBA 1XGPA 4XC3H 1XF4A 3U0PA 1MF2L 3WIIL 2ZOLB 1S7RB 4NZUH 4LQ1A 1Z9SA 1N6QL 5HTSA 2NY3D 1S7UB 4JY6A 5D7IB 2UY6A 3CFCH 2DTML 3QCTL 1JFQH 4R0LC 4XVSL 5IJVB 2A74B 4QEGA 1MHCA 4R2GD 4ZQKB 5BV7H 1I8MB 5EUKB 1OAXL 4QT5A 4TSAL 4OT1L 4A2MA 4PLJD 4TSBL 1FV1A 1SMAA 3SJVB 2IBZX 2B7DT 4PTTA 1J8HD 3NACL 4WFGE 4GQ9L 4PGCA 4ONGL 5JIIA 2VAAA 2E7MA 5D7IE 3KAAA 1E4WL 4KKLC 4EXPX 2CSPA 3LSOA 2YPKB 2EDDA 1HH9B 5IR1A 3SJVE 1N5AB 3BWAB 3TNMA 5SWSB 2YPLE 3ISWA 3H8NA 2QTEA 4XNYH 5IMMB 4IRSC 3H7LA 2O5YL 3G6DL 3JWOH 5I1KH 4N0FA 4X80H 4Y19E 3TCXA 3ARFB 3RTQA 3VXRB 2DWDB 1HHGA 5HYSG 4POZD 4KGJA 4AM0A 4JKPL 3KYOA 1MRCH 2HKHL 5CUSH 4YPJA 5E2WL 3BZ4B 2DI7A 4FTVD 3CDGA 5CSZA 1ZOXA 3TT3L 4PRIA 3VXRE 2V2XA 3IDGA 2VDQH 1IGYB 3UJIH 4OLEA 2AJVH 4PLNC 4NZTL 1IEBB 3W82A 3OXRA 5I1EL 4KUCF 5IHZA 5E8EA 4K9EC 1HZHL 1RZIA 4KMQA 3M07A 4LEXH 3JTTB 1VEPA 1FVEB 5JOEA 35C8H 3AU1A 2I27N 1AH1A 4ACPA 4X5XA 5KSAC 5I73B 2HLFD 4XGZA 2RR3A 4UDUA 3SQBA 5IKCA 3MJ8B 4XXDA 4YC2C 3DV6B 3P11H 2R2CA 4FMKA 4PJAF 5DRXB 5HGDA 1WF5A 3Q6FB 1OVZA 4NWTL 3H42H 1IGCL 1OSPL 5CD3B 4UDTA 1T5WA 3AXLB 4BJLA 3QO1B 4BQBA 1T2JA 3MOAL 4LLMA 3IRZA 2QKIB 2BY3A 5CILH 1YEJH 3GIZL 1Q94A 4NKIH 4O02H 5T3XE 5JLZB 4L4VD 1CDCA 1DANT 1DQJB 1MLBA 4H88H 4PJ9C 4HIHB 5B3JF 4HDIA 4X8XA 4MD5A 3O6LH 1AGEB 1NGZB 1JF5A 2MJWA 1WTGT 1LHZA 5DRZB 3TP4A 4P46B 4WU5B 3VU2A 2B1HH 1MJ7L 2HT3D 3VA2C 2IALA 4RDQF 2VQUA 4HWEH 2EZ0D 3ROLB 5IM7A 1ZWIA 3THMH 1WLHA 3NIFE 4PJ7A 4ALAL 5HY9A 3GJFH 2IMMA 2H26B 3QHFL 4X4ME 1LE5A 2D7NA 2Z31D 3QDME 2HFGH 4KPHH 1EFXB 2J2ZA 1AI1H 2VZ1A 4M4PA 2BVOB 3NA9L 1ZLUK 3WHXB 1U58B 5C0BB 1KSRA 2X1PA 5J6GB 2N56A 3EUUA 1Q0YL 1HQRA 3ROOB 3OAUL 2F54B 4S11A 5FOBB 3S9DB 5HI4D 2HJFB 2A6KB 4F15B 5BMFH 3TBTA 2VIRB 4HQQH 5GGQL 4HC1L 3QEHB 3QDJE 4IDJH 4JVPA 3W39B 3CFJA 3KXFA 1FFNA 4FQXC 4XAKD 3SEPA 5I17B 3MREA 4YBQC 4MLIA 1JF6A 5C0BE 5HYJA 3NIGE 3BZDA 3LKQB 3O2WL 5H2BA 2ZKHH 4N5EC 5EA0H 4NO2A 1NC4A 2F54E 1NBZB 1JPSH 2I26N 2NMSA 1XCQB 4PGEB 3WHE1 2IC2A 4UTAL 3EKCA 5HVFB 1K9TA 4FG6D 4LSUL 3UDWC 