2CLVA

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm8 peptide
Total Genus 72
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
72
sequence length
278
structure length
278
Chain Sequence
GPHSLRYFVTAVSRPGLGEPRFISVGYVDNTEFVRFDSDAENPRYEPRARWMEQEGPEYWERETQKAKGNEQSFRVDLRTLLGYYNQSKGGSHTIQVISGCEVGSDGRLLRGYQQYAYDGCDYIALNEDLKTWTAADMAALITKHKWEQAGEAERLRAYLEGTCVEWLRRYLKNGNATLLRTDSPKAHVTHHSRPEDKVTLRCWALGFYPADITLTWQLNGEELIQDMELVETRPAGDGTFQKWASVVVPLGKEQYYTCHVYHQGLPEPLTLRWEPPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Distinct orientation of the alloreactive monoclonal CD8 T cell activation program by three different peptide/MHC complexes.
pubmed doi rcsb
source organism Mus musculus
total genus 72
structure length 278
sequence length 278
chains with identical sequence H
ec nomenclature
pdb deposition date 2006-05-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00129 MHC_I Class I Histocompatibility antigen, domains alpha 1 and 2
A PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2clvA02
3.30.500.10 Alpha Beta 2-Layer Sandwich Murine Class I Major Histocompatibility Complex, H2-DB; Chain A, domain 1 MHC class I-like antigen recognition-like 2clvA01
1KXTB 3H9ZA 5SWQB 4XNYH 1Q9OB 2Z91B 5IB5A 5CUSL 1B4JH 1VKXA 1PDKA 4R4FH 1I9RL 2GY5A 1BQLH 3U0WH 2W65A 3T1WA 1JNJA 1T83A 1TZHB 3OWEA 3FN3A 5E2JA 2JB6A 4XRCB 1I7UB 3W9EB 4HKXA 5HDQH 4EIZC 5T1LA 3WFCL 4AG4H 5FOBB 3MV01 1U3ZA 3IFPB 3ORJA 1MVUA 2VZUA 4JFZH 5HHMB 4KVNL 3ESUF 1YECH 1JF1B 3DV6A 3HN3A 3O3AB 1U8MB 1W72L 2BHZA 1IQDB 2B0SL 4OCXH 1EDQA 1Y6NR 2YPKB 5M94B 4Z7UE 5K93A 2EC9T 5F9JB 4HWBA 3P9WB 1V8HA 4X7TB 4JPKL 5JOEA 1J1OL 1A47A 1P1ZA 3OX8B 2BY2A 3RWJB 2OJEB 1FGVL 1MJUL 1AY1L 4GAGL 2NZ9C 4HJGA 5DRWB 4B53A 5LQBL 5CJXC 2B5IC 1LK3H 1A21A 3BHBA 1NDMB 1A3RH 3FB7A 4JN1L 2P48B 4L9LB 3NMEA 3GIZL 4ODXA 1QSEB 4P4KB 2JB5L 1MI5E 4HXAH 1OGAB 3WD5H 1IEAA 4X99B 5KVGH 1G9NC 3JWOH 3IDGB 4YGVB 4F37K 4YHLL 2IBZY 4ONOA 5D7IE 4FMKA 4IOFC 4NUGL 4KI5D 1PG7X 4P5TD 4O2EA 2ICWB 2NW3B 3CU1A 3L5WA 4HXBH 4OZ4B 4LRIC 3BPLC 3IDMA 1IFHH 5L2KE 1XIWD 5ICZA 3EDDA 4FQ1L 4DN4L 4G3YH 5CLWA 5F7NC 3QDME 5D2NB 1NAKH 3L3IA 3ZE0E 3MNWB 4D0CB 4NRZB 4I5BA 4P3WA 4PBVC 4R7NA 5IV2A 3VFVA 3T0EB 1ZOXA 4BQ8A 4KUZL 4K8RH 1V7ML 1BGXL 4K55A 5I9QC 5DA0B 5C7XL 1X5KA 1DSFL 2WBWB 1RZFL 1G6RA 5TE7L 4X83A 1MCDA 4WDIB 3GMOB 3VU2A 3TJEH 5BS0D 3HC3H 4OLUL 4D2NA 4M8VA 3UTQB 4AEIH 4LNRA 3V0VB 2EDFA 3L5IA 1KIRB 5F96H 3ARVA 3PL6B 5I0DA 2VABB 4NKQB 5I1IL 5DUBA 1YY8B 4HUUA 1NC4D 4PP2A 3VFPA 5JZ7C 5GS0L 3EHBD 3NZHL 2W9DL 1OTTC 4LLDB 1F6FB 4OV6F 3H9SD 4WI7A 5EUKA 4WV1A 3RHWF 2GY7B 2PTVA 4LVNC 2A6KB 4HFWB 4MQ7B 3CDYA 4PGEB 5IP4A 4RWHA 3QNXA 2C3HA 2XZQH 5FKAA 3MOAL 3CLFH 3FO2B 1D5ZB 2PXYC 4PJCB 3ZE2E 3O2WL 3ARUA 4K8RD 4CMHC 2YUVA 4WUUB 1V7NH 4G6JL 5IBUB 1IGIL 2R56H 3O4LE 1RZJH 2YD2A 4ZO7A 4XC1H 3GSQB 3GSNA 3V7AG 4HT1L 3T77B 3BP6B 3MV8B 4JQIL 4CGTA 3FTGB 2FDBP 1I3GH 4W6XB 4TULL 1YNTA 2JJWA 4X4ZA 3MACH 4LSQL 5DRNA 1CBVH 2NY7H 3F8UB 4CAGA 4AEHL 1BM3H 1VKXB 4EDXA 3TA3C 1ES0A 3LPWA 1T1WA 4QHMB 1JHKH 1A1NB 3CC5B 5D6CB 3RWIB 2XN9E 2VAJA 2BNQA 2HT4D 4HKXB 5T1LB 1D3CA 4WW2C 1F6AA 2P44B 4EN3A 5DYOA 4LIQL 1KTRL 4AENA 3ZDXF 1MVUB 1L4IA 1OT1A 4LPYA 4HJ0C 4F8TA 1NBQA 1BX2A 2Q7NA 4HUMB 1NAML 3MLSL 3G9AB 3UJTH 2J8UF 5HDBE 2OSLA 4A2LA 1P1ZB 1F8TL 5GHWL 3HNSL 4P59L 4PGZA 4L3EE 4HJGB 2FX9L 1QFUL 1CDHA 3BHBB 4WY7H 3QO1A 3UBXA 3V8OA 3C5SA 2WWKO 3FB7B 1CD8A 4HZAA 4PRHB 5JORA 1UCTA 2W1NA 1MRCH 1F4XH 4PGDA 3O4OB 2GTWA 4JFYA 1IEAB 1WTLA 1MCCA 2GHWB 2DI7A 3CPLA 5L88H 4JKPL 1A1OA 4XI5C 3I75A 4OUUA 1MEXL 5D4QA 3BIBX 2P5EA 5EOCL 3BPNB 2ZG2A 4O2EB 2H2PC 1NL0L 4KJYB 5FEBA 5DJXB 1OVZA 3L5WB 3VXRE 3LEVL 4KI1A 4YHKH 2YD7A 1NUNB 2DIJA 1RJZA 1U42A 5JHDE 1BIIB 1HH9A 1TMCB 4MJID 5DI8A 2PW2A 4EUPG 3TM6A 5CFHA 3PGFH 1KB5B 3SY0A 3B43A 4F3FB 5B21A 1LE5A 2XY1A 1GZQA 4I5BB 4OCRH 1KENH 3TYGL 1VADA 5FYKH 5ACZA 1BAFL 1F02I 4M43L 4WU7B 2QKIB 5HDBF 2ZUVA 4ONGL 1XGYL 1Q0XL 4P57A 2EDOA 4IJ3C 3L3DA 4D9LL 2HFFA 5KVMC 1TLKA 2XRAH 4ZUVA 4KJQC 1KLUB 4XX1E 3EYUL 3A6CH 2XYCA 1KJ3H 1JCKA 5BMFH 3HUJA 4GUPA 5E6IB 5C71A 3V6FB 4HUNB 4WO4A 1AXTL 2P4AB 3KPMA 2AXGA 4B5EA 4QRQA 2YEZB 3T1FA 4N5EC 4PDCE 1E4WL 2H3NA 1HQ4A 4PJHE 3TBTB 1LP9B 5AWNL 2IH3B 1IM3B 1KCKA 3QR2A 4HUUB 4PP2B 4Y16D 3VFPB 4ZODA 3VH8G 1YEGH 5K9JH 2AJYH 5DT1L 2A6DB 1JFQH 5I1KL 5DJ6A 4ZS7H 1AE6H 3MXWH 3ZT7A 3BRGC 3RVTC 5FYKD 1FFPA 5KTEH 2OR8A 5MENB 1IC4L 4K3JH 2F8XC 2LVEA 4E41D 1KYOK 4FQJL 3RTQA 2CIKA 3FFDB 3DSFL 5TDOB 1KEMH 5DGQA 3FFCD 1YNTB 1XCQA 4LCUA 1EGJH 1TVHA 5KSAD 2AV7B 5C09D 3ULVE 3WIHL 5D1XD 4EDXB 5ILTH 5HVWA 1I7ZA 5EU7C 4JG1H 1ES0B 3VXUE 1U8PA 1PQZB 4RX4A 4R97B 3T04D 3QCUL 1JNNL 5IQ7H 1R3JA 1F6AB 1LD9A 2YPLA 1AKJD 1HZHH 5DYOB 5E2UL 4Z77A 2XWJB 2RFXB 1CIDA 2ZKHL 3Q3GB 5K59E 1AJ7L 1WQVT 5JDJA 3GRWL 4BQCA 1R3IH 3L1OL 3T4YA 3B3IB 4M7KH 3MBEA 1T7XA 3IDXH 1R5VA 4OZIA 1X5FA 4ZXBA 3DIFB 4Y4KD 3AXLA 2X9YA 3RPKA 3VXMA 1FLRL 4LQ1A 3V0AC 4JY6B 1YYMH 3E6HA 1HHIA 1CFSA 3QO1B 5D7JA 1IE5A 2DLEA 3GJFH 4F7EB 4BYHA 5JORB 4S1QH 2IBZX 4Y4FC 4JQXC 1V05A 5BV7C 2YRLA 4LDEB 5C08B 4HIEB 4BFBD 2GTWB 4JFYB 2C1PA 1RUKH 3RQ3A 