2CLZB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
publication title Distinct Orientation of the Alloreactive Monoclonal Cd8 T Cell Activation Program by Three Different Peptide/Mhc Complexes.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 16
structure length 99
sequence length 99
chains with identical sequence P
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2clzB00
1XH3A 4NQSB 1JWSB 3RWIB 4HV8B 3F7RA 5F44A 1UXWB 1FNGB 2ATPB 2PTTB 3RNQB 3HMXA 1C12A 3RI5K 1MI5B 3HLAA 3OKEB 4HWNA 1TVBB 2UZIL 1FFOB 2FBJH 4R0LA 3HC0B 5TE7H 4OCYL 3I6GA 4TVSa 2P45B 1W0WA 4JRXD 4UQ2A 5GJSH 5EC2A 2E7HA 5FUZH 4TULL 4S10A 2H2PC 5GS2D 1BZQK 4IDLA 4NO3A 5DVLA 2YR3A 3P4NB 4RAUA 5C0IA 3ARGD 1W72H 4PV8B 1U93A 3VXMA 1RURH 1KLFA 4OGYH 3LPGA 1UM5L 3PL6C 3TC9A 3Q6FB 5F6HI 2GY7B 3V4UL 3B2UC 3T0EB 3HC3L 3MV9A 4RGOL 4DFHA 3EO1A 1FYTA 2P49B 3GM0A 2LU7A 4R9HA 4KV5E 2SEBA 4L9DA 2K7QA 3S3SA 5HYQA 4KK6C 2H8PA 1HHGB 1FN4A 1HZHH 5CUSL 2BMKB 2W0FA 4U6YA 4LARL 2L7JA 5LGKA 2ZNWA 4JREC 1JGVL 5D7SH 3SKOB 1XR9A 4CGTA 5F6IB 3KYKH 1U95A 3BPOC 3F6IA 4NHUB 1OF2A 1G9ML 3QEGL 3ULSB 4JZOA 4MJ2A 4J23A 2EDNA 4KU1A 4MA1B 3B9EA 4AY0A 1ZA6B 3SKUD 1KJ2H 2A1WL 1AGFB 2DLFL 3FB8A 5E1HB 2AAVA 2PXYC 5ALCL 4BZ1H 3N1QC 3QDGA 4NGHH 3U0WH 2VISA 3EO9H 4WFEE 1KNOB 1AR1D 1TQCC 3EYFB 1U8MA 1YECL 4XNQB 2HFEA 5JHDA 1ZVSB 2C3WA 4K94C 2XWBA 5B38G 1JK8B 2YWYA 3C5JA 4PJ7E 1PSKL 4TVPD 3IT8D 4H20H 1ZSDB 5FDWB 1F8TL 1UJTA 4FXGB 5K9JL 3DHJA 3KNBA 4NHCH 5HPOA 5IV2B 1GL4B 3NH7H 1F42A 3HA0A 1OTSC 4HS8L 1AIFB 3F58L 4WU7B 3GGWA 1CDGA 3P77B 4PJ5A 2A9NH 5HYJD 4P5TA 4HCRA 4R26L 3TT1L 3KYOA 3JWOH 1MAKA 2MSPA 3QXAB 4QRTA 1BLNB 4WU5B 2MNUA 5DJ6B 4YNYA 1HWGB 1BVLB 4YHML 4K23H 3S37X 1AKJA 4HUVA 1T5XA 1EHNA 1QSEA 4PRIE 2HVJB 2BFVH 1INEL 4Q2ZB 2IH1A 2HA1A 2GK0B 4PJDA 1BQLL 1A47A 4Q6IB 1EAPB 2VL5B 4OJFL 3ULUL 2HMID 1RUKH 3N9GL 1X5ZA 5FOJA 3OB0H 1DBAH 1DDHB 4XPTL 4YHIB 2DI9A 4QRUB 3V5DB 3ARBA 2R56L 3IS1X 4EN3A 2J88H 2VDML 5DJZA 5JXAL 3W2DH 1W2KT 5ACZB 2J7LA 4NQCE 5FO9B 3TVMC 3V5KA 3PV7A 1GGIL 1WITA 