2CLYB

Subcomplex of the stator of bovine mitochondrial atp synthase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
KLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE B CHAIN, MITOCHONDRIAL
publication title On the Structure of the Stator of the Mitochondrial ATP Synthase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 36
structure length 120
sequence length 120
chains with identical sequence E
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2clyB00
2CLYB
chains in the Genus database with same CATH superfamily
4KHPT 3SRZA 4JI0T 5M4YA 2DLRA 1IAPA 5L4EA 4KI0F 3KVBA 4PFOA 3B57A 4U72A 4O2BE 3ZMSB 3O1IA 2XM1A 4OFZA 3GN5A 4FI5A 4XBFB 5HEHA 3UQ4A 3PV0F 2BS3A 3N9LA 1UGOA 2X9YA 3VRBA 2KLQA 2WZHA 2UXXB 5JR9B 5HWXA 4HFVA 4PW8A 3SFEA 2MBGA 2LKHA 4U74A 3OVUA 5HCJA 3HKEE 1HF8A 1T72A 5HWYA 4GIWA 3ZC1A 2JMHA 2X0HA 5A1LA 2WU5A 3VKHA 2MOZA 2EHOD 4GYRA 3Q9DA 3K3NA 2XQ5A 3PUAA 3MZKB 3LG7A 3N9PA 1FMVA 3RYHE 5IWAT 1G8XA 1WYCA 4IE0A 2CEAA 4P0BA 3AEFA 4JEUB 2LSJA 3F31A 1YKHB 3UULA 5J0ZA 2UUCT 3PUXF 4OHFA 4YTMA 3FB2A 4UXNB 4IREA 2W61A 3AA7B 2KWHA 4BJNA 3QC9A 3AB3B 5FXWA 3RIAA 1KNPA 4A56A 1H7CA 4I55E 2CXDA 4V1Av 2WWUA 4WW0A 1Z0PA 3PJAA 4DMVA 2W2UA 1FMWA 2W62A 4P1NA 3LK42 1S94A 2LKGA 2KSRA 4YHHT 3GN5B 4B6XA 2B1EA 2QA7A 4O4IE 2NTXA 2VVNA 1MMNA 4LF9T 3ZT7A 2NTYA 4ASKA 4EYUA 4YJ3E 4TWHA 4AISA 1N36T 4ZI2C 2BKNA 4L0RA 4WYVA 2K5BB 1LRZA 4GK0E 3AXJA 3P7IA 3UFGA 5FP3A 3MJXA 4DMWA 3N9NA 2BG9C 3PE0A 4EEBA 2BVMA 3MKDA 1LKXA 3ETUA 3C50A 3AE7A 4YTPA 4IL9A 2H3RA 2WDQA 5L2LA 5L3GB 5C8YE 3IBPA 2K48A 3TLTA 5AQLB 2WAUA 2BKPA 2CPTA 2WZIA 1FEWA 3HI2A 5JQGE 3DJBA 2YEVC 3UU5A 5ABHA 2SPCA 4QX7B 1T7SA 2LRLA 4H9QC 4C91A 2JPFA 3CMLA 3NZQA 1UCUA 2V6YB 4ILBA 4QH5A 4JUYA 4F8HA 3AEDA 3FZLB 4AQGA 4IDOA 1IZNB 3P8CD 3K3QC 4ZZCA 1KNZA 5F3JA 3ZN1B 1OWAA 4H9PC 4IE7A 3ZC0A 5FL1A 1HCIA 5J1GA 2L3LA 3FXDB 3JC6D 1HNXT 2YU2A 3LDQB 2XSAA 3MK7C 3Q5DA 4GKKT 2M6BA 2X9XA 3CX6B 3SFDA 1M62A 5H6QB 2QVAA 5LP6E 3RRCA 2CRBA 4IIJE 3NRYA 3AAEB 3TLWA 4JI2T 3R84B 2OA5A 2YDRA 4EZHA 3KVAA 1OEDA 3PU8A 2LSYA 4A5XA 2IDOB 1WYBA 2H89A 4UVAB 4AKIA 1BR0A 4IDNA 5JRCA 3RPUA 2AE9A 4ISSA 4KHZF 4IHJE 2A2FX 4CQIA 1HS7A 1N34T 4B3RT 2E2AA 2NW7A 4HWHA 5ABEA 2XQAA 2JQ9A 3CQCB 4JI4T 3OYZA 5FMNA 5HXSA 1U5PA 4HFEA 2IUBA 2CBJA 4HFBA 2UU9T 1SUMB 5DJQC 3QB5K 4PAGA 5AQMB 4YXDA 4DO0A 2V5CA 5AQFB 2MAWA 5ADXL 4LMLA 2DNXA 2V6XA 2XASB 2XTLA 1WR0A 4DV5T 3UU6A 5AQRB 4ZS2A 2VWAA 2BKOA 4UVCB 4P09A 3W15B 2BS2A 4KBMB 4L5GA 3Q2MA 1IJ5A 3ZJ1A 4KMCA 2IAKA 1OEDE 3EUHA 4IT4A 2X67A 4KUMB 4GYSA 5DABA 1ZHCA 2BDEA 4EGWA 4NUVA 3HL6A 3PU3A 3RYFE 1QLBA 1T98A 3FXEB 2X68A 3FHNA 2MTQA 3FZKB 1UX4A 4HWDA 1W09A 2QYWA 2NWBA 1OEDB 1W9RA 1S35A 4PJNA 3T8OA 5DQVA 1YXRA 3B5MA 4I0UA 1SE7A 1AJ3A 4TN7B 2FJAA 4ZXLA 3RX6A 1XWMA 1R8IA 3K1SA 4PFPA 4O2AE 5CA1E 5GONE 3ONLC 1QSDA 3PJAJ 2Y8DA 3F57A 1IBMT 1YKEB 4YTNA 4NXMT 4MLKA 2R6GF 2XM2A 2XQ8A 3PDYA 5EK2A 4ZI3C 4DV3T 1HX1B 5FYMA 3RIUA 3SOLA 2RA1A 4ZOLE 2WM9A 5BR8T 4QXCB 2MPKA 4H9SE 4EIWA 5H6RB 3QB5A 3AE6A 4H63V 3I9YA 1KEYA 1IBKT 2CLYC 1MIWA 2ZLYA 1XDPA 4MHCA 2XQ3A 2G0UA 2X66A 2I59A 4NIQA 5HXEA 5LNKA 5AQPB 5EZYE 2XUEA 2NW8A 2W0GA 3V5SA 2ODUA 4OK0A 4UR9A 3ZT5A 2KINB 2BVLA 4IE4A 4LMKA 3H37A 3PUWF 3RF1A 4QX8B 3JAEA 3TLVA 2FBWA 3OYXA 2H7VC 4PK5A 2C0SA 3O1JA 3CX8B 2K9AA 2WQYA 4CXXA 1MIVA 5J2TE 4BA9A 2VKJA 2IW5B 3SS1A 2YU1A 3OKQA 3OTOT 2V5DA 3CIRA 1UURA 4CZZB 3AEEA 5LA6E 4BAYB 4QHOA 3CQGB 1N33T 2BG9A 2HH7A 5JH7E 5ETWA 5FL0A 3FBLA 2C5JA 2X9WA 5TAOA 1WLXA 1D1CA 3CPZA 1VOMA 2KWIB 5EK3A 4ADZA 2XAGB 2BZBA 3ZMZB 3EVYA 2XQ6A 3MACA 2W66A 2YINA 3KINB 3ZSSA 2Q9QC 2LE8A 2J1DG 2VB6A 1U4QA 3EI0A 1D1BA 1XMQT 4WBOA 2VKOA 2KZ7B 4DR5T 4QXHB 1E1HB 4KX6A 5HEGA 5AQJB 2VQFT 2PFVA 1Y01A 2LM2A 3F2EA 1UUSA 1SHZC 5F8PA 4EYYR 3HKBE 1O3XA 2L9QA 2VQET 3ETVA 1XNRT 2HN1A 1X79A 2ACZA 1D1AA 2BG9E 2MYSA 3ONJA 4TV8E 2V6YA 4EXTA 3AVRA 2LSIA 3G06A 5L3DB 4JI5T 5LHHB 4HFCA 4FJOA 3VHLA 2Z6EA 2WS3A 3QNUA 4DV2T 2JQQA 2A72A 2BG9B 5AQGB 3ZMUB 3VR8A 3AE5A 4HEAA 2CHNA 3BQIA 5AQVB 4U2ZA 3L39A 4YFSA 3RQUA 2LSGA 3OPCA 4UIGA 5LBMA 3BQKA 4TUYE 5LJNA 4MALA 4P0AA 3PTRB 4CI2B 2RP4A 2CBIA 3RRWA 4PJJA 2FJEA 1HFAA 4U31A 2XQ4A 2F4VT 3KFWX 2LHRA 4HWFA 3PUZF 2IIUA 4X1IE 4B3ST 4X5TA 2IC6A 3CX7B 3QK6A 3NBXX 