2CLYB

Subcomplex of the stator of bovine mitochondrial atp synthase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
KLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE B CHAIN, MITOCHONDRIAL
publication title On the Structure of the Stator of the Mitochondrial ATP Synthase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 36
structure length 120
sequence length 120
chains with identical sequence E
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2clyB00
2CLYB
chains in the Genus database with same CATH superfamily
3FBLA 4LMKA 1XDPA 1O3XA 1U5PA 3ANWB 5FYMA 3RIUA 2L8KA 5DJQC 4HFIA 5LP6E 4PFPA 2CRBA 2UXCT 2IDOB 2V8SV 3GA8A 2UXBT 4HEAA 3NBXX 3M3ZB 4ZI2D 3HR0A 3K8PC 3HI2A 2CXDA 2E8IA 2BKOA 2XY8B 3B5MA 2UXNB 4N78D 4UELA 2HPLA 2Q9QD 5FY0A 4X66T 1QSDA 3MKDA 1FEWA 4DMWA 4YHHT 4JV5T 4B3ST 4ZZCA 4QXHB 2XQ3A 2NWBA 3H3MA 5AQUB 2SPCA 4LF4T 3J7Yq 2JQQA 3Q5XA 5FNVE 4P0AA 1Z8UA 3P8CD 3V5SA 2IIUA 3QNUA 4DV4T 2KZ7B 3KBTA 3UUXB 3ZJ2A 4HWDA 4O2AE 4HKAA 1BR0A 3RC8A 2VK9A 2WU5A 4PJJA 5H6QB 2EHOC 2XTLA 2Q9QB 4UR9A 2X9YA 2WSSV 4GKKT 5CA1E 2VKJA 1G73A 2LM2A 4DR2T 2LSJA 3AEFA 4H9QC 2KINB 1I6ZA 4XZCA 3I0QA 1KNRA 4EZ4A 4HE8A 2L9QA 3A5XA 5CFBA 4U2ZA 3EUHA 2YN6A 3P4QA 5C8YE 3NRXA 5F8PA 4O8SA 1KFYA 4CN1A 4E7ZA 1OEDA 3AEDA 4K0UA 4Z8XA 3PE0A 5CB4E 3Q5EA 2V1DB 4LF9T 3AEGA 3ZT6A 2YU1A 2BS2A 5AQOB 4H63H 2X66A 4PK5A 1IAPA 5LXTE 5AQQB 3CX6B 1N36T 2NTYA 1UCUA 3KV9A 2HHHT 2KNDA 4H9NC 5E0OA 1LVKA 4WBNE 2WQYA 2ZM0A 5AFUL 2VVNA 2WP9A 4ZI3D 3RKOA 1OEDB 3LJCA 4F6RC 4JYAT 1ZHCA 5AQPB 4EYUA 2RA1A 3AAIA 4Q25A 3HKEE 4G2AA 4LF5T 2CLYC 4TUYE 5LNKA 2D9DA 4CXYA 4XAXB 4HFCA 3T1HT 2BBJA 1N34T 4NPPA 3UUBA 2IAKA 2WS3A 1KNZA 4GYSA 3SRZA 3M65A 3AB3B 1YW0A 4EB6E 4HWFA 3ONJA 3C4WA 1MNEA 3ZN0B 2WDVA 3ZC1A 4UV9B 4K0KT 2NW8A 4AQFA 3C4ZA 4U33A 4ZI7E 2YKSA 4UVBB 3PUSA 2CCQA 3OBVE 4JUYA 4KMCA 5BR8T 3MJXA 1VOMA 3LK2B 4O4HE 5FMNA 5LBMA 5LGNB 3EHZA 5EK4A 4DMVA 4NXNT 3ZMVB 5JRCA 2H7OA 2OV9A 4GOUA 3KV4A 2BVMA 2CWOA 1T7SA 3F31A 2V6XA 3PTRB 3AE6A 1UX4A 3ZMUB 4TWFA 1N32T 3AE8A 3C4XA 3AEAA 5BMVE 1UGOA 4WNKA 2QGSA 3JC6C 2CHNA 3ZYKA 3MZKB 4IDZA 4PK6A 1X79A 2A3DA 4YXDA 4KI0F 4LFCT 4QXCB 2LSGA 4H9OC 4NUUA 4YTPA 3V5UA 4IE5A 5FY1A 2W67A 2LOSA 1SUMB 4TWHA 4QH1A 5AQHB 3AE7A 4JI2T 5HWYA 3SOLA 1J5ET 4X1YE 2I6HA 3IF8B 4B6XA 3SS1A 4CI3B 1JNRA 1KEYA 2H7VC 4DR6T 2WAUA 2XM1A 4HFHA 4ZZBA 3RRWA 1HTJF 4OYKA 1WCRA 2UXDT 1XMQT 2UUAT 1D1CA 5L4EA 3EI0A 4IT4A 1CUNA 3EAMA 4DR5T 1UK5A 3RC3A 3RF1A 4U7IA 4YT0A 3RIFA 2D0UA 4KP3C 2J62A 3K3OA 5KXJA 5FY7A 3NKZA 2ZM6T 4ISSA 4YY3T 2CXFA 2LSKA 3IEEA 3CPZA 2V26A 1WR0A 2BBHA 4GK5E 3P50A 4GKJT 4U2YA 4WZXA 3HL6A 1WR6A 3AAEB 4DNDA 2W2UA 2WU2A 1XDOA 4EYYR 4X20E 3P4SA 4X65T 3RYFE 3N9NA 1OXZA 1QUUA 2DNXA 2YINA 3L3PA 1HNXT 2AE9A 1LKXA 4ZI3C 2LEHA 4YHJA 4IGUA 4LF7T 1OEDE 5ADXL 5KMGP 2XQ7A 4JI8T 5LJNA 5AQMB 3UUNA 2PJQA 5KDMC 5ABFA 4QH5A 2HH7A 4X62T 2BKPA 1MIWA 3L8RA 4DIDB 2XAQB 4CI2B 2JMHA 2V6YA 3LDQB 3AECA 4B3TT 3K3QC 2MAWA 4BJNA 4DV0T 2HN1A 4A5XA 5FXZA 3HKDE 2CXLA 2IHR1 3PURA 4XBFB 5DQWA 1YD8G 3UULA 4YSXA 4A97A 4C91A 2WY2A 1B7TA 4DR4T 3D0TA 3T8OA 2NTXA 5TAOA 1IZNB 2FUPA 2LM9A 2K5BB 3BQLA 3SFEA 3AXJB 2WDRA 5LOVE 1MIYA 4FI5A 3CQCB 3OYZA 2V6YB 5FVLA 1KF6A 3ZYMA 1Y01A 5LB7B 4JI0T 2LKGA 5J0ZA 3PU3A 2X0HA 1G8XA 3RIAA 1GQEA 4OYJA 1I94T 4UF0A 1D0ZA 2C5JA 3SFDA 4EIWA 3O9XA 3O1HA 1T72A 5ETWA 3L39A 2QA7A 4ZOLE 2LKHA 4LFAT 2CBIA 2UXXB 4U31A 2FJBA 4KX6A 1L0VA 3RRCA 2LJLA 1J1JA 5EZYE 3KDSE 2FJDA 3UFGA 3OTOT 4IE7A 1WYBA 4IE6A 1MMNA 3RI5A 3PUWF 2PFVA 4UIGA 3C64A 3ZCJA 2F4VT 3NRYA 4AI6A 3IBPA 3ZN1B 1MMDA 1HF8A 4UEMA 2WBLA 2MTQA 2E9XA 1BR2A 3N2KE 2BG9C 4CZZB 2CM0A 2DLRA 4Z90A 4QH4A 3LG7A 2YDRA 3JCFA 5FXVA 3A8YC 3QC9A 4YLHA 5FL1A 5JDMA 3DJBA 4IE4A 1OWAA 3UQ7A 5HXCA 3ESLA 3QUJA 2UU9T 1VCTA 2XJ7A 2E9XB 3ZYLA 1SE7A 2L3LA 1UUSA 5AQVB 1XNRT 2D2SA 4CN4A 3CK6A 3W15B 2VQFT 2JQKA 3N9MA 5L3GB 3FXDB 3AA7B 3WAKA 5AQFB 3UU6A 3RYHE 4DR3T 5EK3A 3RPUA 4MLKA 5FL0A 5A1LA 3CIRA 3RYCE 1SHZC 3PV0F 2CE7A 4UVCB 1VCSA 2R6GF 2WMOA 5HEGA 5JR9A 3TLUA 3C51A 5HXSA 2WWUA 2XSBA 4IDOA 4F8HA 2I59A 3KVAA 2D5UA 2LOPA 3N5LA 4LF8T 4DV6T 3FZHB 2M6BA 4IREA 2XASB 4ILUA 2C0SA 2ZLYA 2W0GA 2X9HA 3K1SA 4H9RC 3VKGA 1N33T 2RP4A 5JDNA 1ZKEA 4P09A 3K3NA 1D0YA 4TX5A 3UQ4A 3U3IA 