4N90E 1RZFH 1JPGB 3K8LA 4Y16D 4YZFE 2E7LC 4GG6B 3UTSA 1CBVH 4L8CA 5T33L 1RK1B 3VFUB 4OZGA 3B8SA 1EMTH 3QQ4B 4F33A 3CVHL 3J8F7 5CZXD 1KIPA 4HWEL 4NDMA 5IGXH 4B53A 1KELH 5HHNA 2HJLB 2XZCL 3ULVF 5SWZD 1G9NL 4P3DA 2DD8L 5IB2A 1JIBA 5AG8A 3MNVB 1RZKH 5HHVH 4X6FB 4P46C 2Z93A 3HCVB 3QUMA 3KJ4B 1MCLA 3BX7C 4S0SD 1A7RL 4NZUH 2HKHH 2XA8H 4F7CA 4OLEA 1HHIB 4HKXB 1TQBB 5IESL 4KXZI 1NC4A 4FQJL 1IBGH 3ILPB 1VFBA 2MOVA 4Q9QL 3L6FB 3IAQA 4Q9BA 4OGAD 3WNNA 1ORQB 2R0WH 1FCCA 5FM8A 4IRZH 3V6OC 1QEWA 3RL2A 4NKDB 3TBTA 3BAEL 4LPTA 1ZLWK 1NANH 4YC2C 4LFHG 2OLDA 1UM4L 4M5YL 2DICA 4G43B 1YY8B 1K8DA 2O61B 3MNZA 1GOHA 5C0CE 3DXAA 1DN0B 4ZAKD 5KS9A 4YPGA 1J5OH 4MCYB 4OLUL 1MAJA 2FGWH 1U8KB 3I85A 1FG2A 4P4RA 4HIHA 3V95A 3KWWA 3OG6B 4D0DA 5C9JA 2VWEC 3MXWH 5C09D 3CFBA 4Y89A 1WT5C 2N7BA 5JIIA 5I15L 2BSED 1KIUA 1S9VA 1JF1B 1I9IL 4MXVE 3MRQB 4PJHF 5FB8A 1OCWL 2H2SC 1BZ7B 1FNFA 3BGMB 4MD4A 4PRAB 5DQJA 4YEFA 4TNWK 5I1KL 2F58L 1MWAA 3G6AA 3G6DH 5DYOB 3S5LA 5KN5A 1R3IH 3KPSB 5LCVL 5HJ3B 4X6DF 3MRMB 2AJXL 2FZ3A 3SQOL 1CLOH 3FT4B 4PJAF 3NIFF 3W82A 3OJMB 1R5IB 1DZBA 4Z7QF 2YUXA 1DUYA 3SKMB 1G7LB 5ECJE 4XWOD 1IAOA 1SJHB 3EZJB 4H0GA 3PL6B 2GW5A 1A1MB 3WLWD 4UT9L 1Z5LB 2AJUL 3G5VA 2EH7H 3EOAA 2GJJA 1LQSR 4P9HC 4OAWB 4FQ2L 5TDPB 4JQXA 3FFCD 1K4CB 1MCJA 1PKQA 2VZ3A 5DSCB 1V3JA 5B8CA 4Z76A 5AUMB 4ODTL 1P84J 1YNLH 4M1CD 4UB0H 1I3GL 1MHCA 3BN9C 1SEQL 4W4OC 5GS1C 3BHBA 3IFNL 2GJZB 2FEEI 4JREB 4PTTA 2CKNA 3U6RB 1U3HA 2ZG1A 4ZUVB 4O9HL 2X89D 5DMJB 1WFOA 1JUFB 3BPOB 5GSRA 1A5FL 4IDJH 1WC7A 4KTDL 5C0RH 4Q6YA 3KYMA 1NBQA 1FIGH 4JO1H 1EDQA 1ZHNA 3EOTL 4U6XA 1BIIA 4Y19B 3FN9A 4UTBL 3RL1B 4PJFF 3D3VB 1VGKA 4PB9H 4U1HA 5GRUH 4LK4A 1OPGL 5EC1B 2PXYB 1C08A 1OTTC 3IU3B 4XMLL 4F3FB 4XNMA 5IJKC 2B7DT 4PGJA 3GBNL 4HCRH 5I1HL 5CLTA 2ICES 3EOBA 4H5SB 2V17H 2DQJL 4M7KH 3BH9A 2DB8A 4L29A 5EUKB 2P43B 2VLKD 4I3RL 1CGVA 5IBTL 4XPBL 3SEPA 5ITFB 3MUGB 4QHLB 2R1WB 3ZLQC 4OFKA 3MPCA 4P9MH 3W0WA 3AS0A 3HNVL 2F5AH 4PP1C 1H15A 4PRPB 2BVQA 5F9DC 3JWDH 3FONB 4K8RC 3CFJB 3LKPA 5DGQA 3CC5B 1LE5A 5IHBA 