3EDUA 3A7MA 3WAKA 2UXCT 1J5WA 1GQEA 5HXHA 3N9QA 1N32T 3VKGA 5KXJA 4ZZBA 4X1KE 3FZFB 3M3ZB 2W00A 5CJ5A 4ZI2D 5L3CB 3KBTA 4E7ZA 2WSSV 3DTOA 2RPAA 1YW0A 1YQ4A 4IE6A 4DV6T 5IUXA 4JI6T 2N1GA 2XAFB 1UX5A 4Z8XA 4EZ4A 2E9XB 1D0XA 4Z90A 4XZCA 3LK3B 2YN6A 3T1YT 2E8IA 1KF6A 4X66T 2X9HA 4G63A 4LF6T 3KV4A 2W63A 3T1HT 3EAMA 3K8PC 2JIWA 2K24A 3EABA 5LJMA 3P4QA 1X9BA 4O4JE 2X0LB 3UU8A 2WBLA 3ZMTB 3AA1B 4B3MT 2YK0A 4YHJA 3L09A 3UTKA 2E9XC 4ILCA 4X20E 4HFHA 1VRBA 1G73A 3E08A 2BBHA 2KT9A 1I6ZA 2ES0A 3C51A 3Q5EA 2AXDS 1ZV4X 2ZM2A 3Q5XA 1BR4A 4DR1T 3A8YC 4DV7T 2CHOA 2XPKA 3OJAA 3LBXB 3AAIA 2H88A 5JDMA 1D0YA 4DNDA 5J2UE 5LGUB 4GKJT 4HFIA 3ZN0B 3RKGA 1QUUA 4PK4A 3UUNA 4J2CA 1XDOA 4I43B 5FVKA 3ZT6A 5CA0E 2D2SA 1W0BA 5HCMA 2VK9A 1CUNA 4EEDA 4DUZT 4Z91A 1FIOA 4IE5A 4QH1A 5FKYA 3AE3A 2OLTA 3CWZB 4YSYA 2K3WA 3PUQA 3RYCE 4CXWA 4CN6A 4QWNB 5C2TA 3RYIE 4A97A 1FJGT 1NENA 3AEBA 5LG3A 3O1HA 4H9NC 2VKDA 4TZ4C 4DR4T 3IA3A 5KX5E 2JRKA 5FVLA 3RHWA 4HKAA 3ZKRA 3M65A 2ZM0A 3ESLA 3UUBA 2WU2A 2NR4A 2DL1A 3RC8A 5LYJE 3ZYMA 3ZJ2A 5JDLA 5AQQB 2UXDT 3O4XE 2CWYA 3CVRA 5CFBA 4MFRA 3JCFA 5LGTB 3C4XA 4IGUA 5L47A 3AE2A 2J47A 5FXXA 4UF0B 3S4UA 2Q9QA 1IBLT 4EOZB 5IYZE 5JDHA 2FJBA 5C3JA 5JTGA 2I0MA 4LF5T 5HXRA 4DBRA 4B3TT 2UXBT 1E7PA 1ZOYA 5L3BB 2LSKA 2ZM8A 2CLYB 5AFUL 4UEMA 5HEOA 5LGNB 3AAAB 3J9X1 5FY1A 4EV6A 3O9XA 3HKCE 4JV5T 3PUYF 2E5VA 3PUGA 3HA4A 3WAJA 2VL8A 3ZEFB 2Y48B 1MNDA 2UXNB 5L4HA 5KMGP 4K0UA 3FBZA 3P50A 3FZHB 3A5XA 1HNZT 2C5KT 5AQKB 3D0TA 4ZEYA 1NAFA 1BR2A 3N9MA 5AQNB 1IJ6A 1YQ3A 1HG5A 4U3CA 4OYJA 3ZCIA 2DHRA 4LF8T 2WP9A 4WZXA 2WY2A 2W67A 4GK5E 3P4RA 3E0ZA 4ZI3D 2CXFA 2XAJB 2HPJA 4HGAA 4IL4A 5AQIB 4QH4A 4ERRA 4X62T 1Y64B 2ODVA 3CKDA 3AEAA 4LFCT 2Q9QB 3TLSA 3IHRA 3KV9A 2V7LA 4EAHA 3AA6B 1UK5A 4ZS3A 4Q25A 3RLFF 1KFYA 1JNRA 4A98A 4COFA 4HFDA 4U7IA 1WCRA 2EHOC 3N2OA 5EK4A 2B76A 2PJQA 2UUAT 2UUBT 4AI6A 3CQXC 3GA8A 1HTJF 5FY0A 1NWMX 2LOSA 3NWIA 4LFBT 4LMJA 4KP3C 4JBWF 5HAXA 3WI3A 2W4XA 4C90A 1DU2A 1M7KA 3IEEA 3ONXA 3UQ7A 4YSXA 3ZLIA 5E0OA 3UT5E 2C5IT 4PJLA 4HN9A 2V7JA 2HN2A 4NXNT 3ANWA 2JMKA 4YLHA 3RIFA 3I0QA 4CXYA 4AQFC 4LF4T 2DWGA 4JI8T 5HYAA 2LM9A 2XJ7A 1J5ET 4AKRB 5KDMC 2XQYA 5JR9C 4JI7T 1LVKA 5FNVE 1MMAA 2YOEA 2LLYA 5FXVA 3RKOA 2VURA 1MMDA 2XZEA 4OYKA 3HR0A 4U2YA 2Q9QD 1OXZA 1T8BA 2E9XA 4PNIA 3RIUC 2KXPB 3U78A 5LXTE 2N2NA 3RI5A 1E2AA 4XAXB 2N9DA 1MNEA 5CB4E 2J62A 1HG2A 2Y6XA 2JJ9A 5HEUA 2DI4A 4X64T 3EHZA 5F5WA 3MA9A 2FJDA 1HR0T 5IHYA 1ZEEA 3PURA 3L8RA 4M1PA 4TNVA 3Q5WA 2CM0A 4X65T 2WMNA 2LJLA 5LG4A 4AKGA 4DUYT 1VCTA 2WDRA 2V8SV 3LBXA 2JQHA 1MIYA 3UU3A 1BR1A 3E22E 4JI1T 3RH3A 3UUMA 1J1JA 3AEGA 2V7IA 4NPPA 2NW9A 4BJMA 1XNQT 3UFEA 2KMFA 3C98B 3IF8B 3ANWB 4OX9T 3QUJA 5LMNT 3AECA 1ZKEA 4CN4A 1D0ZA 4G2AA 4UVBB 4DV1T 2L8KA 1EZ3A 3OBVE 2X51A 3ZYKA 3VR9A 5JREA 5JDQA 1WR6A 4YT0A 2JQKA 2V1DB 2LHNA 3JC6C 4DV0T 2YDSA 2NOXA 4DBQA 1NEKA 1ZP0A 2WDVA 3I1AA 3RC3A 3C4WA 3NVOA 3I9WA 2PBIA 1SA0E 2CA5A 3V5UA 2FUPA 4U7YA 4QXBB 1JNZA 4AIUA 2V7MA 4CN1A 3N2GE 2VKHA 4ANJA 2X0YA 4E7SA 4MBQA 5LHGB 2D0UA 3AE4A 4JI3T 5L3FB 2WB5A 5DQWA 4AQYT 2VL0A 2DWKA 3LJCA 5ABFA 2ZMAA 2IHR1 4N78D 2XY8B 3NKZA 2WMOA 3KBUA 5JDFA 4YJ2E 3AE1A 3FZMB 2ACXA 1V9DA 5JVDE 3CK6A 1CHUA 3JADA 4UF0A 3AE8A 4DV4T 3ZSTA 3BQLA 1B7TA 4WNKA 3KDSE 2CCQA 3NZPA 4LF7T 2LT3A 3U3IA 4DR7T 3KV6A 3VU7H 4TWDA 1HNWT 3P4SA 3AXJB 3ZMVB 2KNDA 4GOUA 4O4HE 2XAQB 3JAFA 1VCSA 2J4GA 3AVSA 4L9IA 4PK6A 4UV9B 4LFAT 5LMUT 4IDPA 5FY7A 5LBQB 1WFDA 2VVSA 5L3EB 2HPLA 2E9XD 4AXPA 4PJMA 1MMGA 2XQ7A 4JYAT 4ILAA 3H3MA 2P9BA 3LSVA 1KNRA 2QRXA 4K0KT 3N2KE 4UELA 2XSBA 4U33A 4ZHQE 5ABGA 4HE8A 4I50E 2D0TA 4ILUA 4DIDB 3TKLB 2ZM6T 2V7KA 3H3AA 2PG8A 3LK2B 5LOVE 4O8SA 5AQSB 2HHHT 3PUVF 3HKDE 3UU4A 2LEHA 2CMRA 4JEHB 4ZI7E 4I4TE 2BBJA 3I0OA 4HWIB 1I94T 1L0VA 4H9RC 3R6NA 2EHOA 4DVDA 5ABFB 1Z8UA 2LOPA 1US7B 3ABVA 3RQWA 2H7OA 2XAHB 3QOFA 2D9DA 2QGSA 3LFMA 3UUXB 4IDZA 4ISTA 2XQ9A 2XHEB 3ZYLA 4QKNA 4HWCA 4WBNE 5CGMA 3P4WA 4UV8B 2YDQA 3BK9A 2V26A 3AA0B 3C64A 4HTEA 4TNWA 4DR6T 3ZCJA 4TWFA 3SWHA 2A9UA 2OV9A 3RGLA 4TX5A 2M67A 4AQFA 2IMLA 3AE9A 1XMOT 3PUSA 2E5LT 4AKLA 2VASA 2WCAA 5HEJA 3GMIA 3NRXA 4H63H 2IC9A 3B13A 4AKHA 2CWOA 2GK9A 5JR9A 1XZYA 5JRCB 5JDNA 2A3DA 4H9OC 2CE7A 3N9OA 4X1YE 5AQTB 4DR3T 4YSZA 4CI3B 3X1DA 4EB6E 1OEDC 5AQUB 2YKSA 2I6HA 2DCFA 2D5UA 3EDVA 3J7Yq 2NP9A 2M6IA 4IDQA 4O4LE 5AQHB 1W0AA 5JDGA 5FXZA 3GWHA 2LRKA 3TLUA 3KV5A 3VRAA 3DP7A 5LB7B 2WWVA 3N5LA 4CI1B 5HXCA 4NUUA 2EHOB 4YY3T 3C4ZA 3L3PA 5LCYA 4TV9E 3MXZA 4F6RC 1YD8G 4DR2T 1WRDA 3P4PA 2CXLA 2BS4A 5AQOB 2PTFA 5LHIB 4JLEA 1HX8A 3ZPOA 1KK7A 5BMVE 3K3OA 1LVFA