4AQGA 3J9X1 5C3JA 2XZEA 5C2TA 4OK0A 4CQIA 3ABVA 1T8BA 2Z6EA 1Z0PA 3NVOA 3PUQA 4J2CA 3AA1B 3VU7H 3FZFB 2ACXA 5L4HA 2MBGA 2LT3A 4AXPA 3HKBE 3AEEA 5L3BB 2XQ4A 3T1YT 2W66A 3ZSTA 2BS3A 2XQ8A 1LRZA 4ANJA 2XM2A 2KXPB 2KMFA 1IJ5A 4DBRA 3TLVA 4DUYT 4AKIA 3X1DA 3PU8A 5L47A 3NZPA 4OHFA 2JQHA 2H89A 5ABHA 2PG8A 2K24A 2FBWA 3R84B 1XMOT 4BJMA 2X9WA 3RYIE 2DI4A 4HWHA 3RIUC 4HTEA 4UVAB 4JEHB 3AE4A 1Y64B 4ADZA 1US7B 4CN6A 2A9UA 1KNPA 5AQNB 3LK3B 4ILCA 4ZI2C 3EABA 2JPFA 4AKGA 3N9OA 4DV1T 2BS4A 2VKHA 4NUVA 3CKDA 2Q9QC 4LFBT 5JRCB 3UU8A 1W0AA 4O2BE 5HCJA 2V5DA 5L3CB 4PK4A 3UU5A 3G06A 2BVLA 2K3WA 1MMAA 1CHUA 4COFA 2JIWA 5LHHB 4I43B 2NW7A 4DV2T 3JADA 2V7IA 4QX8B 2LSYA 1YQ3A 5JDFA 5CJ5A 2WZHA 3P7IA 4JI6T 2W63A 1SA0E 3ZPOA 3EDVA 5IHYA 3QB5A 1UX5A 2CWYA 4JI4T 2X9XA 3O1JA 2N2NA 3CVRA 2QRXA 3OYXA 2JRKA 1YKEB 4DV5T 4B3MT 3HKCE 3RQUA 3UU4A 2WDQA 4DR7T 3KV6A 4PW8A 5FP3A 3Q5WA 2KSRA 5H6RB 3AA6B 1W09A 2CHOA 2ACZA 1OEDC 1FMWA 3FZLB 3VKHA 1YQ4A 1KK7A 2EHOA 4H9PC 2RPAA 1IBLT 3O4XE 1HNWT 4HWIB 4YTNA 2N1GA 4AKHA 2JJ9A 2A2FX 3RQWA 5HXRA 3KFWX 2V7KA 2CBJA 4JEUB 2ZM8A 3AA0B 1FMVA 1XZYA 2NR4A 3RX6A 2IMLA 3FXEB 5DABA 5L2LA 3KVBA 3DTOA 5HCMA 2EHOB 2UUCT 4Z91A 2VURA 4TNWA 1FJGT 2JQ9A 5HAXA 2M67A 1HNZT 4JI7T 4LMJA 4H63V 4O4IE 4HFDA 2DHRA 3OJAA 2KT9A 2XUEA 3FHNA 2W62A 2E5VA 3B57A 3TKLB 4IE0A 4AQYT 3ZT5A 4IL9A 4CI1B 4PJLA 4WBOA 5JDHA 3N9LA 1BR4A 4QKNA 1HCIA 1W9RA 2V7LA 5HXHA 3C50A 2IW5B 3NWIA 4ILAA 2YDQA 3GWHA 1U4QA 5LMNT 1NAFA 3F57A 3UTKA 4AQFC 3ONXA 5L3FB 1YKHB 4QWNB 4I0UA 5ABFB 5LG3A 3AAAB 4PNIA 4EAHA 2YK0A 2E5LT 2VQET 4YJ2E 5LA6E 2W61A 1IBMT 4PJNA 3LBXA 4IHJE 2WCAA 3IA3A 4GK0E 4KBMB 3ANWA 5F5WA 5HEOA 4PAGA 4MFRA 3LK42 4HFVA 5KX5E 2G0UA 2ZMAA 4EXTA 3RLFF 2XQ6A 1M7KA 2CLYB 5M4YA 4ZS3A 1IBKT 2IUBA 4O4JE 1D1BA 2WM9A 3UU3A 2LRKA 3LBXB 3RKGA 3ONLC 3Q2MA 1HR0T 5LBQB 4UF0B 1R8IA 1NENA 2Y6XA 2ES0A 1T98A 3O1IA 2AXDS 2E9XD 4WYVA 2LHRA 3JC6D 2OLTA 3CQXC 2XQ5A 2V7JA 1E7PA 3ZSSA 4IDQA 3AE2A 2WWVA 2IC9A 4ZXLA 2YU2A 3PUXF 3N2OA 4TV8E 3CX8B 2Q9QA 5LCYA 2P9BA 2N9DA 3RH3A 2KWIB 2LSIA 4EEDA 4L5GA 2XSAA 1D1AA 2H3RA 2X68A 3FBZA 2LE8A 4MBQA 3H3AA 4AKRB 4JLEA 3MACA 4U7YA 3BQIA 3PJAA 1V9DA 3FZMB 2BZBA 2DCFA 2FJEA 3OKQA 2MYSA 3PUZF 5HEJA 2C5IT 4EGWA 4HGAA 5AQSB 2DWKA 2HPJA 5GONE 3PUVF 4C90A 2BG9E 5DQVA 5IWAT 3PDYA 4E7SA 5JVDE 4DV3T 1XWMA 2VKDA 5AQLB 3BK9A 2QVAA 4HFEA 2V5CA 1J5WA 4X1IE 3IHRA 3RGLA 2KWHA 1W0BA 2OA5A 2VVSA 2YOEA 3PJAJ 2CEAA 3N2GE 2XQ9A 1QLBA 4EEBA 4HFBA 2CMRA 2XQYA 5HEHA 2KLQA 5J2UE 3TLWA 5JH7E 4V1Av 4ILBA 2LLYA 5AQKB 2M6IA 3R6NA 2D0TA 3PUYF 1VRBA 4DV7T 4ISTA 4WW0A 5JR9B 4MALA 3BQKA 2QYWA 4KHPT 2K48A 4U3CA 2X51A 4AISA 3ZCIA 5L3DB 4O4LE 3EDUA 4YJ3E 3RHWA 2JMKA 5JDLA 1S35A 2XPKA 4DO0A 2XAHB 3I9YA 1DU2A 3MK7C 3F2EA 5FXXA 4KUMB 3ZMZB 3A7MA 2E2AA 3I1AA 2H88A 3MXZA 2IC6A 3FB2A 3AE5A 1FIOA 3CQGB 5J2TE 4EZHA 2XHEB 2WB5A 2W4XA 1X9BA 1HX1B 3Q9DA 4G63A 3ZEFB 2PBIA 2CPTA 1MIVA 3B13A 4MHCA 5HXEA 3LFMA 1E1HB 2XAGB 4IDPA 3ETUA 4TNVA 4DUZT 4NIQA 5JTGA 4TN7B 4CXWA 1WLXA 5LG4A 3ZMTB 4B3RT 2PTFA 3AE1A 4ASKA 1D0XA 2YEVC 3N9PA 1WYCA 5AQRB 1IJ6A 4H9SE 2J4GA 4PJMA 5HYAA 4ZS2A 2ODVA 4TWDA 4HN9A 2WMNA 4P0BA 4LF6T 1HG5A 5LHIB 2W00A 2E9XC 3P4WA 3H37A 3CMLA 2J47A 2B76A 4JI1T 2VWAA 5AQTB 4BA9A 3LSVA 1HG2A 2WZIA 4I55E 1H7CA 3JAEA 2K9AA 1MMGA 4L0RA 3VHLA 4IDNA 3Q5DA 3UFEA 2DWGA 3AVSA 5J1GA 1NEKA 2XAJB 3E0ZA 2MOZA 3CX7B 4YSZA 5HWXA 3QK6A 4PFOA 2MPKA 3VR8A 3FZKB 5JDGA 2B1EA 3ZC0A 4YSYA 2A72A 3E22E 3ETVA 4YTMA 2YDSA 4GYRA 2BKNA 3EVYA 5IUXA 2BG9A 3U78A 4GIWA 2V7MA 1WFDA 4P1NA 2GK9A 5AQGB 2LHNA 5ABGA 5L3EB 4X5TA 2BDEA 3S4UA 4ZEYA 1WRDA 3OPCA 3VRAA 4UXNB 2VL0A 1NWMX 3TLSA 1ZP0A 3CWZB 1E2AA 4CXXA 4X1KE 4U74A 4EOZB 4JI3T 3SWHA 2EHOD 4OFZA 2C5KT 5LMUT 5LHGB 5LGUB 3GN5A 4U72A 2BG9B 3VR9A 5JR9C 1UURA 2I0MA 3AE9A 3DP7A 1ZOYA 2CA5A 4AIUA 4DBQA 2UUBT 5FKYA 4EV6A 5IYZE 5EK2A 3NZQA 1HFAA 2NP9A 4FJOA 1EZ3A 4QX7B 5CGMA 5AQJB 3ZT7A 5JDQA 1LVFA 3N9QA 4TZ4C 3HA4A 4TV9E 5LYJE 3WAJA 4QXBB 3GMIA 3C98B 5LGTB 5FXWA 3WI3A 3GN5B 3I9WA 2J1DG 3P4PA 5JQGE 3UT5E 4BAYB 4YFSA 1MNDA 5FVKA 2XQAA 2DL1A 3VRBA 3E08A 4A98A 4KHZF 3L09A 4LMLA 2XAFB 3KV5A 2NW9A 2VL8A 1YXRA 2FJAA 4I4TE 1BR1A 3P4RA 3AXJA 3QOFA 3AE3A 5LJMA 4JBWF 4DVDA 2ZM2A 1JNZA 3ZJ1A 3TLTA 2HN2A 4ZHQE 3OVUA 4ERRA 4JI5T 1ZEEA 4UV8B 3KINB 4HWCA 3AVRA 3ZKRA 1S94A 2ODUA 4IIJE 5HEUA 2Y8DA 2Y48B 5F3JA 4L9IA 3ZMSB 4DR1T 1XNQT 4A56A 3AEBA 3ZLIA 5JREA 2NOXA 1ZV4X 2VASA 4NXMT 5ABEA 3PUAA 4OX9T 3PUGA 2VKOA 3UUMA 2X67A 1AJ3A 4AKLA 2X0LB 4M1PA 4X64T 3I0OA 1HX8A 3MA9A 2X0YA 5CA0E 5AQIB 2LRLA 3JAFA 4IL4A 2VB6A 4I50E 3QB5K 1HS7A 4QHOA 3KBUA 1M62A