2F74B 2DWDB 1G7IB 2BVTA 5MEQB 3ZSSA 4KHTL 2DQTL 1B4JL 4Z77A 5CJXC 4M1GL 1ERNA 2ADGB 2Q7YA 4U33A 2MCPH 5DI8A 2EIZA 4Y16A 5C0BE 1E28B 3KS0J 1U8LB 5DWUL 3QXWA 2DM2A 4KDWA 3NCJH 3DROB 3JBG7 3RWCB 4Q9CA 3BIKB 5GZOD 4YBQC 3QO1A 5EBMA 5I1JH 3BKML 5T1DH 4XWGL 3IJYA 4PFEA 5KVGH 5EZOH 3CJJA 4JRXE 5C0NC 1FRGH 2DBJA 4X4YB 1OLZA 4GBXA 3G9VA 4GRWE 1YEDB 1JPSH 1DQDL 3U0TA 1C1EL 3MFGB 2OYPA 4NUGL 5EU6D 2ZUVA 1F58H 3QUMH 3AC0A 1P5UA 3SGEH 4NN7C 4KHXL 2BC4A 1X5FA 3ILQD 3RU8L 3UJTL 4U0RC 5C6WH 1QSFA 5KVEL 5GJTL 1MHHA 3RIAK 3T77B 2WBJC 1OGAB 3QWOB 3WXWL 4WO4C 5CEXB 2V2TA 1BBDL 3FB5A 2YUWA 4WWKB 3W11D 5TGBB 3ZHDA 3MLYH 5IJVA 3CSGA 3A6OA 3QRGL 4MXQC 5GS2H 4GRWH 4I3GA 4ZMAT 5F70A 4DOHB 5FV1L 4XCFL 3UTTB 5BJTA 4P46B 3MRNA 2IALA 3OX8B 4HXAH 5CBAA 2OK0L 1PFCA 4ZD3H 5ESAA 3MRJB 3U79A 3HC4L 3U2SB 1FNHA 2YEZA 1CYGA 1CLYL 1J9CT 2G2RA 1F5WA 5SX4H 3N85L 3RAJL 2JJTA 1MIMH 3QI9C 4EVNA 5GS0D 5E9DA 2AW2A 1TJHL 3DRQB 3O6FC 3MMEB 2FR4B 1FNLA 3K4AA 2UWEE 4GXVH 4UMGA 4YDVA 3GSOA 4FP8H 2CJUL 2WIMA 2ZKHL 3I75A 1YPZF 2APWA 3MOAH 4HDIB 4PRBA 3TIEA 1I7TA 4YC2B 2OX5A 2GT9A 3QQ3B 5IVZB 4DK6A 3VFMA 4GQPH 5T5FH 2NQCA 4ODUB 4P2QD 4YHKH 4APQA 1D6VL 1J0IA 2F53A 3FQUB 4M1DL 3ZO0A 4E0RB 3GMQB 3OQ3B 43CAB 4ONGL 4TVPE 3O3BA 4LDLB 2DDQL 3MLXH 4YDIH 4G42A 3TCLB 4KK5D 4QNPF 3QEQD 2YC1A 2WNGA 3T65B 1R5WB 3IXTA 4NWUL 5D7LD 3FB7A 4N0UA 1PYWA 2PW1B 5EA0L 5J6HA 1MCKA 2Z0BA 1UC6A 4LSTL 8FABA 5HYJE 1AO7A 1OARL 4PG9B 3HZYB 2Q3AA 2I60L 3QEHB 5HGBB 4MX7A 5E56A 3L3OB 3U7AA 1WBZB 2IMNA 4ZUUA 1LEIB 2VIRB 4YPJA 4TSAL 3FN0L 4I0CC 1J1PL 3BEVA 2P5EB 3C8KB 3HAEH 1IGFH 2ARJB 1YQVL 3GMLB 3BO8A 5IW1B 1LMKA 2OSLA 2C3VB 2HKFH 4Z5RB 1G0XA 4TVPH 1HH9A 3VFWA 3NCYP 1GSMA 3GKWL 5CMAB 3IDYC 3RKDC 4QRPD 4BQBA 1XF4B 5HI3C 5HGAA 4W6WB 3SDAC 1VACA 5LXGL 1UJ3C 4DQOL 3OKLA 3VFGH 5GISL 1JV5B 3MRBA 1HE7A 1OSPH 2DKUA 4MYWB 1BQSA 4R2GC 4AQOA 3VCLB 2EYSA 4N1CA 4LSPH 1FAIL 1P6AB 1X5YA 1AGBB 2R9HD 3HE7C 1AXSA 3OKNB 1R3HA 2VLKA 1L4IA 4FQLH 4HIJA 5MI0C 1LP9E 4A6YA 3U0PB 4ACPA 4GMSH 4OIAA 1XGQB 4WHCA 2XZAH 1F4AA 1A14L 