2CLYB

Subcomplex of the stator of bovine mitochondrial atp synthase
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
120
structure length
120
Chain Sequence
b'KLALKTIDWVAFGEIIPRNQKAVANSLKSWNETLTSRLATLPEKPPAIDWAYYKANVAKAGLVDDFEKKFNALKVPIPEDKYTAQVDAEEKEDVKSCAEFLTQSKTRIQEYEKELEKMRN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ATP SYNTHASE B CHAIN, MITOCHONDRIAL
publication title On the Structure of the Stator of the Mitochondrial ATP Synthase.
pubmed doi rcsb
source organism Bos taurus
molecule tags Hydrolase
total genus 36
structure length 120
sequence length 120
chains with identical sequence E
ec nomenclature ec 3.6.3.14: Transferred entry: 7.1.2.2.
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF05873 Mt_ATP-synt_D ATP synthase D chain, mitochondrial (ATP5H)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.880 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Methane Monooxygenase Hydroxylase; Chain G, domain 1 2clyB00
2CLYB
chains in the Genus database with same CATH superfamily
4DV4T 3VRBA 3K8PC 2JRKA 4XAXB 3J9X1 1BR4A 2OV9A 3Q9DA 3S4UA 5L4HA 1FMVA 3C4XA 4IHJE 5HXEA 3Q5DA 2DI4A 4ILAA 3QK6A 5L2LA 4HGAA 2JIWA 2KT9A 5JVDE 5HXHA 3ZC0A 5H6RB 4DR5T 2L3LA 2VKJA 3RHWA 5ABHA 2X0HA 4AQYT 5DJQC 5L4EA 1XMQT 4ZI2D 4TNVA 4A56A 4IE5A 1G73A 1NENA 4GOUA 3C50A 3TLSA 2LSIA 3T8OA 1KEYA 1O3XA 2V5CA 4QX8B 5EK2A 4B3ST 2W62A 5FVKA 1WFDA 3H3AA 4HE8A 2MOZA 3PUYF 5AQVB 2L8KA 1YKHB 2AXDS 1J1JA 3O1JA 1SA0E 3AAAB 1W9RA 1HS7A 3L3PA 3KFWX 2LOSA 2CBIA 3ZJ1A 3AE2A 2NP9A 4JI6T 1T72A 5JDGA 3I9YA 3ZPOA 3BQIA 1IJ5A 2WY2A 2LKHA 5AQLB 2DNXA 3ZT6A 4YHHT 4LMKA 4QX7B 5IHYA 2D5UA 3RYCE 4OYJA 3FXDB 3NBXX 4AQFC 5LNKA 3SFDA 5FY7A 1YQ3A 3FZMB 4YLHA 2Y6XA 3NZQA 2VB6A 2FBWA 5KX5E 4ZHQE 1LKXA 1XNQT 3WI3A 5DABA 5DQVA 4DV5T 5L3CB 4C90A 1OEDA 2PTFA 2IDOB 3TLTA 4QH4A 4QXBB 3EUHA 4U7IA 3U78A 3KINB 4LF4T 1ZKEA 3LK3B 1I94T 2XQ6A 3OYZA 3RKOA 2IIUA 3VHLA 3DJBA 4UV8B 3CMLA 2E5LT 4PAGA 5EK3A 2AE9A 1GQEA 4WBOA 2RPAA 3PU8A 3ZJ2A 3QUJA 4PJLA 4YSXA 5FXVA 4AIUA 4CI1B 1B7TA 5LXTE 2BS2A 2IUBA 5LGNB 4DUZT 1KFYA 2VVNA 3FZKB 2K48A 4QHOA 4O2BE 4YXDA 3UTKA 2D0TA 5KDMC 1YKEB 3UQ4A 4ZI2C 4IE0A 5JR9A 3KDSE 3O1HA 3IEEA 5FYMA 2XQ9A 3KVAA 5L3EB 2V8SV 3HKCE 3PU3A 3IHRA 2WWVA 3HKBE 2XQ7A 4GIWA 4IDQA 5HAXA 4JEUB 4QWNB 2P9BA 5FL0A 5CFBA 2VQET 2XPKA 3N9NA 5JDNA 3ZYKA 4ZI3D 3F31A 4DR7T 3PE0A 2CM0A 3RX6A 4EV6A 4KHPT 1WRDA 4X62T 2A3DA 4AKHA 1LVKA 3UQ7A 3Q2MA 3UUMA 2RP4A 3RC3A 3QB5K 3AEAA 1VRBA 4L0RA 5AQHB 3RLFF 1HNZT 2MBGA 2RA1A 1SE7A 1IJ6A 5H6QB 3AEBA 4ASKA 2M6BA 5EK4A 4O4HE 2H89A 2V6YA 2E5VA 2V6XA 2WZIA 1WYCA 5LG4A 2LKGA 3GWHA 2QVAA 1U4QA 5J2TE 4WBNE 3NWIA 4U3CA 2KXPB 2X9HA 3C4WA 3DTOA 3O9XA 2MTQA 4YFSA 4PNIA 5FKYA 2N2NA 3NRXA 1JNZA 1KF6A 4GK0E 3HKDE 5ABFA 3AE4A 3AA6B 4N78D 4JYAT 2VL0A 3VRAA 2Y8DA 3ZLIA 2E9XC 4WZXA 2NW9A 1D0ZA 3AE7A 3RGLA 1J5WA 4YHJA 2I6HA 4HFIA 3P50A 4EAHA 2ZM0A 3AVRA 4HFEA 5LA6E 5HWXA 3TLVA 1HX8A 2C5KT 5AQTB 1MIYA 3LJCA 2UUAT 3EDUA 3K3NA 4F8HA 2CA5A 4HEAA 1Z0PA 5JDHA 4PJJA 1UK5A 3PUVF 1SHZC 2W63A 2WMOA 4KI0F 3RIFA 3VU7H 2LRKA 1Z8UA 3FB2A 4K0UA 4L5GA 3BQKA 4BA9A 4U7YA 3ETUA 5L3FB 4ADZA 2WBLA 4NUVA 5LG3A 3ZSTA 4NIQA 4O4IE 4B3MT 2NTYA 1HTJF 3O1IA 2CHNA 2XHEB 4H9OC 1D0XA 5LBQB 4U2YA 2Q9QA 4WW0A 1MMDA 4ZI3C 1XZYA 3N9QA 2QGSA 4LF6T 3B13A 2XZEA 4CQIA 3ZT7A 5AQFB 1CHUA 1V9DA 3ZN0B 3UT5E 2CXFA 4MFRA 4TX5A 1DU2A 2MYSA 3MK7C 2XTLA 2WWUA 2XJ7A 3FZLB 3AE3A 3PUXF 4YTPA 4JUYA 2WQYA 4Z8XA 1XWMA 3PJAA 4YTNA 2I0MA 4Z90A 3VKHA 4H9NC 2XAJB 1N32T 5F3JA 2XAGB 1HG5A 2X9WA 2F4VT 3CK6A 2V1DB 4LMJA 3AAEB 1H7CA 4QH5A 4IDZA 2WAUA 2DHRA 4KMCA 2K5BB 5AQNB 4UEMA 3RH3A 4E7ZA 4BAYB 4WYVA 4DV1T 1ZHCA 2PFVA 3R84B 2XAHB 3GMIA 3NRYA 3E08A 2XASB 2YN6A 2E9XB 3P7IA 4P09A 4HN9A 2D2SA 2LSJA 1EZ3A 2KWIB 5JREA 4EIWA 3E22E 2SPCA 4XBFB 2X0YA 4G2AA 1I6ZA 4X1KE 4UVAB 3ZMVB 3RQWA 3J7Yq 3VR8A 2IHR1 3FXEB 3P8CD 5DQWA 5AQIB 4PK6A 2JMHA 4ERRA 3G06A 1BR2A 2XAFB 4YJ3E 2H3RA 2X9XA 3UFGA 3UU6A 1IAPA 3M3ZB 3C64A 1OEDC 3K3OA 4H9QC 3LFMA 1HX1B 5ETWA 5AQUB 3P4WA 3P4SA 4PW8A 2VASA 2DCFA 5LJMA 3L39A 4ANJA 4OFZA 2QA7A 3LDQB 5F8PA 4DUYT 2CMRA 1IBMT 4GKKT 5HWYA 2HPJA 4PJMA 2WMNA 4I4TE 3AE1A 3A7MA 3N9OA 4DBQA 4ISSA 1HNXT 3C4ZA 3RPUA 2K3WA 3PUSA 4I43B 3ANWA 4AQGA 4O4JE 1KNPA 3PURA 1WYBA 1HNWT 2XM1A 2ZLYA 3ZMSB 3I0QA 2C5JA 1M62A 