chains in the Genus database with same CATH topology
5DABA 3SRZA 1ZHCA 2BDEA 4O4JE 4NUVA 5IHYA 3HL6A 2X0LB 1ZEEA 3PU3A 2WBLA 3PURA 3RYFE 5M4YA 2DLRA 3ZMTB 4M1PA 1T98A 3AA1B 1IAPA 3FXEB 2YK0A 4YHJA 3L09A 3UTKA 2X68A 2E9XC 4X20E 3Q5WA 1VRBA 3KVBA 1G73A 4PFOA 3B57A 4U72A 4O2BE 3E08A 2MTQA 3FHNA 3ZMSB 3O1IA 2KT9A 2CM0A 2ES0A 2WMNA 3C51A 2LJLA 1UX4A 4OFZA 1ZV4X 2ZM2A 3Q5XA 5LG4A 1BR4A 4AKGA 3GN5A 2NWBA 3OJAA 4FI5A 3LBXB 4XBFB 3AAIA 5JDMA 1S35A 4PJNA 3LBXA 3N9LA 3T8OA 1D0YA 1MIYA 5DQVA 4DNDA 2X9YA 5J2UE 1BR1A 2KLQA 5LGUB 2UXXB 3E22E 5JR9B 3RH3A 5HWXA 3ZN0B 4HFVA 3UUMA 1QUUA 4PW8A 1AJ3A 2V7IA 4PK4A 4TN7B 3UUNA 2MBGA 2NW9A 4BJMA 3RX6A 4J2CA 4I43B 4PFPA 4O2AE 3UFEA 4U74A 5CA0E 2KMFA 3C98B 3IF8B 5CA1E 5GONE 2D2SA 1QSDA 3ANWB 2Y8DA 3QUJA 3F57A 1YKEB 1ZKEA 3HKEE 1HF8A 1D0ZA 4MLKA 4G2AA 5HWYA 3PDYA 4GIWA 5EK2A 4ZI3C 3ZC1A 4UVBB 2VK9A 2JMHA 5FYMA 5A1LA 1CUNA 3SOLA 1FIOA 4IE5A 2L8KA 2RA1A 3VKHA 4ZOLE 2MOZA 2WM9A 2EHOD 4GYRA 1EZ3A 3Q9DA 3K3NA 3OBVE 4QXCB 2X51A 3CWZB 3ZYKA 3PUAA 3MZKB 4H9SE 5JREA 4EIWA 5H6RB 3PUQA 3LG7A 3RYCE 3N9PA 4CXWA 5JDQA 1WR6A 4H63V 1FMVA 3I9YA 4QWNB 3RYIE 3RYHE 2CLYC 1G8XA 1WYCA 2V1DB 4IE0A 1MIWA 2LHNA 2ZLYA 3JC6C 2CEAA 4P0BA 4MHCA 3O1HA 4JEUB 2LSJA 2G0UA 2X66A 2I59A 2NOXA 5HXEA 5LNKA 4DBQA 4H9NC 2VKDA 4TZ4C 3RC3A 3I1AA 3C4WA 5EZYE 5KX5E 2XUEA 3I9WA 2NW8A 3F31A 1YKHB 2JRKA 2W0GA 3UULA 3V5SA 2PBIA 1SA0E 4HKAA 2ODUA 4OK0A 2CA5A 3V5UA 4OHFA 2KINB 4QXBB 3M65A 2BVLA 2ZM0A 3ESLA 2V7MA 3FB2A 4IE4A 4UXNB 3H37A 3N2GE 2VKHA 4ANJA 3RC8A 2W61A 4QX8B 3AA7B 5LYJE 4E7SA 3ZYMA 3ZJ2A 2KWHA 5JDLA 4MBQA 3OYXA 2H7VC 4BJNA 4PK5A 2C0SA 2D0UA 3O1JA 3QC9A 5LHGB 3AB3B 5FXWA 3CX8B 3O4XE 2K9AA 2CWYA 3CVRA 4MFRA 4A56A 5L3FB 5DQWA 1H7CA 4I55E 4CXXA 5LGTB 1MIVA 2DWKA 5J2TE 3LJCA 3C4XA 2CXDA 4V1Av 4BA9A 2VKJA 2ZMAA 2WWUA 4WW0A 4N78D 2IW5B 1Z0PA 4IGUA 3SS1A 2WMOA 2YU1A 3KBUA 4DMVA 1FMWA 5JDFA 3OKQA 4YJ2E 2W62A 4CZZB 2ACXA 3LK42 1V9DA 5JVDE 1S94A 5FXXA 5LA6E 4UF0B 4BAYB 3GN5B 4QHOA 3CQGB 3S4UA 4UF0A 4B6XA 2HH7A 2B1EA 5ETWA 2Q9QA 5JH7E 2QA7A 4O4IE 4EOZB 2NTXA 5IYZE 5JDHA 3FBLA 3BQLA 2C5JA 1B7TA 1MMNA 4WNKA 2X9WA 3KDSE 2CCQA 5HXRA 5TAOA 1WLXA 1D1CA 3CPZA 4DBRA 2NTYA 1VOMA 2KWIB 2LT3A 3NZPA 3U3IA 4ASKA 4EYUA 4YJ3E 3KV6A 3VU7H 5L3BB 5EK3A 4ADZA 4ZI2C 4L0RA 2LSKA 2ZM8A 2K5BB 3ZMVB 2XAGB 1LRZA 2CLYB 4GK0E 2KNDA 3P7IA 4GOUA 5AFUL 4UEMA 2BZBA 3ZMZB 3EVYA 5FP3A 5LGNB 4O4HE 3MJXA 2XAQB 3AAAB 3MACA 3J9X1 5FY1A 4DMWA 3AVSA 3KINB 2YINA 4L9IA 3N9NA 3O9XA 2Q9QC 2LE8A 4PK6A 4UV9B 3HKCE 3PE0A 2J1DG 2BVMA 2VB6A 3MKDA 5FY7A 5LBQB 1LKXA 1U4QA 3PUGA 5L3EB 1D1BA 3ETUA 3C50A 4WBOA 2HPLA 2VKOA 2E9XD 2KZ7B 3HA4A 4PJMA 4AXPA 3WAJA 2H3RA 4QXHB 1E1HB 2VL8A 3ZEFB 1MMGA 5L3GB 5C8YE 5L2LA 3IBPA 2K48A 2P9BA 2Y48B 1MNDA 2UXNB 2PFVA 3N2KE 5KMGP 4UELA 3F2EA 2WAUA 4ZHQE 4K0UA 3FBZA 1SHZC 4HE8A 1FEWA 4I50E 5F8PA 4EYYR 3HKBE 3HI2A 2D0TA 3A5XA 4ILUA 1O3XA 3TKLB 5JQGE 2L9QA 2V7KA 3H3AA 2PG8A 3DJBA 3LK2B 5LOVE 4O8SA 2C5KT 2YEVC 3D0TA 3HKDE 2SPCA 4QX7B 3ETVA 4H9QC 4C91A 1NAFA 1BR2A 1X79A 2JPFA 3CMLA 3N9MA 1D1AA 3NZQA 1IJ6A 2MYSA 1UCUA 2LEHA 2CMRA 4JEHB 4TV8E 4ZI7E 1HG5A 4I4TE 4EXTA 4JUYA 4OYJA 3ZCIA 2DHRA 3AVRA 2LSIA 3I0OA 4GK5E 5L3DB 3E0ZA 4ZI3D 4H9RC 3R6NA 2CXFA 2EHOA 5LHHB 2XAJB 4DVDA 4AQGA 4FJOA 3VHLA 2HPJA 2LOPA 1US7B 2Z6EA 1IZNB 3P8CD 4HGAA 2H7OA 2XAHB 3K3QC 2QGSA 3LFMA 3UUXB 4ERRA 5F3JA 1KNZA 3ZN1B 1OWAA 4H9PC 4IDZA 4ISTA 1Y64B 4IE7A 2XHEB 3ZC0A 2ODVA 1HCIA 3CKDA 2JQQA 5J1GA 2A72A 3ZMUB 2L3LA 3ZYLA 3FXDB 2Q9QB 4HEAA 3JC6D 3BQIA 4QKNA 2YU2A 3IHRA 3KV9A 2V7LA 4EAHA 4WBNE 4UV8B 3AA6B 4YFSA 4ZS3A 2LSGA 3BK9A 3MK7C 2V26A 3AA0B 2X9XA 3C64A 4HTEA 3CX6B 3ZCJA 4UIGA 5H6QB 2EHOC 3N2OA 5EK4A 5LP6E 5LBMA 3BQKA 3RRCA 3SWHA 4IIJE 3NRYA 3AAEB 4TX5A 4TUYE 2M67A 2PJQA 3R84B 5LJNA 2OA5A 4MALA 4AQFA 4AI6A 4EZHA 3CQXC 3GA8A 1HTJF 5FY0A 4P0AA 3PUSA 3KVAA 3PTRB 4AKLA 4CI2B 3PU8A 1NWMX 2LOSA 2RP4A 2VASA 2LSYA 3GMIA 3NRXA 4H63H 4KP3C 2IC9A 