3DX7B 4NRZB 4MNQD 4KQ3L 4FXKB 2X42A 3ZTJH 2BJMH 2V2XA 3O4LD 3GI9H 4M6OL 1FZMB 2GFBB 2H1PH 3K2MC 1DQQA 2VUYA 4MDJB 5SWZE 3NAAH 4ZO8A 4K9EC 2VTFA 1HYSD 3RWGB 1S9XA 3VGAC 3WFDH 5F71A 1M05A 1FFNA 4V1DB 2X4NB 1M7XA 3P4LA 1WISA 1DFBL 3SQBA 3ARFD 4CVWA 5IQ7L 5FYKU 1IEBA 4KMTH 5F7LB 1QBML 4OFPA 3NCMA 4N0YH 3ME0A 5TE4L 5D1ZA 3BDXA 4ETQB 2B4CL 2ZUWA 3H7BB 1HYRC 1EEZB 2BHUA 4KFZC 1DBML 5H2BA 2FECL 1CXHA 3DX8A 1DP0A 5BV7C 1A7QH 1YEGL 1ZVHA 5FKAA 4RBPK 3LOWA 5A3IC 1N6QL 2DLIA 3LRHA 3TM6A 1B0RB 4JFZH 4HS6B 5IQ9A 3CLEL 3TZVD 3TBWA 4NZTL 3ZKND 2VITB 4NKIH 4JR9L 1V3LA 4ZXBD 5LQBL 4H88L 2NTFA 4PJIF 1GZQB 4ZSOB 4HUUB 3K80A 5EORH 1A6AA 2RCSH 2EDWA 1HQ4A 2G75A 4CN4A 2ZSWB 2VC2H 3KPRD 1BJ1J 5ETUA 2H32H 4LNRB 4PJ8D 4QO1A 4LSQH 5FYJD 4J6RL 5EU4A 4LSDA 4RFOL 1LK3L 1W8OA 2Q8BL 2NY6B 2VLRA 5C09E 1J0KA 3CDFA 4LPVA 4WFHD 3OGOE 5DXWA 3C5ZC 3WLBA 4XCNB 4PJXA 3L3HB 4NRXA 3NZ8B 2CO6B 4PLJC 1LO0H 4QTIL 2XOTA 1C16A 3O41A 3CFIC 3KR3L 2OXHA 3AROA 3CFEA 3QULB 2J8UA 2C3HA 5K93A 4JFQA 1RZKC 3QNYA 4F37K 1SJXA 4XHJC 4EXKA 3O3EB 3I6LE 3CLFL 2CDEB 3VA2C 4I2XE 4WIQA 1FVCA 3LEYL 2A6KB 3FO9B 4NN7B 3S8WA 1ED3B 3R06B 4WHYH 2DLEA 4HQQH 1PZ5B 5FGCE 1FNSH 4U0RB 4HIIA 3QSKB 4XP5L 3H9ZA 3UJJL 1MY5A 2K1MA 3E1F1 4LRIC 4FQCH 4IRSA 1KB5H 2WBJB 3NFNA 2AXFA 2QQKL 3P4OA 3FFCE 3V6OE 5I1LB 4CUCA 4P2QA 3B8YA 4WUUD 5CJOL 5BXFB 1CE1H 5EH1A 3RHWF 5EUOF 2GIYA 3RWJA 2R4RH 3QHZH 4QXGH 1OP3H 2PYFB 5IVXB 35C8L 3DVNA 2H6PB 4LOUC 2G9HB 2PR4H 3RDTA 2OXGA 3MOBH 4NUJB 3CVIL 3BH8A 3Q5TA 4QRRA 3VFOA 4J2XA 3MLPA 1QNZH 4NQUA 1FORL 5D1QA 4DAGL 1VCAA 2NY7H 2HLFD 2A77L 3GIZH 4DVBB 3UJIL 3QI9B 2JJSC 5FHBL 3BESR 2VWEE 4FFWC 4E9LA 4LBEA 5FYLL 2VXVL 2A0LD 3GBML 2BSRA 4LHUD 4ZNEA 2P24A 5T1MA 5CP3A 5MERA 1A4JB 2AK4D 4X9GA 2BRRL 3IJHA 3QDJB 5FCSH 4Y4FA 2CUIA 3O6LH 3BD5A 1NFDF 2IG2H 2ZPKH 5FF6B 3JVGA 3UTZA 4C56B 4OLZH 4U3XA 1HI6A 1LE9B 3ESVF 4LPUA 3WSQH 1X6LA 3BP6B 3E8UH 5IB3B 4WNQA 1UWGL 3O6MH 1TJGL 3HKFA 5M7QA 4LRNH 2IH3A 2JIXB 4OUOA 3PWVB 1W72B 2IGFH 4I18B 4XAWH 5IHZA 3GB7A 1IAIL 1H3VA 4O58H 5I1AA 5IEHA 