4CI2B 4ZEYA 1G8XA 4HTEA 5JR9C 2UU9T 3RI5A 5HEOA 1KK7A 5EZYE 3EAMA 2HHHT 2CXDA 3OYXA 5CJ5A 4X64T 2A2FX 2KMFA 3P4QA 5A1LA 1YD8G 5HXCA 4LFAT 3KVBA 2CCQA 3Q5XA 5FNVE 3NKZA 1XNRT 1N33T 5J0ZA 1IZNB 3ZMTB 4PFOA 4I55E 4NXNT 4GK5E 2FJAA 3UU4A 4EXTA 2Q9QD 3CVRA 3MACA 3AEEA 1Y01A 3V5SA 4H9SE 2ZM8A 2CLYC 2LE8A 3WAKA 2JQHA 4O2AE 3N9LA 5M4YA 3MKDA 3V5UA 3QNUA 1ZOYA 1MNEA 3EHZA 4MBQA 2BG9E 5BMVE 2J47A 3N5LA 3ZMUB 4TWDA 4TV9E 2NW7A 3RRWA 2BZBA 2N9DA 4EGWA 4ZZBA 4IL4A 2VK9A 1J5ET 3SFEA 1OEDB 4DO0A 1M7KA 5LMUT 2XQ4A 1UGOA 2GK9A 2B1EA 2YK0A 3TKLB 3ONJA 4AXPA 3B5MA 2C0SA 3AE8A 3OPCA 1W0AA 3NVOA 3SS1A 1X9BA 2V26A 3H37A 4U72A 4CXWA 4CN1A 4EZ4A 5IYZE 5JRCB 3KV4A 4MHCA 3PUGA 3JAFA 4ILCA 3UUBA 2KINB 3C98B 2V7MA 1IBLT 1QSDA 3IF8B 2VQFT 1FMWA 2V7KA 2K24A 1IBKT 3P4PA 2K9AA 3AA7B 2ZMAA 1NAFA 2LSKA 2X0LB 4ZXLA 2J1DG 2E2AA 3PV0F 3UUNA 3OTOT 2JQKA 2LHNA 4M1PA 3ZSSA 5KMGP 5JR9B 4LF7T 2CWOA 1T7SA 2G0UA 1BR1A 4AI6A 3CX7B 1E1HB 2MAWA 5LBMA 4IIJE 4X1YE 4IGUA 5E0OA 3SRZA 4EYYR 4AKRB 3KBTA 1HG2A 2NW8A 3PUWF 1D0YA 1QUUA 4IT4A 5L3BB 4X65T 3VR9A 2Q9QC 3PUAA 4Z91A 3FHNA 2XQ8A 4L9IA 1WR0A 4ZI7E 4Q25A 2CBJA 3CX6B 2YEVC 4JI8T 1E2AA 4DNDA 1MNDA 4GKJT 5AQQB 4P1NA 2VKDA 2CLYB 2H88A 4TNWA 3UU3A 2WP9A 4QXCB 4DR4T 1ZP0A 1Y64B 4X5TA 4LFCT 4YSZA 4HWCA 4X66T 2LEHA 3LBXA 5AQMB 4X20E 2ZM6T 3I9WA 2UXBT 4UF0A 4UVCB 2WZHA 4KP3C 4HFBA 1UX5A 3AXJA 3ZMZB 3D0TA 3RYHE 2X66A 2LLYA 4NUUA 2WDVA 4OX9T 3KV5A 3ONXA 2M67A 4TWHA 4PFPA 5BR8T 1XDPA 5ABEA 3FZHB 3TLUA 2IC6A 4OK0A 4DR6T 3LSVA 2UXCT 2XQ5A 3L8RA 1JNRA 5ABFB 2XQ3A 2WU2A 5JDLA 2D9DA 3A5XA 4DVDA 1YW0A 3JADA 2BG9A 2R6GF 4BJMA 3IBPA 2BDEA 2PJQA 3QC9A 3LK42 2CWYA 1D1CA 1HCIA 4K0KT 3H3MA 5FL1A 3FZFB 3MA9A 2VWAA 2IMLA 3E0ZA 1S94A 3HL6A 4CN6A 4DIDB 4ILBA 4KHZF 5LHGB 2MPKA 4U33A 4NPPA 1D1BA 5AQSB 1FEWA 1KNRA 2NWBA 1D1AA 2NOXA 5AQOB 2N1GA 3FBZA 4UXNB 5L3GB 2PBIA 2HH7A 4O4LE 3HR0A 4H63V 1NWMX 2DLRA 2DL1A 3UFEA 2EHOA 3SOLA 5CA1E 3K3QC 2W67A 2A9UA 4KUMB 1UCUA 3QOFA 4J2CA 2W4XA 4JI4T 2CPTA 2E9XA 2UXNB 5L47A 4F6RC 2WSSV 2BVMA 2Q9QB 1R8IA 4FI5A 4A97A 1XMOT 3RKGA 1NEKA 3PDYA 4EOZB 4HKAA 4QKNA 3T1YT 2YU1A 4CXXA 3EI0A 2NTXA 2W0GA 5HEUA 4IE6A 4H63H 4QXHB 4YT0A 2YINA 4DR1T 3HA4A 4UIGA 3PJAJ 5LGUB 3UULA 2FUPA 3F57A 2X9YA 3JC6D 3CQCB 4HFCA 4EEBA 2VKOA 1HF8A 3HKEE 5AQPB 4JEHB 3BK9A 4AKIA 4LF9T 3ZEFB 3GN5B 5AQGB 2WB5A 3KBUA 3T1HT 2J62A 1FJGT 3RYIE 3ZT5A 4DV3T 5FXWA 1T98A 3RIUA 2IC9A 1SUMB 4YY3T 3EDVA 4DV7T 3AEFA 5HEHA 3AE5A 2CHOA 2UUBT 5FP3A 1L0VA 2BKPA 3L09A 2IW5B 2KNDA 3QB5A 4IDOA 4XZCA 5CB4E 3ZCIA 2BVLA 4CXYA 5LOVE 1MMGA 4EZHA 2LM9A 2BKNA 2FJDA 4IL9A 4ISTA 4JBWF 3R6NA 5C3JA 4MLKA 3LK2B 4YJ2E 5GONE 2WM9A 2BBJA 3AVSA 4CI3B 5KXJA 5F5WA 5FXZA 3ZN1B 2ZM2A 2WU5A 1AJ3A 2V7LA 4JI3T 4MALA 5LHHB 4TUYE 2LOPA 3RQUA 5CGMA 1LVFA 4HWFA 2BS3A 2ES0A 2DWKA 3AE9A 4IE7A 3RIAA 4DMWA 4O8SA 1WR6A 3PUZF 2VURA 4GYSA 5HCMA 2XQAA 2XUEA 5JDQA 5LMNT 3AEGA 3CKDA 5FVLA 4LMLA 1HR0T 4DR2T 4IDNA 2B76A 3KV6A 4ZOLE 4ZS2A 3UUXB 4E7SA 3NZPA 3ZYMA 2L9QA 1US7B 2H7VC 2ODVA 4H9RC 4OHFA 4ZZCA 4WNKA 2XM2A 5TAOA 2E8IA 2HN1A 5FMNA 2LRLA 3TLWA 4YSYA 4EEDA 3M65A 4KBMB 2CE7A 2PG8A 1WLXA 4CZZB 2LJLA 3ANWB 5LGTB 4B3TT 3OJAA 2I59A 3AB3B 2XAQB 1MMAA 2XY8B 3JC6C 2LHRA 5ABGA 3OKQA 3JCFA 4U2ZA 1W0BA 4CN4A 3WAJA 3RC8A 4COFA 3RF1A 5LP6E 2EHOD 3JAEA 4FJOA 1T8BA 2XSAA 5JRCA 3I0OA 3A8YC 3Q5WA 3AEDA 4U31A 2E9XD 4HFDA 2HN2A 5FXXA 2WS3A 3X1DA 1VCSA 4DR3T 3CWZB 5JTGA 1XDOA 2KWHA 3UU5A 2BS4A 5JQGE 1MIVA 4IREA 4DMVA 3I1AA 2JQ9A 1WCRA 1N36T 4LF5T 3F2EA 2DWGA 3HI2A 2QRXA 2KZ7B 4UV9B 4G63A 3PTRB 3RYFE 4AQFA 4HFVA 2KLQA 1E7PA 4AISA 4DBRA 1QLBA 5HXSA 1MMNA 2W2UA 4AKLA 5JH7E 2H7OA 5J1GA 2NR4A 2YOEA 4OYKA 4U74A 2LM2A 3AAIA 1N34T 1KNZA 4ILUA 2JPFA 2ACXA 3SWHA 2V5DA 3CQGB 4P0BA 5FY0A 3P4RA 2BBHA 2D0UA 4HWHA 3ZKRA 3ABVA 5AQRB 2UXDT 2YDSA 4X1IE 3OBVE 1W09A 3ONLC 4JV5T 4JLEA 4A5XA 4DV6T 4LFBT 2BG9C 5JDFA 4YTMA 1VCTA 1YXRA 3ZYLA 1ZEEA 3CQXC 4PK5A 3EABA 5C8YE 3VKGA 3N9PA 4EYUA 1YQ4A 3AECA 2Y48B 2W61A 3K1SA 2V7IA 5C2TA 2IAKA 3N9MA 5HCJA 4GYRA 2JJ9A 4IDPA 3IA3A 2LSYA 3MXZA 3ZCJA 4ZS3A 3GA8A 2XQYA 5LYJE 3N2GE 2EHOC 2V6YB 3MZKB 4P0AA 3EVYA 4TV8E 4UELA 1VOMA 2YDQA 5IWAT 5AQJB 5AQKB 1HFAA 1BR0A 2UXXB 4HWIB 1S35A 4JI7T 1CUNA 1UX4A 2ODUA 4UVBB 1U5PA 2BKOA 4TN7B 4JI5T 2X67A 3U3IA 1FIOA 2LSGA 5HEJA 2WDQA 1OWAA 2VL8A 3B57A 3BQLA 4NXMT 3UU8A 