3B13A 3RRWA 4AKHA 1WYBA 2CWOA 2GK9A 4PJJA 4UVAB 5JR9A 5HAXA 3WI3A 5JRCB 4C90A 1HFAA 3IEEA 3ONXA 5JDNA 4AKIA 1BR0A 5JRCA 2A3DA 3RPUA 3KFWX 4H9OC 2LHRA 4ISSA 2CE7A 3ZLIA 3N9OA 4X1YE 4IHJE 2A2FX 4X1IE 4CQIA 1HS7A 5E0OA 3UT5E 2C5IT 4PJLA 4HN9A 2NW7A 2IC6A 3CX7B 3QK6A 2V7JA 3NBXX 3ANWA 2JMKA 3EDUA 4YLHA 3WAKA 4CXYA 3I0QA 4AQFC 4CI3B 2DWGA 3CQCB 5HXHA 3N9QA 5HYAA 2LM9A 3OYZA 3VKGA 4EB6E 5FMNA 5HXSA 1U5PA 2DCFA 2D5UA 3EDVA 4AKRB 5KDMC 3J7Yq 2NP9A 4X1KE 4O4LE 5DJQC 2W00A 2XQYA 4PAGA 5JR9C 5JDGA 4DO0A 5FXZA 4ZI2D 3GWHA 5L3CB 3KBTA 4E7ZA 1LVKA 2WSSV 5FNVE 1MMAA 3DTOA 1YW0A 3KV5A 3DP7A 4IE6A 5FXVA 3N5LA 4CI1B 3RKOA 5ADXL 2DNXA 1MMDA 2XASB 4OYKA 2XTLA 2N1GA 3HR0A 2XAFB 5HXCA 4ZS2A 1UX5A 2Q9QD 4Z8XA 4EZ4A 2VWAA 1OXZA 2E9XB 4NUUA 4UVCB 1D0XA 2E9XA 4PNIA 2EHOB 4P09A 4XZCA 2KXPB 3W15B 3U78A 5LXTE 3C4ZA 3L3PA 3LK3B 2N2NA 5LCYA 2E8IA 4KBMB 4TV9E 3MXZA 4F6RC 1YD8G 4L5GA 4XAXB 2N9DA 2X9HA 3Q2MA 4G63A 1IJ5A 3ZJ1A 1WRDA 3KV4A 2CXLA 2W63A 4KMCA 1MNEA 2IAKA 3EUHA 5LHIB 4JLEA 2X67A 3K8PC 5CB4E 4KUMB 1HX8A 3ZPOA 1HG2A 2Y6XA 1KK7A 2JJ9A 5BMVE 2K24A 3K3OA 2DI4A 1LVFA 4GYSA 5LJMA 3MA9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLY B; 
#chains in the Genus database with same CATH topology
 4KHP T;  3SRZ A;  4JI0 T;  5M4Y A;  2DLR A;  1IAP A;  5L4E A;  4KI0 F;  3KVB A;  4PFO A;  3B57 A;  4U72 A;  4O2B E;  3ZMS B;  3O1I A;  2XM1 A;  4OFZ A;  3GN5 A;  4FI5 A;  4XBF B;  5HEH A;  3UQ4 A;  3PV0 F;  2BS3 A;  3N9L A;  1UGO A;  2X9Y A;  3VRB A;  2KLQ A;  2WZH A;  2UXX B;  5JR9 B;  5HWX A;  4HFV A;  4PW8 A;  3SFE A;  2MBG A;  2LKH A;  4U74 A;  3OVU A;  5HCJ A;  3HKE E;  1HF8 A;  1T72 A;  5HWY A;  4GIW A;  3ZC1 A;  2JMH A;  2X0H A;  5A1L A;  2WU5 A;  3VKH A;  2MOZ A;  2EHO D;  4GYR A;  3Q9D A;  3K3N A;  2XQ5 A;  3PUA A;  3MZK B;  3LG7 A;  3N9P A;  1FMV A;  3RYH E;  5IWA T;  1G8X A;  1WYC A;  4IE0 A;  2CEA A;  4P0B A;  3AEF A;  4JEU B;  2LSJ A;  3F31 A;  1YKH B;  3UUL A;  5J0Z A;  2UUC T;  3PUX F;  4OHF A;  4YTM A;  3FB2 A;  4UXN B;  4IRE A;  2W61 A;  3AA7 B;  2KWH A;  4BJN A;  3QC9 A;  3AB3 B;  5FXW A;  3RIA A;  1KNP A;  4A56 A;  1H7C A;  4I55 E;  2CXD A;  4V1A v;  2WWU A;  4WW0 A;  1Z0P A;  3PJA A;  4DMV A;  2W2U A;  1FMW A;  2W62 A;  4P1N A;  3LK4 2;  1S94 A;  2LKG A;  2KSR A;  4YHH T;  3GN5 B;  4B6X A;  2B1E A;  2QA7 A;  4O4I E;  2NTX A;  2VVN A;  1MMN A;  4LF9 T;  3ZT7 A;  2NTY A;  4ASK A;  4EYU A;  4YJ3 E;  4TWH A;  4AIS A;  1N36 T;  4ZI2 C;  2BKN A;  4L0R A;  4WYV A;  2K5B B;  1LRZ A;  4GK0 E;  3AXJ A;  3P7I A;  3UFG A;  5FP3 A;  3MJX A;  4DMW A;  3N9N A;  2BG9 C;  3PE0 A;  4EEB A;  2BVM A;  3MKD A;  1LKX A;  3ETU A;  3C50 A;  3AE7 A;  4YTP A;  4IL9 A;  2H3R A;  2WDQ A;  5L2L A;  5L3G B;  5C8Y E;  3IBP A;  2K48 A;  3TLT A;  5AQL B;  2WAU A;  2BKP A;  2CPT A;  2WZI A;  1FEW A;  3HI2 A;  5JQG E;  3DJB A;  2YEV C;  3UU5 A;  5ABH A;  2SPC A;  4QX7 B;  1T7S A;  2LRL A;  4H9Q C;  4C91 A;  2JPF A;  3CML A;  3NZQ A;  1UCU A;  2V6Y B;  4ILB A;  4QH5 A;  4JUY A;  4F8H A;  3AED A;  3FZL B;  4AQG A;  4IDO A;  1IZN B;  3P8C D;  3K3Q C;  4ZZC A;  1KNZ A;  5F3J A;  3ZN1 B;  1OWA A;  4H9P C;  4IE7 A;  3ZC0 A;  5FL1 A;  1HCI A;  5J1G A;  2L3L A;  3FXD B;  3JC6 D;  1HNX T;  2YU2 A;  3LDQ B;  2XSA A;  3MK7 C;  3Q5D A;  4GKK T;  2M6B A;  2X9X A;  3CX6 B;  3SFD A;  1M62 A;  5H6Q B;  2QVA A;  5LP6 E;  3RRC A;  2CRB A;  4IIJ E;  3NRY A;  3AAE B;  3TLW A;  4JI2 T;  3R84 B;  2OA5 A;  2YDR A;  4EZH A;  3KVA A;  1OED A;  3PU8 A;  2LSY A;  4A5X A;  2IDO B;  1WYB A;  2H89 A;  4UVA B;  4AKI A;  1BR0 A;  4IDN A;  5JRC A;  3RPU A;  2AE9 A;  4ISS A;  4KHZ F;  4IHJ E;  2A2F X;  4CQI A;  1HS7 A;  1N34 T;  4B3R T;  2E2A A;  2NW7 A;  4HWH A;  5ABE A;  2XQA A;  2JQ9 A;  3CQC B;  4JI4 T;  3OYZ A;  5FMN A;  5HXS A;  1U5P A;  4HFE A;  2IUB A;  2CBJ A;  4HFB A;  2UU9 T;  1SUM B;  5DJQ C;  3QB5 K;  4PAG A;  5AQM B;  4YXD A;  4DO0 A;  2V5C A;  5AQF B;  2MAW A;  5ADX L;  4LML A;  2DNX A;  2V6X A;  2XAS B;  2XTL A;  1WR0 A;  4DV5 T;  3UU6 A;  5AQR B;  4ZS2 A;  2VWA A;  2BKO A;  4UVC B;  4P09 A;  3W15 B;  2BS2 A;  4KBM B;  4L5G A;  3Q2M A;  1IJ5 A;  3ZJ1 A;  4KMC A;  2IAK A;  1OED E;  3EUH A;  4IT4 A;  2X67 A;  4KUM B;  4GYS A;  5DAB