3RX7A 2PO6D 5J1TC 1FNGB 3HMWL 3ZKNC 3ULVF 4M1DL 2ZSWA 2X1QA 2DQEH 3AS3A 4GG6E 3BW9A 4X80L 5EC1B 4KROB 3RIAK 2XG4A 4LVHC 4HIXH 1RUAH 3C8KB 4G8GE 4PBXA 2BVQA 3KJ4C 4I2XE 5IW1A 3LKPB 4YUEH 2VZ1A 5KSVA 1RJZB 4R3SA 3SDYH 3QXVA 2JELH 3OKMA 4N9GA 4V3DB 4JM2D 4WHCA 2PW2B 2NX5B 1ZA6A 3G6JA 1J18A 4P46C 1BQHG 4RWYH 1MJJA 3HG1D 4B0MM 1LE5B 4Y4HA 5K59F 3OR7B 3O8XC 1GZQB 2PYEA 3E2HC 1VADB 1ZVHA 3MOQA 1CFNB 5ACZB 1JNLH 4JRXA 2XA8H 4P57B 3QRGH 1RIHL 4ZUVB 4XP4H 4MWFA 4GUPB 3LRHA 4G6KL 2J6EL 2I9LA 3RWGA 3KPMB 2AW2A 2AXGB 2QSTA 4QRQB 3T1FB 1QOKA 5DF0A 4WJ5A 5C0CD 4NQDA 3TZVC 1G7HA 1FNAA 2EO9A 2VDNL 3PHQA 4MQSB 5J3HD 4Z7OE 3KDMA 4K3GA 1IGMH 2EEDA 1TIUA 2WUCH 3IF1A 3HMXA 1N7MH 4XPGL 2QHLA 3QUZC 3FB6B 3IVKB 5E00B 1OGAD 4X5XB 2A83A 1JE6A 3K81A 1H15A 4Z8FH 5DJ6B 4JAMA 5E2VH 4GG6F 2QEJA 4YXKL 3P0YH 4TVPD 3T2OA 4OAWA 4EDWH 2GJJA 2YD1A 1FFPB 4KGLA 3BZ4A 1UJ3A 4UOW0 3RTQB 2CIKB 4D0DA 5GRWA 1WCBA 4GKZB 3UAJD 5CP7A 3VDBA 1EEUA 1NMAH 4YDVA 2UWEF 3VGAC 5EU5A 3SJVA 2E3VA 3RIAF 2ESVA 4KHTH 5BJTA 5HYJE 1I7ZB 1HK6A 1U8PB 5DK0A 5D1QD 5E95B 5LWYL 4QRRE 5H8DA 4Z7WF 3ARGC 1UFUA 1ORSA 1JFMA 2X40A 4LSRL 4NM8L 1R3JB 1LD9B 3OBAA 4U49A 5HPOA 2YPLB 5I1DA 3UZEA 5H2BA 1NCDH 4Z77B 3C09C 4JFFA 3MLRL 4OJFL 3PV7A 1RIVL 4PV8A 3FOMB 4H8WH 1LO4L 4ENEC 4ZOBA 3SGKC 1EVTC 1KPVA 5ESAB 4ZFOL 1NGQL 2WIIB 3BOVA 4P2QB 4J1UB 3SEPA 2C3GA 2G75A 3MBEB 3IXAA 3GSOB 5DHVH 3VJ6B 4P5TA 4OZIB 4XCYB 1OPGH 3IKCA 4ORZC 3HS0A 1HINH 4M00A 3P4NA 3AXLB 3QUXA 4YX2L 3BRDA 4QXUH 2NY4D 2R1XA 3WFBL 3GMNB 5D7JB 3O6FC 1HHIB 1CFSB 3VDAA 2NNAA 1XIWA 2V17H 5B3JE 3F12B 1EHLH 1LGVA 1PSKL 2FH8A 1NEZA 3F7YA 2XY2A 5IG7B 3CDCA 2C1PB 2OI9A 1EO7A 3FAWA 4LHQB 3CFKA 5ITFB 3T2NH 1ULVA 2WBKA 1X7QA 4M6AA 3U1SH 2ZSWB 4C55A 5CINH 3BW9B 3NABH 4LLUB 2D7TL 5B38G 4X7CC 3BFOA 5I1AA 4R4BB 5BS0A 4NKOA 2BVQB 5IW1B 4O51A 4Y0GA 4JFPA 4DTGH 4R3SB 1WAAA 5BZDA 1FO0H 4FQXA 2CIIA 1T1ZA 3DV4B 3D18A 1ZA6B 3ZTJH 5FYJH 3C6LC 4V1DB 4CJ0A 3PWJA 1E4XH 4LLYA 5BVJB 1NC4A 1VFUA 3S4SG 2YC1A 3CSBA 3H9SA 4V2BA 5E94A 4RDQG 4XPBH 3WDHA 2DB8A 1F4AA 4P2OC 5E2TH 2A77H 4NQED 1EMTL 5EU6E 3T4AA 3MJ8A 4XPHL 4MWFB 4WHDA 4O2FB 1RU9H 2I9LB 4YLQT 3RWGB 4PJCE 3PG2A 5GXBB 4PYGA 4OIIL 1QLFA 1AO7E 3OF6D 5A43C 3MGAA 1G7HB 4ELKA 1PYWB 3VD7A 4CU6A 1U3JA 4FFEX 4XH2A 4OTXL 3QXDA 5DD3H 1FCGA 3AY4C 1YUHA 3RIFK 2DMKA 4G6MH 2RCSH 4FOMA 1QKZH 3HZMA 4RBPH 5FYJD 4JAMB 1D5IH 3D9AH 4OAWB 2KPNA 3MRLB 3RVUC 3BZ4B 5B39G 5IVOA 3MLZH 4HKBA 4ZQKA 3RNKB 4LSSL 5CP7B 4Y2DA 1CL7L 2R2HB 5KAQF 2N7AA 1I1RA 1ADQL 1M05A 4TTDC 4NQXA 3SJVB 1DANU 5HGGS 2ESVB 5BJTB 4LLWA 4YHOH 5F44A 4X0KA 4RGMC 2JJTA 2GK0B 3S8WA 2XKNA 5KS9B 2ICWJ 4PY7A 3MV11 1ZSDB 4ODSH 1E6JL 2F5BL 1ORSB 3D2UA 3QIBD 3NCYS 1A6ZB 1Y6KR 3VMPA 1FL6A 1X5YA 3W0WA 4X9HA 5J11B 5JW4M 3W2DH 5H2BB 3ZDYF 2PYFB 3VRLE 2R2EA 4HG4K 1FYTD 1WBZB 3QCTH 4JFFB 2G2RA 1Z5LA 3KPRA 1AGEA 2CKBL 4PV8B 4U0RC 3ZKSD 1W8OA 5CLTA 4NIKB 1LEIA 3V4UH 1ZANL 1ZHLA 1KPVB 3JSSA 2C3WA 3N1MC 2WWMD 1XGRB 3I6LD 1QBBA 2D9QB 4YXLH 2G75B 3RFZC 4IMKC 4H20L 4R7DB 1FGNL 5IFHL 2CDFA 3IKCB 1KC5L 4ESKA 1OAYH 3HS0B 3ARDC 5JR1H 4DVRH 3UZVB 3FMGL 3QUXB 2IQAA 1JPTL 1OGTA 1A3LL 3DXAB 4TUOB 4FABH 4Q9BA 4LARH 4NGHL 1Z6JT 2DM2A 4U2YA 3P40A 4U0QB 3ALPA 5B4MC 1P4BL 1NEZB 3CIQA 2NY6D 1FG2A 3C9NB 1AGDA 1CGUA 3BAEL 4LEOA 2OI9B 5HYFA 3DECA 5CGYD 2EDHA 1DN2A 3CFKB 1BFVL 3LRGA 1RJYB 4N0CD 2JCCA 1DQDH 1YN7A 3EJJX 1YA5A 4KI5C 4GRLD 4B50A 5HI3C 1FL5B 4OZGA 2R0WH 1FNEA 4JDTH 5HVHC 1XGTA 5IMLA 4HK3N 5AZEH 4NKOB 1MLCA 3MRBA 1FG9C 4UV4H 4E0RB 4W68A 4FQXB 2CIIB 12E8H 1T1ZB 4I0PA 3D18B 4OLWH 2OMNA 3CXDH 3PWJB 5CSZB 4MSWA 1CU4H 4Y16A 5ADOL 2V2XA 3EOTL 3RGVB 3K4AA 4Y19D 2D4DA 4M4RA 4BZYA 1QBMH 2LV4A 4NFDA 1T89A 4UBDC 3T4AB 3MLYL 2ICES 4P5MA 4E41A 4LGRB 4YPGA 2ATKA 3HZYA 4DOHB 5I15H 1QLFB 3C08H 4ELKB 5HD8D 5HHOD 5IHLB 3TT1H 3C60D 4OV5A 3BVNA 4BFEA 4ORGA 2OZ4A 5C08D 2VDML 5DD0L 1MY7A 1YUHB 5D1XA 2H9GB 1DQJA 2V5RA 3ZE1E 3HZMB 5IHUH 1KELH 1CFQB 1UWEH 3EJZD 3L6FA 1CICB 4PRBA 2BNQE 2PETA 3GKWH 3NA9H 1AKJA 3RZCB 5CILL 4WU5A 3GK8H 5DUML 2LVCA 3DUUA 5D6DC 1CQKA 4PLNC 5I73B 1T22B 5E99H 4GSDH 5KVFL 4NQXB 1MRDH 4WCYH 3BDYH 4RZCA 4HWUA 4NCC2 1IQWL 2H8PA 2KBGA 3UTPE 4LLWB 2FD6H 2E27L 4X0KB 4DZBA 2F53B 3ULVL 5KOVC 1YMHA 3ROLA 2ZSVA 3LS5H 3UTOA 4XNZC 2XKNB 4YDIH 4PY7B 1ZLUK 4NUJA 3D2UB 1XR8A 5I66B 1EGJA 2HT4C 3W0WB 1AD9A 4JREB 5C0BD 2BP3A 4YNYA 3IDJB 1DQQA 3IDNA 5F89A 1MOEA 5AAMA 1C16A 2FYYA 2G2RB 3FT4B 3KPRB 1AGEB 4G8EB 5D1ZC 1K2DB 2ICEA 1CDCA 3M45A 1TJHL 1ZHLB 2V7HA 2NXZB 4PLKC 3RX8A 5DR5H 1YMMD 2QV2A 5SWZD 2PO6A 3EO9L 5FHBH 4N90E 3E6FA 1CDBA 3TBYA 4ZTOL 1BOGA 2HJFA 4XNQA 5DFVC 1HILA 4JG0L 1QBLL 1VGEL 2CDFB 3JWDH 2P5EE 3BKML 2XKSA 4MD4B 1TNMA 1ETZA 3L3GA 1CXKA 4MNQD 2YKLL 1OGTB 3AMLA 2CR3A 3VFRA 4WEBH 5DEGA 25C8H 1FIEA 2NY2B 3HI6H 4XB7A 2EYSB 3T3PE 1S9KC 1FG2B 3ILPA 1OB1A 1AGDB 1X4YA 1GPOH 1L6ZA 1RJCA 4LEOB 4NZUL 1JHLH 3P4MA 3OAZK 3TN0C 4QXGL 2D0FA 1CG9A 4G6AD 3BZEB 4LPUA 3I9GH 4FFZH 1YN7B 3LKNA 3LOWA 5F9WB 3RZWA 1Z9OA 4OZGB 1FVDB 1FNEB 1AH1A 1HOCA 1FFQA 1DLFL 4GKOA 1CLZL 2UUDH 4GAJH 4WEMB 3MRBB 3EZJB 1HSBB 2HH0H 3HUJE 5T5NF 5HGAB 1T7YA 4HMCA 3C6SB 1JWMB 4I0PB 4L29A 1OWWA 1H3WM 2DLFH 3EYSL 5C0CA 1G1CA 