chains in the Genus database with same CATH topology
3FBLA 3LK3B 2KWHA 4EYYR 4X20E 2OA5A 3RYFE 3N9NA 1O3XA 1U5PA 3ANWB 4ZI2C 1OXZA 5FYMA 1QUUA 2JPFA 2DNXA 2L8KA 4AKGA 5DJQC 3N9OA 2CEAA 2VKHA 3N2GE 5LP6E 2YINA 3L3PA 4NUVA 3CKDA 4PFPA 2Q9QC 2CMRA 1LKXA 4ZI3C 2XQYA 5JRCB 2LEHA 2KLQA 3GA8A 5J2UE 4HEAA 4YHJA 3NBXX 4O2BE 4IGUA 5JH7E 4V1Av 5L3CB 5ADXL 5KMGP 4ZI2D 4PK4A 3HR0A 3K8PC 3HI2A 2BVLA 2CXDA 1MMAA 2E8IA 3R6NA 2D0TA 5LJNA 2UXNB 4N78D 4UELA 4I43B 1VRBA 5LHHB 2NW7A 4ISTA 4WW0A 5JR9B 2HPLA 2Q9QD 5FY0A 4MALA 3UUNA 1QSDA 2PJQA 2V7IA 3BQKA 5KDMC 4QX8B 2LSYA 3MKDA 2HH7A 2K48A 5JDFA 1FEWA 2X51A 4DMWA 1MIWA 3ZCIA 5L3DB 4O4LE 3EDUA 3P7IA 4YJ3E 2JMKA 4QXHB 2XAQB 2NWBA 4CI2B 2JMHA 5JDLA 1S35A 2SPCA 3K3QC 3J7Yq 4DO0A 2JQQA 2W63A 1SA0E 3ZPOA 4BJNA 3Q5XA 3EDVA 5FNVE 2XAHB 4P0AA 3I9YA 3P8CD 5IHYA 3V5SA 1UX5A 5FXZA 2CWYA 3HKDE 2CXLA 3MK7C 3F2EA 2X9XA 3PURA 3O1JA 5FXXA 4XBFB 2KZ7B 2N2NA 3CVRA 3KBTA 4KUMB 1YD8G 5DQWA 3UUXB 3UULA 3ZMZB 3OYXA 3ZJ2A 4O2AE 2JRKA 4HKAA 1YKEB 1BR0A 3RC8A 3I1AA 2VK9A 4C91A 1B7TA 4PJJA 3HKCE 3D0TA 5H6QB 3MXZA 3T8OA 2NTXA 2EHOC 5TAOA 2XTLA 1IZNB 2IC6A 2Q9QB 3KV6A 2LM9A 2X9YA 2K5BB 3FB2A 1FIOA 3CQGB 4PW8A 4EZHA 5J2TE 2XHEB 3BQLA 2WSSV 5FP3A 5CA1E 3Q5WA 2VKJA 5LOVE 1MIYA 1G73A 4FI5A 3Q9DA 5H6RB 3CQCB 2LSJA 3OYZA 4G63A 3ZEFB 2PBIA 3ZYMA 4H9QC 3AA6B 2KINB 1MIVA 3B13A 1FMWA 4MHCA 4XZCA 3PU3A 3I0QA 5HXEA 1G8XA 3VKHA 3LFMA 1E1HB 2XAGB 4EZ4A 1KK7A 3ETUA 4HE8A 2EHOA 4OYJA 2L9QA 4H9PC 4TN7B 3A5XA 4CXWA 1WLXA 5LG4A 3ZMTB 4UF0A 1D0ZA 3O4XE 2C5JA 3EUHA 4EIWA 5C8YE 3NRXA 3O9XA 4ASKA 1D0XA 3O1HA 5F8PA 2YEVC 3N9PA 4O8SA 5ETWA 2N1GA 4E7ZA 4AKHA 1WYCA 2QA7A 2JJ9A 4ZOLE 2A2FX 4K0UA 4Z8XA 3PE0A 5CB4E 5HXRA 1IJ6A 4H9SE 3KFWX 4PJMA 2UXXB 5HYAA 2V1DB 4ZS2A 2ODVA 2V7KA 2YU1A 4H63H 3RRCA 4JEUB 2ZM8A 2LJLA 2X66A 3AA0B 4HN9A 2WMNA 4PK5A 1FMVA 1IAPA 5EZYE 3RX6A 4P0BA 1HG5A 3KDSE 5LHIB 5LXTE 3FXEB 4IE7A 1WYBA 4IE6A 5DABA 5L2LA 3KVBA 3CX6B 1MMNA 2W00A 2E9XC 3DTOA 2NTYA 3H37A 1UCUA 3CMLA 3KV9A 2VWAA 2EHOB 4BA9A 2PFVA 4UIGA 3C64A 2KNDA 1HG2A 4H9NC 5E0OA 5HAXA 2M67A 3ZCJA 4I55E 1H7CA 1LVKA 4WBNE 2ZM0A 5AFUL 1MMGA 2K9AA 3NRYA 4L0RA 4H63V 4AI6A 3IBPA 3ZN1B 4O4IE 1MMDA 3VHLA 1HF8A 2DHRA 3OJAA 4ZI3D 4UEMA 3RKOA 2KT9A 3LJCA 2WBLA 4F6RC 2XUEA 2MTQA 3FHNA 2W62A 2E9XA 1BR2A 1ZHCA 3N2KE 4EYUA 3UFEA 4CZZB 2CM0A 2RA1A 2DWGA 3B57A 3TKLB 4IE0A 3AVSA 3AAIA 2DLRA 5J1GA 2XAJB 3E0ZA 4CI1B 2MOZA 3CX7B 4PJLA 4WBOA 3LG7A 5JDHA 5HWXA 3HKEE 4G2AA 3N9LA 3QK6A 4PFOA 2CLYC 4TUYE 5JDGA 5LNKA 5FXVA 1BR4A 4QKNA 3QC9A 2B1EA 1HCIA 2V7LA 4CXYA 4XAXB 3C50A 2IW5B 2A72A 3E22E 3ETVA 5HXHA 3ZC0A 4GYRA 3GWHA 1U4QA 4YLHA 3EVYA 1NAFA 3F57A 5JDMA 3DJBA 4IE4A 3UTKA 4AQFC 3ONXA 2IAKA 1OWAA 3U78A 5L3FB 1YKHB 4GIWA 2V7MA 5HXCA 1KNZA 4GYSA 4QWNB 3SRZA 3ESLA 3AB3B 1YW0A 3M65A 3QUJA 4EB6E 2GK9A 3C4WA 2LHNA 5L3EB 1MNEA 3ZN0B 2BDEA 3S4UA 2E9XB 3AAAB 3ZYLA 1WRDA 4PNIA 2L3LA 4EAHA 3ZC1A 4UXNB 4UV9B 2D2SA 1NWMX 2YK0A 3CWZB 2NW8A 3W15B 4CXXA 4X1KE 4U74A 4EOZB 4AQFA 3C4ZA 3SWHA 3N9MA 4ZI7E 4UVBB 4YJ2E 5LA6E 2W61A 2EHOD 4OFZA 2C5KT 4PJNA 3LBXA 5L3GB 3PUSA 2CCQA 4IHJE 5LHGB 3FXDB 5LGUB 3AA7B 3OBVE 4GK0E 4JUYA 3WAKA 4KBMB 3ANWA 4KMCA 3GN5A 4U72A 4PAGA 3MJXA 4MFRA 3RYHE 1VOMA 3LK2B 5JR9C 4O4HE 3LK42 4HFVA 5FMNA 5KX5E 2G0UA 5EK3A 2ZMAA 5LBMA 5LGNB 3RPUA 5EK4A 4DMVA 3ZMVB 4EXTA 3DP7A 5JRCA 2H7OA 4MLKA 2CA5A 4DBQA 2CLYB 3KV4A 4GOUA 2BVMA 5M4YA 4ZS3A 5A1LA 5IYZE 5EK2A 2CWOA 3NZQA 3F31A 1HFAA 2NP9A 4FJOA 1EZ3A 3PTRB 3RYCE 4QX7B 1SHZC 1UX4A 4O4JE 2CE7A 4UVCB 3ZMUB 1D1BA 2WMOA 3C4XA 5JDQA 1LVFA 3N9QA 4TZ4C 5JR9A 2WM9A 3HA4A 5BMVE 4TV9E 3LBXB 4WNKA 2QGSA 3C51A 3JC6C 5HXSA 5LYJE 2WWUA 3WAJA 4QXBB 3GMIA 3C98B 3Q2MA 5FXWA 3ZYKA 5LGTB 3MZKB 2I59A 3KVAA 4IDZA 3GN5B 3WI3A 3I9WA 2D5UA 2J1DG 4PK6A 5LBQB 4UF0B 2LOPA 3N5LA 1X79A 5JQGE 2Y6XA 3UT5E 2ES0A 1T98A 2A3DA 4BAYB 3O1IA 2XASB 2E9XD 4ILUA 4QXCB 2LSGA 4H9OC 2LHRA 4NUUA 3JC6D 2C0SA 1MNDA 4YFSA 2ZLYA 2W0GA 