2Z91B 4OLUL 3CFKB 5T1LD 5JNYA 4MCZB 4K7FB 4U1JA 4X7SL 3KLDA 1TENA 3ZL4L 1OGAA 3LKSA 5LGHH 2PW1A 4WRLA 1CYGA 1S8DB 1U8HA 5F1OB 3TA3B 4E41B 4PD4K 3PV6A 2Q76A 2GTZB 5DHVA 5IIEA 5D6CA 3KLHC 1RK0A 4X9BA 4LSSL 2CLVA 4U6YB 1KJVA 1PYWB 3FQTA 3QI9C 4CDGC 4DKDC 5HHMA 4D3CH 3K1DA 4PS4L 2AK4A 2DL9A 4XWOD 2BVQB 2F9BT 1F4YL 3DUUB 3U36B 4E41E 1YY9C 3EYVA 5LBSH 3O9WD 1JUFB 2AJ3A 3HLAB 1NBVH 1A3QA 2DQDH 4XPFL 3IFLL 3GMNB 4XBEH 4JRXE 3S98A 1ONQA 1RZ8A 4UIKH 2AXJA 4ZAKA 4LRIA 1DLHA 4MJ5B 4PUBH 1DTUA 1INEL 3BSZH 1JRHH 2LFGA 4KY1H 4PGBA 5C3LD 1S7SB 4J4PC 3IJHB 3MRPA 2HH0L 3T0BA 4Z7VF 1S7WB 1JHLL 4GW4A 1L6ZA 1VKXB 2I60L 1TQCB 1A7NL 3RVWD 1BFVL 5IVXA 1IGFL 3QIUC 3E3QC 2MCPH 2XPGB 2X7LA 3REWB 4ZPVB 1IC5L 3KYAA 3MFGB 4PJAB 5T33H 1A47A 4EI5C 2VZVA 3W9EB 5J12C 3OPZH 5EG6C 1U8MB 3MGTB 3MNVA 4JPIA 3U7YH 4RMUA 2WIMA 3INUH 3IF1B 2GT9B 1XGTB 1F4WH 3QQ9D 4WO4B 3QJFB 5ENWB 3C8KB 4PRHD 4IS6A 4PJAE 1CGSH 3WN5A 5A2IH 1I9JH 1A8JH 2OYPA 4O5LH 3OAZH 3G6JB 3QAZC 5DD3L 1K6QH 4HK0A 2WP3T 3HNSL 2EXWC 4JAMB 1BQHB 4P5TD 3L6FA 2V2WA 4RFEA 2AJZA 1NSNH 3F12A 3ABZA 1UJ3C 4PJEF 3KPMA 4K3HA 2R23A 1FVCB 5C07A 5HVHC 3P4OB 4JO3L 1W72L 3MBXL 4XAWH 1QKZH 4R7NB 2XQYG 1G7MB 5GGTA 3VMNA 1JI2A 1IL1B 2RCSL 3G6JE 3RRQA 4O2CB 4U1HB 3O6MH 5BXFB 1F97A 3O8XB 5B39G 4Q6IB 1MCNA 3DXAB 3E3QE 5IB5A 3NCJH 3CSYB 4Z18A 1TVBB 5GSVB 4XTRC 2EXYD 3IS1X 4MD4B 4HS6A 4OLXL 2B4CC 4JG0L 2OBGA 5DD1H 5DUPL 5K9OB 1MAJA 2DBLL 3HR6A 2VXUL 4RQQA 2BRRL 1F3RB 1X7QB 4FABL 1WEJH 2YA1A 1CXEA 3DHMA 3U0WH 4WWKD 3DXAE 1XIWA 1WK0A 4NGHL 1TETL 4LOUD 5EUOA 1RUPL 1WIOA 5F7FA 3QPQD 3QHZH 3CSBA 5TE7H 1G0DA 2PXYA 3C5ZA 1JNNL 4HAFA 4HCRH 2F5BL 3GSRA 4FZEH 3CDCA 1F4AA 1BGXL 5CJQL 5SX4H 1LMKA 4L4TD 1RULL 1AGBA 1FORH 5F7LB 2ZUWA 4IRJC 5FYJE 3D9AL 4G6AC 5IMKB 2FYYA 2IH3A 3PL6D 4H5SA 2IQAA 4Y0GA 3NFPB 1FO0L 3OB8A 2Q7YA 4OLYH 3JBG7 2DJUA 4JRYB 4Y5YB 1A3LH 2ZCHL 3X11B 5F7YC 3T65B 4U1KA 3L7EB 5HYSA 3NFSL 5DC4B 1BX2B 1PFCA 4JLRB 5ALBL 1SMOA 1M05B 4NC0B 3JV4A 1MWAL 1UYWH 4HC1A 3NMEA 4PG9B 1YY8A 5KVEL 2JKXA 3EYQC 