4G5ZL 1KCRL 1J8HA 1QO3A 5KN5A 3N50A 4NJ9H 1U8IA 4QTIH 4NWTH 2XXCB 2QADD 4PB9L 4U1MB 1XGUA 2VLKD 2FATL 1BZ7B 3LY6A 2FIKA 5AZ2H 3U7WH 1EAPA 5L8JB 3ZZ1A 4R4ND 2QHRL 4P5MB 1S7QB 4YPGB 3HZYB 2V5YA 2Y06L 2MOVA 3DBXA 3AM8A 3L5XH 3SOBL 5IWLA 1VGKA 1C1EL 2AEWA 4O58H 4JDVA 5IQ9A 1XR9A 3T3PF 3CMGA 4OV5B 3BVNB 3GBMH 3EOYG 3TO4D 1KIPA 3HE6B 3WE6B 2I5YH 1ZHNB 5MP6L 4NO5A 2DLHA 3M8OH 4G8FA 2O93L 1MUJA 1NCWH 4L5FL 3KS0H 3LEYH 4MA7L 3L6FB 3MO1A 5H35B 3WN5A 3EDEA 5KZCD 1F4YL 4D0BA 2AI0L 3O9WA 2HTLC 4YBLB 3HUJF 3KPLB 2YPLE 4F58L 5I1CH 4WU5B 4NZTH 3LPGA 2VLJB 3KPNA 4KMQA 5JXAL 4UT9L 1NCAL 4MNHA 4KRPB 1E6OL 2QSCH 3LQAC 1X5JA 4HKZB 4QRPA 4OLYL 5KSAC 4DZBB 1YMHB 2ZSVB 2O5YL 5D8JH 1YJDH 4NN5C 4NUJB 5T3XE 3F62A 4OZIE 2KZWA 4J6RH 4JFXA 2CDGA 4KUCF 3HAEG 4U1JA 1CDYA 3VXME 5DD5L 2JE8A 2X09A 4AL8L 2DS4A 1A7PH 3VWKD 2APVA 2YS4A 2P24A 1ZT4B 4X7SH 2ICEB 4PB0L 3B2UC 2BRRL 5KJRH 3HPJA 4APQB 1NFKA 2V7HB 3JVGA 1MHEA 1RZKH 2Z31A 2VH5L 4JM4H 1FZMB 1MFEL 1RULL 4OD3H 1QFHA 4HZLA 3MUY1 3DUSA 1KXQE 2HJFB 3MXVL 4NN7B 3DJ9A 1MHPL 5D5MB 3C5ZA 3K2UH 3NAAL 3CZJA 4WWKD 5TFSL 1A9BB 1FNHA 4PLJD 1U8KA 3ULUE 3CUPA 3MCLL 1ETZB 3LSOA 4XBGA 5J6GA 4KZDL 3VXSB 4RISH 1BBDL 4Y4KC 2NTFA 2DTSA 2V5SA 3I2CL 4PJ7B 1N0XH 2OTUA 1EEQA 3VFRB 4UILH 4XTRD 5DEGB 1U8QA 2VZ3A 1WGOA 1DVFD 4LNVA 5DHVA 3MV7D 3O3UN 2XA3A 5FV2A 1FHGA 3O2DH 1IRAY 3UDWC 4F15B 3QEQA 5DEFA 5I1HH 1VSCA 3OQ3B 3TWCH 4POZD 3G6JE 1OB1B 3PJSA 3Q6GL 4POUB 5J7CC 2VLRB 2IWGA 1EO8H 3QDGA 3C8DA 2PYEE 4JRXE 4MS8A 4JPIB 3QG7L 4PIRF 1SHMA 1URLA 1CT8B 4NQEA 1HOCB 3HE7D 4L3AA 1E4KC 5IB3A 1JGLL 2FEDC 3QEUA 4GMTL 5DS8A 5J0BA 1KJ2H 5CKGA 1QLRA 3OF6A 4JM2C 2Q86A 1ZS8A 3WXVL 5I18H 1J8HB 4NQDE 4LU5L 1I8LC 5C0EA 1CLYL 3MA9L 3CDFA 2VQUA 2WUBL 1U8IB 1KN2H 3SGJA 5HTSA 1FO0A 4MDIA 4XP5L 3R1GH 5GSRB 1XGUB 1IAII 4KU1A 1U93A 3WLWD 3X11B 3UPCA 2Y9RT 1GAFH 3I6KA 3PHOB 4QTHA 1MREH 3VMOA 1EAPB 3ULUF 1YQ2A 4RAVA 3GNMH 3OG4B 3S3JA 5HVFB 3B83A 4HDIB 5EUOB 5GISH 5BQ7B 4OCSL 5H94A 5A2LH 2R4SH 3BSZL 4TUJA 3BT2H 4JDVB 4WI6A 3LB6D 3VWJD 5IIEB 1XR9B 2A9MH 1T21A 2R1WB 3SDXA 4N0UA 4QOKD 1JV5B 1I4FB 3KLHC 3ZHKA 1IGJA 1KIPB 1ZGLP 1PX3A 4L9LC 3B6SA 3DYPA 5J3HC 1A64A 1G84A 4LVEA 4PJIB 4PJFB 4P4KC 3MLWH 4FXKB 3TIDB 1MUJB 1CK0H 1P4LA 4LHUD 1XF4B 3CH8A 4QWWD 3O41A 5JXED 3WN5B 4KTEH 4NM4H 4N0RA 4NC1C 4W4OA 3U4BL 4XX1G 3U9UA 3O9WB 4ZO8A 5KW9L 2AABH 2VLLA 5GRUH 2VL4A 3U30B 1AR2A 4JFFE 3WMSA 3I6GB 3UAJC 3NACL 3I02A 1BZ9B 3L95A 1ITBB 1EZVY 3NCJL 1CDIA 5D71H 5EO1B 3AREB 1T66D 4ZPTA 1DBMH 4QRPB 5IK3A 2DQCH 1XH3A 5D2NC 2AS5M 4Y5YA 4HWBL 5DTFA 2OYPA 3EOBB 2X4SA 4AM0B 4MDJA 3T0EC 4RFEA 5D1QC 1Q9KB 4HGWB 4X5WA 4QCIA 2AJXH 5HGBA 4JFXB 1IC7H 2CDGB 4AIXA 5CSGA 5H37H 3JUYA 1UVQB 3W5NA 1IAOB 5J12B 4PJAA 2P24B 4Y5VA 3VA6A 1PEWA 1XGQB 5FYLH 5IW6A 3HPJB 2Z31B 2X4QA 3MREA 5IT2L 5J6HA 3DUSB 4JR9L 4IDJH 4N0CA 3C5ZB 4KKBD 3BDXA 5HY9B 4GRLA 4MJ5A 1U8KB 3CUPB 2UZIH 2WNGA 1OTSC 1N2RA 3LSOB 4OZFG 5J6GB 4CADA 1PVHA 2NTFB 3TVMD 3KS0J 4JZNA 2OTUB 5BS0E 2NY4C 1NGXB 2P43B 2VLME 3HB3C 1U8QB 2ZUTA 4X98A 1DUZA 1E27A 3OL2A 1WAAE 3WS6C 3TBVB 4LL9A 3FZUD 4KQ3H 3BMWA 3QEQB 5DEFB 1ZHKB 1UH3A 2IQ9H 3WEXA 2DQIL 4C4KO 2AQ3A 4CW1A 3ARBD 1FPTL 1OAXH 3QDGB 5I8KL 4DGVL 5TE4L 2ID5A 2YBRA 5DQDL 5CD5C 1DN0A 5EORH 3FO1A 3H9SE 5FYLD 5T33H 5HYQA 4K9EL 1YEDA 4UAOC 1G7LB 4LRNH 1G6RL 3EYFA 3L3KB 4G43A 4KI5F 5DWUH 4GW4B 4YHYC 5IB3B 3VXPA 5F88A 3QEUB 4KH2A 4GLRI 2E6JA 2B39A 1SEQH 4JLRA 1QLRB 1Q9LB 1A02N 5CMAA 2Q86B 1ZS8B 5HHOA 5E5UB 1UXSA 5IB2A 3ECBB 2WY3A 5DQJB 5C0GA 2CUIA 3CFDB 3MFFB 2BVEA 3WUWA 1U93B 4MXQC 2VUOA 2W59A 2WAHA 4KK5D 2BC4B 2N7BA 3I6KB 4QTHB 5E1HB 4M48H 3VGFA 4RAVB 4H88H 1QNZL 2Y6SD 3DWTA 3JTSA 4KMTH 5CJ5A 4WI5A 4M5ZH 5GRVK 2E5EA 4FQLH 4LBEA 4TUJB 3WL9A 5CEZE 1WAAF 3RVXD 3GSNL 4HH9A 4N0UB 2XPGA 2F74A 3B6SB 5C0FA 1FP5A 4EI5A 1GL4B 4M61A 4OLXH 4JY4A 3QIWD 3LEXA 5CGTA 3O4OC 4NO0D 1J0KA 4WI8A 3MRNB 1J0IA 3O41B 4PS4L 1Y6MR 3ZYOA 2PTTA 1KCSL 4NRXB 2MHAA 5GQBA 3CFEB 4PGBB 5C0BA 4ZNEA 3BPNC 2W0PA 3U9UB 3W0WE 2A9NL 43CAA 3OAUL 2VXSL 2VLLB 1R3HA 2DKMA 4LF3A 5DJCB 3VFGL 1RURL 4MA8H 3I02B 3L95B 1UWGL 1KTKE 3G5YB 2VN7A 1UZ8A 3LRSB 4ZPTB 1DUYB 4X6CA 5FF6A 4NDMA 2DN7A 4OCNC 5MEQA 5DTFB 4JY5L 3FO0L 2X4SB 1XCTA 4MDJB 5BRZD 1AGBA 3JV4B 4QKXB 4YC2C 2YZ8A 4K7PL 1D5MA 3QIBC 4L1HA 4QCIB 5HGBB 2HLFC 4N8CL 4R96A 2WP3O 4NBXB 4HS8H 4RNRA 3GI8H 5DD1H 3P9MB 3UO1L 4LPTA 2XNAB 2P8PB 4MJIE 4X4XA 3MRDA 4Y5VB 5JUEH 5E6IC 4MD0A 1GGCL 3TESA 4IRZH 5IW6B 4P9HH 4C4KT 4MAUL 1I8MA 1U92A 3SHSA 4D9QD 3TP4A 2EE3A 2WWMC 3MREB 5J6HB 2VITA 3LMJL 4OQTA 4P3DB 1E28B 1GGTA 5GIRA 1FIGL 4DKEH 4MJ5B 2JCCE 3KHQA 3MUHL 3OG6B 3RBGA 3UC0H 4ZAKD 1N2RB 4ELMA 2FECL 4PYHA 3QCVH 4OZGE 3S35X 1JYWA 4BZ2H 3MA7A 1F42A 4HGKC 1J11A 2PR4L 3L7EB 4FFWC 2DLGA 3RDTA 5E8PB 3ARYA 2AEIT 5MEPA 1KLGA 4BFIA 4L9DA 5I8OH 1I85C 3WEXB 3JTTB 1KCUL 2Q87A 1LDPH 1NCTA 4X8JB 4HWNA 3HTLX 4UTBH 5HVGB 3FT2A 1CGTA 1M1SA 3P30L 2VLKA 5BOZG 1DN0B 3FO1B 1WF5A 1KTDA 2W38A 1TQBC 1C8PA 3EYFB 2WSKA 4G43B 4XAWL 1ACYH 1ZXQA 3VXPB 5F88B 4NPYB 5TDPA 4F7PA 2RGSA 3CVIL 3KXFD 4E41E 2A6JA 4JLRB 4NNPH 1JTTA 1LO3H 1RUQL 4Y2OA 4F7TA 2QTEA 5IB2B 2VXVL 5C0GB 3FFCE 2N1KA 4DQOH 5K9KB 4U6HB 1IKFH 