3CQXC 2X9HA 3V5UA 2V7JA 4H9RC 4IE5A 5FY1A 3VKGA 2RP4A 2LOSA 5JDNA 1ZKEA 4P09A 3K3NA 1D0YA 4TX5A 3U3IA 4AQGA 3J9X1 3E08A 5HWYA 2IC9A 3L09A 3SOLA 2YU2A 2XAFB 3N2OA 3KV5A 3CX8B 4TV8E 4X1YE 2Q9QA 4OK0A 2NW9A 3IF8B 5LCYA 4B6XA 2P9BA 2VL8A 2N9DA 4I4TE 3SS1A 3RH3A 2KWIB 2LSIA 4CQIA 1BR1A 4CI3B 2H7VC 2Z6EA 4L5GA 5LJMA 1D1AA 1Z0PA 2H3RA 4DVDA 2WAUA 2ZM2A 3PUQA 2X68A 4J2CA 3ZJ1A 4ZHQE 3FBZA 2LE8A 3RRWA 1HTJF 4OYKA 4MBQA 3H3AA 3AA1B 4ERRA 3VU7H 4AKRB 1D1CA 3MACA 4JLEA 2ACXA 2MBGA 2LT3A 1ZEEA 4AXPA 4UV8B 3HKBE 1CUNA 5L3BB 3KINB 3BQIA 3AVRA 3RC3A 1V9DA 2BZBA 2DCFA 1S94A 2ODUA 3OKQA 2D0UA 4KP3C 4IIJE 2MYSA 3K3OA 2Y8DA 1LRZA 4ANJA 2Y48B 5F3JA 4L9IA 3ZMSB 2C5IT 5FY7A 4A56A 2KXPB 3ZLIA 5JREA 4ISSA 2KMFA 4HGAA 1IJ5A 2NOXA 4DBRA 2CXFA 2DWKA 1ZV4X 4AKIA 2HPJA 2LSKA 3PU8A 5GONE 3IEEA 3NZPA 3CPZA 2VASA 4OHFA 4C90A 5DQVA 2PG8A 3PDYA 3PUAA 2K24A 4E7SA 2V26A 3R84B 3PUGA 5JVDE 2VKOA 4BJMA 2X9WA 3RYIE 3UUMA 2X67A 2DI4A 1AJ3A 4AKLA 2X0LB 4GK5E 4M1PA 4HTEA 4UVAB 3I0OA 1HX8A 2VKDA 3MA9A 4JEHB 1Y64B 4ADZA 1US7B 5CA0E 3BK9A 3HL6A 2VB6A 1WR6A 3AAEB 4I50E 1HS7A 4QHOA 3KBUA 4X1IE 3IHRA 4DNDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLY B; 
#chains in the Genus database with same CATH topology
 3FBL A;  4LMK A;  1XDP A;  1O3X A;  1U5P A;  3ANW B;  5FYM A;  3RIU A;  2L8K A;  5DJQ C;  4HFI A;  5LP6 E;  4PFP A;  2CRB A;  2UXC T;  2IDO B;  2V8S V;  3GA8 A;  2UXB T;  4HEA A;  3NBX X;  3M3Z B;  4ZI2 D;  3HR0 A;  3K8P C;  3HI2 A;  2CXD A;  2E8I A;  2BKO A;  2XY8 B;  3B5M A;  2UXN B;  4N78 D;  4UEL A;  2HPL A;  2Q9Q D;  5FY0 A;  4X66 T;  1QSD A;  3MKD A;  1FEW A;  4DMW A;  4YHH T;  4JV5 T;  4B3S T;  4ZZC A;  4QXH B;  2XQ3 A;  2NWB A;  3H3M A;  5AQU B;  2SPC A;  4LF4 T;  3J7Y q;  2JQQ A;  3Q5X A;  5FNV E;  4P0A A;  1Z8U A;  3P8C D;  3V5S A;  2IIU A;  3QNU A;  4DV4 T;  2KZ7 B;  3KBT A;  3UUX B;  3ZJ2 A;  4HWD A;  4O2A E;  4HKA A;  1BR0 A;  3RC8 A;  2VK9 A;  2WU5 A;  4PJJ A;  5H6Q B;  2EHO C;  2XTL A;  2Q9Q B;  4UR9 A;  2X9Y A;  2WSS V;  4GKK T;  5CA1 E;  2VKJ A;  1G73 A;  2LM2 A;  4DR2 T;  2LSJ A;  3AEF A;  4H9Q C;  2KIN B;  1I6Z A;  4XZC A;  3I0Q A;  1KNR A;  4EZ4 A;  4HE8 A;  2L9Q A;  3A5X A;  5CFB A;  4U2Z A;  3EUH A;  2YN6 A;  3P4Q A;  5C8Y E;  3NRX A;  5F8P A;  4O8S A;  1KFY A;  4CN1 A;  4E7Z A;  1OED A;  3AED A;  4K0U A;  4Z8X A;  3PE0 A;  5CB4 E;  3Q5E A;  2V1D B;  4LF9 T;  3AEG A;  3ZT6 A;  2YU1 A;  2BS2 A;  5AQO B;  4H63 H;  2X66 A;  4PK5 A;  1IAP A;  5LXT E;  5AQQ B;  3CX6 B;  1N36 T;  2NTY A;  1UCU A;  3KV9 A;  2HHH T;  2KND A;  4H9N C;  5E0O A;  1LVK A;  4WBN E;  2WQY A;  2ZM0 A;  5AFU L;  2VVN A;  2WP9 A;  4ZI3 D;  3RKO A;  1OED B;  3LJC A;  4F6R C;  4JYA T;  1ZHC A;  5AQP B;  4EYU A;  2RA1 A;  3AAI A;  4Q25 A;  3HKE E;  4G2A A;  4LF5 T;  2CLY C;  4TUY E;  5LNK A;  2D9D A;  4CXY A;  4XAX B;  4HFC A;  3T1H T;  2BBJ A;  1N34 T;  4NPP A;  3UUB A;  2IAK A;  2WS3 A;  1KNZ A;  4GYS A;  3SRZ A;  3M65 A;  3AB3 B;  1YW0 A;  4EB6 E;  4HWF A;  3ONJ A;  3C4W A;  1MNE A;  3ZN0 B;  2WDV A;  3ZC1 A;  4UV9 B;  4K0K T;  2NW8 A;  4AQF A;  3C4Z A;  4U33 A;  4ZI7 E;  2YKS A;  4UVB B;  3PUS A;  2CCQ A;  3OBV E;  4JUY A;  4KMC A;  5BR8 T;  3MJX A;  1VOM A;  3LK2 B;  4O4H E;  5FMN A;  5LBM A;  5LGN B;  3EHZ A;  5EK4 A;  4DMV A;  4NXN T;  3ZMV B;  5JRC A;  2H7O A;  2OV9 A;  4GOU A;  3KV4 A;  2BVM A;  2CWO A;  1T7S A;  3F31 A;  2V6X A;  3PTR B;  3AE6 A;  1UX4 A;  3ZMU B;  4TWF A;  1N32 T;  3AE8 A;  3C4X A;  3AEA A;  5BMV E;  1UGO A;  4WNK A;  2QGS A;  3JC6 C;  2CHN A;  3ZYK A;  3MZK B;  4IDZ A;  4PK6 A;  1X79 A;  2A3D A;  4YXD A;  4KI0 F;  4LFC T;  4QXC B;  2LSG A;  4H9O C;  4NUU A;  4YTP A;  3V5U A;  4IE5 A;  5FY1 A;  2W67 A;  2LOS A;  1SUM B;  4TWH A;  4QH1 A;  5AQH B;  3AE7 A;  4JI2 T;  5HWY A;  3SOL A;  1J5E T;  4X1Y E;  2I6H A;  3IF8 B;  4B6X A;  3SS1 A;  4CI3 B;  1JNR A;  1KEY A;  2H7V C;  4DR6 T;  2WAU A;  2XM1 A;  4HFH A;  4ZZB A;  3RRW A;  1HTJ F;  4OYK A;  1WCR A;  2UXD T;  1XMQ T;  2UUA T;  1D1C A;  5L4E A;  3EI0 A;  4IT4 A;  1CUN A;  3EAM A;  4DR5 T;  1UK5 A;  3RC3 A;  3RF1 A;  4U7I A;  4YT0 A;  3RIF A;  2D0U A;  4KP3 C;  2J62 A;  3K3O A;  5KXJ A;  5FY7 A;  3NKZ A;  2ZM6 T;  4ISS A;  4YY3 T;  2CXF