4CJ0A 3CFIC 5DZOA 3D0LA 3I6LE 1YMMD 3G08B 15C8H 5J6HA 4FMFA 3AS0A 2BY2A 1KTDA 5BVPL 5DJAA 3R06A 3RWGB 5D1XA 4G7VH 4PJHF 5DSCA 1F58H 4NHUE 1RIVL 4XPAH 1B0GB 4Z7OF 3BIKA 4HUUA 4Z7VB 4X0KB 1G9ML 4XNXH 3KPSD 3LKRA 1AR1D 1S5IH 5EULV 1K2DB 4C55A 3ARGC 3SPVB 3TH3T 3TVMC 1XF2A 2Q6WA 1ZEAL 3MTRA 1IGTA 1U8PA 4Z8FL 1JP5A 5BRZA 1T22A 4NQVA 3ARBC 3QUKA 2YWYA 3LQMA 4MDIB 4E5XA 3ULVE 2VDLL 4LVNB 3UPRA 2BJML 2KDGA 4J6RH 5F44A 2R1XA 4GBXA 3B6SB 4HMCA 2J8OA 3UTTA 5HHPA 1LE9A 4GLRI 4OJFH 1IAII 4UBDD 1CFSB 1N7MH 4I4WA 2P42B 4UB0H 1R24A 5FXCH 4EUPB 3QUYA 4J3XA 1DUZB 2J6EL 1UKSA 4FQJL 4DK3A 1D6EB 3B8YA 4MAUH 3FO2B 5GGRA 3ARDB 1MFEH 4LCIH 1PX3A 5HHQA 4QOKA 4JKLA 5CINH 2V9QA 5C0GA 1C5CL 4YHKL 4X8JB 4PJEB 3K80A 4MQTB 3S34H 5IFHL 4EQ3A 1U8QB 1HDMA 4TTGA 1JVKA 4DKFL 4N0CA 3GHEL 3V5KA 5CSGA 1A1NB 1IEHA 1L9MA 4MAYD 4YGVB 2A77H 4TPRH 3ULUD 1WT5A 4WCYH 1JTTA 4PJEE 3CZFB 1HYSC 4YH6A 4WUUA 2HRLA 2I24N 4P2OA 4HWBL 3MNZB 3GMPA 3H9HB 3SKMA 4PRBB 1CBVL 1A6ZB 2R69L 3AC0A 1PQZB 1YYML 3BUYB 5L8KB 1AGFB 3BZEA 1BOYA 4QRTB 4J3SA 5D2NB 1SEQL 2EDYA 1IGIH 4M5YL 4ZTPL 4RAVB 2FL5B 2PCPB 1KB5L 1I3RB 4S1SL 3IDIB 1CFQA 1A7QL 3BT2H 2X2YA 4F9PC 3CVIH 4QY8A 5C0JA 5TE6H 1DE4B 1XR9A 3V4PL 1WFUA 1UWGL 4HUXB 4JKWA 5CEZH 5KJRH 3EOTH 1ZGLP 3ESUF 5D2NE 4G8FB 5I18H 3VI3F 2KL6A 5FCUL 5I8KL 3E2HA 4X6DA 3DIFB 1CS6A 2O5ZH 3MNWB 1FFQA 4P49A 5A2FA 3M1BA 1OPGH 4NN6B 3IXTB 3ULSB 3HCVA 2YZ8A 4IHOA 1W72A 5CP7A 2PETA 1KIRA 2Z8RA 5JO5A 4LPYA 4WDIB 2NX5B 4ZFFB 1P7QA 5EBGA 4YX2L 1RZKC 25C8L 1CG9A 5EC1B 3FT3A 4MVBA 3BZFB 2AV1A 1HNFA 4UOW0 1QLRA 4BSWA 5TFSH 2WINB 2ZWLT 4A2LA 1C5DB 2PYEB 4K55A 4X9FA 4MWFB 5ACZB 4I9WE 3RWIB 2DLHA 1DQLH 2R1WB 1ZGLB 3TBVA 1F4HA 2VLJA 4KFZC 1MHPL 5FYKE 2ZPKL 4LGPB 2EE6A 2NY0D 1BAFL 2YUVA 3DRTB 1S7QB 3QEQD 4YAQB 7CGTA 2ZJSL 2V9RA 4KK6D 3OHXB 4I2XA 4M8VA 4PJBF 4PJHB 1ZVYA 4DZ8A 4ZUTA 1B9ZA 2Q86B 2HVJB 2PYEE 4KK9D 3SCMD 2P5EA 4K7PX 1LO0L 4ELKB 3RWFA 5B38G 3DSFL 4KV5F 5ESAB 1NPUA 5T3XL 5BW7C 2ZUTA 3TN0B 3MV9B 2R2HA 2W92A 1UZ6E 2EDBA 2I5YL 1V7NL 