4R2GB 4KKCD 5C6WH 2VWEC 3RI5K 4CN4A 4NT6A 1NSNL 5HHPB 3MNZB 3WDJA 4CVXA 3O6ML 4BK5A 2DWEA 3F65A 3R8BB 4DGYH 3MRCA 3JTSB 3I50H 3SCMD 5IHZA 2PCPA 1HQRA 4JANA 3VFWB 2BNRD 3GBNH 3TPUA 4MXWL 4NNXA 5HD8C 4XXCA 2J4WL 2XPGB 4QGYA 1KBGL 5J89A 1MCBA 5C0FB 3HA0A 4EI5B 4YWGH 3QHTC 3T0BA 3LEXB 3QWRD 4LSDA 1TITA 1FZOA 1XGPA 5JA8B 1Q8MA 1QG3A 1WK0A 5BW7A 3EJZC 4J23A 4WI3A 4WFHE 1DL7L 2HKFH 1JGVL 4HIIB 2WP3T 4C56D 2I07B 5CIPH 5ISZB 1EZVX 1K6QL 5M95B 1A2YA 43CAB 3MR9A 4IHOA 2BVUA 4KROC 3VWKA 1ZVYA 3IYLW 3NIDF 1S7RA 4JPVH 4YDJB 3TYFA 2DQFA 5FB8B 1DEEA 1UZ8B 5GJTH 3V6ZA 3AMKA 1KCLA 3MLTA 4X6BA 4M8QA 5FF6B 5JQ6L 3PXHA 5FUZL 2CH8A 2I60H 2X89A 5MEQB 2F9BT 3B9VA 3LS4L 3VG9B 1AGBB 5T3XL 1WZMA 2VDLH 3HRZA 3DMMD 2NLJB 1D5MB 4Q7DA 3VFTA 4JFDD 1DE4A 2X10A 3N1QC 1WFOA 1G0DA 4PRIA 1JYXA 1VPOH 1DVFA 2E8ZA 3X3GH 5KSBF 5C0DA 3MRDB 1A4JB 1X3DA 1EJOL 2AJZA 4I3RL 5ICXB 1BD2A 3HI5L 1UG9A 1I8MB 1U92B 3HG1E 5D7LB 5ALCH 4DCQA 1F90H 3O11A 4UT6L 1J7VR 3WKMH 4A6YL 1VACB 3BIAX 4LFHG 1VERA 4OF0A 5I1JL 5GIRB 4DUXA 1MPAL 3ULUL 3VI3F 5DURB 1QFPA 4J4PA 1HSAA 4PREA 1DLHB 3HE7A 4ELMB 2CGRL 4XAKD 3MA7B 4M6NH 5CZKA 3LN9A 5F9OH 2EIDA 3RDTB 3QB7C 4YE4H 5GGVL 3DGGA 2EH7H 4EUPB 5LGHL 2XV6B 5MEPB 5CJBA 1PEZA 4BFIB 4RMRA 5CJQL 5C0CE 4Y1AD 5ALBH 2D9CA 1J8HE 4LOUD 1BVKB 3FT2B 2DQJH 1RSFA 5E2WL 4EVNB 2HJKB 3O2DA 1CD9B 4LLVB 1NCCH 1P84K 1CFVL 4GW1A 1WWWX 1NCBH 3V0WH 2AJUH 2R15A 1QSFA 3PWUA 4I48B 4PY8J 1LO5A 3U0PA 1ITCA 1IJ9A 4U1IA 2OXHA 1TJIH 4NKIH 5TDPB 1QFWI 2D03H 2B4CH 1INQA 1D6VL 1AP2A 3VXNA 5GZNC 3GSVA 2LU4A 2JJSA 4NZRH 3MRKA 1EEZB 1SJEA 4JM2F 4F7TB 4QOKA 3QXTA 3MRIA 4DWHA 2R69H 3DVFA 2BERA 5C07A 1MCWM 3VH8B 4S1DD 2A1WL 5GGSA 1YEIH 1A7OL 1KJ2A 1K8IB 1ZT1A 3WNMA 1MCJA 2QADC 4LLQB 3HMXL 2EECA 5GGRY 2ADFL 2Q20A 4NT6B 5JW3L 1Q72L 1IM9A 1MAML 2IADA 3IGAB 4LHUA 4HPYL 3OJ2C 5JXEA 4U6VL 1T6WA 4KAQL 4MLSA 3T0VA 3KHOA 4LKCA 3OZ9H 5IHZB 1RD6A 3FQTA 3BP5A 1CN4A 1ZLSH 4ZFFA 5D72H 4JB9L 3BQUB 3DURA 4U7MA 5D7JC 2Z8WC 3N9GL 5D93B 1S3KL 1XEDA 5DJ8B 3QPXH 3S36H 2V7NB 5ICYB 1OLZA 2EE6A 1MRFL 3W82A 4N5UA 4NSKA 1YQVH 4QRPE 4LHJB 3RVVD 1GGIL 1I9EA 4HQQL 4MMZC 4U1SA 4XVJL 2ORBH 3HNTH 3OAYH 3MNVB 3FQNA 4XNYL 2MPAH 1X5IA 1ZT7B 3OXSB 1B4JL 1JVKA 4OSUH 4FS0A 2B20A 4R4FL 1TZIB 3PGCA 1BQLL 3U0WL 3AAZA 1SYSB 1IZJA 4JHBA 1S5IH 3TYFB 3ZMRA 3N0PB 2DQFB 2HT3D 4TPRH 2Y4SA 1S9WA 5EO0B 2BCKA 5EC2A 3V6ZB 5HDQL 2FBOJ 3MLTB 4KC3B 4AG4L 3EO0B 4M8QB 1NLBH 4YR6B 1PBYA 1B90A 4JFZL 1KJVA 1YECL 3RWFA 4OI9A 1I8KA 3E3QA 3HRZB 3LKRA 3MODH 1CXLA 1S9VA 3VFTB 3MRFA 2QQNH 1AGFB 4OCXL 1HHGA 3TVMA 1WBXA 3B8YA 4PRIB 4IS6A 3WNLA 1G9MH 4ONHA 4OZHB 5FK9B 2XQYK 1X4ZA 2AJZB 1BD2B 3V6OA 1O7VA 3QEQE 4I18A 3ARBA 4I13B 3O11B 4UZGA 3SGEH 3QDGE 4BKLA 5JIHA 3MMEB 1NAMA 2KL6A 4WWKC 2W92A 1G7MB 1M71A 4PLJC 4HXAL 3GUTA 1CFTA 3FONA 1ZLWH 4NQEE 3WD5L 4ZD3H 4HFUH 4M5YH 5BXFA 5KVGL 2F5AH 3W11D 3N85H 1S5HA 2CMRL 4XTRC 4UNVA 3DGGB 5T5NG 3U6RB 1BQHB 2H2SD 1CTOA 4WTZA 3SDAA 3UBXG 4HXBL 4AK1A 3S4SA 1IFHL 3PQYB 4XBPA 3TFKA 5IBLC 4G3YL 3MJ7B 4FN0A 2VDQH 2E6QA 2X1OA 1FYHB 1NAKL 1P69B 2R8SH 1LEGA 3NIGF 1NBZA 1QSFB 1NLDH 1RZKC 3PWUB 1LO5B 4U1IB 1CE6B 2Y07H 2FWOA 1UM4H 3VXNB 3GSVB 3VFNA 5C9KA 3WFZA 1SJEB 1H3XA 3D69A 3MRIB 1WFTA 1VA9A 3QDJD 3TJEL 3SDXE 4N0UE 5C07B 1M6OA 5GGSB 4AEIL 4XXDB 1ZT1B 4HBCH 3U2SB 5F96L 1IM9B 4NJAH 3U9PH 2WBJB 3ESVF 5ITBH 4NZJA 2WMPA 4L4VD 4WWID 5FUCC 3SKNB 2Q8AH 5A3ID 1M7XA 1RHHA 3NZ8B 1LILA 2B1AH 5CEZL 1EO5A 4UQ3A 4LEXH 1FYTE 2IH1A 4OGAD 4BH7A 3VWJC 3DURB 2FR4B 2XZQL 4GRMA 3CLFL 1G7IA 5JOPD 4L4TD 4RMQA 2MFNA 3QQ3A 1V7NL 3QEGH 3REWA 5GRVL 1RZJL 1T3FB 1ROWA 3BGMA 1BBJA 2OI9C 5E8NA 4U1SB 1JYVA 4QWWC 1I3GL 2WK2A 4S2SA 4ZSOB 2Z92A 5CZXC 3DRQA 4P0DA 1Y18A 3CSGA 3DRTA 3MACL 1CBVL 3HPLA 1CCZA 2XG5A 4K23L 4ONFH 1BM3L 4KY1H 1NANI 1B0WA 3PGCB 2FEEL 4MX7A 3QQNA 1JHKL 4PJAE 3ZHDA 5GJSL 1V3JA 15C8H 4OZFH 1S9WB 1WWCA 5EC2B 4H25A 1T66C 4CBPA 1C08A 3QQ4A 2P49B 3RVWD 3ARXA 1KJVB 5E7BA 1NFDB 3CLEH 2X70B 5IMOB 4LCWA 4XWOC 4JZJB 3CFBA 3RGVC 4ZAKA 4X4YA 2X7LB 1BJ8A 1S9VB 3ZKXB 4U1NA 4MNGA 3P3YA 1I1FA 1NUGA 3IAQA 2YD3A 1NGWA 1ZTXH 4ONHB 2H32H 4FQCH 3OB0H 3GSWA 1A1MA 5JTWA 4OI7A 2JTDA 4XMPH 1I3UA 3SDCA 3MRPA 5J1SC 4UU9B 1ZMYA 4WY7L 1KACB 4BKLB 3W81A 1LP9F 2DWDA 4RGNE 1NAMB 3QIUD 4G7VH 4Y19E 4F8QA 1A7RH 1BWMA 1MRCL 4HWEH 3MGTA 3QAZB 3GKZA 1F4XL 3IETA 5B38B 5IMMA 5L2JB 4G6FB 3GGWA 1CFTB 4XCCH 3STZB 4MVBC 5BXFB 3DVNA 1GIGH 4GKNB 5L88L 2HG5A 4PRNA 4HAGA 5HHXH 4DUWA 5GGSY 1CICC 1IGYA 1O5DT 2IAND 3TCLB 1T1YA 3RAJH 3FZUC 2W0FA 3H7BA 1L0XA 2F19H 3RZCC 3SDAB 3QUYD 5HHOE 1QRND 1HKFA 3F5WA 1FC1A 3S4SB 4YHKL 4XVSH 3MRQA 4NQCD 5I73C 2V2WA 3FHQA 4DK6A 2ZCHH 3CX5K 4XBPB 4ZUTA 2EKJA 3PGFL 1IMHC 3MV9D 4K3HA 1NBZB 5EB9A 5I8CA 2IAMD 3DX9B 2YSSA 4JFOB 2JF1A 1KENL 2ZOLB 3BZDA 3GMRA 5GS3A 2FWOB 4GRWH 4EQ2A 2BNRA 3VFNB 4IBLT 4F9PC 2XRAL 3D69B 4JREC 3SO3B 4WW1A 1INDL 3V7AE 3A6CL 5EIVA 3EFDH 1KJ3L 5IM7A 5EOTA 4HW6A 5BMFL 2P42B 4KJWD 4NKMA 3GMPA 2OZ4L 5TH2A 3MUGA 3TH2T 4AT6A 1BVZA 3W9DA 1VESA 2OK0H 2M26A 2DQDH 4C56A 1R5WB 4S0TD 4PGCB 5B39B 2DD8H 2FHBA 3VFMA 4ZNEE 1WWAX 5C0BE 5K9JL 4UQ3B 4IRJD 5DJ0A 5DMIH 4DKDC 1JFQL 2IH1B 4BH7B 2XZCH 5AUMA 4ZS7L 4XPAH 3MXWL 