2JMKA 4BJNA 2ACZA 3LBXB 3N2KE 4DV0T 4TZ4C 3PUQA 2WCAA 3CIRA 3ESLA 3AA0B 2CRBA 4UF0B 4V1Av 2M6IA 5AFUL 3AXJB 4I50E 3CPZA 2X68A 4AKGA 5LCYA 1LRZA 3O4XE 4A98A 4TWFA 4IE4A 5L3DB 1UURA 2YDRA 3ZC1A 4PJNA 4KX6A 2OLTA 2J4GA 2X51A 2W66A 2XSBA 4EB6E 4C91A 3RIUC 4UR9A 4LF8T 3CX8B 2A72A 5JDMA 2BG9B 2YKSA 3Q5EA 3KV9A 5J2UE 4H9PC 1OEDE 5LHIB 2FJEA 2W00A 4HFHA 4JI1T 3N2OA 2WDRA 4B6XA 3W15B 5IUXA 3OVUA 2CXLA 1OXZA 2C5IT 2HPLA 2QYWA 3FBLA 1ZV4X 1X79A 3MJXA 3C51A 5LB7B 2Z6EA 2FJBA 3AA1B 3GN5A 5ADXL 2V7JA 1MIWA 5FY1A 2EHOB 5CA0E 4B3RT 5HYAA 4QH1A 4JI0T 2CEAA 2YU2A 2VKHA 4HWDA 2VVSA 3ETVA 5LJNA 5HXRA 5HEGA 4I0UA 4PK4A 2KSRA 2LT3A 3DP7A 2UUCT 2OA5A 1UUSA 2JQQA 3RRCA 3AE6A 4DV2T 4JI2T 3LG7A
chains in the Genus database with same CATH topology
3O1IA 2G0UA 2XHEB 1BR1A 3OJAA 4AI6A 3CX7B 4H9OC 2I59A 1E1HB 1D0XA 3AB3B 5LBQB 5LBMA 2XAQB 4IIJE 3K8PC 4X1YE 4IGUA 2JRKA 4XAXB 3J9X1 5E0OA 1MMAA 2Q9QA 4WW0A 3JC6C 2LHRA 1BR4A 3SRZA 4EYYR 1MMDA 3Q9DA 4ZI3C 3S4UA 4AKRB 3OKQA 3KBTA 1FMVA 3C4XA 4IHJE 5HXEA 3N9QA 2QGSA 1HG2A 3B13A 2NW8A 2DI4A 4CQIA 1D0YA 1QUUA 3QK6A 5L3BB 5L2LA 4HGAA 1V9DA 3ZN0B 3UT5E 2CXFA 4MFRA 4TX5A 2KT9A 3WAJA 3RC8A 5JVDE 2MYSA 5HXHA 2Q9QC 3MK7C 2XTLA 3PUAA 3FHNA 3ZC0A 5H6RB 2WWUA 5LP6E 2L3LA 2VKJA 4L9IA 4JUYA 4ZI7E 2EHOD 5DJQC 4FJOA 4Z8XA 3CX6B 2YEVC 5JRCA 4ZI2D 4DNDA 3VKHA 1MNDA 3I0OA 4A56A 3Q5WA 4IE5A 4H9NC 1G73A 2VKDA 2XAJB 2CLYB 4GOUA 5F3JA 2E9XD 2XAGB 3C50A 1HG5A 5FXXA 2X9WA 2LSIA 3T8OA 2V1DB 4QXCB 1Y64B 3AAEB 1O3XA 4QX8B 5EK2A 1H7CA 4IDZA 2W62A 3CWZB 3H3AA 4HE8A 2MOZA 2KWHA 2L8KA 2LEHA 2WAUA 5JQGE 3LBXA 1MIVA 2DHRA 4KMCA 1YKHB 4DMVA 3I1AA 4X20E 3O1JA 3F2EA 3I9WA 2DWGA 1SA0E 2K5BB 4UF0A 3AAAB 4UEMA 4UVCB 3HI2A 3RH3A 4E7ZA 1HS7A 3L3PA 4KP3C 2KZ7B 1UX5A 4BAYB 1ZHCA 4UV9B 3KFWX 2PFVA 3ZMZB 3D0TA 4G63A 3PTRB 3RYFE 3RYHE 2LOSA 3R84B 3ZJ1A 2XAHB 2X66A 4AQFA 3GMIA 2NP9A 3NRYA 3E08A 2XASB 4HFVA 2KLQA 5JDGA 3I9YA 3ZPOA 4DBRA 3BQIA 1IJ5A 4NUUA 3KV5A 3ONXA 2M67A 1MMNA 5HXSA 2E9XB 4AKLA 3P7IA 4PFPA 4P09A 2DNXA 5JH7E 4HN9A 2D2SA 2LSJA 2H7OA 5J1GA 1EZ3A 2KWIB 4QX7B 5IHYA 2D5UA 2IC6A 4OK0A 3RYCE 5JREA 4EIWA 3E22E 2SPCA 3FXDB 4G2AA 4OYJA 4XBFB 3NBXX 4AQFC 5LNKA 4X1KE 4OYKA 4U74A 5FY7A 3AAIA 4YLHA 5JDLA 3A5XA 4DVDA 1YW0A 2Y6XA 1KNZA 4ILUA 2JPFA 4UVAB 3NZQA 2ACXA 4BJMA 3IBPA 2BDEA 2PJQA 3SWHA 2VB6A 3QC9A 3CQGB 4P0BA 5FY0A 5KX5E 3LK42 4ZHQE 1LKXA 3WI3A 5DABA 5DQVA 2D0UA 3ZMVB 5L3CB 2CWYA 4C90A 1D1CA 1HCIA 3J7Yq 3MA9A 4X1IE 2VWAA 3FXEB 3E0ZA 3P8CD 5DQWA 3OBVE 1S94A 3HL6A 4PK6A 4QXBB 4JLEA 3EUHA 3U78A 3KINB 1ZKEA 2JMHA 4ERRA 5LHGB 5JDFA 3LK3B 1BR2A 1D1BA 2XAFB 3OYZA 4YJ3E 2H3RA 3RKOA 1FEWA 2X9XA 2NWBA 3ZYLA 1IAPA 3VHLA 1ZEEA 3CQXC 3DJBA 4PK5A 1D1AA 3C64A 3CMLA 4UV8B 2NOXA 4PAGA 4H9QC 3K3OA 2N1GA 5EK3A 3LFMA 5ETWA 4WBOA 5C8YE 3FBZA 3PU8A 3N9PA 4UXNB 3VKGA 3ZJ2A 4EYUA 5L3GB 4PW8A 2PBIA 2HH7A 2VASA 4O4LE 2DCFA 3HR0A 5LJMA 3QUJA 4H63V 4ANJA 2Y48B 2W61A 1NWMX 2DLRA 4PJLA 5FXVA 2EHOA 3SOLA 3UFEA 5CA1E 4CI1B 1B7TA 4OFZA 3K3QC 5LXTE 2QA7A 2V7IA 2IAKA 3N9MA 5F8PA 2CMRA 4KUMB 5LGNB 1UCUA 4J2CA 4GYRA 2JJ9A 5HWYA 2E9XA 2UXNB 2K48A 4QHOA 4O2BE 2HPJA 4PJMA 2WMNA 4I4TE 4F6RC 2WSSV 2LSYA 3MXZA 3UTKA 2D0TA 3ZCJA 4ZS3A 3GA8A 2BVMA 2Q9QB 2XQYA 3N9OA 4DBQA 5KDMC 4ISSA 5LYJE 1YKEB 3N2GE 4FI5A 2EHOC 3C4ZA 3RPUA 4ZI2C 3PDYA 3MZKB 4IE0A 5JR9A 3PUSA 4I43B 3ANWA 4EOZB 4HKAA 4O4JE 4AQGA 4P0AA 3PURA 3EVYA 4QKNA 3KDSE 4TV8E 1WYBA 2ZLYA 3O1HA 4UELA 3ZMSB 2YU1A 4CXXA 1VOMA 3IEEA 3I0QA 5FYMA 2NTXA 2W0GA 2C5JA 3KVAA 1HFAA 5L3EB 1BR0A 2UXXB 4IE6A 4CI2B 4H63H 1S35A 4QXHB 1G8XA 3HKCE 1CUNA 1UX4A 2ODUA 4HTEA 2YINA 4UVBB 1U5PA 3HA4A 5JR9C 4UIGA 4TN7B 3PU3A 1KK7A 5EZYE 3IHRA 5LGUB 2X67A 3HKBE 2CXDA 3U3IA 4GIWA 3UULA 1FIOA 2LSGA 3OYXA 5HAXA 4JEUB 2A2FX 2KMFA 4QWNB 5A1LA 2P9BA 1YD8G 3F57A 1OWAA 2VL8A 2X9YA 3JC6D 3B57A 3N9NA 3CQCB 3BQLA 5JDNA 5HXCA 3ZYKA 4ZI3D 3F31A 3KVBA 2CCQA 2JMKA 3PE0A 2CM0A 3RX6A 2VKOA 3Q5XA 1HF8A 3HKEE 5FNVE 4BJNA 1WRDA 2A3DA 3LBXB 3N2KE 4AKHA 1LVKA 4JEHB 4TZ4C 3PUQA 1IZNB 3BK9A 3ZMTB 4PFOA 4AKIA 3ESLA 3Q2MA 3ZEFB 4I55E 3AA0B 3UUMA 2RP4A 3GN5B 4GK5E 4UF0B 4V1Av 3RC3A 5AFUL 4EXTA 1VRBA 2Q9QD 4L0RA 3KBUA 2MBGA 2RA1A 4I50E 1IJ6A 3CVRA 3MACA 3V5SA 3CPZA 3RYIE 2X68A 5H6QB 4AKGA 5LCYA 4ASKA 1LRZA 3O4XE 4H9SE 5FXWA 4IE4A 1T98A 2ZM8A 2CLYC 5L3DB 2LE8A 3WAKA 2IC9A 5EK4A 4O2AE 4O4HE 3ZC1A 