A;  2LSK A;  3IEE A;  3CPZ A;  2V26 A;  1WR0 A;  2BBH A;  4GK5 E;  3P50 A;  4GKJ T;  4U2Y A;  4WZX A;  3HL6 A;  1WR6 A;  3AAE B;  4DND A;  2W2U A;  2WU2 A;  1XDO A;  4EYY R;  4X20 E;  3P4S A;  4X65 T;  3RYF E;  3N9N A;  1OXZ A;  1QUU A;  2DNX A;  2YIN A;  3L3P A;  1HNX T;  2AE9 A;  1LKX A;  4ZI3 C;  2LEH A;  4YHJ A;  4IGU A;  4LF7 T;  1OED E;  5ADX L;  5KMG P;  2XQ7 A;  4JI8 T;  5LJN A;  5AQM B;  3UUN A;  2PJQ A;  5KDM C;  5ABF A;  4QH5 A;  2HH7 A;  4X62 T;  2BKP A;  1MIW A;  3L8R A;  4DID B;  2XAQ B;  4CI2 B;  2JMH A;  2V6Y A;  3LDQ B;  3AEC A;  4B3T T;  3K3Q C;  2MAW A;  4BJN A;  4DV0 T;  2HN1 A;  4A5X A;  5FXZ A;  3HKD E;  2CXL A;  2IHR 1;  3PUR A;  4XBF B;  5DQW A;  1YD8 G;  3UUL A;  4YSX A;  4A97 A;  4C91 A;  2WY2 A;  1B7T A;  4DR4 T;  3D0T A;  3T8O A;  2NTX A;  5TAO A;  1IZN B;  2FUP A;  2LM9 A;  2K5B B;  3BQL A;  3SFE A;  3AXJ B;  2WDR A;  5LOV E;  1MIY A;  4FI5 A;  3CQC B;  3OYZ A;  2V6Y B;  5FVL A;  1KF6 A;  3ZYM A;  1Y01 A;  5LB7 B;  4JI0 T;  2LKG A;  5J0Z A;  3PU3 A;  2X0H A;  1G8X A;  3RIA A;  1GQE A;  4OYJ A;  1I94 T;  4UF0 A;  1D0Z A;  2C5J A;  3SFD A;  4EIW A;  3O9X A;  3O1H A;  1T72 A;  5ETW A;  3L39 A;  2QA7 A;  4ZOL E;  2LKH A;  4LFA T;  2CBI A;  2UXX B;  4U31 A;  2FJB A;  4KX6 A;  1L0V A;  3RRC A;  2LJL A;  1J1J A;  5EZY E;  3KDS E;  2FJD A;  3UFG A;  3OTO T;  4IE7 A;  1WYB A;  4IE6 A;  1MMN A;  3RI5 A;  3PUW F;  2PFV A;  4UIG A;  3C64 A;  3ZCJ A;  2F4V T;  3NRY A;  4AI6 A;  3IBP A;  3ZN1 B;  1MMD A;  1HF8 A;  4UEM A;  2WBL A;  2MTQ A;  2E9X A;  1BR2 A;  3N2K E;  2BG9 C;  4CZZ B;  2CM0 A;  2DLR A;  4Z90 A;  4QH4 A;  3LG7 A;  2YDR A;  3JCF A;  5FXV A;  3A8Y C;  3QC9 A;  4YLH A;  5FL1 A;  5JDM A;  3DJB A;  4IE4 A;  1OWA A;  3UQ7 A;  5HXC A;  3ESL A;  3QUJ A;  2UU9 T;  1VCT A;  2XJ7 A;  2E9X B;  3ZYL A;  1SE7 A;  2L3L A;  1UUS A;  5AQV B;  1XNR T;  2D2S A;  4CN4 A;  3CK6 A;  3W15 B;  2VQF T;  2JQK A;  3N9M A;  5L3G B;  3FXD B;  3AA7 B;  3WAK A;  5AQF B;  3UU6 A;  3RYH E;  4DR3 T;  5EK3 A;  3RPU A;  4MLK A;  5FL0 A;  5A1L A;  3CIR A;  3RYC E;  1SHZ C;  3PV0 F;  2CE7 A;  4UVC B;  1VCS A;  2R6G F;  2WMO A;  5HEG A;  5JR9 A;  3TLU A;  3C51 A;  5HXS A;  2WWU A;  2XSB A;  4IDO A;  4F8H A;  2I59 A;  3KVA A;  2D5U A;  2LOP A;  3N5L A;  4LF8 T;  4DV6 T;  3FZH B;  2M6B A;  4IRE A;  2XAS B;  4ILU A;  2C0S A;  2ZLY A;  2W0G A;  2X9H A;  3K1S A;  4H9R C;  3VKG A;  1N33 T;  2RP4 A;  5JDN A;  1ZKE A;  4P09 A;  3K3N A;  1D0Y A;  4TX5 A;  3UQ4 A;  3U3I A;  4AQG A;  3J9X 1;  5C3J A;  2XZE A;  5C2T A;  4OK0 A;  4CQI A;  3ABV A;  1T8B A;  2Z6E A;  1Z0P A;  3NVO A;  3PUQ A;  4J2C A;  3AA1 B;  3VU7 H;  3FZF B;  2ACX A;  5L4H A;  2MBG A;  2LT3 A;  4AXP A;  3HKB E;  3AEE A;  5L3B B;  2XQ4 A;  3T1Y T;  2W66 A;  3ZST A;  2BS3 A;  2XQ8 A;  1LRZ A;  4ANJ A;  2XM2 A;  2KXP B;  2KMF A;  1IJ5 A;  4DBR A;  3TLV A;  4DUY T;  4AKI A;  3X1D A;  3PU8 A;  5L47 A;  3NZP A;  4OHF A;  2JQH A;  2H89 A;  5ABH A;  2PG8 A;  2K24 A;  2FBW A;  3R84 B;  1XMO T;  4BJM A;  2X9W A;  3RYI E;  2DI4 A;  4HWH A;  3RIU C;  4HTE A;  4UVA B;  4JEH B;  3AE4 A;  1Y64 B;  4ADZ A;  1US7 B;  4CN6 A;  2A9U A;  1KNP A;  5AQN B;  3LK3 B;  4ILC A;  4ZI2 C;  3EAB A;  2JPF A;  4AKG A;  3N9O A;  4DV1 T;  2BS4 A;  2VKH A;  4NUV A;  3CKD A;  2Q9Q C;  4LFB T;  5JRC B;  3UU8 A;  1W0A A;  4O2B E;  5HCJ A;  2V5D A;  5L3C B;  4PK4 A;  3UU5 A;  3G06 A;  2BVL A;  2K3W A;  1MMA A;  1CHU A;  4COF A;  2JIW A;  5LHH B;  4I43 B;  2NW7 A;  4DV2 T;  3JAD A;  2V7I A;  4QX8 B;  2LSY A;  1YQ3 A;  5JDF A;  5CJ5 A;  2WZH A;  3P7I A;  4JI6 T;  2W63 A;  1SA0 E;  3ZPO A;  3EDV A;  5IHY A;  3QB5 A;  1UX5 A;  2CWY A;  4JI4 T;  2X9X A;  3O1J A;  2N2N A;  3CVR A;  2QRX A;  3OYX A;  2JRK A;  1YKE B;  4DV5 T;  4B3M T;  3HKC E;  3RQU A;  3UU4 A;  2WDQ A;  4DR7 T;  3KV6 A;  4PW8 A;  5FP3 A;  3Q5W A;  2KSR A;  5H6R B;  3AA6 B;  1W09 A;  2CHO A;  2ACZ A;  1OED C;  1FMW A;  3FZL B;  3VKH A;  1YQ4 A;  1KK7 A;  2EHO A;  4H9P C;  2RPA A;  1IBL T;  3O4X E;  1HNW T;  4HWI B;  4YTN A;  2N1G A;  4AKH A;  2JJ9 A;  2A2F X;  3RQW A;  5HXR A;  3KFW X;  2V7K A;  2CBJ A;  4JEU B;  2ZM8 A;  3AA0 B;  1FMV A;  1XZY A;  2NR4 A;  3RX6 A;  2IML A;  3FXE B;  5DAB A;  5L2L