3RVXC 1JUFA 1PKQB 4JFED 3WDIA 2NY2C 2DYPB 5KTEL 1K5NB 1FNFA 3IJYA 3QQ3B 4K3JL 5JQHC 3BEVA 4JRWA 3REWB 4X6CE 1RHFA 3FQWA 1L9MA 4PJGA 3QIWC 2GCYA 3BGMB 3R06A 2BSTB 1BBJB 4CNIB 5E8NB 1GCFA 1EHXA 1KEML 5C6TH 3SO5A 5EO9A 4ZDHA 2Z92B 3DRQB 2YA2A 3DRTB 2JLLA 3EYVB 1FNLA 4MNQE 1EGJL 5F9WC 4JO2H 4HUVA 4XP9H 4LVOC 2FL5B 4UTAH 5T3ZH 1CD1B 2XWTA 1RUMH 4URTB 2OQJA 1G9NH 1NGPH 3R0MA 4UDUB 5DDHA 2R2BA 5CIPA 4M62H 1PW3A 5IQ7L 2LQRA 1HZHL 2ZUQB 1C08B 3D0VA 5IF0A 1K9TA 2VXQH 5IKCB 2X44D 4OQ1A 2MCPH 1U91A 4LCWB 4YFLF 1RV6X 5SX4I 1A6TB 4YZFE 1I1FB 5K9OB 4ELME 3HZKA 1NGWB 4RMUA 1UM6H 3CK0H 3LDBB 2YUWA 4M7KL 2GI7A 5IVZA 2NZ9D 4LPWA 1P7HL 2YA1A 1E4JA 1BFSA 2ITCA 3CSPA 4XPTH 3ILQC 3HC0A 3SDCB 1D6EA 4Q6IA 1U2CA 3DLQR 1YYML 1OTUC 2QR0A 3DOSA 2R9HC 4X6CF 1GRWA 2MKLC 1I9RH 2D7PA 3WV0A 2VLKE 3MGTB 5IMMB 2ICWI 2E9BA 3HE6C 1W0VB 2UUDK 4IOFD 1T5WA 1RUKL 3DVNB 2HG5B 1I1YB 3IU3A 4M6MH 4FZEH 1IGYB 1J86A 4IEFB 5FUOH 4BZ1H 1T1YB 1JN6B 2W0FB 3H7BB 1N6QH 4YBLC 1W72H 2BVPA 5DRXA 4HIXL 1RUAL 3F5WB 1KIQB 1BJMA 4YUEL 2GJ6A 4U6TA 4QYOA 1Q9WB 2V2WB 3SDYL 2JELL 3F6IA 4NN6B 4KRPC 5DO2D 3UP1A 3INUH 3NCYP 3QEHA 4JDZA 3QDAA 4MXVE 1AD0A 2VR4A 4KDTA 4LAQH 3T0DA 5EZOL 4YZFF 2G9HA 4OF7A 3GMRB 1JNLL 1X4XA 1PKOA 2FSEA 5JLZA 2XA8L 2GYSA 5L7XH 3LD8C 3GIZH 3M1BA 3QRGL 1AHWC 2D31A 4ZOAA 3BO8B 1LWRA 3UMTA 4XP4L 3TPUE 1UQSB 5TQ0H 3EFFA 3RJQB 1GJIA 1QR1B 1D9KA 2LAAA 3GMPB 2DICA 3MRRA 1HEZA 3ME0A 4APQC 4MCYA 5TH2B 4IDLA 4KKNA 2EDLA 4KKCC 3QPQD 3TIEA 4DZ8A 2H6PB 4AT6B 1OTTD 4PJ5A 1HHKA 4DUVA 4ZUSA 2IGFH 4J3TA 1OT2A 4I77H 1IGML 1HIML 4Z7QE 4B7LA 3VFMB 2WUCL 3SCMC 3REVA 5CBEB 5LGJB 1D7FA 4Z8FL 1JPSH 3P0YL 1JTPA 1HYSC 1WZKA 1JZ4A 3F7PC 2EC8A 1HKLL 4RIRA 3FL7A 3IJYB 4PTTA 3IDYB 1K4DB 2UVEA 3BEVB 3V52H 2J8UA 4HF5H 2Z4QB 4WVRA 1NMAL 4L8SA 1IAIH 4PP1C 4JJHA 5EO9B 4ZDHB 2ATPA 1IC5H 1VFAB 3VXTB 1DP0A 4QRUA 4KHTL 4HUVB 4PRIE 1ORQA 3MV7E 2I24N 2AV1A 4GW5A 4OT1H 4G9FD 2J2ZA 4MLIA 2OQJB 4YFEA 1C7TA 3CVHA 1INEH 5DDHB 1BD2E 4QO1A 2OL3H 1JI1A 4NHCH 1S7VA 1ADQA 3FOLA 1L6XA 3WJLA 5D2LB 3K1DA 1NCDL 3SE3C 4I4WA 1ZAGA 5IF0B 5F7YC 4H8WL 1U91B 3MYJA 4YPJA 4WTXA 4G80B 1KB9J 4S1RH 3DMMC 1FLTX 2Y5TA 4PV9A 3HZKB 4R90H 4LCIL 3PIQB 1DEDA 2X41A 4C57C 1P9MC 4UDTA 5DJAB 3QWQB 4G6JH 1IGIH 5T1KD 1C12A 5ADPH 3GM8A 2ITCB 3ARFD 1OPGL 3L5HA 4H5SA 1TCRA 4O02H 3HC0B 3MLVH 4Z0BH 5JPNA 2YPVH 4GQ9L 5IWLC 3EW3B 1J0JA 4QXUL 1D6EB 2HN7A 4Q6IB 1JZ5A 3A67H 3RX5A 3LKOA 1HWGB 3FRUA 4MGXA 4NO3A 1XZ0A 3OKNA 2QR0B 4ZFOB 4Z7UB 4AIOA 1EHLL 2AXFB 4YDLC 4Z6AT 2D4FA 1S8DA 4XI5D 1GVIA 2BSRA 1T5WB 2VQ1A 1QSFE 2FX8H 1RVFH 3P73A 4NOBA 1OF2A 3T2NL 3JV0A 5ESQB 3MLPA 1TVBA 1I1CA 3H2WA 3U1SL 5CINL 3MRGA 4ZUWA 2QJDA 3O9WC 3ISWA 1A0QH 3GDBA 5DRXB 4QOKE 1DBKH 1UA6L 4RMVA 1WBYB 3MLSH 3U30C 4GG8A 4DTGL 4QYOB 3M17A 4EIGB 1FO0L 2NY3B 5HHNB 2RQ8A 1YY9C 5DJZA 3AREC 1FBIH 4JDZB 3QEHB 5GHWH 2IEPA 5D7IB 5TPWH 3JV6A 1AD0B 1P6AB 1E4XL 4KV5E 4P59H 2NXYB 1SVZA 2FX9H 1MFCH 4QHNA 4KJQD 1KPRA 3VXRA 4JQVA 2FSEB 5JLZB 1RZGB 1NGYA 4XPBL 5DK3A 1B0GA 5KANI 5IJKA 2D31B 2CK0H 3KPSD 1G1YA 4G8IA 3PWLA 2A77L 3QDMB 4L4TA 1RU9L 3EFFB 5F1NA 4S1DC 2ZUSA 1D9KB 4KQ4H 5F7DB 2Z93A 1KGCD 3QG6A 4H1LH 2RB8A 3JVGC 4MCYB 3T8XA 4EXPX 1B3JA 3TIEB 5I1EL 3NPSB 2VTFA 1HHKB 4PJ5B 2DQUH 4F7CB 3ZSSA 3ZT5A 3LEVH 5DD3L 4QF1A 3X3FH 4M02A 3REVB 4GLRH 1U8LA 4G6ML 5EBWA 2VSCA 1IEBB 1UB6A 3SDDB 1D5IL 3D9AL 3HNVH 2E7LA 4PTTB 3MLZL 3TYGH 3Q1SH 3VFSB 1MLBA 2VZVA 2KQMA 3W39A 3D39A 1XGYH 3WNKA 2CQVA 2DMCA 1S7WB 2Y25A 4L8SB 3P11L 2C4FU 3E3QE 2EH8H 3NFNA 5E6ZA 3HAEB 4MS8C 3GB7A 3S7GA 4YHOL 3EJYD 4N1CA 3QI9B 1TETL 1QA9A 3O4LB 3WO4C 3CVHB 4ODSL 2OTWA 2BZDA 4J8RB 3V6OE 3A0OA 4Q2ZA 5EOQH 3FOLB 3W2DL 4UOJA 1I9IH 4M4PA 5GRYA 3ZDZF 4I4WB 3QCTL 5INDA 4MHHG 4FTVD 2YRPA 3QIUA 3O3DA 3MRHA 3IRZA 5ACMA 3VGHA 2CLZA 5FYLE 1UGNA 3E0GA 4OZFA 3V4UL 1QHPA 2Y5TB 2GW5A 2NR6C 5JDSA 4FQJH 4YXLL 1OAKH 3BYYA 3HR5A 2R0LH 4H5SB 1TCRB 5CHNA 1AXIB 3WHXB 1BFTA 1OAYL 5JR1L 2C1OA 4DVRL 1I1AB 3WLBB 2IPTH 2HN7B 1V5JA 4Y4FD 4PRDA 1MJ8H 1P7QD 3FRUB 4NQCA 4FABL 4LARL 4BSVA 1XZ0B 3OKNB 1A7QL 3H3KA 1J12A 1NFIB 3MV9A 4OM0H 1H8NA 3BD4A 1S8DB 2C26A 2BY3A 4OFDA 3H6JA 1JNNH 5FM5O 2HKHH 3D85D 3P73B 1Q0YH 2K3TA 2ZCLL 1OF2B 4Z7NE 4L3EB 1G7PA 2IPUK 2WQ8A 1IGTA 1DQDL 2PW1B 3MRGB 4JO4H 4ZUWB 3P0VH 2H2SC 2R0WL 4JDTL 2DQGL 5HGDA 1BVLB 5L6YH 4YFLI 5AZEL 4GMSH 4UV4L 3KYOB 4P46D 3M17B 3L1OH 12E8L 1LO2H 1OW0A 3O8XD 1I8IA 2Y5EA 2J5LC 4OLWL 3CXDL 3BWAA 3JV6B 3CDGA 2FJGA 3BKJH 1WEJH 4QHUA 4UMGA 3SE4C 2VAAA 4QHNB 4PJ9A 3BEWA 1MCQA 3DROA 1KPRB 3VXRB 1NGYB 1NC2D 2NMSA 2DRUA 1B0GB 5C3TA 1YEJH 1QBML 1K85A 2Y7QA 2CKNA 2W9EH 1M7IB 2L4OA 2OS7A 2UWEA 1IILE 3ABZA 4FG6D 2VE6B 3HRPA 5J56B 4FZ8H 1TQCC 2X6MA 2ZCKH 3QG6B 3ETBF 4ZYKA 5IR1A 4M1DH 3C08L 1H8SA 3BGFB 2P5WA 5KG9B 3KPQB 3QUZD 4HK0A 3TT1L 5C1MB 4Z7WA 1EEYA 2AEQH 5F9AC 2GEEA 5T1MA 1J0ZA 3FQXA 5BZWB 3KG5A 3TNMA 1EFXA 4Z7NF 1N5AA 4DJMA 5EBWB 1JPGA 5FAAA 4JHWH 5IHUL 4OGAC 1KELL 1UWEL 3IRPX 5FA4B 4LDLB 2DI8A 5I2IB 1YPZE 3NA9L 4D9QE 4QRTA 1MLBB 5TQ2H 3GK8L 3W39B 4OM1H 2O5ZH 2X1XR 1OY3B 2EDDA 3FQUB 3L3JA 3RWHB 2C3XA 5C3LD 5E99L 4GSDL 1UB5A 4LCWE 4LSUH 4W6YB 2ZUXA 1MRDL 4WCYL 3BDYL 3NFNB 3CMOH 3GB7B 4MNGE 3ARGD 