A;  1ZHC A;  2BDE A;  4EGW A;  4NUV A;  3HL6 A;  3PU3 A;  3RYF E;  1QLB A;  1T98 A;  3FXE B;  2X68 A;  3FHN A;  2MTQ A;  3FZK B;  1UX4 A;  4HWD A;  1W09 A;  2QYW A;  2NWB A;  1OED B;  1W9R A;  1S35 A;  4PJN A;  3T8O A;  5DQV A;  1YXR A;  3B5M A;  4I0U A;  1SE7 A;  1AJ3 A;  4TN7 B;  2FJA A;  4ZXL A;  3RX6 A;  1XWM A;  1R8I A;  3K1S A;  4PFP A;  4O2A E;  5CA1 E;  5GON E;  3ONL C;  1QSD A;  3PJA J;  2Y8D A;  3F57 A;  1IBM T;  1YKE B;  4YTN A;  4NXM T;  4MLK A;  2R6G F;  2XM2 A;  2XQ8 A;  3PDY A;  5EK2 A;  4ZI3 C;  4DV3 T;  1HX1 B;  5FYM A;  3RIU A;  3SOL A;  2RA1 A;  4ZOL E;  2WM9 A;  5BR8 T;  4QXC B;  2MPK A;  4H9S E;  4EIW A;  5H6R B;  3QB5 A;  3AE6 A;  4H63 V;  3I9Y A;  1KEY A;  1IBK T;  2CLY C;  1MIW A;  2ZLY A;  1XDP A;  4MHC A;  2XQ3 A;  2G0U A;  2X66 A;  2I59 A;  4NIQ A;  5HXE A;  5LNK A;  5AQP B;  5EZY E;  2XUE A;  2NW8 A;  2W0G A;  3V5S A;  2ODU A;  4OK0 A;  4UR9 A;  3ZT5 A;  2KIN B;  2BVL A;  4IE4 A;  4LMK A;  3H37 A;  3PUW F;  3RF1 A;  4QX8 B;  3JAE A;  3TLV A;  2FBW A;  3OYX A;  2H7V C;  4PK5 A;  2C0S A;  3O1J A;  3CX8 B;  2K9A A;  2WQY A;  4CXX A;  1MIV A;  5J2T E;  4BA9 A;  2VKJ A;  2IW5 B;  3SS1 A;  2YU1 A;  3OKQ A;  3OTO T;  2V5D A;  3CIR A;  1UUR A;  4CZZ B;  3AEE A;  5LA6 E;  4BAY B;  4QHO A;  3CQG B;  1N33 T;  2BG9 A;  2HH7 A;  5JH7 E;  5ETW A;  5FL0 A;  3FBL A;  2C5J A;  2X9W A;  5TAO A;  1WLX A;  1D1C A;  3CPZ A;  1VOM A;  2KWI B;  5EK3 A;  4ADZ A;  2XAG B;  2BZB A;  3ZMZ B;  3EVY A;  2XQ6 A;  3MAC A;  2W66 A;  2YIN A;  3KIN B;  3ZSS A;  2Q9Q C;  2LE8 A;  2J1D G;  2VB6 A;  1U4Q A;  3EI0 A;  1D1B A;  1XMQ T;  4WBO A;  2VKO A;  2KZ7 B;  4DR5 T;  4QXH B;  1E1H B;  4KX6 A;  5HEG A;  5AQJ B;  2VQF T;  2PFV A;  1Y01 A;  2LM2 A;  3F2E A;  1UUS A;  1SHZ C;  5F8P A;  4EYY R;  3HKB E;  1O3X A;  2L9Q A;  2VQE T;  3ETV A;  1XNR T;  2HN1 A;  1X79 A;  2ACZ A;  1D1A A;  2BG9 E;  2MYS A;  3ONJ A;  4TV8 E;  2V6Y A;  4EXT A;  3AVR A;  2LSI A;  3G06 A;  5L3D B;  4JI5 T;  5LHH B;  4HFC A;  4FJO A;  3VHL A;  2Z6E A;  2WS3 A;  3QNU A;  4DV2 T;  2JQQ A;  2A72 A;  2BG9 B;  5AQG B;  3ZMU B;  3VR8 A;  3AE5 A;  4HEA A;  2CHN A;  3BQI A;  5AQV B;  4U2Z A;  3L39 A;  4YFS A;  3RQU A;  2LSG A;  3OPC A;  4UIG A;  5LBM A;  3BQK A;  4TUY E;  5LJN A;  4MAL A;  4P0A A;  3PTR B;  4CI2 B;  2RP4 A;  2CBI A;  3RRW A;  4PJJ A;  2FJE A;  1HFA A;  4U31 A;  2XQ4 A;  2F4V T;  3KFW X;  2LHR A;  4HWF A;  3PUZ F;  2IIU A;  4X1I E;  4B3S T;  4X5T A;  2IC6 A;  3CX7 B;  3QK6 A;  3NBX X;  3EDU A;  3A7M A;  3WAK A;  2UXC T;  1J5W A;  1GQE A;  5HXH A;  3N9Q A;  1N32 T;  3VKG A;  5KXJ A;  4ZZB A;  4X1K E;  3FZF B;  3M3Z B;  2W00 A;  5CJ5 A;  4ZI2 D;  5L3C B;  3KBT A;  4E7Z A;  2WSS V;  3DTO A;  2RPA A;  1YW0 A;  1YQ4 A;  4IE6 A;  4DV6 T;  5IUX A;  4JI6 T;  2N1G A;  2XAF B;  1UX5 A;  4Z8X A;  4EZ4 A;  2E9X B;  1D0X A;  4Z90 A;  4XZC A;  3LK3 B;  2YN6 A;  3T1Y T;  2E8I A;  1KF6 A;  4X66 T;  2X9H A;  4G63 A;  4LF6 T;  3KV4 A;  2W63 A;  3T1H T;  3EAM A;  3K8P C;  2JIW A;  2K24 A;  3EAB A;  5LJM A;  3P4Q A;  1X9B A;  4O4J E;  2X0L B;  3UU8 A;  2WBL A;  3ZMT B;  3AA1 B;  4B3M T;  2YK0 A;  4YHJ A;  3L09 A;  3UTK A;  2E9X C;  4ILC A;  4X20 E;  4HFH A;  1VRB A;  1G73 A;  3E08 A;  2BBH A;  2KT9 A;  1I6Z A;  2ES0 A;  3C51 A;  3Q5E A;  2AXD S;  1ZV4 X;  2ZM2 A;  3Q5X A;  1BR4 A;  4DR1 T;  3A8Y C;  4DV7 T;  2CHO A;  2XPK A;  3OJA A;  3LBX B;  3AAI A;  2H88 A;  5JDM A;  1D0Y A;  4DND A;  5J2U E;  5LGU B;  4GKJ T;  4HFI A;  3ZN0 B;  3RKG A;  1QUU A;  4PK4 A;  3UUN A;  4J2C A;  1XDO A;  4I43 B;  5FVK A;  3ZT6 A;  5CA0 E;  2D2S A;  1W0B A;  5HCM A;  2VK9 A;  1CUN A;  4EED A;  4DUZ T;  4Z91 A;  1FIO A;  4IE5 A;  4QH1 A;  5FKY A;  3AE3 A;  2OLT A;  3CWZ B;  4YSY A;  2K3W A;  3PUQ A;  3RYC E;  4CXW A;  4CN6 A;  4QWN B;  5C2T A;  3RYI E;  4A97 A;  1FJG T;  1NEN A;  3AEB A;  5LG3 A;  3O1H A;  4H9N C;  2VKD A;  4TZ4 C;  4DR4 T;  3IA3 A;  5KX5 E;  2JRK A;  5FVL A;  3RHW A;  4HKA A;  3ZKR A;  3M65 A;  2ZM0 A;  3ESL A;  3UUB A;  2WU2 A;  2NR4 A;  2DL1 A;  3RC8 A;  5LYJ E;  3ZYM A;  3ZJ2 A;  5JDL A;  5AQQ B;  2UXD T;  3O4X E;  2CWY A;  3CVR A;  5CFB A;  4MFR A;  3JCF A;  5LGT B;  3C4X A;  4IGU A;  5L47 A;  3AE2 A;  2J47 A;  