A;  3KVB A;  3DTO A;  5HCM A;  2EHO B;  2UUC T;  4Z91 A;  2VUR A;  4TNW A;  1FJG T;  2JQ9 A;  5HAX A;  2M67 A;  1HNZ T;  4JI7 T;  4LMJ A;  4H63 V;  4O4I E;  4HFD A;  2DHR A;  3OJA A;  2KT9 A;  2XUE A;  3FHN A;  2W62 A;  2E5V A;  3B57 A;  3TKL B;  4IE0 A;  4AQY T;  3ZT5 A;  4IL9 A;  4CI1 B;  4PJL A;  4WBO A;  5JDH A;  3N9L A;  1BR4 A;  4QKN A;  1HCI A;  1W9R A;  2V7L A;  5HXH A;  3C50 A;  2IW5 B;  3NWI A;  4ILA A;  2YDQ A;  3GWH A;  1U4Q A;  5LMN T;  1NAF A;  3F57 A;  3UTK A;  4AQF C;  3ONX A;  5L3F B;  1YKH B;  4QWN B;  4I0U A;  5ABF B;  5LG3 A;  3AAA B;  4PNI A;  4EAH A;  2YK0 A;  2E5L T;  2VQE T;  4YJ2 E;  5LA6 E;  2W61 A;  1IBM T;  4PJN A;  3LBX A;  4IHJ E;  2WCA A;  3IA3 A;  4GK0 E;  4KBM B;  3ANW A;  5F5W A;  5HEO A;  4PAG A;  4MFR A;  3LK4 2;  4HFV A;  5KX5 E;  2G0U A;  2ZMA A;  4EXT A;  3RLF F;  2XQ6 A;  1M7K A;  2CLY B;  5M4Y A;  4ZS3 A;  1IBK T;  2IUB A;  4O4J E;  1D1B A;  2WM9 A;  3UU3 A;  2LRK A;  3LBX B;  3RKG A;  3ONL C;  3Q2M A;  1HR0 T;  5LBQ B;  4UF0 B;  1R8I A;  1NEN A;  2Y6X A;  2ES0 A;  1T98 A;  3O1I A;  2AXD S;  2E9X D;  4WYV A;  2LHR A;  3JC6 D;  2OLT A;  3CQX C;  2XQ5 A;  2V7J A;  1E7P A;  3ZSS A;  4IDQ A;  3AE2 A;  2WWV A;  2IC9 A;  4ZXL A;  2YU2 A;  3PUX F;  3N2O A;  4TV8 E;  3CX8 B;  2Q9Q A;  5LCY A;  2P9B A;  2N9D A;  3RH3 A;  2KWI B;  2LSI A;  4EED A;  4L5G A;  2XSA A;  1D1A A;  2H3R A;  2X68 A;  3FBZ A;  2LE8 A;  4MBQ A;  3H3A A;  4AKR B;  4JLE A;  3MAC A;  4U7Y A;  3BQI A;  3PJA A;  1V9D A;  3FZM B;  2BZB A;  2DCF A;  2FJE A;  3OKQ A;  2MYS A;  3PUZ F;  5HEJ A;  2C5I T;  4EGW A;  4HGA A;  5AQS B;  2DWK A;  2HPJ A;  5GON E;  3PUV F;  4C90 A;  2BG9 E;  5DQV A;  5IWA T;  3PDY A;  4E7S A;  5JVD E;  4DV3 T;  1XWM A;  2VKD A;  5AQL B;  3BK9 A;  2QVA A;  4HFE A;  2V5C A;  1J5W A;  4X1I E;  3IHR A;  3RGL A;  2KWH A;  1W0B A;  2OA5 A;  2VVS A;  2YOE A;  3PJA J;  2CEA A;  3N2G E;  2XQ9 A;  1QLB A;  4EEB A;  4HFB A;  2CMR A;  2XQY A;  5HEH A;  2KLQ A;  5J2U E;  3TLW A;  5JH7 E;  4V1A v;  4ILB A;  2LLY A;  5AQK B;  2M6I A;  3R6N A;  2D0T A;  3PUY F;  1VRB A;  4DV7 T;  4IST A;  4WW0 A;  5JR9 B;  4MAL A;  3BQK A;  2QYW A;  4KHP T;  2K48 A;  4U3C A;  2X51 A;  4AIS A;  3ZCI A;  5L3D B;  4O4L E;  3EDU A;  4YJ3 E;  3RHW A;  2JMK A;  5JDL A;  1S35 A;  2XPK A;  4DO0 A;  2XAH B;  3I9Y A;  1DU2 A;  3MK7 C;  3F2E A;  5FXX A;  4KUM B;  3ZMZ B;  3A7M A;  2E2A A;  3I1A A;  2H88 A;  3MXZ A;  2IC6 A;  3FB2 A;  3AE5 A;  1FIO A;  3CQG B;  5J2T E;  4EZH A;  2XHE B;  2WB5 A;  2W4X A;  1X9B A;  1HX1 B;  3Q9D A;  4G63 A;  3ZEF B;  2PBI A;  2CPT A;  1MIV A;  3B13 A;  4MHC A;  5HXE A;  3LFM A;  1E1H B;  2XAG B;  4IDP A;  3ETU A;  4TNV A;  4DUZ T;  4NIQ A;  5JTG A;  4TN7 B;  4CXW A;  1WLX A;  5LG4 A;  3ZMT B;  4B3R T;  2PTF A;  3AE1 A;  4ASK A;  1D0X A;  2YEV C;  3N9P A;  1WYC A;  5AQR B;  1IJ6 A;  4H9S E;  2J4G A;  4PJM A;  5HYA A;  4ZS2 A;  2ODV A;  4TWD A;  4HN9 A;  2WMN A;  4P0B A;  4LF6 T;  1HG5 A;  5LHI B;  2W00 A;  2E9X C;  3P4W A;  3H37 A;  3CML A;  2J47 A;  2B76 A;  4JI1 T;  2VWA A;  5AQT B;  4BA9 A;  3LSV A;  1HG2 A;  2WZI A;  4I55 E;  1H7C A;  3JAE A;  2K9A A;  1MMG A;  4L0R A;  3VHL A;  4IDN A;  3Q5D A;  3UFE A;  2DWG A;  3AVS A;  5J1G A;  1NEK A;  2XAJ B;  3E0Z A;  2MOZ A;  3CX7 B;  4YSZ A;  5HWX A;  3QK6 A;  4PFO A;  2MPK A;  3VR8 A;  3FZK B;  5JDG A;  2B1E A;  3ZC0 A;  4YSY A;  2A72 A;  3E22 E;  3ETV A;  4YTM A;  2YDS A;  4GYR A;  2BKN A;  3EVY A;  5IUX A;  2BG9 A;  3U78 A;  4GIW A;  2V7M A;  1WFD A;  4P1N A;  2GK9 A;  5AQG B;  2LHN A;  5ABG A;  5L3E B;  4X5T A;  2BDE A;  3S4U A;  4ZEY A;  1WRD A;  3OPC A;  3VRA A;  4UXN B;  2VL0 A;  1NWM X;  3TLS A;  1ZP0 A;  3CWZ B;  1E2A A;  4CXX A;  4X1K E;  4U74 A;  4EOZ B;  4JI3 T;  3SWH A;  2EHO D;  4OFZ A;  2C5K T;  5LMU T;  5LHG B;  5LGU B;  3GN5 A;  4U72 A;  2BG9 B;  3VR9 A;  5JR9 C;  1UUR A;  2I0M A;  3AE9 A;  3DP7 A;  1ZOY A;  2CA5 A;  4AIU A;  4DBQ A;  2UUB T;  5FKY A;  4EV6 A;  5IYZ E;  5EK2 A;  3NZQ A;  1HFA A;  2NP9 A;  4FJO A;  1EZ3 A;  4QX7 B;  5CGM A;  5AQJ B;  3ZT7 A;  5JDQ A;  1LVF A;  3N9Q A;  4TZ4 C;  3HA4 A;  4TV9 E;  5LYJ E;  3WAJ A;  4QXB B;  3GMI A;  3C98 B;  5LGT B;  5FXW A;  3WI3 A;  3GN5 B;  