4LP4A 2FD6L 3K1KC 4PJDE 2O26U 3LS5L 4YEFA 1QA9B 4YDIL 5CJXA 1PFCA 1J9CT 4QXWA 3O3EA 3G6DH 4Y8DC 1CF8H 4LDOB 5IROC 2EKSA 4HV8A 1MCPH 2VDOH 4Q2ZB 1MY5A 1UZ6E 2ZZUT 1J05A 2FH6A 3C2AH 1SBSL 3G5XA 4ENED 1IBGH 1JWUA 1T4KA 3B5TA 2W07A 3O3DB 3RVWC 3ARRA 2AK4D 1HXYA 4NKDA 4OZFB 4HC1H 5ID0B 5EOCJ 4NYLB 3VXUB 4FFVC 4R2GC 1I3RA 4I1NB 5FHBL 5JDSB 4PR5A 3RL2B 3HR5B 3KXFE 4LRIA 4OIBA 1XF1A 3JWDL 3A6BH 3MJ6A 3O6FD 3EO1B 1JL8A 3G08B 2C1OB 5CP3A 1DDHB 4KTDL 3BIKB 1HNFA 1YPZF 4PRDB 4QLRA 4WENB 4WEBL 4X6DA 25C8L 4R8WH 3WNPA 1FZKA 2Z8RA 2E6PA 3VI4E 1S9YB 1R3LA 4RMWA 4EI5C 3QJFB 4LSRH 1UXWA 1JHLL 3D3VD 1N64H 3QZWG 3I9GL 2WW8A 4FFZL 1RIVH 4PJDF 4WHTA 2BNRE 1KNOB 2XTJD 3F7VA 1LO4H 3SKMA 5CD3B 4P2RA 5L9DH 2OMBA 5HYSG 1QEWA 3QUYC 2VDKH 4PLOB 4GAJL 4X6FA 3L7FA 1UZ6F 4KJPC 3C6LD 4K3EH 4XVTH 5EU4A 4W70A 1I8IB 2DLFL 2FRGP 5A2JH 3K4ZA 2BSSB 3CDGB 3QFJD 2GUOA 4KRLB 3MYZA 3ERYA 5E70A 4YX2H 4QTIL 2J88H 2XQYG 4GG6B 2AJVH 4PJ9B 3KYAA 4C56E 4P2OD 4PG2C 2XFXA 2FBJH 4N0FA 2BMKA 4G8GB 2PXYA 2W0LA 1S7SA 1AGCA 4PJ8A 3WIIH 5F6HJ 1SMOA 3HI1A 1ND0A 1WICA 4HLZH 4NWUL 2UWEB 1U3HD 2Y36H 3QNYB 1BPVA 1H0DA 1VFMA 2D7OA 4ZYKB 3CXHJ 3L5XL 5IR1B 4OLZH 4PJGE 4OLEA 4HK0B 1JK8B 3GBML 2NY5C 3TA3A 3TBSA 4JFDE 2C4FT 2KQNA 2DKUA 5D5MF 2DJSA 3ZTJG 2I5YL 3TNMB 1EFXB 1UWXH 1QFWH 1N5AB 5I0ZA 1JWSA 4WW2A 3RVUD 3M8OL 4DEPB 4G9FA 1NCWL 2MMXA 3LEYL 3HFMH 4RMTA 4PJ7F 4JHAH 3GHBH 1ZKAA 5FFLA 3TCXA 1J1PH 1PG7H 1HHJA 2QL1A 3SBWA 3TNNA 4U1GB 4TTDD 5I1CL 4X7DC 5F7KC 4NZTL 5ANMA 4WI2A 3DETD 4QXTB 3WIFA 4P4RA 1MI5D 1R24A 3C8HA 2QSCL 1X5XA 3RNQA 3OB8A 4AEEA 5IFJA 1MIEL 4N0YH 2FIRT 2VN4A 4IRSA 3KPOA 4XAKE 2X1WL 3Q5TA 3OKEA 5IEKB 4EI6B 5DHYA 3FO9A 5D8JL 5I1GH 1KCVH 1YJDL 1HXMA 2CD0A 1YYLH 4YK4B 1T0MB 2EKSB 4HV8B 5J4MA 2DQHH 2E9IA 4J6RL 4YFDB 5I16A 5L2KD 2A6IA 1T4KB 1A7PL 5CS7A 2G5BA 2YD5A 2VSDA 5KANG 4X7SL 4PJGF 3GJEB 5KJRL 5HYJB 1MCFA 1F58L 4P23B 3QXUA 4GBXD 2OL3A 4JM4L 4FXGB 1I3RB 4QRRB 1MH5B 5EN2A 1IAIM 3ARDD 4UIKH 1LO0H 4LMQI 2FJFA 3K2UL 4LSSH 3MLUH 4BH8A 3BPLB 2D7MA 5EU3B 1CL7H 5EIIB 4H26B 3RHWK 4RISL 4CKVX 2APXA 5E9DA 3BQUC 1U58B 4UILL 5B4MD 1WTGT 2GJ6E 3D6GA 4DAGH 1FZKB 3O2DL 1S7TA 4CDGC 3H9YA 4WUKH 2FX7L 4Y89A 3KLSA 1L7IH 2B7DT 1I7TA 5I1HL 3TWCL 3GM0A 4YO0B 5TDNA 5I9QB 4AQ1B 5C86A 3LZFL 3CNKA 1U8JB 3KR3H 1UXWB 3QH3A 4PJIF 5HI3D 2AJ3A 5BW7C 4E5XA 3F7VB 4MCZA 3KPSA 4P2RB 2BXZA 2CLVA 4N5EA 1QEWB 2L7JA 5DEZA 1QD0A 3L7FB 2XKUA 3FN0H 4KZEH 4WFED 1G7QB 1KJ2L 3LH2L 5HDOA 4H20H 4PUBH 4ZPVA 4J3OC 3SQBA 3TPKA 3V5DA 5I18L 5DO2C 3H9HB 4U05A 3IKKA 1GC1L 1N3NB 4PJ5E 5FA3B 3KPPA 1EIBA 3ZSTA 5DMGC 1T03H 2M1KA 3NN8A 1EBAA 2XFXB 3GMMA 4UBDD 4N0FB 2BMKB 2PXYB 1S7SB 1BHGA 1G7JB 1FN4A 3QA3A 4PJ8B 3B9KB 4CMHB 2XN9D 1MREL 3BE1H 3ZDXE 4N9OB 1CLCA 2FCBA 3GNML 1KF9B 2I25N 5GISL 2R4SL 4I3SH 1CGWA 3BT2L 5F1SA 2J8UE 2CRYA 4U1KA 5EZLA 3FJTA 1NKOA 3QPQC 2CRIA 1A14H 3TA3B 4KGJA 3WUWG 3TBSB 3JWNC 4W81A 4H1LA 3ROOB 5EU6B 1MSPA 2IPKB 4J4PC 3MLWL 4OBSA 5SWSA 3BXNB 3UTTD 1CK0L 1HDMA 1A4KA 2XI9A 4NOFA 5E6YA 4BJLA 5IOPA 4ODBD 1AFVH 3L5JA 1AO7B 5F70A 4MD5A 4LCCC 1HHJB 5AG8A 3EOTH 2BOCA 3DNKA 4ZNCD 4ZS6C 1LNUA 4FTVA 2AABL 4UIMA 5E7FA 1IVLA 5IB5B 4P4RB 5DJ2A 3PP4H 1R24B 5IJVA 5D71L 1DBML 3RNQB 2DQTH 5IFJB 2XACC 2W65B 4IRSB 4LQFH 2DQCL 3KPOB 2CDEA 3TT3L 2OR9H 2X2YA 3OKEB 2JB6B 2QQKH 1R3KA 3AVEA 5DHYB 3FO9B 1WISA 1HXMB 4X6EA 1A7NH 2AP2A 3QNZA 2AJXL 2IFGA 5D1ZD 1XMWA 4Y4FA 2WM0A 5I16B 5JHDD 4JQXA 3DV6B 2A6IB 3NOIA 1MHHA 4EZMA 1NDGA 4PLKD 2G5BB 4FMFA 2Q76A 4QT5A 5FYLL 5EG6C 3RY6C 4M1GH 1LVEA 5DFVD 1ZLWK 1MWAH 3SQOL 2ITDA 5EN2B 2WQRA 1DBAH 2VIRA 4JFQA 2WBJC 1GC1C 4IDJL 4F2MA 2FJFB 1MCHA 4Q6YA 1NANH 4S1SH 3ARFC 2J8HA 2UZIL 5KVDH 1P2CA 3QDJE 1T5XA 1IQWH 5C70A 4I3GA 1X5ZA 2E27H 4ODXB 3RWCA 4HMEA 1S7TB 1A6WH 2NY1D 3E2HA 2EYRA 1EH9A 3TN0D 4UINL 1I7TB 2GKIA 5TDNB 5KSUA 2EIBA 3R8QA 5GS0C 3PWPA 1LEKA 2AJSH 3S34H 4CN6A 1NC2A 2JIXD 5EORL 4E5XB 5T33L 4O9HH 1JGUH 4PJEF 4HKJA 4MCZB 3O45A 3IDMB 4XT1C 3FT3A 4LRNL 5DWUL 3S98A 2F58H 5ICZB 3TZVA 3EO9H 2ZG1A 5JOPE 5FECA 4L4TE 3L3IB 4CU8A 3DTXA 3TO2A 1A5FH 1SEQL 4XP1H 1WFUA 5IV2B 4R7NB 2HVKA 3L3HA 3VFVB 2HLAA 3G6AA 2VC2H 4H0IA 4YHPA 3QUZA 1YEHH 3KPPB 3NN8B 4JZJC 1G6RB 3GMMB 3FRPG 2EXYC 3S37L 3ZKXC 2ZNXA 2E7CA 1FN4B 1QZ1A 3LQAH 1QYGH 4LNRB 4M48L 5DJYA 4HWZA 4DGIL 4M7JH 4KMTL 2EEAA 4CVWA 3K8KA 2CO7B 4WNQA 4XNMA 4Z7VF 2E7LE 4M5ZL 4FQLL 4GH7B 1GXEA 1C5CL 2LE9A 5DUBB 4MYWB 5FM8A 3D39E 4JHZA 1VB9A 2YD6A 4PY8I 5EUKB 5E5MA 5C92A 2HMIC 4WV1B 1CGXA 5ESVA 3ARGA 3QAZC 4OLXL 3QNXB 5FKAB 3MBXL 4M93B 4O5LH 4WTWA 5SWSB 4HS6A 2XIDA 1A4KB 5IOPB 2HTLD 4F9LC 1BOYA 4MD5B 3N1FC 5F93C 3GSNB 1Z3GH 1IAKA 1UJTA 2BOCB 2VDPH 4KRNA 1OAQH 4OFYD 5J1AA 4UIMB 5MHSD 5CWSA 3VXQA 3P77A 2FHFA 5DRNB 1VFOA 4MAYD 5DJ2B 3WJJC 4XMKH 1MCRA 1T2QL 2G60H 1OAUH 1DCLA 1NUDA 4TQEH 2PN5A 1T1WB 4JRYA 3OB0K 2BNQB 3EJYC 1R3KB 2NY0B 2ADJA 4HCRH 4X5LA 4OBRA 3DI3B 3BWUC 4PJBA 4PRPD 4X6EB 5FO7A 4E42A 5C0AA 4EN3B 2IANE 2BRQA 2WWKT 2CO6B 4AENB 5D9SA 1HNGA 1OSPH 3VRIA 4YDKH 3EGSA 5BV7B 4HS8L 3B2UD 1MHHB 3GI8L 3SO3C 5DD1L 1BX2B 4NQCE 5ERWA 1NDGB 4JKWA 3ZL4H 5K9QG 2GTZA 5JUEL 4NCDA 4QT5B 4IRZL 3MV9E 4P9HL 4LSPL 1EVUA 2OSLB 5F7MC 5HHQA 2F54D 