5FXX A;  4UF0 B;  3S4U A;  2Q9Q A;  1IBL T;  4EOZ B;  5IYZ E;  5JDH A;  2FJB A;  5C3J A;  5JTG A;  2I0M A;  4LF5 T;  5HXR A;  4DBR A;  4B3T T;  2UXB T;  1E7P A;  1ZOY A;  5L3B B;  2LSK A;  2ZM8 A;  2CLY B;  5AFU L;  4UEM A;  5HEO A;  5LGN B;  3AAA B;  3J9X 1;  5FY1 A;  4EV6 A;  3O9X A;  3HKC E;  4JV5 T;  3PUY F;  2E5V A;  3PUG A;  3HA4 A;  3WAJ A;  2VL8 A;  3ZEF B;  2Y48 B;  1MND A;  2UXN B;  5L4H A;  5KMG P;  4K0U A;  3FBZ A;  3P50 A;  3FZH B;  3A5X A;  1HNZ T;  2C5K T;  5AQK B;  3D0T A;  4ZEY A;  1NAF A;  1BR2 A;  3N9M A;  5AQN B;  1IJ6 A;  1YQ3 A;  1HG5 A;  4U3C A;  4OYJ A;  3ZCI A;  2DHR A;  4LF8 T;  2WP9 A;  4WZX A;  2WY2 A;  2W67 A;  4GK5 E;  3P4R A;  3E0Z A;  4ZI3 D;  2CXF A;  2XAJ B;  2HPJ A;  4HGA A;  4IL4 A;  5AQI B;  4QH4 A;  4ERR A;  4X62 T;  1Y64 B;  2ODV A;  3CKD A;  3AEA A;  4LFC T;  2Q9Q B;  3TLS A;  3IHR A;  3KV9 A;  2V7L A;  4EAH A;  3AA6 B;  1UK5 A;  4ZS3 A;  4Q25 A;  3RLF F;  1KFY A;  1JNR A;  4A98 A;  4COF A;  4HFD A;  4U7I A;  1WCR A;  2EHO C;  3N2O A;  5EK4 A;  2B76 A;  2PJQ A;  2UUA T;  2UUB T;  4AI6 A;  3CQX C;  3GA8 A;  1HTJ F;  5FY0 A;  1NWM X;  2LOS A;  3NWI A;  4LFB T;  4LMJ A;  4KP3 C;  4JBW F;  5HAX A;  3WI3 A;  2W4X A;  4C90 A;  1DU2 A;  1M7K A;  3IEE A;  3ONX A;  3UQ7 A;  4YSX A;  3ZLI A;  5E0O A;  3UT5 E;  2C5I T;  4PJL A;  4HN9 A;  2V7J A;  2HN2 A;  4NXN T;  3ANW A;  2JMK A;  4YLH A;  3RIF A;  3I0Q A;  4CXY A;  4AQF C;  4LF4 T;  2DWG A;  4JI8 T;  5HYA A;  2LM9 A;  2XJ7 A;  1J5E T;  4AKR B;  5KDM C;  2XQY A;  5JR9 C;  4JI7 T;  1LVK A;  5FNV E;  1MMA A;  2YOE A;  2LLY A;  5FXV A;  3RKO A;  2VUR A;  1MMD A;  2XZE A;  4OYK A;  3HR0 A;  4U2Y A;  2Q9Q D;  1OXZ A;  1T8B A;  2E9X A;  4PNI A;  3RIU C;  2KXP B;  3U78 A;  5LXT E;  2N2N A;  3RI5 A;  1E2A A;  4XAX B;  2N9D A;  1MNE A;  5CB4 E;  2J62 A;  1HG2 A;  2Y6X A;  2JJ9 A;  5HEU A;  2DI4 A;  4X64 T;  3EHZ A;  5F5W A;  3MA9 A;  2FJD A;  1HR0 T;  5IHY A;  1ZEE A;  3PUR A;  3L8R A;  4M1P A;  4TNV A;  3Q5W A;  2CM0 A;  4X65 T;  2WMN A;  2LJL A;  5LG4 A;  4AKG A;  4DUY T;  1VCT A;  2WDR A;  2V8S V;  3LBX A;  2JQH A;  1MIY A;  3UU3 A;  1BR1 A;  3E22 E;  4JI1 T;  3RH3 A;  3UUM A;  1J1J A;  3AEG A;  2V7I A;  4NPP A;  2NW9 A;  4BJM A;  1XNQ T;  3UFE A;  2KMF A;  3C98 B;  3IF8 B;  3ANW B;  4OX9 T;  3QUJ A;  5LMN T;  3AEC A;  1ZKE A;  4CN4 A;  1D0Z A;  4G2A A;  4UVB B;  4DV1 T;  2L8K A;  1EZ3 A;  3OBV E;  2X51 A;  3ZYK A;  3VR9 A;  5JRE A;  5JDQ A;  1WR6 A;  4YT0 A;  2JQK A;  2V1D B;  2LHN A;  3JC6 C;  4DV0 T;  2YDS A;  2NOX A;  4DBQ A;  1NEK A;  1ZP0 A;  2WDV A;  3I1A A;  3RC3 A;  3C4W A;  3NVO A;  3I9W A;  2PBI A;  1SA0 E;  2CA5 A;  3V5U A;  2FUP A;  4U7Y A;  4QXB B;  1JNZ A;  4AIU A;  2V7M A;  4CN1 A;  3N2G E;  2VKH A;  4ANJ A;  2X0Y A;  4E7S A;  4MBQ A;  5LHG B;  2D0U A;  3AE4 A;  4JI3 T;  5L3F B;  2WB5 A;  5DQW A;  4AQY T;  2VL0 A;  2DWK A;  3LJC A;  5ABF A;  2ZMA A;  2IHR 1;  4N78 D;  2XY8 B;  3NKZ A;  2WMO A;  3KBU A;  5JDF A;  4YJ2 E;  3AE1 A;  3FZM B;  2ACX A;  1V9D A;  5JVD E;  3CK6 A;  1CHU A;  3JAD A;  4UF0 A;  3AE8 A;  4DV4 T;  3ZST A;  3BQL A;  1B7T A;  4WNK A;  3KDS E;  2CCQ A;  3NZP A;  4LF7 T;  2LT3 A;  3U3I A;  4DR7 T;  3KV6 A;  3VU7 H;  4TWD A;  1HNW T;  3P4S A;  3AXJ B;  3ZMV B;  2KND A;  4GOU A;  4O4H E;  2XAQ B;  3JAF A;  1VCS A;  2J4G A;  3AVS A;  4L9I A;  4PK6 A;  4UV9 B;  4LFA T;  5LMU T;  4IDP A;  5FY7 A;  5LBQ B;  1WFD A;  2VVS A;  5L3E B;  2HPL A;  2E9X D;  4AXP A;  4PJM A;  1MMG A;  2XQ7 A;  4JYA T;  4ILA A;  3H3M A;  2P9B A;  3LSV A;  1KNR A;  2QRX A;  4K0K T;  3N2K E;  4UEL A;  2XSB A;  4U33 A;  4ZHQ E;  5ABG A;  4HE8 A;  4I50 E;  2D0T A;  4ILU A;  4DID B;  3TKL B;  2ZM6 T;  2V7K A;  3H3A A;  2PG8 A;  3LK2 B;  5LOV E;  4O8S A;  5AQS B;  2HHH T;  3PUV F;  3HKD E;  3UU4 A;  2LEH A;  2CMR A;  4JEH B;  4ZI7 E;  4I4T E;  2BBJ A;  3I0O A;  4HWI B;  1I94 T;  1L0V A;  4H9R C;  3R6N A;  2EHO A;  4DVD A;  5ABF B;  1Z8U A;  2LOP A;  1US7 B;  3ABV A;  3RQW A;  2H7O A;  2XAH B;  3QOF A;  2D9D A;  2QGS A;  3LFM A;  3UUX B;  4IDZ A;  4IST A;  2XQ9 A;  2XHE B;  3ZYL A;  4QKN A;  4HWC A;  4WBN E;  5CGM A;  3P4W A;  4UV8 B;  2YDQ A;  3BK9 A;  2V26 A;  3AA0 B;  3C64 A;  4HTE A;  4TNW