3I9W A;  2J1D G;  3P4P A;  5JQG E;  3UT5 E;  4BAY B;  4YFS A;  1MND A;  5FVK A;  2XQA A;  2DL1 A;  3VRB A;  3E08 A;  4A98 A;  4KHZ F;  3L09 A;  4LML A;  2XAF B;  3KV5 A;  2NW9 A;  2VL8 A;  1YXR A;  2FJA A;  4I4T E;  1BR1 A;  3P4R A;  3AXJ A;  3QOF A;  3AE3 A;  5LJM A;  4JBW F;  4DVD A;  2ZM2 A;  1JNZ A;  3ZJ1 A;  3TLT A;  2HN2 A;  4ZHQ E;  3OVU A;  4ERR A;  4JI5 T;  1ZEE A;  4UV8 B;  3KIN B;  4HWC A;  3AVR A;  3ZKR A;  1S94 A;  2ODU A;  4IIJ E;  5HEU A;  2Y8D A;  2Y48 B;  5F3J A;  4L9I A;  3ZMS B;  4DR1 T;  1XNQ T;  4A56 A;  3AEB A;  3ZLI A;  5JRE A;  2NOX A;  1ZV4 X;  2VAS A;  4NXM T;  5ABE A;  3PUA A;  4OX9 T;  3PUG A;  2VKO A;  3UUM A;  2X67 A;  1AJ3 A;  4AKL A;  2X0L B;  4M1P A;  4X64 T;  3I0O A;  1HX8 A;  3MA9 A;  2X0Y A;  5CA0 E;  5AQI B;  2LRL A;  3JAF A;  4IL4 A;  2VB6 A;  4I50 E;  3QB5 K;  1HS7 A;  4QHO A;  3KBU A;  1M62 A; 
#chains in the Genus database with same CATH homology
 3FBL A;  3LK3 B;  2KWH A;  4EYY R;  4X20 E;  2OA5 A;  3RYF E;  3N9N A;  1O3X A;  1U5P A;  3ANW B;  4ZI2 C;  1OXZ A;  5FYM A;  1QUU A;  2JPF A;  2DNX A;  2L8K A;  4AKG A;  5DJQ C;  3N9O A;  2CEA A;  2VKH A;  3N2G E;  5LP6 E;  2YIN A;  3L3P A;  4NUV A;  3CKD A;  4PFP A;  2Q9Q C;  2CMR A;  1LKX A;  4ZI3 C;  2XQY A;  5JRC B;  2LEH A;  2KLQ A;  3GA8 A;  5J2U E;  4HEA A;  4YHJ A;  3NBX X;  4O2B E;  4IGU A;  5JH7 E;  4V1A v;  5L3C B;  5ADX L;  5KMG P;  4ZI2 D;  4PK4 A;  3HR0 A;  3K8P C;  3HI2 A;  2BVL A;  2CXD A;  1MMA A;  2E8I A;  3R6N A;  2D0T A;  5LJN A;  2UXN B;  4N78 D;  4UEL A;  4I43 B;  1VRB A;  5LHH B;  2NW7 A;  4IST A;  4WW0 A;  5JR9 B;  2HPL A;  2Q9Q D;  5FY0 A;  4MAL A;  3UUN A;  1QSD A;  2PJQ A;  2V7I A;  3BQK A;  5KDM C;  4QX8 B;  2LSY A;  3MKD A;  2HH7 A;  2K48 A;  5JDF A;  1FEW A;  2X51 A;  4DMW A;  1MIW A;  3ZCI A;  5L3D B;  4O4L E;  3EDU A;  3P7I A;  4YJ3 E;  2JMK A;  4QXH B;  2XAQ B;  2NWB A;  4CI2 B;  2JMH A;  5JDL A;  1S35 A;  2SPC A;  3K3Q C;  3J7Y q;  4DO0 A;  2JQQ A;  2W63 A;  1SA0 E;  3ZPO A;  4BJN A;  3Q5X A;  3EDV A;  5FNV E;  2XAH B;  4P0A A;  3I9Y A;  3P8C D;  5IHY A;  3V5S A;  1UX5 A;  5FXZ A;  2CWY A;  3HKD E;  2CXL A;  3MK7 C;  3F2E A;  2X9X A;  3PUR A;  3O1J A;  5FXX A;  4XBF B;  2KZ7 B;  2N2N A;  3CVR A;  3KBT A;  4KUM B;  1YD8 G;  5DQW A;  3UUX B;  3UUL A;  3ZMZ B;  3OYX A;  3ZJ2 A;  4O2A E;  2JRK A;  4HKA A;  1YKE B;  1BR0 A;  3RC8 A;  3I1A A;  2VK9 A;  4C91 A;  1B7T A;  4PJJ A;  3HKC E;  3D0T A;  5H6Q B;  3MXZ A;  3T8O A;  2NTX A;  2EHO C;  5TAO A;  2XTL A;  1IZN B;  2IC6 A;  2Q9Q B;  3KV6 A;  2LM9 A;  2X9Y A;  2K5B B;  3FB2 A;  1FIO A;  3CQG B;  4PW8 A;  4EZH A;  5J2T E;  2XHE B;  3BQL A;  2WSS V;  5FP3 A;  5CA1 E;  3Q5W A;  2VKJ A;  5LOV E;  1MIY A;  1G73 A;  4FI5 A;  3Q9D A;  5H6R B;  3CQC B;  2LSJ A;  3OYZ A;  4G63 A;  3ZEF B;  2PBI A;  3ZYM A;  4H9Q C;  3AA6 B;  2KIN B;  1MIV A;  3B13 A;  1FMW A;  4MHC A;  4XZC A;  3PU3 A;  3I0Q A;  5HXE A;  1G8X A;  3VKH A;  3LFM A;  1E1H B;  2XAG B;  4EZ4 A;  1KK7 A;  3ETU A;  4HE8 A;  2EHO A;  4OYJ A;  2L9Q A;  4H9P C;  4TN7 B;  3A5X A;  4CXW A;  1WLX A;  5LG4 A;  3ZMT B;  4UF0 A;  1D0Z A;  3O4X E;  2C5J A;  3EUH A;  4EIW A;  5C8Y E;  3NRX A;  3O9X A;  4ASK A;  1D0X A;  3O1H A;  5F8P A;  2YEV C;  3N9P A;  4O8S A;  5ETW A;  2N1G A;  4E7Z A;  4AKH A;  1WYC A;  2QA7 A;  2JJ9 A;  4ZOL E;  2A2F X;  4K0U A;  4Z8X A;  3PE0 A;  5CB4 E;  5HXR A;  1IJ6 A;  4H9S E;  3KFW X;  4PJM A;  2UXX B;  5HYA A;  2V1D B;  4ZS2 A;  2ODV A;  2V7K A;  2YU1 A;  4H63 H;  3RRC A;  4JEU B;  2ZM8 A;  2LJL A;  2X66 A;  3AA0 B;  4HN9 A;  2WMN A;  4PK5 A;  1FMV A;  1IAP A;  5EZY E;  3RX6 A;  4P0B A;  1HG5 A;  3KDS E;  5LHI B;  5LXT E;  3FXE B;  4IE7 A;  1WYB A;  4IE6 A;  5DAB A;  5L2L A;  3KVB A;  3CX6 B;  1MMN A;  2W00 A;  2E9X C;  3DTO A;  2NTY A;  3H37 A;  1UCU A;  3CML A;  3KV9 A;  2VWA A;  2EHO B;  4BA9 A;  2PFV A;  4UIG A;  3C64 A;  2KND A;  1HG2 A;  4H9N C;  5E0O A;  5HAX A;  2M67 A;  3ZCJ A;  4I55 E;  1H7C A;  1LVK A;  4WBN E;  2ZM0 A;  5AFU L;  1MMG A;  2K9A A;  3NRY A;  4L0R A;  4H63 V;  4AI6 A;  3IBP A;  3ZN1 B;  4O4I E;  1MMD A;  3VHL A;  1HF8 A;  2DHR A;  3OJA A;  4ZI3 D;  4UEM A;  3RKO A;  2KT9 A;  3LJC A;  2WBL A;  4F6R C;  2XUE