4LKXA 1F4YH 1L0YA 4F2MB 4LVHB 4F58H 3KJ4B 2GJZA 4DKEL 5JXAH 4HC1A 4FQHA 3UC0L 3O6LH 5DC4B 3UBXB 3C5SB 1E6OH 3QCVL 5LVEA 4JPWL 3T65A 4BZ2L 3PE9A 2WLYA 3MRMA 3C6LA 2X42A 5JW4Q 4PGDB 3D87B 43C9A 3S96A 4A6YA 5I8OL 4OB5H 3CPLB 3UTSD 3QFJA 5KSUB 1LDPL 3CH1A 1A1OB 5JIPA 3I75B 3KWWA 2RIKA 1SJHA 4OUUB 2P5EB 1MQKH 5SX4H 3PWPB 5C2UB 4P2OA 1YNLH 5DD5H 5TE6L 2FEDD 4CVUA 3KYMA 3O45B 4S10A 5T5FH 1S7XA 3L3OA 3FT3B 1GOFA 2ENSA 1HH9B 4OF3A 4DFIA 2YD4A 5DI8B 3DI2B 3TZVB 1QVOA 4RGOH 3SY0B 5KVEL 1N4XL 2UWEE 1UENA 5FV1L 1GSMA 4GRWE 3DVIA 4K94L 4NNPL 5HHMD 2J1KA 2CJUH 4TVPH 3AY4A 2HVKB 3L3HB 1LO3L 2HLAB 2R0ZH 1DQLH 1CFBA 4YHPB 2FJHA 2W60A 2P5WE 3I2CH 2MJWA 2WLZA 3MSPA 3L3DB 5F8QC 2HFFB 1BQUA 2QLVB 4Z7WE 4DQOL 2YMXH 4P23D 5CEXA 1IKFL 1B2WH 3HUJB 4Z0XA 4WO4B 1WIUA 3LDBC 4JZOA 4DGYL 5B8CC 3Q6GH 1XF3A 2H3NB 5A40E 2ED8A 1HQ4B 3I50L 4FG6C 3LN4A 4WNQB 4XNMB 1BJ1J 3GEWB 3KLHD 3SDCC 5EA0L 4RFNB 1KYOJ 5C0RH 1QSED 3BPOB 3GSRA 4P4KD 8FABA 1AC0A 4YWGL 5CSBA 3O0RH 2C5DC 1I9JH 4LHUG 4DKFH 2YK1H 2HRPH 3IB4A 4HSQA 4MZ2A 2VL5A 3U46A 3IFNH 3BKYH 4R0LC 5F72S 4ODWA 3TJHD 5I17A 2ZNWA 4XP5H 3MLXH 3VD9A 3K46A 4GRWF 4PPTA 5T3ZE 1XCQB 3P77B 4JPVL 4K7PY 1V3LA 4LCUB 1TVHB 4M1CC 4IMKA 2X4PA 4NN6C 4YGAB 5GJTL 1MFDH 4M7ZC 3U4EA 3T0ED 3MFGB 4JRYB 5JW4R 4YHIA 3BSZH 4TYUA 5DQ9A 5AYQA 2ADJB 4LAJH 4L3CA 5JOFA 3H42H 3LQMA 2VDLL 1QQDA 4XCEA 5C0AB 4MJ6A 5D9SB 1QFWM 1KFAH 1F45A 1NBVH 4OCLC 4TRPH 1FZJA 1VPOL 2EDEA 4G42A 1PG7W 5ERWB 2Q7YA 1PLGH 3EZ8A 4X6DE 5ECJE 4XNUH 3NGBC 3X17A 3PL6D 3T4YB 1N5YH 4AZ8A 4Y8AA 5ALCL 1F90L 1R5VB 4ZXBB 2AXJA 1OTSD 2FGZA 1PY4A 4I9WD 5FGSA 3VXMB 1DFBL 5LG1A 3HB3D 3E6HB 2LU3A 4XWGH 4P2RE 3H7LA 3V6BR 3ARWA 4M6NL 3DPBA 4JO1H 1WZ1H 5DC9B 1WC7A 4WUUD 5F9OL 4YE4L 5FO8A 4M7LH 3D25A 1J10A 5JA9A 4A6YB 5H37G 3IDYC 5ALBL 1TTGA 3CH1B 3MV8D 5IW3A 5CD5D 3KWWB 4LGPB 2VERN 5EIQA 1TCMA 2DQJL 2R1YA 2ADGA 1A8JH 4MJ4A 3MRJA 5GRXG 3QHZH 4LSVH 1NCCL 1RZ8A 1NCBL 1S7XB 5KSVB 2XTJC 1F3DH 3V0WL 2AJUL 4N9GB 3OKMB 4X9BA 4X9IA 1WUNT 5HDLA 5T1LD 1OD7A 3KGRA 1TJIL 4NKIL 3G6JB 2B4CL 1MJJB 4JR9H 2ARJA 2CUMA 4WTZG 3N06B 4NZRL 4Y4HB 5C0ND 1LDSA 4X6DF 2PYEB 5DSCA 3B9EA 4TUKH 4RFOH 2FJHB 2R69L 4JRXB 7CGTA 3PABA 3DYMA 1KT2A 4MXQD 3BDBA 1YEIL 5CEXB 3DYOA 4Y7MA 4LPVA 1ODAA 1N8ZA 3DX8A 4ZTPH 3P2TA 3UTTA 4L1DA 3ZDYE 1KB5H 4G9FE 1P6FA 2AEPH 2BJMH 1RMFH 4POYA 3OZ9L 4WJ5B 4OZHF 1U3HC 4G7YH 4NQDB 1JTOA 1WT5C 1JNHA 1H3VA 1F13A 3PHQB 1ZLSL 1R6VA 1T2JA 5D72L 4PRHD 3KDMB 5ANME 1OM3H 4HBQA 4XB8A 1Z9SA 4HUWA 3T2PA 3IF1B 3QPXL 2IPUG 3S36L 8FABB 5IB4A 1TFHA 1ZHBA 3ZT6A 2A83B 4YH6A 1H15B 1YQVL 1YDPA 3QQ9C 1GHFL 2V9TA 1UJ3B 4JEGB 4Y88A 2ORBL 3CVHL 3HNTL 4D0DB 1H3PL 1WCBB 4WEUD 3BZFA 5D1ZA 3QT2A 4TNWF 1F97A 2MPAL 3CD4A 3RA7H 4YDVB 4OSUL 1QLEL 5EU5B 1MCKA 4RA0C 4UB0H 3DETC 3SGEI 5AEAA 4KPHH 3BN9C 1S5IL 5IVXE 5SV4A 2DDQH 4TPRL 2QSVA 3QFDA 1LE9A 1JRHI 3B2VH 2X4PB 2NY3C 4ZO6A 3U4EB 1NLBL 5DK0B 4L8CA 2DIAA 5DQ9B 2NXYC 2HLFD 4OLVH 4L3CB 5I1DB 1QQDB 5J13C 4WW2F 3MODL 3NFPA 2QQNL 4BUGA 5LXGH 4BQ6A 4NQTA 5E6ID 3QUKA 2A2QT 5E9DE 3O2VH 1IZKA 2Q7YB 5DD6A 1F2QA 1KXVC 1YEKH 2P8LA 4FXLA 3TN0A 2R23A 3OTTA 3RY5A 3RJDA 1KPUA 3STLA 1D9KC 5CBAA 4FQQA 2R29H 3IXAB 2HP4A 3GSUA 3QYCA 2WINA 1EHNA 4GBXC 3UJJL 1HH6A 4P5TB 5GGVY 2CUHA 3NPSC 4TNVF 2A9NH 1H5BC 2JIXA 3P4NB 4L4JA 3S88L 4FP8H 3PXJA 2C9AA 2R1XB 3BI9X 4FFWD 2BX5A 1MWAA 2NNAB 3KPSE 1XIWB 4MJIA 4EOWH 3OKDA 1B0RA 4ZD3L 4HFUL 4M5YL 3VE0A 2F5AL 5MEND 3SKJH 3N85L 3SDDC 1WC7B 3F7YB 5GGTH 1IKNC 2YA0A 2CLRA 3TV3H 1ZA3A 5IVXF 1X7QB 1YZZA 3ARZA 2ADGB 2GAZA 4JVUA 5I1AB 3B8SA 4RA3A 5BS0B 2VDQL 4O51B 4ZG1A 2R8SL 4JFPB 4YXHH 3G5ZA 1NLDL 5BZDB 3VG0H 3QI9C 3OKOA 2Y07L 2Z8SA 1UM4L 2X4OA 4LLYB 1NC4B 2YC1B 4LASH 4XPFH 1YNKH 3VXOA 3PABB 4DFHA 2EC9U 3H9SB 5E94B 1C5BL 2JKXA 1MFNA 2O5XH 5EU7E 4D9RD 1NFDF 1CS6A 4HBCL 1K4CA 3D1MC 3MJ8B 3OXRA 3UTZA 5GRZA 4NJAL 3U9PL 3ZYIA 5SWSE 4JJ5A 5ITBL 4ALAL 2APTA 2UZXB 1JNHB 3OMZA 5C9JA 4LEXL 1I1AC 1WVZA 4XH2B 3FFCA 3OGCA 3QXDB 4FTVE 3BRFA 5KSAA 3SE9H 5C09A 4XVUC 5L8KB 4XNZB 4N90D 1ED3A 1ONQA 3X14A 1O0VA 1UH2A 5HI5C 3RRQA 4PRPA 1S78D 4HKBB 5DMKA 5KSBA 1J5OH 4KROD 4ZQKB 1MNUL 4K7PX 1S9XA 3BZFB 1F3DJ 4Y2DB 3NCMA 1M05B 4ONFL 1J1XL 2FGWH 4OCMC 2NX5D 5FGBC 5JIKA 15C8L 2F54A 1LE9B 4O4YH 5IVNA 1CDGA 3CFCH 1XF2A 3T08A 4ODTH 5DXWA 1REIA 3NPZB 2EIZA 4L8CB 2A0LD 2H1PH 4Y4KA 5DVLA 3CLEL 1HYRC 1FL6B 2J8OA 2P46B 3U0TA 4RRPA 1ZGLA 2R2EB 4JQVC 3KNBA 3NFPB 5E08H 1Z5LB 1T0NA 5D7SH 2AK1H 2APFA 3QUKB 1OD9A 1R5IA 1LEIB 3CCHA 3IS1X 4FQCL 4HCRA 5DD6B 4PJXF 3UTSA 1KPUB 5DZNA 3STLB 1FAIH 4Z76A 5CBAB 4FQQB 3GSUB 4M6OH 1AQDA 5SWQA 1HH6B 2COQA 3DARA 1Q9OA 5EZIL 3BGFC 4U2ZA 1CZ8H 1E4KA 1PGRB 3PWPE 4X7EC 5I19H 1CLOH 1JYNA 4G7VL 1ZGLM 1A7RL 2IQAB 2MWCA 4HWEL 3VMNA 1SMAA 2P1YA 4MJIB 4XCCL 4JM2A 4XRCA 3W9EA 4M03A 3VE0B 1GIGL 3P4OA 2EO1A 5FOBA 3IFPA 3RTQD 3HG1A 5F3HA 5HHXL 2VXTH 5CGMA 5HHMA 6FABH 2NY1C 2CLRB 3RAJL 3RKDC 2F19L 3GJFA 3ZLQC 2JCCB 4XVSL 2YPKA 2GAZB 5F9JA 2ZCHL 1IT9H 4X7TA 2DLIA 1XGTB 5IMLB 2MQ3A 3OX8A 1MLCB 1EJOH 4RX4D 2BSED 5GZND 4NO2A 2L7UA 3LHPL 5L8LB 5J9PA 2PNDA 2YPLD 3OKOB 3UCRA 1NDMA 2X4OB 4L9LA 4MSWB 4Y16B 3H3PH 1J88A 2VKXA 2V2XB 4GO6B 3EFDL 3JBG7 1P4IH 