A;  4DR6 T;  3ZCJ A;  4TWF A;  3SWH A;  2A9U A;  2OV9 A;  3RGL A;  4TX5 A;  2M67 A;  4AQF A;  2IML A;  3AE9 A;  1XMO T;  3PUS A;  2E5L T;  4AKL A;  2VAS A;  2WCA A;  5HEJ A;  3GMI A;  3NRX A;  4H63 H;  2IC9 A;  3B13 A;  4AKH A;  2CWO A;  2GK9 A;  5JR9 A;  1XZY A;  5JRC B;  5JDN A;  2A3D A;  4H9O C;  2CE7 A;  3N9O A;  4X1Y E;  5AQT B;  4DR3 T;  4YSZ A;  4CI3 B;  3X1D A;  4EB6 E;  1OED C;  5AQU B;  2YKS A;  2I6H A;  2DCF A;  2D5U A;  3EDV A;  3J7Y q;  2NP9 A;  2M6I A;  4IDQ A;  4O4L E;  5AQH B;  1W0A A;  5JDG A;  5FXZ A;  3GWH A;  2LRK A;  3TLU A;  3KV5 A;  3VRA A;  3DP7 A;  5LB7 B;  2WWV A;  3N5L A;  4CI1 B;  5HXC A;  4NUU A;  2EHO B;  4YY3 T;  3C4Z A;  3L3P A;  5LCY A;  4TV9 E;  3MXZ A;  4F6R C;  1YD8 G;  4DR2 T;  1WRD A;  3P4P A;  2CXL A;  2BS4 A;  5AQO B;  2PTF A;  5LHI B;  4JLE A;  1HX8 A;  3ZPO A;  1KK7 A;  5BMV E;  3K3O A;  1LVF A; 
#chains in the Genus database with same CATH homology
 5DAB A;  3SRZ A;  1ZHC A;  2BDE A;  4O4J E;  4NUV A;  5IHY A;  3HL6 A;  2X0L B;  1ZEE A;  3PU3 A;  2WBL A;  3PUR A;  3RYF E;  5M4Y A;  2DLR A;  3ZMT B;  4M1P A;  1T98 A;  3AA1 B;  1IAP A;  3FXE B;  2YK0 A;  4YHJ A;  3L09 A;  3UTK A;  2X68 A;  2E9X C;  4X20 E;  3Q5W A;  1VRB A;  3KVB A;  1G73 A;  4PFO A;  3B57 A;  4U72 A;  4O2B E;  3E08 A;  2MTQ A;  3FHN A;  3ZMS B;  3O1I A;  2KT9 A;  2CM0 A;  2ES0 A;  2WMN A;  3C51 A;  2LJL A;  1UX4 A;  4OFZ A;  1ZV4 X;  2ZM2 A;  3Q5X A;  5LG4 A;  1BR4 A;  4AKG A;  3GN5 A;  2NWB A;  3OJA A;  4FI5 A;  3LBX B;  4XBF B;  3AAI A;  5JDM A;  1S35 A;  4PJN A;  3LBX A;  3N9L A;  3T8O A;  1D0Y A;  1MIY A;  5DQV A;  4DND A;  2X9Y A;  5J2U E;  1BR1 A;  2KLQ A;  5LGU B;  2UXX B;  3E22 E;  5JR9 B;  3RH3 A;  5HWX A;  3ZN0 B;  4HFV A;  3UUM A;  1QUU A;  4PW8 A;  1AJ3 A;  2V7I A;  4PK4 A;  4TN7 B;  3UUN A;  2MBG A;  2NW9 A;  4BJM A;  3RX6 A;  4J2C A;  4I43 B;  4PFP A;  4O2A E;  3UFE A;  4U74 A;  5CA0 E;  2KMF A;  3C98 B;  3IF8 B;  5CA1 E;  5GON E;  2D2S A;  1QSD A;  3ANW B;  2Y8D A;  3QUJ A;  3F57 A;  1YKE B;  1ZKE A;  3HKE E;  1HF8 A;  1D0Z A;  4MLK A;  4G2A A;  5HWY A;  3PDY A;  4GIW A;  5EK2 A;  4ZI3 C;  3ZC1 A;  4UVB B;  2VK9 A;  2JMH A;  5FYM A;  5A1L A;  1CUN A;  3SOL A;  1FIO A;  4IE5 A;  2L8K A;  2RA1 A;  3VKH A;  4ZOL E;  2MOZ A;  2WM9 A;  2EHO D;  4GYR A;  1EZ3 A;  3Q9D A;  3K3N A;  3OBV E;  4QXC B;  2X51 A;  3CWZ B;  3ZYK A;  3PUA A;  3MZK B;  4H9S E;  5JRE A;  4EIW A;  5H6R B;  3PUQ A;  3LG7 A;  3RYC E;  3N9P A;  4CXW A;  5JDQ A;  1WR6 A;  4H63 V;  1FMV A;  3I9Y A;  4QWN B;  3RYI E;  3RYH E;  2CLY C;  1G8X A;  1WYC A;  2V1D B;  4IE0 A;  1MIW A;  2LHN A;  2ZLY A;  3JC6 C;  2CEA A;  4P0B A;  4MHC A;  3O1H A;  4JEU B;  2LSJ A;  2G0U A;  2X66 A;  2I59 A;  2NOX A;  5HXE A;  5LNK A;  4DBQ A;  4H9N C;  2VKD A;  4TZ4 C;  3RC3 A;  3I1A A;  3C4W A;  5EZY E;  5KX5 E;  2XUE A;  3I9W A;  2NW8 A;  3F31 A;  1YKH B;  2JRK A;  2W0G A;  3UUL A;  3V5S A;  2PBI A;  1SA0 E;  4HKA A;  2ODU A;  4OK0 A;  2CA5 A;  3V5U A;  4OHF A;  2KIN B;  4QXB B;  3M65 A;  2BVL A;  2ZM0 A;  3ESL A;  2V7M A;  3FB2 A;  4IE4 A;  4UXN B;  3H37 A;  3N2G E;  2VKH A;  4ANJ A;  3RC8 A;  2W61 A;  4QX8 B;  3AA7 B;  5LYJ E;  4E7S A;  3ZYM A;  3ZJ2 A;  2KWH A;  5JDL A;  4MBQ A;  3OYX A;  2H7V C;  4BJN A;  4PK5 A;  2C0S A;  2D0U A;  3O1J A;  3QC9 A;  5LHG B;  3AB3 B;  5FXW A;  3CX8 B;  3O4X E;  2K9A A;  2CWY A;  3CVR A;  4MFR A;  4A56 A;  5L3F B;  5DQW A;  1H7C A;  4I55 E;  4CXX A;  5LGT B;  1MIV A;  2DWK A;  5J2T E;  3LJC A;  3C4X A;  2CXD A;  4V1A v;  4BA9 A;  2VKJ A;  2ZMA A;  2WWU A;  4WW0 A;  4N78 D;  2IW5 B;  1Z0P A;  4IGU A;  3SS1 A;  2WMO A;  2YU1 A;  3KBU A;  4DMV A;  1FMW A;  5JDF A;  3OKQ A;  4YJ2 E;  2W62 A;  4CZZ B;  2ACX A;  3LK4 2;  1V9D A;  5JVD E;  1S94 A;  5FXX A;  5LA6 E;  4UF0 B;  4BAY B;  3GN5 B;  4QHO A;  3CQG B;  3S4U A;  4UF0 A;  4B6X A;  2HH7 A;  2B1E A;  5ETW A;  2Q9Q A;  5JH7 E;  2QA7 A;  4O4I E;  4EOZ B;  2NTX A;  5IYZ E;  5JDH A;  3FBL A;  3BQL A;  2C5J A;  1B7T A;  1MMN A;  4WNK A;  2X9W A;  3KDS E;  2CCQ A;  5HXR A;  5TAO A;  1WLX A;  1D1C A;  3CPZ A;  4DBR A;  2NTY A;  1VOM A;  2KWI B;  2LT3 A;  3NZP A;  3U3I A;  4ASK A;  4EYU A;  4YJ3 E;  3KV6 A;  3VU7 H;  5L3B B;  