3EDVA 3N9LA 4PJNA 5M4YA 3MKDA 3V5UA 1MNEA 2X51A 5FP3A 1WYCA 3L09A 5LG4A 4MBQA 2KNDA 2IW5B 4EB6E 4XZCA 5CB4E 3ZCIA 3GWHA 5BMVE 2BVLA 3N5LA 3ZMUB 1U4QA 4C91A 4CXYA 5J2TE 5LOVE 4TV9E 2NW7A 3RRWA 2BZBA 3CX8B 4WBNE 2A72A 1MMGA 5JDMA 4EZHA 2LM9A 4ISTA 3R6NA 3KV9A 5J2UE 4H9PC 4MLKA 3LK2B 2KXPB 4YJ2E 2X9HA 3C4WA 5GONE 5LHIB 2N9DA 2WM9A 3AVSA 3DTOA 4CI3B 3O9XA 2W00A 2MTQA 5FXZA 3ZN1B 2VK9A 4PNIA 4YFSA 3N2OA 2N2NA 3NRXA 2ZM2A 1AJ3A 2V7LA 4GK0E 4DO0A 3HKDE 4MALA 3AA6B 4B6XA 5LHHB 4N78D 4TUYE 3W15B 2LOPA 2Y8DA 2CXLA 2GK9A 1OXZA 2B1EA 2C5IT 3ZLIA 2YK0A 2E9XC 2HPLA 3TKLB 4AXPA 1LVFA 2NW9A 1D0ZA 3FBLA 2ES0A 3LG7A 2DWKA 4IE7A 2C0SA 1ZV4X 1X79A 3MJXA 4YHJA 4DMWA 4O8SA 3SS1A 3C51A 1WR6A 2Z6EA 2V26A 3H37A 4U72A 3AA1B 3GN5A 4EAHA 4CXWA 5ADXL 2ZM0A 3AVRA 5HWXA 5LA6E 4GYSA 4EZ4A 5IYZE 5JRCB 1HX8A 3KV4A 4MHCA 2C5KT 3PUGA 1MIYA 2V7JA 2KINB 3LJCA 3C98B 3EDUA 1MIWA 5FY1A 2XUEA 2V7MA 3K3NA 5JDQA 1QSDA 3IF8B 3CKDA 2CA5A 4HEAA 2EHOB 1Z0PA 1FMWA 2V7KA 5CA0E 2K24A 5JDHA 5HYAA 4PJJA 1SHZC 2CEAA 2VKHA 2W63A 2YU2A 2WMOA 3KV6A 4ZOLE 4ZS2A 3UUXB 2K9AA 3AA7B 2ZMAA 3ETVA 1NAFA 5LJNA 4E7SA 3VU7H 3FB2A 3NZPA 2LSKA 4K0UA 4L5GA 3BQKA 5HXRA 3ZYMA 2X0LB 2L9QA 4BA9A 1US7B 2H7VC 3ETUA 5L3FB 2J1DG 4PK4A 2ODVA 4H9RC 4OHFA 4ADZA 2WBLA 4WNKA 2LT3A 3DP7A 3UUNA 5TAOA 2E8IA 2OA5A 2LHNA 5FMNA 2JQQA 4M1PA 3RRCA 3M65A 4KBMB 4NUVA 2CE7A 2PG8A 1WLXA 4CZZB 5KMGP 2LJLA 5JR9B 4O4IE 2CWOA 3ANWB 5LGTB 2NTYA 1HTJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CLY B; 
#chains in the Genus database with same CATH topology
 4DV4 T;  3VRB A;  3K8P C;  2JRK A;  4XAX B;  3J9X 1;  1BR4 A;  2OV9 A;  3Q9D A;  3S4U A;  5L4H A;  1FMV A;  3C4X A;  4IHJ E;  5HXE A;  3Q5D A;  2DI4 A;  4ILA A;  3QK6 A;  5L2L A;  4HGA A;  2JIW A;  2KT9 A;  5JVD E;  5HXH A;  3ZC0 A;  5H6R B;  4DR5 T;  2L3L A;  2VKJ A;  3RHW A;  5ABH A;  2X0H A;  4AQY T;  5DJQ C;  5L4E A;  1XMQ T;  4ZI2 D;  4TNV A;  4A56 A;  4IE5 A;  1G73 A;  1NEN A;  4GOU A;  3C50 A;  3TLS A;  2LSI A;  3T8O A;  1KEY A;  1O3X A;  2V5C A;  4QX8 B;  5EK2 A;  4B3S T;  2W62 A;  5FVK A;  1WFD A;  3H3A A;  4HE8 A;  2MOZ A;  3PUY F;  5AQV B;  2L8K A;  1YKH B;  2AXD S;  1J1J A;  3O1J A;  1SA0 E;  3AAA B;  1W9R A;  1HS7 A;  3L3P A;  3KFW X;  2LOS A;  2CBI A;  3ZJ1 A;  3AE2 A;  2NP9 A;  4JI6 T;  1T72 A;  5JDG A;  3I9Y A;  3ZPO A;  3BQI A;  1IJ5 A;  2WY2 A;  2LKH A;  5AQL B;  2DNX A;  3ZT6 A;  4YHH T;  4LMK A;  4QX7 B;  5IHY A;  2D5U A;  3RYC E;  4OYJ A;  3FXD B;  3NBX X;  4AQF C;  5LNK A;  3SFD A;  5FY7 A;  1YQ3 A;  3FZM B;  4YLH A;  2Y6X A;  3NZQ A;  2VB6 A;  2FBW A;  5KX5 E;  4ZHQ E;  1LKX A;  1XNQ T;  3WI3 A;  5DAB A;  5DQV A;  4DV5 T;  5L3C B;  4C90 A;  1OED A;  2PTF A;  2IDO B;  3TLT A;  4QH4 A;  4QXB B;  3EUH A;  4U7I A;  3U78 A;  3KIN B;  4LF4 T;  1ZKE A;  3LK3 B;  1I94 T;  2XQ6 A;  3OYZ A;  3RKO A;  2IIU A;  3VHL A;  3DJB A;  4UV8 B;  3CML A;  2E5L T;  4PAG A;  5EK3 A;  2AE9 A;  1GQE A;  4WBO A;  2RPA A;  3PU8 A;  3ZJ2 A;  3QUJ A;  4PJL A;  4YSX A;  5FXV A;  4AIU A;  4CI1 B;  1B7T A;  5LXT E;  2BS2 A;  2IUB A;  5LGN B;  4DUZ T;  1KFY A;  2VVN A;  3FZK B;  2K48 A;  4QHO A;  4O2B E;  4YXD A;  3UTK A;  2D0T A;  5KDM C;  1YKE B;  3UQ4 A;  4ZI2 C;  4IE0 A;  5JR9 A;  3KDS E;  3O1H A;  3IEE A;  5FYM A;  2XQ9 A;  3KVA A;  5L3E B;  2V8S V;  3HKC E;  3PU3 A;  3IHR A;  2WWV A;  3HKB E;  2XQ7 A;  4GIW A;  4IDQ A;  5HAX A;  4JEU B;  4QWN B;  2P9B A;  5FL0 A;  5CFB A;  2VQE T;  2XPK A;  3N9N A;  5JDN A;  3ZYK A;  4ZI3 D;  3F31 A;  4DR7 T;  3PE0 A;  2CM0 A;  3RX6 A;  4EV6 A;  4KHP T;  1WRD A;  4X62 T;  2A3D A;  4AKH A;  1LVK A;  3UQ7 A;  3Q2M A;  3UUM A;  2RP4 A;  3RC3 A;  3QB5 K;  3AEA A;  1VRB A;  4L0R A;  5AQH B;  3RLF F;  1HNZ T;  2MBG A;  2RA1 A;  1SE7 A;  1IJ6 A;  5H6Q B;  3AEB A;  4ASK A;  2M6B A;  5EK4 A;  4O4H E;  2H89 A;  2V6Y A;  2E5V A;  2V6X A;  2WZI A;  1WYC A;  5LG4 A;  2LKG A;  3GWH A;  2QVA A;  1U4Q A;  5J2T E;  4WBN E;  3NWI A;  4U3C A;  2KXP B;  2X9H A;  3C4W A;  3DTO A;  3O9X A;  2MTQ A;  4YFS A;  4PNI A;  5FKY A;  2N2N A;  3NRX A;  1JNZ A;  1KF6 A;  4GK0 E;  3HKD E;  5ABF A;  3AE4 A;  3AA6 B;  4N78 D;  4JYA T;  2VL0 A;  3VRA A;  2Y8D A;  3ZLI A;  2E9X C;  4WZX A;  2NW9 A;  1D0Z A;  3AE7 A;  3RGL A;  1J5W A;  4YHJ A;  2I6H A;  4HFI A;  3P50 