4RCAA 3RBSA 1OGAA 5ID1A 4P2QD 2AQ2A 3QISA 3ULVC 1FCCA 1K4CB 3MBED 2NYYC 3OXRB 5AD0A 3UTZB 1JPST 4XNXH 5T3XD 2BHYA 4K7FA 4E41B 2ICWA 2ATKB 2OK0L 2IC2A 2OM5A 1OARL 3DO7A 2DKSA 1GH7A 2DD8L 4X4ME 3PNWA 1OP9A 3T3MF 5D7JD 5DMIL 3FFCB 5FO9A 3B9AA 5ETUA 2XZCL 2AK4E 2Q3ZA 4ORGB 5D2NA 5KSAB 5C09B 1DANT 3TBWA 3MNWA 5D1XB 4BA8A 4KK9D 1DQJB 1ED3B 1ONQB 4IOSD 3T0EA 4NN5B 3LVEA 5D1QA 35C8H 2BFVH 1CXHA 3UZQA 4BQ9A 1HE7A 3MJ9H 1D6VH 4JRYE 3OPZH 4PRBB 1FFOA 2IMNA 5BO1H 1GOGA 1AKJB 5DMKB 5C6TL 4PJBE 4WDIA 3GMOA 4HIHA 3RWEA 5GRJH 4OCWH 2ED9A 5C0AE 3DUUB 5AYUH 1H3UA 3UTQA 1A7OH 4KDVA 4JO2L 4XP9L 1CXEA 1RI8A 5T3ZL 4RZCB 1RUML 1TNNA 2H8PB 4EXKA 1MAMH 3NH7H 1G9NL 1NGPL 4HPYH 4MAYC 5DZLA 5I76A 4V1DD 1YY8A 3ET9F 4M62L 1T7VA 4ODHL 3ROLB 1XF2B 1SYVA 3AS2A 2J3SA 2UZYB 4FHBD 4LLDA 2EIZB 1XR8B 1UACH 2VXQL 3SE8H 4Y4KB 2XTLA 2MCPL 5EFIA 4HFWA 1AD9B 1X44A 4MQ7A 3RWDA 5IEHA 4YNYB 4PGEA 3HZVA 1DQQB 3IDNB 2GSIA 3FO2A 1SY6H 5F89B 5FKPA 1C16B 2FYYB 4LPCA 3WS6A 4CMMA 3CU7A 5E03A 1UM6L 1R5IB 3CK0L 3VA2C 4ETYA 4WUUA 3CCHB 2VO5A 2K1MA 5F71A 3GSQA 5M7QA 5MI0C 4S0UC 1IGCH 2PO6B 2DMBA 4XPTL 3BP6A 3T77A 4Z76B 1JZ2A 3E6FB 3MV8A 3FTGA 3TBYB 1BOGB 3QFJE 4XNQB 3RUGE 1HILB 1AQDB 4XBEH 5E4IA 3QHFH 4Y5XC 1MHCA 2M2DA 3QZWA 3L3GB 5SV3A 1RPQA 2DBLH 4QHMA 3WFDL 3CC5A 1A1NA 5TF1H 5D6CA 3RWIA 5HYSA 3QSKB 2HYMA 4JM2B 4PJBF 2N4IA 3MTRA 3P4OB 4DEPC 2B1HH 3HG1B 5F3HB 3ILPB 2DF3A 1B9ZA 4M6ML 4XGZA 4FZEL 3MUJA 5FUOL 4OFKA 4BZ1L 3P4MB 3HC4H 1N6QL 3GJFB 4U1GC 1CG9B 4AY0A 5IBLD 2ERJC 3SJVD 4MXQA 3LKNB 3V4VH 4JFHD 2ESVD 2BVOA 1ZEAH 3INUL 3NTCH 5GZOD 4NP4H 5F6IB 3PUCA 3DHMA 4NO2B 4LAQL 1TJGH 4L29B 2RAMA 5J9PB 4Q58C 5C0CB 3NIFF 1TPXB 2DL9A 1MCEA 4JFFD 1QO3B 4YK4C 5KN5B 5L7XL 4PRHA 3WFHA 2VMFA 1YEFH 3Q6FA 4JGMA 1HI6A 2E9JA 4OGYL 4Z9KB 5D2LF 1BEYL 5TQ0L 5A2KH 3ELAT 1YEEL 4S11A 3RUGF 5ID1B 4QY8A 2EDWA 5ENWA 2EDBA 1F00I 1UWXK 2CMRH 2FIKB 5EBMA 4P23C 1ZV5A 4NCC1 5AD0B 1RZ7L 4K7FB 5HJ3A 1H9VA 4KJYA 4OI8A 5DJXA 2IGFL 3DO7B 3DBXB 3QUXD 4I77L 4BQBA 1VGKB 3DXAD 3HKFA 3PNWB 5IQ9B 5AG9A 1BIIA 1E0OB 1TMCA 1KOAA 3F7QA 4OD1H 5FO9B 5ETUB 1KB5A 2NZIA 4U3CA 3V4PH 4JCLA 4F3FA 1JPSL 2IFFH 3TBWB 1QUNA 4KHXH 8CGTA 4NO5B 3S5LG 1R0AH 4G8FB 5D1QB 3V52L 4Z7UF 4ZFGH 1KN4L 4WU7A 3QIBA 2QKIA 4HF5L 4YJZL 2HTKC 3MO1B 5CZXD 2OJZH 2DBJA 3NCFB 1FFOB 4D0BB 1IAIL 1NGZA 1KLUA 3BGAA 1FYTA 4AIZA 4HIHB 3RWEB 1IC5L 3TJHC 3KPNB 4JVPA 2VLMD 5E6IA 3V6FA 4KFZC 1MCOH 4HMDA 1OAZH 4MNHB 3AROA 4IIQA 2DJ4A 4FQXD 2YEZA 1EAJA 1WIOA 5MEOA 4OT1L 1EA9C 3TBTA 1LP9A 1INEL 3JXAA 3MX0A 5I76B 2IH3A 1IM3A 2JK5A 2OL3L 4NHCL 1SYVB 4XWOD 3RGVD 4KI5E 2X4TA 5F7EH 5CEZH 5BVPH 2YD8A 2A6DA 5HSFA 5D7IF 2NY4B 5EFIB 5IEHB 3RWDB 4U1JB 5E1AA 4YHNA 3HZVB 1IGFH 2GSIB 4J3XA 4S1RL 5FKPB 4P2YA 3BKCL 4R90L 4CMMB 3QBTB 4PJ8C 1I85A 3B9KC 5MENA 1JGEA 4WFEE 3MZTA 1MHEB 4F37F 3IAPA 5ADPL 3O6KH 3FFDA 1DQTA 2EE2A 5TDOA 4O02L 3MLVL 4HZLB 3WSQH 4Z0BL 3PL6C 2VNCA 2YPVL 1EK3A 5F8RC 3ZE0F 4WIQA 3U36A 4ETQA 3A67L 2FLBT 4UAOB 4YHYB 2AV7A 5F1OB 4K23H 1MHCB 3QZWB 4XBGB 3IU4H 1AQKL 1NUFA 3A6OA 1SM3H 4MVBD 3U4AA 4JN2A 4OCYH 1PQZA 3IFOA 5HYSB 1M4KA 5GJSH 5DHVB 1CICD 2FX8L 1RVFL 9CGTA 3QULA 3U48A 5CEZD 4K2UH 3RZCD 2XWJA 4XGZB 2RFXA 3PJSB 4JVWA 4Y2DD 1DBBL 3SBWC 1EBPA 3Q3GA 1A0QL 5CJOH 4Y19A 1OP5H 3PDDA 1DBKL 4TOYH 4FQIH 4HD9A 5GGTA 2BVOB 3B3IA 4FNLL 4NQEB 3OJMB 2F53D 1FBIL 5TPWL 4IRSC 1P5VA 3DIFA 3D2UD 3UTTE 5DS8B 1T83C 1Q1JH 3W5MA 3VW3H 1MFCL 3W0WD 3ZE2F 3U7AA 4JY6A 3CAFA 4F7EA 5C0EB 3C60A 3WFHB 3KPRD 4Z18A 3Q6FB 4FRWA 5C0NC 1HI6B 2CK0L 3PP3H 5D96B 1FO0B 4MA3A 4F33A 5C08A 4HIEA 4MDIB 2NTSP 3LIZH 2NXZD 3L9RA 1MJ7H 4QY8B 4XC3H 4KQ4L 5ENWB 2HT2C 1JF5A 1FFNA 5EBMB 1FNGA 2ZJSH 2AQ1A 4F7MA 1NMBH 1JPFA 5GGUA 2VXUH 4NQSA 1MF2H 3NFSH 5HJ3B 4GS7B 2DQUL 5EC1A 5H94B 4HHAA 1L7TL 5GGQH 1LMKA 3C8KA 1T7WA 5A2IH 3LKPA 2MQCA 3X3FL 1T21B 3SDXB 3KLDA 1U95A 2NY2D 2W91A 3S35H 1IGJB 2NX5A 1A6UH 3HNVL 2VDRH 3OR7A 3Q1SL 4MQXC 1CFNA 1P4LB 4YC2B 3QIBB 4FFYH 3EYQC 4NQVA 5JNYA 1WSST 4V2CB 1QSZA 1NGZB 5HI4C 5F6HI 3WFEL 1INDH 4BM7A 1FYTB 4AIZB 4HUKB 1PD6A 4WFFD 2EH8L 4YBQC 5DRZA 2WANA 3AFLA 4IIQB 5BV7L 4UT7H 2VZOA 2OZ4H 5MEOB 4I0PD 5CZVH 1YMMA 5SWZA 1CE1H 5FCUH 5IK3B 1XH3B 4Y5YB 5EULV 2CRMA 2JK5B 2OXGA 5EOQL 1I9IL 2X4TB 4RFEB 3FB6A 3IVKA 1JHTA 3MUZ1 4MNQA 5E00A 4X5WB 4X5XA 5E1AB 4JO3H 4K9EC 4YHNB 5I30L 3KVQA 3UYRH 1MFAL 2AERT 4PJAB 3WCYA 1RZIA 1T04A 3ILQD 1JGEB 2NY6B 1OAKL 1F4WH 4GKZA 2Q8BH 2R0LL 4OFIA 2X4QB 3SGDI 1OTUD 4LCYA 1AR1C 2R9HD 2KZ1B 3U36B 2IPTL 4ETQB 4N1EA 1MJ8L 4GRLB 1TQBB 3HE6D 4CADB 4GXUN 4JN2B 4WV1C 3OSKA 4OM0L 3GHEH 4R26L 4JZNB 3LKSA 3LV3A 1SJXA 2EYTA 3IFOB 4X98B 1DUZB 3U7YH 1E27B 4J3WA 4M93C 2HKHL 1Q0YL 3QULB 4LK4A 2EDRA 4CW1B 2VLJD 3FOMA 4K71B 4JE4B 5CCKH 4JO4L 4PJHF 3P0VL 3SPVA 4RGNB 4HPOH 4Y19B 5L6YL 3N1GC 4KRPD 5ESAA 2YBRB 3I84A 4GMSL 2WIIA 4GQPH 4P2QA 4J1UA 5HYQB 1Q94A 1YEDB 3FRPA 1LO2L 4MA1B 5KOMC 3GSOA 1XFPA 3VJ6A 4WFHD 4XCYA 5FYKE 3BKJL 1FRGH 1WEJL 3O3BA 3AS1A 3NIDE 4HAFA 4R97C 2NY0C 1GGBH 5CMAB 3GMNA 3NVQA 5HHOB 4ERSH 3LQZA 3V5HA 1UXSB 4EN3C 3C60B 1U6AH 1CTNA 1YEJL 3F12A 3TO4A 1UADC 5T1DH 4MA3B 4F33B 5MHSE 1RAMA 2W9EL 2E7HA 2GT9A 4APQD 5IG7A 3GIVA 2IBBA 3L9RB 3WUWB 5F7HA