5EK3 A;  4ADZ A;  4ZI2 C;  4L0R A;  2LSK A;  2ZM8 A;  2K5B B;  3ZMV B;  2XAG B;  1LRZ A;  2CLY B;  4GK0 E;  2KND A;  3P7I A;  4GOU A;  5AFU L;  4UEM A;  2BZB A;  3ZMZ B;  3EVY A;  5FP3 A;  5LGN B;  4O4H E;  3MJX A;  2XAQ B;  3AAA B;  3MAC A;  3J9X 1;  5FY1 A;  4DMW A;  3AVS A;  3KIN B;  2YIN A;  4L9I A;  3N9N A;  3O9X A;  2Q9Q C;  2LE8 A;  4PK6 A;  4UV9 B;  3HKC E;  3PE0 A;  2J1D G;  2BVM A;  2VB6 A;  3MKD A;  5FY7 A;  5LBQ B;  1LKX A;  1U4Q A;  3PUG A;  5L3E B;  1D1B A;  3ETU A;  3C50 A;  4WBO A;  2HPL A;  2VKO A;  2E9X D;  2KZ7 B;  3HA4 A;  4PJM A;  4AXP A;  3WAJ A;  2H3R A;  4QXH B;  1E1H B;  2VL8 A;  3ZEF B;  1MMG A;  5L3G B;  5C8Y E;  5L2L A;  3IBP A;  2K48 A;  2P9B A;  2Y48 B;  1MND A;  2UXN B;  2PFV A;  3N2K E;  5KMG P;  4UEL A;  3F2E A;  2WAU A;  4ZHQ E;  4K0U A;  3FBZ A;  1SHZ C;  4HE8 A;  1FEW A;  4I50 E;  5F8P A;  4EYY R;  3HKB E;  3HI2 A;  2D0T A;  3A5X A;  4ILU A;  1O3X A;  3TKL B;  5JQG E;  2L9Q A;  2V7K A;  3H3A A;  2PG8 A;  3DJB A;  3LK2 B;  5LOV E;  4O8S A;  2C5K T;  2YEV C;  3D0T A;  3HKD E;  2SPC A;  4QX7 B;  3ETV A;  4H9Q C;  4C91 A;  1NAF A;  1BR2 A;  1X79 A;  2JPF A;  3CML A;  3N9M A;  1D1A A;  3NZQ A;  1IJ6 A;  2MYS A;  1UCU A;  2LEH A;  2CMR A;  4JEH B;  4TV8 E;  4ZI7 E;  1HG5 A;  4I4T E;  4EXT A;  4JUY A;  4OYJ A;  3ZCI A;  2DHR A;  3AVR A;  2LSI A;  3I0O A;  4GK5 E;  5L3D B;  3E0Z A;  4ZI3 D;  4H9R C;  3R6N A;  2CXF A;  2EHO A;  5LHH B;  2XAJ B;  4DVD A;  4AQG A;  4FJO A;  3VHL A;  2HPJ A;  2LOP A;  1US7 B;  2Z6E A;  1IZN B;  3P8C D;  4HGA A;  2H7O A;  2XAH B;  3K3Q C;  2QGS A;  3LFM A;  3UUX B;  4ERR A;  5F3J A;  1KNZ A;  3ZN1 B;  1OWA A;  4H9P C;  4IDZ A;  4IST A;  1Y64 B;  4IE7 A;  2XHE B;  3ZC0 A;  2ODV A;  1HCI A;  3CKD A;  2JQQ A;  5J1G A;  2A72 A;  3ZMU B;  2L3L A;  3ZYL A;  3FXD B;  2Q9Q B;  4HEA A;  3JC6 D;  3BQI A;  4QKN A;  2YU2 A;  3IHR A;  3KV9 A;  2V7L A;  4EAH A;  4WBN E;  4UV8 B;  3AA6 B;  4YFS A;  4ZS3 A;  2LSG A;  3BK9 A;  3MK7 C;  2V26 A;  3AA0 B;  2X9X A;  3C64 A;  4HTE A;  3CX6 B;  3ZCJ A;  4UIG A;  5H6Q B;  2EHO C;  3N2O A;  5EK4 A;  5LP6 E;  5LBM A;  3BQK A;  3RRC A;  3SWH A;  4IIJ E;  3NRY A;  3AAE B;  4TX5 A;  4TUY E;  2M67 A;  2PJQ A;  3R84 B;  5LJN A;  2OA5 A;  4MAL A;  4AQF A;  4AI6 A;  4EZH A;  3CQX C;  3GA8 A;  1HTJ F;  5FY0 A;  4P0A A;  3PUS A;  3KVA A;  3PTR B;  4AKL A;  4CI2 B;  3PU8 A;  1NWM X;  2LOS A;  2RP4 A;  2VAS A;  2LSY A;  3GMI A;  3NRX A;  4H63 H;  4KP3 C;  2IC9 A;  3B13 A;  3RRW A;  4AKH A;  1WYB A;  2CWO A;  2GK9 A;  4PJJ A;  4UVA B;  5JR9 A;  5HAX A;  3WI3 A;  5JRC B;  4C90 A;  1HFA A;  3IEE A;  3ONX A;  5JDN A;  4AKI A;  1BR0 A;  5JRC A;  2A3D A;  3RPU A;  3KFW X;  4H9O C;  2LHR A;  4ISS A;  2CE7 A;  3ZLI A;  3N9O A;  4X1Y E;  4IHJ E;  2A2F X;  4X1I E;  4CQI A;  1HS7 A;  5E0O A;  3UT5 E;  2C5I T;  4PJL A;  4HN9 A;  2NW7 A;  2IC6 A;  3CX7 B;  3QK6 A;  2V7J A;  3NBX X;  3ANW A;  2JMK A;  3EDU A;  4YLH A;  3WAK A;  4CXY A;  3I0Q A;  4AQF C;  4CI3 B;  2DWG A;  3CQC B;  5HXH A;  3N9Q A;  5HYA A;  2LM9 A;  3OYZ A;  3VKG A;  4EB6 E;  5FMN A;  5HXS A;  1U5P A;  2DCF A;  2D5U A;  3EDV A;  4AKR B;  5KDM C;  3J7Y q;  2NP9 A;  4X1K E;  4O4L E;  5DJQ C;  2W00 A;  2XQY A;  4PAG A;  5JR9 C;  5JDG A;  4DO0 A;  5FXZ A;  4ZI2 D;  3GWH A;  5L3C B;  3KBT A;  4E7Z A;  1LVK A;  2WSS V;  5FNV E;  1MMA A;  3DTO A;  1YW0 A;  3KV5 A;  3DP7 A;  4IE6 A;  5FXV A;  3N5L A;  4CI1 B;  3RKO A;  5ADX L;  2DNX A;  1MMD A;  2XAS B;  4OYK A;  2XTL A;  2N1G A;  3HR0 A;  2XAF B;  5HXC A;  4ZS2 A;  1UX5 A;  2Q9Q D;  4Z8X A;  4EZ4 A;  2VWA A;  1OXZ A;  2E9X B;  4NUU A;  4UVC B;  1D0X A;  2E9X A;  4PNI A;  2EHO B;  4P09 A;  4XZC A;  2KXP B;  3W15 B;  3U78 A;  5LXT E;  3C4Z A;  3L3P A;  3LK3 B;  2N2N A;  5LCY A;  2E8I A;  4KBM B;  4TV9 E;  3MXZ A;  4F6R C;  1YD8 G;  4L5G A;  4XAX B;  2N9D A;  2X9H A;  3Q2M A;  4G63 A;  1IJ5 A;  3ZJ1 A;  1WRD A;  3KV4 A;  2CXL A;  2W63 A;  4KMC A;  1MNE A;  2IAK A;  3EUH A;  5LHI B;  4JLE A;  2X67 A;  3K8P C;  5CB4 E;  4KUM B;  1HX8 A;  3ZPO A;  1HG2 A;  2Y6X A;  1KK7 A;  2JJ9 A;  5BMV E;  2K24 A;  3K3O A;  2DI4 A;  1LVF A;  4GYS A;  5LJM A;  3MA9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...