A;  4EAH A;  2ZM0 A;  3AVR A;  4HFE A;  5LA6 E;  5HWX A;  3TLV A;  1HX8 A;  2C5K T;  5AQT B;  1MIY A;  3LJC A;  2UUA T;  3EDU A;  3K3N A;  4F8H A;  2CA5 A;  4HEA A;  1Z0P A;  5JDH A;  4PJJ A;  1UK5 A;  3PUV F;  1SHZ C;  2W63 A;  2WMO A;  4KI0 F;  3RIF A;  3VU7 H;  2LRK A;  1Z8U A;  3FB2 A;  4K0U A;  4L5G A;  3BQK A;  4BA9 A;  4U7Y A;  3ETU A;  5L3F B;  4ADZ A;  2WBL A;  4NUV A;  5LG3 A;  3ZST A;  4NIQ A;  4O4I E;  4B3M T;  2NTY A;  1HTJ F;  3O1I A;  2CHN A;  2XHE B;  4H9O C;  1D0X A;  5LBQ B;  4U2Y A;  2Q9Q A;  4WW0 A;  1MMD A;  4ZI3 C;  1XZY A;  3N9Q A;  2QGS A;  4LF6 T;  3B13 A;  2XZE A;  4CQI A;  3ZT7 A;  5AQF B;  1CHU A;  1V9D A;  3ZN0 B;  3UT5 E;  2CXF A;  4MFR A;  4TX5 A;  1DU2 A;  2MYS A;  3MK7 C;  2XTL A;  2WWU A;  2XJ7 A;  3FZL B;  3AE3 A;  3PUX F;  4YTP A;  4JUY A;  2WQY A;  4Z8X A;  1XWM A;  3PJA A;  4YTN A;  2I0M A;  4Z90 A;  3VKH A;  4H9N C;  2XAJ B;  1N32 T;  5F3J A;  2XAG B;  1HG5 A;  2X9W A;  2F4V T;  3CK6 A;  2V1D B;  4LMJ A;  3AAE B;  1H7C A;  4QH5 A;  4IDZ A;  2WAU A;  2DHR A;  4KMC A;  2K5B B;  5AQN B;  4UEM A;  3RH3 A;  4E7Z A;  4BAY B;  4WYV A;  4DV1 T;  1ZHC A;  2PFV A;  3R84 B;  2XAH B;  3GMI A;  3NRY A;  3E08 A;  2XAS B;  2YN6 A;  2E9X B;  3P7I A;  4P09 A;  4HN9 A;  2D2S A;  2LSJ A;  1EZ3 A;  2KWI B;  5JRE A;  4EIW A;  3E22 E;  2SPC A;  4XBF B;  2X0Y A;  4G2A A;  1I6Z A;  4X1K E;  4UVA B;  3ZMV B;  3RQW A;  3J7Y q;  3VR8 A;  2IHR 1;  3FXE B;  3P8C D;  5DQW A;  5AQI B;  4PK6 A;  2JMH A;  4ERR A;  3G06 A;  1BR2 A;  2XAF B;  4YJ3 E;  2H3R A;  2X9X A;  3UFG A;  3UU6 A;  1IAP A;  3M3Z B;  3C64 A;  1OED C;  3K3O A;  4H9Q C;  3LFM A;  1HX1 B;  5ETW A;  5AQU B;  3P4W A;  3P4S A;  4PW8 A;  2VAS A;  2DCF A;  5LJM A;  3L39 A;  4ANJ A;  4OFZ A;  2QA7 A;  3LDQ B;  5F8P A;  4DUY T;  2CMR A;  1IBM T;  4GKK T;  5HWY A;  2HPJ A;  4PJM A;  2WMN A;  4I4T E;  3AE1 A;  3A7M A;  3N9O A;  4DBQ A;  4ISS A;  1HNX T;  3C4Z A;  3RPU A;  2K3W A;  3PUS A;  4I43 B;  3ANW A;  4AQG A;  4O4J E;  1KNP A;  3PUR A;  1WYB A;  1HNW T;  2XM1 A;  2ZLY A;  3ZMS B;  3I0Q A;  2C5J A;  1M62 A;  4CI2 B;  4ZEY A;  1G8X A;  4HTE A;  5JR9 C;  2UU9 T;  3RI5 A;  5HEO A;  1KK7 A;  5EZY E;  3EAM A;  2HHH T;  2CXD A;  3OYX A;  5CJ5 A;  4X64 T;  2A2F X;  2KMF A;  3P4Q A;  5A1L A;  1YD8 G;  5HXC A;  4LFA T;  3KVB A;  2CCQ A;  3Q5X A;  5FNV E;  3NKZ A;  1XNR T;  1N33 T;  5J0Z A;  1IZN B;  3ZMT B;  4PFO A;  4I55 E;  4NXN T;  4GK5 E;  2FJA A;  3UU4 A;  4EXT A;  2Q9Q D;  3CVR A;  3MAC A;  3AEE A;  1Y01 A;  3V5S A;  4H9S E;  2ZM8 A;  2CLY C;  2LE8 A;  3WAK A;  2JQH A;  4O2A E;  3N9L A;  5M4Y A;  3MKD A;  3V5U A;  3QNU A;  1ZOY A;  1MNE A;  3EHZ A;  4MBQ A;  2BG9 E;  5BMV E;  2J47 A;  3N5L A;  3ZMU B;  4TWD A;  4TV9 E;  2NW7 A;  3RRW A;  2BZB A;  2N9D A;  4EGW A;  4ZZB A;  4IL4 A;  2VK9 A;  1J5E T;  3SFE A;  1OED B;  4DO0 A;  1M7K A;  5LMU T;  2XQ4 A;  1UGO A;  2GK9 A;  2B1E A;  2YK0 A;  3TKL B;  3ONJ A;  4AXP A;  3B5M A;  2C0S A;  3AE8 A;  3OPC A;  1W0A A;  3NVO A;  3SS1 A;  1X9B A;  2V26 A;  3H37 A;  4U72 A;  4CXW A;  4CN1 A;  4EZ4 A;  5IYZ E;  5JRC B;  3KV4 A;  4MHC A;  3PUG A;  3JAF A;  4ILC A;  3UUB A;  2KIN B;  3C98 B;  2V7M A;  1IBL T;  1QSD A;  3IF8 B;  2VQF T;  1FMW A;  2V7K A;  2K24 A;  1IBK T;  3P4P A;  2K9A A;  3AA7 B;  2ZMA A;  1NAF A;  2LSK A;  2X0L B;  4ZXL A;  2J1D G;  2E2A A;  3PV0 F;  3UUN A;  3OTO T;  2JQK A;  2LHN A;  4M1P A;  3ZSS A;  5KMG P;  5JR9 B;  4LF7 T;  2CWO A;  1T7S A;  2G0U A;  1BR1 A;  4AI6 A;  3CX7 B;  1E1H B;  2MAW A;  5LBM A;  4IIJ E;  4X1Y E;  4IGU A;  5E0O A;  3SRZ A;  4EYY R;  4AKR B;  3KBT A;  1HG2 A;  2NW8 A;  3PUW F;  1D0Y A;  1QUU A;  4IT4 A;  5L3B B;  4X65 T;  3VR9 A;  2Q9Q C;  3PUA A;  4Z91 A;  3FHN A;  2XQ8 A;  4L9I A;  1WR0 A;  4ZI7 E;  4Q25 A;  2CBJ A;  3CX6 B;  2YEV C;  4JI8 T;  1E2A A;  4DND A;  1MND A;  4GKJ T;  5AQQ B;  4P1N A;  2VKD A;  2CLY B;  2H88 A;  4TNW A;  3UU3 A;  2WP9 A;  4QXC B;  4DR4 T;  1ZP0 A;  1Y64 B;  4X5T A;  4LFC T;  4YSZ A;  4HWC A;  4X66 T;  2LEH A;  3LBX A;  5AQM B;  4X20 E;  2ZM6 T;  3I9W A;  2UXB T;  4UF0 A;  4UVC B;  2WZH A;  4KP3 C;  4HFB A;  1UX5 A;  3AXJ A;  3ZMZ B;  3D0T A;  3RYH E;  2X66 A;  2LLY A;  4NUU A;  2WDV A;  4OX9 T;  3KV5 A;  3ONX A;  2M67 A;  4TWH A;  4PFP A;  5BR8 T;  