5T3XD 3T3MF 5CD5D 2VERN 4NQED 4NO0D 5K59E 2WUCL 3D2UB 4Y4KC 1CFNB 5JXED 2AEQH 2P8MA 3HZKA 4MQ7A 4HK0B 1VKXB 1DANU 4M3JA 3NN8B 4PRHD 3Q2CA 1FGNL 1WBYB 1FAKT 4OF5A 3F12B 4L4TB 5FECA 3U9PH 4A6YH 2LU3A 2P5WD 4BELD 4FFZH 4PS4L 4M61A 1NAMA 1MLCB 4ZQKA 1XIWA 2CIIA 5FXCH 2NX5B 1QLFA 5I2IA 2BY1A 3TWCL 4G7YH 4Y5VA 3V5HA 5JORA 4UZGA 3U4AA 1YJDL 2YD6A 2YD9A 1ZT7A 3IDYB 3SDYL 3NIDF 4XP1H 1GJIA 3ARFA 1PQZA 5ICZB 1N5AB 5F93C 3SDAB 1UJ3B 5EU6E 1RJZB 5DGRA 5F88A 1XGYL 5EOCJ 1KYOK 1JPFB 5D72L 4ONFL 1VADB 5F1IA 1A4KB 1UG9A 4QWWD 3QUYD 2ADFH 3LAFA 4R2GB 2PF6A 4Y7MA 1AE6H 2NW2B 2JK5A 4W70A 1YYLL 4XNUH 3HE7B 4OB5L 5D1XC 3SPVB 3TGXA 5JW4N 2VDKL 5MI0B 4M8VA 1VEPA 1X4ZA 3RA7L 4EI5A 2D31A 3VXSE 3IDJA 1KN2L 5C6PB 2BXYA 3VXQA 5C6TL 3L3DB 1RU9L 2LVEA 4UT7H 4XC3H 4HC1L 3JWDC 3VGAB 4OGXL 3S4SA 1N64H 2DQDH 5HYSB 4FZEL 1EHAA 3CFDA 5GSVB 2PO6D 2X1QA 4HXBH 1RJYB 4MJIB 4Z7WF 1TJIH 2Y36L 1FJ1B 4LASL 1T22B 3G5XB 2J4WH 4GKSB 1EEUA 4BUHA 3ARBC 4R4FL 4LCYA 3LIZL 4O2EB 1GGTA 4R7NA 2XKSA 1ONQA 2OR8A 1QPPA 1RUPH 3TH3T 3RPIB 2VR9A 5IB1A 4OM1L 2QLVB 2FBOJ 4TNWF 5SWQA 5EDXA 4XBEL 4JPIA 5IROC 2GI7A 2IAMD 3L5IA 1CK0H 3MRLB 3BPCA 3BZDA 1INQA 1J8HE 1S5HA 3BGFC 4PJ7B 4GAJH 3X3GH 4LQFH 3A6CH 4P59H 25C8H 5I16A 4OCSH 2X70B 1L7IL 2OZ4L 3TJHD 1A6TB 2IADA 2FNBA 1T66C 2C26A 3MJ9L 4PGBB 1RZJH 4L3EB 2C4FT 5L2KA 3QEQE 4O51B 3G6JA 5INCA 3RWDB 2I07B 5IOPA 1ZGLB 5D7LE 1MCWW 4NSKA 5IT2L 1MAML 4UINL 1RUMH 5D5MF 1RV6X 4PJ9D 1BEYH 4ZTPH 5EU5B 1A6ZB 3C5ZB 3UYRH 1OSZB 4WUUA 2E9WA 4WJ5B 4GFTB 2HTLC 2NNAA 32C2A 3T0AA 4BM7A 5IIEA 1WZKA 1XF5A 5DD6A 1R3LB 1I1FA 3OKYA 1I1YA 1D5XB 3CMOH 3FB6B 5EBGA 1KT2A 1ZS8A 4XP9L 1NAKL 4UNTA 3NZHH 2CLVA 5DK0B 5CEZD 4NQDA 1X5JA 2NXZB 2MPAL 2XXCB 3QHFH 4HPOL 4M7ZC 3MUJA 3SO5A 4QRPE 1FGVL 5C08B 1BWMA 5HHXL 1S8DA 1ZA3A 3VFRB 4N0CC 3NA9L 4PGZA 1MFCL 5EBWB 4LAQH 4JFFD 3TO4A 1XH3B 4JQVA 1NLDH 2QADB 4WI7A 2C7UA 5D71L 4LHUA 3QPQD 5H8DA 4OLXL 2LQRA 5SV3A 1AC0A 2AS5M 1C12B 5DRWA 4G6MH 3HLAB 3NGBB 3SDCA 2VDNL 5CP3H 4DEPB 4XPAH 1EERB 2X9YA 5B3JE 4KTEH 4YE4H 1OM3L 4S1QH 4FTVA 