4H26A 4GW5B 3C60D 4YNYA 3V6FA 1OW0C 3WDIA 1FO0A 4JEGB 5CGMA 5C09A 1EFXD 1CFBA 2VLLB 4OB5H 4ZS6D 4LKXA 4N1HB 1S3KH 4N68A 4XPBH 5J1AB 1U8OA 1KCVL 1IQDA 4NQDE 4ZD3H 3D18B 1NCTA 5JXED 4OI7A 5H94B 1VFAA 2WY3A 5D7LA 1MWAA 1KPRA 5I1LA 2VXSH 3TFKA 4V3DB 4JN2B 4KROB 4QO1A 4I8DA 2AI0L 5D1ZB 2DI9A 4RX4D 4UI2A 4ZO8A 5ACMA 1FZMA 5D96C 1FL3B 1J0IA 5IT2H 4JFZH 4LLWA 1D6VL 4S0SD 1N0XL 4OCSL 2OLDA 3QIWA 1CTOA 2B8OT 3FB5B 4F3FB 1T04B 1EJ6A 3S4SB 5HGAA 2JJTC 1F6LL 1KBGH 2XZAH 4MNQB 5EU6E 5MEPA 2FO1A 3WFHA 2CUIA 4BQ6A 1E4JA 2WWKO 3B3IB 3JWDC 1J0KA 5JZ7D 1TZHA 4LSTH 3HZYB 4H0HB 5CGYD 1Q9KA 5B39A 1ND0A 4TRPH 5IF0B 3NZ8A 5J7CC 4HKXB 1DLFL 3GK8L 1I9RL 3HMXL 5GS0D 2CLRA 4O2FA 1IGJB 2XNAB 1JMXA 1FVDB 3CXDH 4X7EC 1ZSDA 2V7NA 4HAGA 5GZNC 1YNLH 5GRXG 2J6EA 4HUVA 2OK0H 1YNKL 4NBXB 2PO6D 1KXQE 1UXWA 2H8PB 4GS7C 4PV8B 4GRLB 2YD8A 2OSLA 5EB9A 5JPMB 3C5JB 5JUEH 4RNRB 5TQ2L 2KUTA 1PDKA 3GSWA 4XCCH 5K9KB 2PYFA 5E08L 4CU8A 4Y4FB 4KUCD 3GMOB 2ERJC 1T83C 4LHUB 4JFFD 4X4XB 1EZVX 2OMBA 2ZOLA 5F72S 1S7RA 2PF6A 4ZUVB 2WMPA 5F3BB 2RB8A 4KTEL 2QSCH 4HIXH 1G7QA 3CVHH 3WD5H 1T1ZB 5EUKA 3O3BB 5TGBB 3MV8B 4XP6H 4KI1A 2WBJA 3SJVA 4BFIB 5IMLB 4EIGB 4ELME 5I16B 5IJKC 2G2RB 2YPLA 2ESVB 5HDQH 2HRPL 1BBDL 4GW1A 4JGUA 3DVNB 1EHLL 1DBAH 4XB7A 1W8OA 4P2QE 1FAIL 3KYKH 1KB5A 4WO4D 4Y19A 1HH9A 1CI5A 5D8JH 1JI1A 4PJBB 3NCEB 5C2BL 3BWAA 3D5OF 3O4OB 3MRCB 3WE6B 3CAFA 4K3JL 3V52H 1X5ZA 4PJCF 3MGOA 3KPPB 3KJ4C 4IOIB 1BFTA 1W0VA 5IMMA 1DFBH 2K9UA 1D5BB 1OQOA 3MRNA 3WFBL 4ETQB 3L5IA 4R0LA 1J88A 3D85B 4EN3B 4KC3B 2FJGA 3OJDB 1DSFH 4HIIB 3VXRA 1FJ1B 3TBYB 4ZUWB 3UTQB 3ZYIA 3QUZB 3LH2L 3MCG1 2X9YA 4KV5E 1GGBL 1PD6A 2FATL 5CP3H 4PJXF 4WFFD 3PXHA 4N0UB 3T8XB 1FL6B 2DDQL 2VLRB 1AXTH 3MYJB 3Q48A 4OI8A 1UM5L 5F7KC 4Y5XC 4B41A 1FDLL 5L88L 4ODSL 4OFPA 4OIIH 1KN4L 2WBWB 1KLUA 5EZJA 2CRZA 3WHE0 3C6LB 1VGEH 4PRPB 4A6YB 1IGYA 3CMGA 3FO0H 1DQMH 3LZFH 4FQCH 1U91A 3QH3A 4P57B 5MERB 3GSVA 1NCBL 4P3CH 3SO5A 4N0UE 3UTZA 4NKOA 3RZCB 2VLRE 2BNQD 2GI7A 1RY7B 4GXUN 5EZIH 5CBEA 3EOBA 3O6FD 