1XDP A;  5ABE A;  3FZH B;  3TLU A;  2IC6 A;  4OK0 A;  4DR6 T;  3LSV A;  2UXC T;  2XQ5 A;  3L8R A;  1JNR A;  5ABF B;  2XQ3 A;  2WU2 A;  5JDL A;  2D9D A;  3A5X A;  4DVD A;  1YW0 A;  3JAD A;  2BG9 A;  2R6G F;  4BJM A;  3IBP A;  2BDE A;  2PJQ A;  3QC9 A;  3LK4 2;  2CWY A;  1D1C A;  1HCI A;  4K0K T;  3H3M A;  5FL1 A;  3FZF B;  3MA9 A;  2VWA A;  2IML A;  3E0Z A;  1S94 A;  3HL6 A;  4CN6 A;  4DID B;  4ILB A;  4KHZ F;  5LHG B;  2MPK A;  4U33 A;  4NPP A;  1D1B A;  5AQS B;  1FEW A;  1KNR A;  2NWB A;  1D1A A;  2NOX A;  5AQO B;  2N1G A;  3FBZ A;  4UXN B;  5L3G B;  2PBI A;  2HH7 A;  4O4L E;  3HR0 A;  4H63 V;  1NWM X;  2DLR A;  2DL1 A;  3UFE A;  2EHO A;  3SOL A;  5CA1 E;  3K3Q C;  2W67 A;  2A9U A;  4KUM B;  1UCU A;  3QOF A;  4J2C A;  2W4X A;  4JI4 T;  2CPT A;  2E9X A;  2UXN B;  5L47 A;  4F6R C;  2WSS V;  2BVM A;  2Q9Q B;  1R8I A;  4FI5 A;  4A97 A;  1XMO T;  3RKG A;  1NEK A;  3PDY A;  4EOZ B;  4HKA A;  4QKN A;  3T1Y T;  2YU1 A;  4CXX A;  3EI0 A;  2NTX A;  2W0G A;  5HEU A;  4IE6 A;  4H63 H;  4QXH B;  4YT0 A;  2YIN A;  4DR1 T;  3HA4 A;  4UIG A;  3PJA J;  5LGU B;  3UUL A;  2FUP A;  3F57 A;  2X9Y A;  3JC6 D;  3CQC B;  4HFC A;  4EEB A;  2VKO A;  1HF8 A;  3HKE E;  5AQP B;  4JEH B;  3BK9 A;  4AKI A;  4LF9 T;  3ZEF B;  3GN5 B;  5AQG B;  2WB5 A;  3KBU A;  3T1H T;  2J62 A;  1FJG T;  3RYI E;  3ZT5 A;  4DV3 T;  5FXW A;  1T98 A;  3RIU A;  2IC9 A;  1SUM B;  4YY3 T;  3EDV A;  4DV7 T;  3AEF A;  5HEH A;  3AE5 A;  2CHO A;  2UUB T;  5FP3 A;  1L0V A;  2BKP A;  3L09 A;  2IW5 B;  2KND A;  3QB5 A;  4IDO A;  4XZC A;  5CB4 E;  3ZCI A;  2BVL A;  4CXY A;  5LOV E;  1MMG A;  4EZH A;  2LM9 A;  2BKN A;  2FJD A;  4IL9 A;  4IST A;  4JBW F;  3R6N A;  5C3J A;  4MLK A;  3LK2 B;  4YJ2 E;  5GON E;  2WM9 A;  2BBJ A;  3AVS A;  4CI3 B;  5KXJ A;  5F5W A;  5FXZ A;  3ZN1 B;  2ZM2 A;  2WU5 A;  1AJ3 A;  2V7L A;  4JI3 T;  4MAL A;  5LHH B;  4TUY E;  2LOP A;  3RQU A;  5CGM A;  1LVF A;  4HWF A;  2BS3 A;  2ES0 A;  2DWK A;  3AE9 A;  4IE7 A;  3RIA A;  4DMW A;  4O8S A;  1WR6 A;  3PUZ F;  2VUR A;  4GYS A;  5HCM A;  2XQA A;  2XUE A;  5JDQ A;  5LMN T;  3AEG A;  3CKD A;  5FVL A;  4LML A;  1HR0 T;  4DR2 T;  4IDN A;  2B76 A;  3KV6 A;  4ZOL E;  4ZS2 A;  3UUX B;  4E7S A;  3NZP A;  3ZYM A;  2L9Q A;  1US7 B;  2H7V C;  2ODV A;  4H9R C;  4OHF A;  4ZZC A;  4WNK A;  2XM2 A;  5TAO A;  2E8I A;  2HN1 A;  5FMN A;  2LRL A;  3TLW A;  4YSY A;  4EED A;  3M65 A;  4KBM B;  2CE7 A;  2PG8 A;  1WLX A;  4CZZ B;  2LJL A;  3ANW B;  5LGT B;  4B3T T;  3OJA A;  2I59 A;  3AB3 B;  2XAQ B;  1MMA A;  2XY8 B;  3JC6 C;  2LHR A;  5ABG A;  3OKQ A;  3JCF A;  4U2Z A;  1W0B A;  4CN4 A;  3WAJ A;  3RC8 A;  4COF A;  3RF1 A;  5LP6 E;  2EHO D;  3JAE A;  4FJO A;  1T8B A;  2XSA A;  5JRC A;  3I0O A;  3A8Y C;  3Q5W A;  3AED A;  4U31 A;  2E9X D;  4HFD A;  2HN2 A;  5FXX A;  2WS3 A;  3X1D A;  1VCS A;  4DR3 T;  3CWZ B;  5JTG A;  1XDO A;  2KWH A;  3UU5 A;  2BS4 A;  5JQG E;  1MIV A;  4IRE A;  4DMV A;  3I1A A;  2JQ9 A;  1WCR A;  1N36 T;  4LF5 T;  3F2E A;  2DWG A;  3HI2 A;  2QRX A;  2KZ7 B;  4UV9 B;  4G63 A;  3PTR B;  3RYF E;  4AQF A;  4HFV A;  2KLQ A;  1E7P A;  4AIS A;  4DBR A;  1QLB A;  5HXS A;  1MMN A;  2W2U A;  4AKL A;  5JH7 E;  2H7O A;  5J1G A;  2NR4 A;  2YOE A;  4OYK A;  4U74 A;  2LM2 A;  3AAI A;  1N34 T;  1KNZ A;  4ILU A;  2JPF A;  2ACX A;  3SWH A;  2V5D A;  3CQG B;  4P0B A;  5FY0 A;  3P4R A;  2BBH A;  2D0U A;  4HWH A;  3ZKR A;  3ABV A;  5AQR B;  2UXD T;  2YDS A;  4X1I E;  3OBV E;  1W09 A;  3ONL C;  4JV5 T;  4JLE A;  4A5X A;  4DV6 T;  4LFB T;  2BG9 C;  5JDF A;  4YTM A;  1VCT A;  1YXR A;  3ZYL A;  1ZEE A;  3CQX C;  4PK5 A;  3EAB A;  5C8Y E;  3VKG A;  3N9P A;  4EYU A;  1YQ4 A;  3AEC A;  2Y48 B;  2W61 A;  3K1S A;  2V7I A;  5C2T A;  2IAK A;  3N9M A;  5HCJ A;  4GYR A;  2JJ9 A;  4IDP A;  3IA3 A;  2LSY A;  3MXZ A;  3ZCJ A;  4ZS3 A;  3GA8 A;  2XQY A;  5LYJ E;  3N2G E;  2EHO C;  2V6Y B;  3MZK B;  4P0A A;  3EVY A;  4TV8 E;  4UEL A;  1VOM A;  2YDQ A;  5IWA T;  5AQJ B;  5AQK B;  1HFA A;  1BR0 A;  2UXX B;  4HWI B;  1S35 A;  4JI7 T;  1CUN A;  1UX4 A;  2ODU A;  4UVB B;  1U5P A;  2BKO A;  4TN7 B;  4JI5 T;  2X67 A;  3U3I A;  1FIO A;  2LSG A;  5HEJ A;  2WDQ A;  1OWA A;  2VL8 A;  3B57 A;  3BQL A;  4NXM T;  3UU8 A;  2JMK A;  4BJN A;  2ACZ A;  3LBX B;  3N2K E;  