4R0LB 4MNQE 1ZT1A 4YWGH 1Z9SA 4LLYA 1E4XL 3BP4A 3I6GB 3O4LE 1W0WB 4UQ2B 5EC2B 2VLLA 5BZWA 5IMKA 3VH8A 1P1ZA 1KPRA 2EIEA 4NO3B 1I8IA 1MY7A 5DHXB 1UA6H 2R1YA 3JV6A 4OD2A 3HG1D 4YXLH 4RAUB 3R1GH 4NQEA 2X9WA 4CJ1A 2DM4A 1U93B 3VXMB 2I24N 4KVCH 1B3JA 3ZDZF 1OHQA 1YYMH 1MJ8L 4J3XA 4PBXA 1EZVY 3NFSH 3MV9B 4M5ZH 4XI5D 3EO1B 4P9HL 1FYTB 4PRHA 3PWJA 4HMCA 4OZHA 2SEBB 1A2YA 2FX7L 3FMGL 3D87B 5HYQB 4LSVH 2H8PB 3UP1A 1FN4B 2W0FB 4U6YB 5B8CC 2DJ4A 2H26A 1BFTA 4B41A 1ROWA 4Z7VE 2MJWA 3REVA 4BYHA 1TTGA 1NAMH 4F8QA 1U3HC 3SDXE 1MQKL 5L9DH 1XR9B 2GHWB 2WW8A 3H0TA 3FJTA 1U95B 4JFEE 4NKOA 1QFWL 5E99L 1I1CA 1OF2B 4IRJB 2G5RA 3LSOA 4NM8L 4JZOB 3VWKA 1FDLL 3KPRE 4DGVL 4HPYH 1HSAA 4D2NA 2NTSP 1P2CB 3T0VA 1KACB 3FB8B 1G6VK 1ETZA 4QY8A 3L7EA 3MUZ1 4RMQA 3QDGB 4POYA 1E0OB 4WFHE 1MLBA 1HKFA 2VISB 3KLDA 1W8NA 3EOYG 2VXSH 4MA7H 4R4ND 1U8NA 2R2BA 5JW3L 4WTXA 5J1AA 1HINL 5ANME 5F9OH 3SDDC 3NACL 1U8MB 2JELH 2HFEB 4HFWA 5JHDB 2XWBB 1DQTA 1BD2D 3C5JB 4X6CE 3ULUF 5AAWA 5D9SA 2PO6A 1U8OA 1I8MA 2V5SA 2YA2A 2EDKA 2GSIA 4C58B 3KNBB 2NY0C 4HEPG 4P23A 4WI2A 3QNZA 5FYJH 1JZ2A 5T3ZL 4K7PX 5GGQL 4LCCA 3C2AL 3WIIL 4AH2A 3GGWB 5KOMC 1UT9A 3PF2A 4RAHA 4A2LA 4PJ5B 1XF3A 4P5TB 1N0LA 3KYOB 3N1MC 4GQ9H 2NZ9C 4QRTB 4XNXL 2A6JA 5GRYA 2XTJC 4KUZL 5CSGA 4XPHL 2VXTH 4YNYB 3RVWC 1AKJB 4HUVB 1T5XB 1PLGL 1AD9A 1QSEB 1LVEA 2IH1B 4U05A 4R7DA 4GW1A 2FWOA 4PJDB 3D85A 5H35A 1MCWM 4KI5C 4GBXC 2OJZH 4Z7UA 1BQHG 5E70A 3K2UL 2HTKD 1UEYA 4PJBE 1TXKA 4GSDL 1F3DH 3U7YH 2D2OA 2DQCL 3ARBB 4EN3B 1GGBL 4M03A 5DJZB 2UVFA 4WY7H 2B2XH 4ENEC 3HUJE 4L3AA 3V5KB 4J3WA 1WJ3A 2WV3A 4AG4L 1QOKA 1RIUH 4S1SH 3UTSB 4L8CB 2G60L 3AVEA 4OZGB 2XT1B 2AK4E 3PHQA 1KIPB 1PW3A 1QLEH 4NDMB 3JV0A 3BGFB 1ZHLA 3DIFA 1IJ9A 5HHNB 1G7QA 3WN5A 5EOTA 2X6MA 2NXYC 2O5YH 2CQVA 3JV4B 4P3DB 1KULA 1OT1A 4PJEA 1KCVH 4G9FE 5IB2B 5MEND 3F7YA 3K8MA 2Z93B 4KVNL 3QUMB 5HGDA 2OR9H 4F7CB 2ITDA 5T3XE 1GGYA 5GZNC 5JW5A 3GUTA 2CSPA 5DR5H 3IAGC 3BSZH 1UYWH 1IKNA 1VFBB 1HEZA 4NZRH 4LVEA 1IQWL 3BVNA 3IXAA 1OTUD 1QEWB 4Y2DD 3RL2B 5TJWK 3TBTB 