4J3TA 1FVEA 4LRNL 3LEXB 1JFMA 1LWRA 3FB7A 5FA4A 4TVPE 5L9DH 3FFCB 2ADFL 3GMQB 3G9VA 3MSPA 1JN6B 4HKZB 2B2XH 2OR7A 1ES0B 4NJ9L 5IHUH 1OP3K 2BMKA 3B9KC 1R5IA 5DRXA 2XG4A 5EOCH 1JPTL 5T1KA 3BUTA 1IZJA 3L3IA 3HAEB 1ZV5A 4HJ0C 3HC0B 4KJQD 4JRYD 3IFNH 5FYJL 4CAGA 5JLZA 4LMQI 1KTLA 1DQJA 3HC3L 3T4YA 2YKLL 1Q0XH 1U6AH 4X4MA 5B4MD 2VSCA 3QDMA 4D9LL 4Q9CA 5GZOC 1WBYB 4P46A 5IB1B 2C3VA 5KSAA 2F74B 4HJJL 4N9GA 1G7PB 2X9WA 5D9SB 3DX8A 1WZLA 1ZTXH 3OR7A 1MCBA 1QTYT 3BN9C 2DLFH 3IS0X 4Z7WF 1HH6B 3DURB 5EPMA 5EORH 2I9LA 4YBHA 1QOKA 2Q8BH 2H26A 4NHCL 5GGSY 2E27L 3QDJA 2OP4H 2QQKL 3I6GB 2JK5B 3MUY1 1F8TL 1EO8L 2BVOA 1FIEA 1Q9WB 1UB5A 5C0NC 3QCVL 4YHLH 2V17L 5L6YH 2APTA 5CBAA 1RUAL 1AQDB 5BV7C 1FNEB 1JGVH 3HZVA 5DEGA 5JHLL 2CKBB 3Q2CA 3K3QA 1UEMA 3I50L 4K3EL 2A6KA 5ICZB 1YEDB 3QEHA 3HFML 1ZHNB 4KDWA 3KNBA 5I17A 4G6KH 1U9KA 5E99L 1UJTA 4I3GA 4R97C 1MFDL 4M1GL 5DJCA 2ARJA 3LKQA 2YD4A 2AJUL 4XMLL 3HE6C 5DUBB 1AP2A 4PGEA 4DKEH 4AT6B 1AXIB 4QRQB 3ULVL 3ARYA 4F37F 3FZUD 3CFKA 4MCZA 4LLUB 2QADC 3O81A 3CLEH 3JWOC 2P5WB 4Y16C 4E41A 4H1LG 4YR6A 3TA3A 1I4FB 4U1LB 4PJCB 4YHOL 1NUDA 4YHIB 1T0NB 4ODHH 4QYOB 2ZUVA 3GNMH 3PDGA 3FCTB 2EDTA 3VXSB 5I76B 3TCLA 4DUVA 1BJMA 2DKSA 1U2HA 2BOCA 3LAFA 5B38A 1RJYB 3TZVD 1PYWA 4PRNA 4JRXA 1UCBH 3OGOE 1FGNL 3VI4E 2A2QT 3KXFD 4MJIB 4FQXA 4AL8H 5CCKL 2P5WE 4U3XA 3U36A 4BZ1H 1BFSA 1A6TA 1MCIA 2NY6B 2C9AA 3TO2B 3VXSE 1JUFA 1MLCB 2ZOKB 4QHUA 2OQJB 1IKFL 1U8KA 1HHJA 2GQHA 3QQ3B 4MDJB 5T1DL 5DYOB 1OGAD 2BX5A 4MJIE 3IDXL 1KELH 3BP6B 1RURL 3REVB 4M6AA 5HYQB 2XKNB 4TTDD 4MJ5A 5DMJB 2CMRH 5D72L 3HMWL 1S7SA 3PWJB 1VFMA 4AMKL 3WIFA 1CFVH 4G80A 1BOGB 1KACB 3QI9A 3T2PA 5FYLH 4CVUA 1IC4L 1VKXA 4DN4L 5EU7C 1OP9A 2AK4D 2BCKA 4Q6YA 4JJ5B 4HFWB 4N8VG 4WI3A 2XPGA 5I74B 3MXWL 1A64A 4G7YH 5AD0B 5DGQA 4L29B 1H15B 4PJAA 3VW3L 3O2VH 1RQ5A 3L95B 4X6EB 2D2OA 2D31A 4TULH 5ITBH 4DN3L 1B4JH 3KPOA 3MGTA 4NQCD 1EHAA 2G60L 1A9EB 1SEBA 4L8SB 4RFNC 1AE6L 1VACA 1J8KA 1VB9A 2GT9A 2D4DA 1OTTD 1KIQA 2NX5D 4JFHE 4MMZC 3IFOB 2GK0B 