4DV0 T;  4TZ4 C;  3PUQ A;  2WCA A;  3CIR A;  3ESL A;  3AA0 B;  2CRB A;  4UF0 B;  4V1A v;  2M6I A;  5AFU L;  3AXJ B;  4I50 E;  3CPZ A;  2X68 A;  4AKG A;  5LCY A;  1LRZ A;  3O4X E;  4A98 A;  4TWF A;  4IE4 A;  5L3D B;  1UUR A;  2YDR A;  3ZC1 A;  4PJN A;  4KX6 A;  2OLT A;  2J4G A;  2X51 A;  2W66 A;  2XSB A;  4EB6 E;  4C91 A;  3RIU C;  4UR9 A;  4LF8 T;  3CX8 B;  2A72 A;  5JDM A;  2BG9 B;  2YKS A;  3Q5E A;  3KV9 A;  5J2U E;  4H9P C;  1OED E;  5LHI B;  2FJE A;  2W00 A;  4HFH A;  4JI1 T;  3N2O A;  2WDR A;  4B6X A;  3W15 B;  5IUX A;  3OVU A;  2CXL A;  1OXZ A;  2C5I T;  2HPL A;  2QYW A;  3FBL A;  1ZV4 X;  1X79 A;  3MJX A;  3C51 A;  5LB7 B;  2Z6E A;  2FJB A;  3AA1 B;  3GN5 A;  5ADX L;  2V7J A;  1MIW A;  5FY1 A;  2EHO B;  5CA0 E;  4B3R T;  5HYA A;  4QH1 A;  4JI0 T;  2CEA A;  2YU2 A;  2VKH A;  4HWD A;  2VVS A;  3ETV A;  5LJN A;  5HXR A;  5HEG A;  4I0U A;  4PK4 A;  2KSR A;  2LT3 A;  3DP7 A;  2UUC T;  2OA5 A;  1UUS A;  2JQQ A;  3RRC A;  3AE6 A;  4DV2 T;  4JI2 T;  3LG7 A; 
#chains in the Genus database with same CATH homology
 3O1I A;  2G0U A;  2XHE B;  1BR1 A;  3OJA A;  4AI6 A;  3CX7 B;  4H9O C;  2I59 A;  1E1H B;  1D0X A;  3AB3 B;  5LBQ B;  5LBM A;  2XAQ B;  4IIJ E;  3K8P C;  4X1Y E;  4IGU A;  2JRK A;  4XAX B;  3J9X 1;  5E0O A;  1MMA A;  2Q9Q A;  4WW0 A;  3JC6 C;  2LHR A;  1BR4 A;  3SRZ A;  4EYY R;  1MMD A;  3Q9D A;  4ZI3 C;  3S4U A;  4AKR B;  3OKQ A;  3KBT A;  1FMV A;  3C4X A;  4IHJ E;  5HXE A;  3N9Q A;  2QGS A;  1HG2 A;  3B13 A;  2NW8 A;  2DI4 A;  4CQI A;  1D0Y A;  1QUU A;  3QK6 A;  5L3B B;  5L2L A;  4HGA A;  1V9D A;  3ZN0 B;  3UT5 E;  2CXF A;  4MFR A;  4TX5 A;  2KT9 A;  3WAJ A;  3RC8 A;  5JVD E;  2MYS A;  5HXH A;  2Q9Q C;  3MK7 C;  2XTL A;  3PUA A;  3FHN A;  3ZC0 A;  5H6R B;  2WWU A;  5LP6 E;  2L3L A;  2VKJ A;  4L9I A;  4JUY A;  4ZI7 E;  2EHO D;  5DJQ C;  4FJO A;  4Z8X A;  3CX6 B;  2YEV C;  5JRC A;  4ZI2 D;  4DND A;  3VKH A;  1MND A;  3I0O A;  4A56 A;  3Q5W A;  4IE5 A;  4H9N C;  1G73 A;  2VKD A;  2XAJ B;  2CLY B;  4GOU A;  5F3J A;  2E9X D;  2XAG B;  3C50 A;  1HG5 A;  5FXX A;  2X9W A;  2LSI A;  3T8O A;  2V1D B;  4QXC B;  1Y64 B;  3AAE B;  1O3X A;  4QX8 B;  5EK2 A;  1H7C A;  4IDZ A;  2W62 A;  3CWZ B;  3H3A A;  4HE8 A;  2MOZ A;  2KWH A;  2L8K A;  2LEH A;  2WAU A;  5JQG E;  3LBX A;  1MIV A;  2DHR A;  4KMC A;  1YKH B;  4DMV A;  3I1A A;  4X20 E;  3O1J A;  3F2E A;  3I9W A;  2DWG A;  1SA0 E;  2K5B B;  4UF0 A;  3AAA B;  4UEM A;  4UVC B;  3HI2 A;  3RH3 A;  4E7Z A;  1HS7 A;  3L3P A;  4KP3 C;  2KZ7 B;  1UX5 A;  4BAY B;  1ZHC A;  4UV9 B;  3KFW X;  2PFV A;  3ZMZ B;  3D0T A;  4G63 A;  3PTR B;  3RYF E;  3RYH E;  2LOS A;  3R84 B;  3ZJ1 A;  2XAH B;  2X66 A;  4AQF A;  3GMI A;  2NP9 A;  3NRY A;  3E08 A;  2XAS B;  4HFV A;  2KLQ A;  5JDG A;  3I9Y A;  3ZPO A;  4DBR A;  3BQI A;  1IJ5 A;  4NUU A;  3KV5 A;  3ONX A;  2M67 A;  1MMN A;  5HXS A;  2E9X B;  4AKL A;  3P7I A;  4PFP A;  4P09 A;  2DNX A;  5JH7 E;  4HN9 A;  2D2S A;  2LSJ A;  2H7O A;  5J1G A;  1EZ3 A;  2KWI B;  4QX7 B;  5IHY A;  2D5U A;  2IC6 A;  4OK0 A;  3RYC E;  5JRE A;  4EIW A;  3E22 E;  2SPC A;  3FXD B;  4G2A A;  4OYJ A;  4XBF B;  3NBX X;  4AQF C;  5LNK A;  4X1K E;  4OYK A;  4U74 A;  5FY7 A;  3AAI A;  4YLH A;  5JDL A;  3A5X A;  4DVD A;  1YW0 A;  2Y6X A;  1KNZ A;  4ILU A;  2JPF A;  4UVA B;  3NZQ A;  2ACX A;  4BJM A;  3IBP A;  2BDE A;  2PJQ A;  3SWH A;  2VB6 A;  3QC9 A;  3CQG B;  4P0B A;  5FY0 A;  5KX5 E;  3LK4 2;  4ZHQ E;  1LKX A;  3WI3 A;  5DAB A;  5DQV A;  2D0U A;  3ZMV B;  5L3C B;  2CWY A;  4C90 A;  1D1C A;  1HCI A;  3J7Y q;  3MA9 A;  4X1I E;  2VWA A;  3FXE B;  3E0Z A;  3P8C D;  5DQW A;  3OBV E;  1S94 A;  3HL6 A;  4PK6 A;  4QXB B;  4JLE A;  3EUH A;  3U78 A;  3KIN B;  1ZKE A;  2JMH A;  4ERR A;  5LHG B;  5JDF A;  3LK3 B;  1BR2 A;  1D1B A;  2XAF B;  3OYZ A;  4YJ3 E;  2H3R A;  3RKO A;  1FEW A;  2X9X A;  2NWB A;  3ZYL A;  1IAP A;  3VHL A;  1ZEE A;  3CQX C;  3DJB A;  4PK5 A;  1D1A A;  3C64 A;  3CML A;  4UV8 B;  2NOX A;  4PAG A;  4H9Q C;  3K3O A;  2N1G A;  5EK3 A;  3LFM A;  5ETW A;  4WBO A;  5C8Y E;  3FBZ A;  3PU8 A;  3N9P A;  4UXN B;  3VKG A;  3ZJ2 A;  4EYU A;  5L3G B;  4PW8 A;  2PBI A;  2HH7 A;  2VAS A;  4O4L E;  2DCF A;  3HR0 A;  5LJM A;  3QUJ A;  4H63 V;  4ANJ A;  2Y48 B;  2W61 A;  1NWM X;  2DLR A;  4PJL