2RQ8A 2P5WE 5TE7L 5GJSL 3QDMA 4WFFD 4KROC 2P4AB 5FUZL 4APQC 1CFSA 3KHQA 5JTWA 1LO2H 4HT1L 1EJ6A 1K8DB 2EZ0D 3OL2A 3MNZB 2J3SA 3KJ6H 5AYUH 4M7ZB 2ESVD 3O3DA 4MHHG 3DXAB 1W72L 3P0YH 1BVZA 1RURL 5KS9B 4YPGB 4PRDA 4OGYL 5T3XH 4YQXH 5J57B 4MSWA 5JO5A 1NEZG 3ULVD 4DTGH 3VD9A 3UAJC 1FG2B 4BA8A 3O3UN 4P4RB 2ZUUA 4HIHB 2CR6A 3KWWB 4D0DB 1ACYH 5C9JB 5D93C 1F00I 2EYTA 1LNUA 1HK6A 3CFBB 2XKUA 1NPUA 1EEYA 3BP7A 2FEDD 2Y1VA 1WTGT 3DUSA 2DQUH 1HZHL 5F7HA 3PWPD 12E8H 1S9VB 4JLRA 3F7PC 5FB8B 4M6NH 5F96H 5J3HC 5D7SL 4MD4B 5DQJB 1T89C 4FQPA 1K9TA 3KYKL 3AU1A 1EO8L 1MWAB 5F1OB 1KENH 3G6AB 3S5LB 5KN5B 2DOCA 4JZJA 5EWIH 4HBQA 4XBPA 2FZ3B 4JRYD 1CL7H 5C0AD 2BNQA 2EE6A 1DUYB 4BFBD 7FABH 5DEZA 4GXUN 1KLUA 4IIQB 1IAOB 2E3VA 4K7PH 3WKMH 5E00A 4POUB 4XVJH 5A16A 3VGHA 4TUKL 2R69H 2VN4A 4W81A 3G5VB 3EOAB 4LVOC 4XZUA 4TN9A 4YDLC 5IBLC 3RRQA 3U0WL 4HKJA 5D7JD 5JIKA 2DMBA 4FFVD 1PKQB 3WXVL 1YA5A 1JHKH 5B8CB 4Z76B 3PABB 4PBVC 3MXVH 1FL3A 1MHCB 1D9KD 3BHBB 4GUPA 4PTTB 4V2CB 5DC0A 5K9QG 1U3HB 3FKUS 3GK8L 5DZNA 4QTHA 1ZMYA 3DV6A 3X3FH 4H20L 5GSRB 3IYLW 1WC7B 3EFDH 3KYMB 4NHCL 4BJLA 1ZHNB 4U6XB 1BIIB 1LO3L 4GJTB 2ITCA 1L7TH 5FKPA 1VGKB 4I0PD 4U1HB 2A9NL 1OP5K 4R3SA 2WSKA 1CDBA 1C08B 1MJUL 3JWOL 5D1ZC 3TP4A 3DV4A 2JCCE 4YZFF 3SCMD 1L9MA 3F7QA 2AP2A 4XNMB 1DVFD 2VYRE 3FOLA 1MQ8A 2YMXL 5JOEA 4NN5B 3EOBB 4OF8A 4K23L 4JM2A 2HFGH 3BH9B 3IRZA 4L29B 2COQA 4EKXA 4RGNC 2BFVL 1MF2H 2VQ1A 1IM9A 5CAYB 4M7LL 4U6HA 4YHPA 5KSBA 1R3KA 1H15B 2BVQB 5DHVA 4KRPD 1RUKL 4ODSH 5FHAH 3LKPB 3P9LA 1HKLH 1W0YT 4PJEE 3S98A 1LE5B 1DBAL 1XR8B 4WRLA 1ZLVH 3S7GA 2J88L 4HHAA 3W2DL 1ITCA 4JFFE 5ALBH 2Q7YB 5DI8B 4HG4K 1BFSA 2EIZB 4Y16B 4XMKH 4KJQD 4LGPB 3QZWA 3EIFA 4ZTOL 1CBVL 3QIBD 4FOMA 5CEYA 3TEUA 4OLWH 3D18A 2BHYA 3VG9C 4OBSA 1QLRA 3IDMA 3RGVD 4UIMA 4OSUH 1IAIM 1EMTL 4PLKD 2XIDA 1BFVH 1EBPA 3QO1B 5EBMB 5MHSD 4ISVA 3PP4H 4UILH 3QUKA 3IJYB 3VFVA 1GIGH 4XVUC 2ZG3A 5CEZH 1A7OH 4FS0A 1JN6A 2FJFA 3CPLA 4PG2A 1RZKL 3HNSH 3QXVA 4GBXB 5D7IA 5FGSA 5HHQA 4QYOA 5GGSA 3U0TB 2QSCH 4FG6D 1NMAH 4X6EA 