1GGTA 3QJFA 4J4PA 1GGCH 1WWBX 4K3DH 3GO1H 3ZKMC 5I15H 1T0MA 5JIPA 2IH1A 3MPCA 3LD8B 3G6JA 1VEOA 4WVRA 2W91A 1BHGA 3OR6A 1JF1A 3CC5A 4QRPE 1WITA 2CXGA 1LQSR 1JPFB 3E3QA 3ARED 1DVFC 3VFUA 4OCNC 4XBPB 5H35B 3P4OA 2CDFB 4EI5A 4JVUA 1HIML 2XZQH 4R7NA 4HBCH 4OKVB 5EBMB 5E6ID 4YXLH 4HG4J 4RZCA 1MOEA 2G75A 5FYKL 2J4WH 4GRWH 2W9DH 1GC1H 5B8CC 1RZJL 5BXFA 2VOTA 3H0TB 4Q6IA 1ERNA 3DXAA 5D7SH 4XX1E 3CSYA 1CICB 5ADPH 3TN0D 2CO6B 4P0DA 3MV9D 3IYLW 1T1YB 1GAFH 3FT4B 2HFEA 5F7EL 2C26A 1A2YB 3TT1L 3DROB 1U3HC 1T5XA 2NY1C 1G7HA 3GUTB 2YK1H 5C8JB 1QFOA 1RU9L 4G6MH 5IGXH 4M8QA 1AFVH 5FK9A 3OB0H 4G9DB 4Y4KB 4Z0XB 2ARJQ 4YFLI 1UXSB 5ELIA 4QCIA 1ZLSL 2ICEB 1ZK9A 4C58B 1NQBA 4TQEH 2CK0H 4NSKB 5D1ZD 1Q72L 4CVZB 3SN6N 4YDKL 4ENED 3U6RB 3W0WB 1LNUA 3LN9A 4MA1B 2EIDA 3IU3A 4I0CC 4Y5YA 2MCG1 4JM4L 2I07A 4KRMB 5DR5L 4IRSB 1T4KA 2F58H 1IAIH 1FSKB 3EO1B 5MI0C 5FHAH 2DD8L 4S1QH 3V6BR 1XIWD 1JNHA 4MNQD 4YIQB 1H0DB 5EN2A 2VN7A 4NHUA 4NQXA 1M05A 3OKDB 2PXYD 3O45B 4LSPH 3C5ZD 3MYZA 4G8GE 2B1AH 5C0EA 1YEFH 1FZOB 3W0WE 1LQVA 1IFHH 3RWCB 4AEHH 1TVHA 3G08A 1XGYH 1S7TA 3P0VH 1TTUA 5KTEL 1UWEH 3BGMA 4XCYB 5GRZA 1CLOL 5A2KH 4X0KA 4OM0H 4G59A 2FBJH 4RGNB 1V05A 1K2DA 3T3MF 1S9YB 4NM4L 5HGHA 1OAQH 3MGAA 3QQ4B 1FL5B 3OKMB 1RMFL 1I8KA 2VDKL 4YHYC 3DGGB 3UYPA 4G43B 5J1SC 5ESVA 1A4KA 5DWUL 1F90L 3MOBH 4EQ2A 3UJTL 4P5KA 5I30H 3B6SA 3L3OB 2VLKD 3ZKNC 1FFPA 1NCUA 4ZFOL 1CFSA 2AEPL 2VSDA 5AWNL 1ZAGA 4NFDA 5DHVH 2XZZA 2HG5B 1BF8A 2IPTL 5D1XD 4OTXH 4K8RD 2A6IA 4AH2B 1MF2H 3ARDA 3MV8D 1XZ0B 2H32H 1UWXH 1BVKB 1NFIB 3ARGA 1K4DB 3LS4L 3I75B 3UAJC 2VZ3A 2ESVD 3QQNA 2DKMA 5F21B 3VXMD 4TUJA 4PJ9B 2ATKB 2DTMH 3QCTH 5KW9H 1U8QA 2AGJL 1NKOA 3JVGA 1OAXH 4FXGA 1E6OL 4TSAH 4XMPL 3VFOB 2DQUL 3HNVL 4OT1H 4TSBH 4RFOL 3E1F1 1U95B 4D0DB 4KMTH 5DK3A 4CMMB 3NACH 4LAJH 3VGDA 4GQ9H 5JMOC 3J8F7 3SGDI 1WAAE 2MNUA 1MI5B 3UP1A 1RK1B 3CUPB 1E4WH 1M7IB 5EIVA 3ZKXB 2DM4A 4JPWL 1S7VB 4UT9L 1U2CA 4X4YB 3QFDB 3D85D 5CIPB 4RGOL 5E1AA 4EN3D 1A6ZA 2EYTA 3MJ7B 5KSBF 1PQZA 1F3DH 3U0TB 5GRJL 