A;  5FXV A;  2EHO A;  3SOL A;  3UFE A;  5CA1 E;  4CI1 B;  1B7T A;  4OFZ A;  3K3Q C;  5LXT E;  2QA7 A;  2V7I A;  2IAK A;  3N9M A;  5F8P A;  2CMR A;  4KUM B;  5LGN B;  1UCU A;  4J2C A;  4GYR A;  2JJ9 A;  5HWY A;  2E9X A;  2UXN B;  2K48 A;  4QHO A;  4O2B E;  2HPJ A;  4PJM A;  2WMN A;  4I4T E;  4F6R C;  2WSS V;  2LSY A;  3MXZ A;  3UTK A;  2D0T A;  3ZCJ A;  4ZS3 A;  3GA8 A;  2BVM A;  2Q9Q B;  2XQY A;  3N9O A;  4DBQ A;  5KDM C;  4ISS A;  5LYJ E;  1YKE B;  3N2G E;  4FI5 A;  2EHO C;  3C4Z A;  3RPU A;  4ZI2 C;  3PDY A;  3MZK B;  4IE0 A;  5JR9 A;  3PUS A;  4I43 B;  3ANW A;  4EOZ B;  4HKA A;  4O4J E;  4AQG A;  4P0A A;  3PUR A;  3EVY A;  4QKN A;  3KDS E;  4TV8 E;  1WYB A;  2ZLY A;  3O1H A;  4UEL A;  3ZMS B;  2YU1 A;  4CXX A;  1VOM A;  3IEE A;  3I0Q A;  5FYM A;  2NTX A;  2W0G A;  2C5J A;  3KVA A;  1HFA A;  5L3E B;  1BR0 A;  2UXX B;  4IE6 A;  4CI2 B;  4H63 H;  1S35 A;  4QXH B;  1G8X A;  3HKC E;  1CUN A;  1UX4 A;  2ODU A;  4HTE A;  2YIN A;  4UVB B;  1U5P A;  3HA4 A;  5JR9 C;  4UIG A;  4TN7 B;  3PU3 A;  1KK7 A;  5EZY E;  3IHR A;  5LGU B;  2X67 A;  3HKB E;  2CXD A;  3U3I A;  4GIW A;  3UUL A;  1FIO A;  2LSG A;  3OYX A;  5HAX A;  4JEU B;  2A2F X;  2KMF A;  4QWN B;  5A1L A;  2P9B A;  1YD8 G;  3F57 A;  1OWA A;  2VL8 A;  2X9Y A;  3JC6 D;  3B57 A;  3N9N A;  3CQC B;  3BQL A;  5JDN A;  5HXC A;  3ZYK A;  4ZI3 D;  3F31 A;  3KVB A;  2CCQ A;  2JMK A;  3PE0 A;  2CM0 A;  3RX6 A;  2VKO A;  3Q5X A;  1HF8 A;  3HKE E;  5FNV E;  4BJN A;  1WRD A;  2A3D A;  3LBX B;  3N2K E;  4AKH A;  1LVK A;  4JEH B;  4TZ4 C;  3PUQ A;  1IZN B;  3BK9 A;  3ZMT B;  4PFO A;  4AKI A;  3ESL A;  3Q2M A;  3ZEF B;  4I55 E;  3AA0 B;  3UUM A;  2RP4 A;  3GN5 B;  4GK5 E;  4UF0 B;  4V1A v;  3RC3 A;  5AFU L;  4EXT A;  1VRB A;  2Q9Q D;  4L0R A;  3KBU A;  2MBG A;  2RA1 A;  4I50 E;  1IJ6 A;  3CVR A;  3MAC A;  3V5S A;  3CPZ A;  3RYI E;  2X68 A;  5H6Q B;  4AKG A;  5LCY A;  4ASK A;  1LRZ A;  3O4X E;  4H9S E;  5FXW A;  4IE4 A;  1T98 A;  2ZM8 A;  2CLY C;  5L3D B;  2LE8 A;  3WAK A;  2IC9 A;  5EK4 A;  4O2A E;  4O4H E;  3ZC1 A;  3EDV A;  3N9L A;  4PJN A;  5M4Y A;  3MKD A;  3V5U A;  1MNE A;  2X51 A;  5FP3 A;  1WYC A;  3L09 A;  5LG4 A;  4MBQ A;  2KND A;  2IW5 B;  4EB6 E;  4XZC A;  5CB4 E;  3ZCI A;  3GWH A;  5BMV E;  2BVL A;  3N5L A;  3ZMU B;  1U4Q A;  4C91 A;  4CXY A;  5J2T E;  5LOV E;  4TV9 E;  2NW7 A;  3RRW A;  2BZB A;  3CX8 B;  4WBN E;  2A72 A;  1MMG A;  5JDM A;  4EZH A;  2LM9 A;  4IST A;  3R6N A;  3KV9 A;  5J2U E;  4H9P C;  4MLK A;  3LK2 B;  2KXP B;  4YJ2 E;  2X9H A;  3C4W A;  5GON E;  5LHI B;  2N9D A;  2WM9 A;  3AVS A;  3DTO A;  4CI3 B;  3O9X A;  2W00 A;  2MTQ A;  5FXZ A;  3ZN1 B;  2VK9 A;  4PNI A;  4YFS A;  3N2O A;  2N2N A;  3NRX A;  2ZM2 A;  1AJ3 A;  2V7L A;  4GK0 E;  4DO0 A;  3HKD E;  4MAL A;  3AA6 B;  4B6X A;  5LHH B;  4N78 D;  4TUY E;  3W15 B;  2LOP A;  2Y8D A;  2CXL A;  2GK9 A;  1OXZ A;  2B1E A;  2C5I T;  3ZLI A;  2YK0 A;  2E9X C;  2HPL A;  3TKL B;  4AXP A;  1LVF A;  2NW9 A;  1D0Z A;  3FBL A;  2ES0 A;  3LG7 A;  2DWK A;  4IE7 A;  2C0S A;  1ZV4 X;  1X79 A;  3MJX A;  4YHJ A;  4DMW A;  4O8S A;  3SS1 A;  3C51 A;  1WR6 A;  2Z6E A;  2V26 A;  3H37 A;  4U72 A;  3AA1 B;  3GN5 A;  4EAH A;  4CXW A;  5ADX L;  2ZM0 A;  3AVR A;  5HWX A;  5LA6 E;  4GYS A;  4EZ4 A;  5IYZ E;  5JRC B;  1HX8 A;  3KV4 A;  4MHC A;  2C5K T;  3PUG A;  1MIY A;  2V7J A;  2KIN B;  3LJC A;  3C98 B;  3EDU A;  1MIW A;  5FY1 A;  2XUE A;  2V7M A;  3K3N A;  5JDQ A;  1QSD A;  3IF8 B;  3CKD A;  2CA5 A;  4HEA A;  2EHO B;  1Z0P A;  1FMW A;  2V7K A;  5CA0 E;  2K24 A;  5JDH A;  5HYA A;  4PJJ A;  1SHZ C;  2CEA A;  2VKH A;  2W63 A;  2YU2 A;  2WMO A;  3KV6 A;  4ZOL E;  4ZS2 A;  3UUX B;  2K9A A;  3AA7 B;  2ZMA A;  3ETV A;  1NAF A;  5LJN A;  4E7S A;  3VU7 H;  3FB2 A;  3NZP A;  2LSK A;  4K0U A;  4L5G A;  3BQK A;  5HXR A;  3ZYM A;  2X0L B;  2L9Q A;  4BA9 A;  1US7 B;  2H7V C;  3ETU A;  5L3F B;  2J1D G;  4PK4 A;  2ODV A;  4H9R C;  4OHF A;  4ADZ A;  2WBL A;  4WNK A;  2LT3 A;  3DP7 A;  3UUN A;  5TAO A;  2E8I A;  2OA5 A;  2LHN A;  5FMN A;  2JQQ A;  4M1P A;  3RRC A;  3M65 A;  4KBM B;  4NUV A;  2CE7 A;  2PG8 A;  1WLX A;  4CZZ B;  5KMG P;  2LJL A;  5JR9 B;  4O4I E;  2CWO A;  3ANW B;  5LGT B;  2NTY A;  1HTJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...