A;  2MTQ A;  3FHN A;  2W62 A;  2E9X A;  1BR2 A;  1ZHC A;  3N2K E;  4EYU A;  3UFE A;  4CZZ B;  2CM0 A;  2RA1 A;  2DWG A;  3B57 A;  3TKL B;  4IE0 A;  3AVS A;  3AAI A;  2DLR A;  5J1G A;  2XAJ B;  3E0Z A;  4CI1 B;  2MOZ A;  3CX7 B;  4PJL A;  4WBO A;  3LG7 A;  5JDH A;  5HWX A;  3HKE E;  4G2A A;  3N9L A;  3QK6 A;  4PFO A;  2CLY C;  4TUY E;  5JDG A;  5LNK A;  5FXV A;  1BR4 A;  4QKN A;  3QC9 A;  2B1E A;  1HCI A;  2V7L A;  4CXY A;  4XAX B;  3C50 A;  2IW5 B;  2A72 A;  3E22 E;  3ETV A;  5HXH A;  3ZC0 A;  4GYR A;  3GWH A;  1U4Q A;  4YLH A;  3EVY A;  1NAF A;  3F57 A;  5JDM A;  3DJB A;  4IE4 A;  3UTK A;  4AQF C;  3ONX A;  2IAK A;  1OWA A;  3U78 A;  5L3F B;  1YKH B;  4GIW A;  2V7M A;  5HXC A;  1KNZ A;  4GYS A;  4QWN B;  3SRZ A;  3ESL A;  3AB3 B;  1YW0 A;  3M65 A;  3QUJ A;  4EB6 E;  2GK9 A;  3C4W A;  2LHN A;  5L3E B;  1MNE A;  3ZN0 B;  2BDE A;  3S4U A;  2E9X B;  3AAA B;  3ZYL A;  1WRD A;  4PNI A;  2L3L A;  4EAH A;  3ZC1 A;  4UXN B;  4UV9 B;  2D2S A;  1NWM X;  2YK0 A;  3CWZ B;  2NW8 A;  3W15 B;  4CXX A;  4X1K E;  4U74 A;  4EOZ B;  4AQF A;  3C4Z A;  3SWH A;  3N9M A;  4ZI7 E;  4UVB B;  4YJ2 E;  5LA6 E;  2W61 A;  2EHO D;  4OFZ A;  2C5K T;  4PJN A;  3LBX A;  5L3G B;  3PUS A;  2CCQ A;  4IHJ E;  5LHG B;  3FXD B;  5LGU B;  3AA7 B;  3OBV E;  4GK0 E;  4JUY A;  3WAK A;  4KBM B;  3ANW A;  4KMC A;  3GN5 A;  4U72 A;  4PAG A;  3MJX A;  4MFR A;  3RYH E;  1VOM A;  3LK2 B;  5JR9 C;  4O4H E;  3LK4 2;  4HFV A;  5FMN A;  5KX5 E;  2G0U A;  5EK3 A;  2ZMA A;  5LBM A;  5LGN B;  3RPU A;  5EK4 A;  4DMV A;  3ZMV B;  4EXT A;  3DP7 A;  5JRC A;  2H7O A;  4MLK A;  2CA5 A;  4DBQ A;  2CLY B;  3KV4 A;  4GOU A;  2BVM A;  5M4Y A;  4ZS3 A;  5A1L A;  5IYZ E;  5EK2 A;  2CWO A;  3NZQ A;  3F31 A;  1HFA A;  2NP9 A;  4FJO A;  1EZ3 A;  3PTR B;  3RYC E;  4QX7 B;  1SHZ C;  1UX4 A;  4O4J E;  2CE7 A;  4UVC B;  3ZMU B;  1D1B A;  2WMO A;  3C4X A;  5JDQ A;  1LVF A;  3N9Q A;  4TZ4 C;  5JR9 A;  2WM9 A;  3HA4 A;  5BMV E;  4TV9 E;  3LBX B;  4WNK A;  2QGS A;  3C51 A;  3JC6 C;  5HXS A;  5LYJ E;  2WWU A;  3WAJ A;  4QXB B;  3GMI A;  3C98 B;  3Q2M A;  5FXW A;  3ZYK A;  5LGT B;  3MZK B;  2I59 A;  3KVA A;  4IDZ A;  3GN5 B;  3WI3 A;  3I9W A;  2D5U A;  2J1D G;  4PK6 A;  5LBQ B;  4UF0 B;  2LOP A;  3N5L A;  1X79 A;  5JQG E;  2Y6X A;  3UT5 E;  2ES0 A;  1T98 A;  2A3D A;  4BAY B;  3O1I A;  2XAS B;  2E9X D;  4ILU A;  4QXC B;  2LSG A;  4H9O C;  2LHR A;  4NUU A;  3JC6 D;  2C0S A;  1MND A;  4YFS A;  2ZLY A;  2W0G A;  3CQX C;  2X9H A;  3V5U A;  2V7J A;  4H9R C;  4IE5 A;  5FY1 A;  3VKG A;  2RP4 A;  2LOS A;  5JDN A;  1ZKE A;  4P09 A;  3K3N A;  1D0Y A;  4TX5 A;  3U3I A;  4AQG A;  3J9X 1;  3E08 A;  5HWY A;  2IC9 A;  3L09 A;  3SOL A;  2YU2 A;  2XAF B;  3N2O A;  3KV5 A;  3CX8 B;  4TV8 E;  4X1Y E;  2Q9Q A;  4OK0 A;  2NW9 A;  3IF8 B;  5LCY A;  4B6X A;  2P9B A;  2VL8 A;  2N9D A;  4I4T E;  3SS1 A;  3RH3 A;  2KWI B;  2LSI A;  4CQI A;  1BR1 A;  4CI3 B;  2H7V C;  2Z6E A;  4L5G A;  5LJM A;  1D1A A;  1Z0P A;  2H3R A;  4DVD A;  2WAU A;  2ZM2 A;  3PUQ A;  2X68 A;  4J2C A;  3ZJ1 A;  4ZHQ E;  3FBZ A;  2LE8 A;  3RRW A;  1HTJ F;  4OYK A;  4MBQ A;  3H3A A;  3AA1 B;  4ERR A;  3VU7 H;  4AKR B;  1D1C A;  3MAC A;  4JLE A;  2ACX A;  2MBG A;  2LT3 A;  1ZEE A;  4AXP A;  4UV8 B;  3HKB E;  1CUN A;  5L3B B;  3KIN B;  3BQI A;  3AVR A;  3RC3 A;  1V9D A;  2BZB A;  2DCF A;  1S94 A;  2ODU A;  3OKQ A;  2D0U A;  4KP3 C;  4IIJ E;  2MYS A;  3K3O A;  2Y8D A;  1LRZ A;  4ANJ A;  2Y48 B;  5F3J A;  4L9I A;  3ZMS B;  2C5I T;  5FY7 A;  4A56 A;  2KXP B;  3ZLI A;  5JRE A;  4ISS A;  2KMF A;  4HGA A;  1IJ5 A;  2NOX A;  4DBR A;  2CXF A;  2DWK A;  1ZV4 X;  4AKI A;  2HPJ A;  2LSK A;  3PU8 A;  5GON E;  3IEE A;  3NZP A;  3CPZ A;  2VAS A;  4OHF A;  4C90 A;  5DQV A;  2PG8 A;  3PDY A;  3PUA A;  2K24 A;  4E7S A;  2V26 A;  3R84 B;  3PUG A;  5JVD E;  2VKO A;  4BJM A;  2X9W A;  3RYI E;  3UUM A;  2X67 A;  2DI4 A;  1AJ3 A;  4AKL A;  2X0L B;  4GK5 E;  4M1P A;  4HTE A;  4UVA B;  3I0O A;  1HX8 A;  2VKD A;  3MA9 A;  4JEH B;  1Y64 B;  4ADZ A;  1US7 B;  5CA0 E;  3BK9 A;  3HL6 A;  2VB6 A;  1WR6 A;  3AAE B;  4I50 E;  1HS7 A;  4QHO A;  3KBU A;  4X1I E;  3IHR A;  4DND A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...