3K8LA 4NQED 4QOKD 5DEFB 4JZNB 5DVMA 4AENA 3G6AA 5D2NA 4RMVA 1JGLL 3QUZD 1MI5E 1ACYL 4RAVA 2O5YH 3VXPA 2FL5A 3G6DH 1Y18B 1FG9C 1L4IA 3IDIA 2R8SL 4N0CD 1KJ2B 1DE4A 4OUUB 2ZG1A 2V2TB 2XXCB 2WQ8A 2RHEA 4N90D 4KZEL 4C83B 3VGBA 1KGCE 4YWGL 2WLYA 3T0EB 4G8FA 4JKPH 4PRPD 4B0MM 1IQWL 2HKHH 4ODXB 3N1MC 1TPXC 4PJFB 4PBWD 5E2WH 3N85L 4IIQC 4H1LA 4P2OD 4DFIA 3TT3H 2ED7A 4X98A 3F58L 2XZCH 4Q9BA 5EBLB 1CD9B 3ZMRA 4QRUB 1XCTB 3V8OA 4ZFFA 3FFCD 2W9EL 3QP3A 2BK8A 4XNMB 3T0EE 4NZTH 5I1EH 2D7QA 2APVA 3OSKA 1HZHH 1GZPB 3BZFA 4PJFE 1A4JB 4U1IA 5JQHC 5CZKA 5CLTA 2P1YA 3SDCC 3UZEA 4HH8A 5ACZA 2PYEA 2C3GA 4TVPL 1VFBB 4DUWA 2Z8SA 1J10A 2IEPA 3DO3A 3GDBA 1U8IB 3FRPG 3VGAC 2A1WL 4KDVA 1S7QA 4O2EB 5FB8A 2Z4QB 4NWTH 4J8RB 2Y36L 1OSPH 5FF6A 4Q9QL 2C4XA 2FCBA 2Q86A 1F13A 3M8OL 5TDOB 3W9DB 3N1PC 3MOAH 2R0ZH 1OF2B 1J86A 3GIZH 5ESAA 1SJEB 2YD9A 2VRAA 1DEEA 4O00A 4ZFZA 1CLZH 2OL3H 4WEUD 5HXMA 2IFFL 4YK4C 4NQDA 5JOPE 1NBQA 3PP3K 3LEVL 1LO4H 4PYGA 3D69A 1DBBL 2B39A 3F7YB 4MXVF 9CGTA 5E5MB 1MJ7H 4OZ4B 2WIIB 3QIUB 2IWGA 3IDYB 1NGQL 3QG7L 4F8QA 1CD1A 4OZGF 1A7PL 1UCTA 2VWEC 3ZO0A 4M7KL 4D94A 1OB1B 3H7BA 2JIXD 5J1AA 1H8SA 2ITDB 4BUGA 5DQ9B 2ZNWA 4HT1L 3W11C 3AM8A 4ALAH 5J12B 3QHFH 1NFDF 2IANA 5F9JB 2H3NA 5H94A 2X41A 4U7KA 2FECI 3F6LA 3MLWH 1MCKA 2GK2A 1ZLWH 1GPOL 3GJEA 5C0CB 5IVNA 1J0YA 4JN2A 1Q0YH 4P9HL 1CWVA 5EU6A 5BW7A 2FIKA 3HR5A 3ZT7A 2QSVA 1VA9A 1FL3A 5L0QC 1NGWB 2HTLD 5F9DC 2IQ9L 3MRIA 2QSQA 1C12B 2A73B 1GOGA 5GGQH 4HC1H 3LPFA 4NNXA 1OW0A 4P4KC 5KZCB 4MJ6A 4U1SA 4EDXB 2MPAL 5C0CE 4F3FA 2DLIA 1UM4L 3O2WH 2DMKA 3O3DB 2HJLA 3EOYG 5JIHA 3B3IA 3B8SA 3IKCA 4M5ZL 3HZYA 4UTAH 2WANA 4FQQA 3UC0L 1CCZA 4OLUH 1OTUC 1AHWC 4X7SH 1M71A 5H8DA 5IF0A 5D7LD 3ZL4H 5HHVL 4PJIE 2X4UB 2X4SA 4RRPG 4HKXA 1JBJA 5E8PA 2GCYB 1JHKL 5EH1A 1IGJA 2XNAA 4ZFOA 5CZXC 5INDB 1FVDA 4FQPA 3QCUL 1FNFA 3DVIA 3MBEC 3D39B 2NY6D 5T5FL 3KS0H 4LSSH 1QR1A 1ZA6B 3IAPA 4LF3B 3I6KA 3SDXF 4XX1G 5DMKB 3K4ZA 3PDOB 4ZTOH 1F4YH 1JWSB 2H8PA 2D7PA 2P8LB 4HBQA 4PV8A 2ATPA 2LAAA 2JJTA 4QXUL 5FM5M 1TITA 3BH8B 4RNRA 1HHHB 4Q2ZB 3D39E 5K9KA 4XPFH 3IFLH 1B2WL 5C0FB 5EOCJ 5C0AA 1S7XA 1ZHBB 1Y6KR 4ELMA 5C6TL 2GJZB 3PWNA 4X6BB 3T1FA 5F3BA 4OD2A 1INEH 2FHCA 3DUHA 4ONHA 4PJDF 3WDJA 4P2QA 3P9MA 4MNGE 2NY2B 1P4BL 1T1ZA 4NN5C 2HH0H 5FO7B 4WW2F 3RVUD 4QTIL 5GGRY 2VZOA 1YEEH 5IMLA 1A7NH 3X3FL 5E70A 1XF3A 3PIQB 5BZWA 2DMCA 1BFVH 3TNNA 1IGFH 1NCDL 2NXZB 4YQXL 4AYFA 1GOHA 4OD3H 1IC5H 1V3MA 3LPGA 5BJTA 3PXJA 3RL1A 1NEZG 5C6WH 3CCHA 3PDDA 1T83A 2DYPA 5DD0L 1I1AB 3S8WA 1K4CA 5A2LH 4YE4L 5HHNB 1DUYA 2VDNL 4KGLA 1TZIB 2J12B 2L7UA 3O3EB 1MCWM 4OQTA 1D5BA 1R3LB 2XWJA 1J12A 3IJSB 4Y5VB 4Y2DC 3TESA 1NJ9B 4ZNEA 1T1XB 5HJ3B 1UACH 2NYYC 4NJAL 5DJ0B 3WFDL 1N2RB 3HNSH 3TBYA 5F88B 2NW3B 5E6ZA 1AXSA 1T21A 1ZS8B 3BGAA 3K0WA 4OZGB 2K7QA 5ESQB 4BH8A 2OR8A 1JYWA 1WFNA 4N0UA 2E7CA 3PE9A 3WJLC 4GKNA 2W60A 3ARBB 4YHZL 1NANH 3V0AC 3U2SA 5E03A 3VDBA 3MBXH 2CQVA 2IF7A 1GHFL 1A3RL 2DQCL 4LGRB 5IK3B 3L5JA 1X3DA 4LLDA 3SO3B 1S9WA 1JCKA 3C6LA 1QZ1A 4QHLA 4QRSB 5HDOA 3RIFF 4PP8C 3RZCA 3MCKB 4M61B 4OLXH 4GKOA 3MJ9L 1A7RL 1OCWL 1UH3A 1JK8A 3FONB 1GL4B 2VXUH 2BRRH 2LQRA 3GMQA 4FABH 4M1DL 1MHHA 4Z77A 1T0PB 4HJGA 1BD2E 1CGYA 4LCWB 3RFZC 4NGHH 3C5SA 1PVHA 1TETH 3DETC 4Z5RB 1RUPH 4KKLD 4NO0A 4OZFG 4B5EA 1LGVA 5ISZD 3RIFK 5EU3A 4MA8L 1JNNH 3DX9B 4YDLC 4CADA 3E6FA 3RY4A 1NAKL 2F5BH 4Z78A 4CL7A 1PY9A 3BW9A 5D5MF 3LIZH 3HC0A 4ORGB 5IEHA 3JTSA 1SYSA 4Z7UF 1BGXH 4UMGA 5CJQH 2OI9B 1TVDA 4URTB 1RULH 4XP4L 5DJ6A 4IRSD 3D9AH 5AG9A 3GIVA 3WYRA 4MXQA 3DUSB 3MFFB 5CWSB 3P73B 3RP1A 5MENB 5F97E 4NOFA 4M7ZC 3BPNC 1FO0H 1JWMA 3SDXB 1G6VK 3HUJE 1WBYA 4OF7A 5KG9A 3H3PL 2F74A 2ZCHH 4R8WH 1FG2B 1P4LA 4KRPB 1SJHB 4J12A 5DURD 4Y1AD 4NKDA 1D5ZB 4IDJL 4LK4A 1RUKL 3BKYH 4X9GA 4HKBA 3NFSH 5KS9F 5TJWK 5ALBH 1WFTA 5MENE 2VERN 3P9LB 4U0RB 5T1KD 1MWAH 3I6GA 1DDHB 2JK5A 3RJQB 3TYFA 2P8MB 4FRWA 1Q9WA 4NDMB 2ADGA 2P47B 4HGKC 1AQDA 3IETA 3ZDYE 4R4BB 4U0QB 1MJJB 5BVPH 3FFDB 3NAAL 3MLSH 5DJ8B 2YD6A 2AJYL 1OM3L 3BP7B 1OAYL 4OFDA 5DC9B 1ORQA 1J11A 3WSQL 4RWYL 4NO5A 5ICZA