3HG1E 1QBBA 2XA8L 1O7VA 3C6LC 4UDUA 2E6JA 2KBGA 2R2HA 2RGSA 4LL9A 2F5BH 1YZZA 2BC4B 2EDYA 5DQDH 2Y7QA 1IBGL 5L88H 1OP9A 3BOVA 5DRXA 1QSFB 3CNKA 4BFGA 3TCXA 4TTGA 5KJRH 2R0WL 5T1LD 1MHHB 2B5IC 2ZCHH 4IRSC 4NFDA 4CVUA 2CK0H 3O0RH 1U3YA 3V52H 2IPKB 3BWUC 2V2TB 1QYGH 4FNLH 3FB5B 5ELIA 4LQ1A 1CI5A 2NXYB 3PV6A 3B2VL 5DJ2A 3ETBF 4YUEH 5IJVB 4QLRA 3EFFA 1VFOA 2VJXA 3V6FA 3RDTC 2ESVA 3S36H 5JOFA 5BJTB 1J12A 3MRPA 3MRNB 1IL1A 4NO5A 3MBEA 2IALB 1J5OL 5CBAB 3QO0A 2QR0A 4Y0GA 5ESAB 4JDZA 5E94B 2YEZB 4UQ3A 1RVFH 5D1QC 5I1GH 4Y1AD 4XNYH 3ARDA 2G2RB 3MLWH 1JI1A 1IM3A 1BVKA 1I8LA 1QBLH 4Z95H 2GSGA 4EVNB 3K4DA 5HYSG 5E9DB 2F54D 3QXDB 4YDVB 1AI1H 3GSOB 3I75B 3DMMA 5CGMA 1WV7T 1A6PA 4L1HA 4PRBB 3TIEB 1I7TB 2GT9B 1FNEA 3VFMB 1U8QA 1GAFH 4Y4FC 4APQB 4RA3A 2F53B 3T1WA 4HAGA 2O93L 1R3IL 1U91A 3M17A 4HW6A 3JVGC 5KSAD 3KPPA 5TF1L 1CLOL 2DBLH 5L6YH 1BD2E 3O3BB 3V4PH 1A9BA 3STBA 5KTEH 3IAPA 4G42B 4LSRH 3FOMA 4FQHA 1WZLA 3B5TA 2YC1B 5FGCB 3IXTB 2IEPA 5C0JA 4XCCL 1KOAA 3H3BC 4HLZH 3VRJA 3L95A 4N0UB 4UNVA 2EH7L 1KC5L 1PYWB 5CINH 5J6HB 8FABB 1AO7B 1DEDA 4BFEA 3S37L 3EYQC 1BHGA 4MX7B 5JPNA 1CD8A 1ZWIA 4XH2B 3B9KC 1DR9A 2D4FA 1T7XA 1YNLL 4ZUUB 3RWFA 5C7XL 5IK3A 3ES6A 1WAAA 4GKZB 4HKBA 1KG0A 3BEVB 4QXWA 1EUTA 3MLUL 4G9DA 3E2HC 1V05A 1XIWC 3O11A 3BO8B 4PJHA 2X4TA 2OSLB 2APVA 5C0RL 2OMNA 1J10A 1HH9B 2Q3ZA 3VFWB 5TFSH 1RULH 4I4WA 4YHOH 3A6BH 3JTTA 4JN1L 5HGAB 4X6DA 1VACB 1F3RB 1OW0A 1CF8H 3OKDA 3OKLB 3MLVH 2AXGA 4MXWH 3MRBB 1NBZA 1DVFA 1II4E 4U1LA 2EYSB 4LVOB 4YDLB 3MYJA 4HCRL 5D7KE 5IFHH 2YUVA 1AXSB 2V17L 4D8PA 4GG6F 1R3HB 4ZFOA 1TZGH 2VLKB 4HIJB 5KZCD 4OI7A 4A6YB 3A67H 2AV1A 4X5XA 2HRPH 2W9DL 1OAXH 4EI5C 4QHNA 4G7VH 3QDAA 1KBGH 2V2XB 4Y5XA 1HHHA 2VE6A 2F5AL 3P4MA 3BQUD 2X2YA 1DQQB 2QSTA 3JWDL 3WNLA 2V7NA 1S9XB 3MRRA 5DHVH 1M05B 1FFNB 5MENE 2RR3A 4HJJH 5JQ6H 4MDIB 3PNWA 4NFBA 3F62A 4KAQH 3S34H 1IEBB 4IOIA 2L4OA 2EDEA 1J7VR 3L5WA 1DLHB 1KTLA 3HE6D 1YN7A 2CLZA 3QIBA 5D1ZB 4RDQF 1YUHA 2GYSA 1CIUA 3NCJL 2UY6A 3DX8B 3NPZB 5FO7A 1CD0A 5DA4A 5GGTA 4BH8A 5FKAB 2XTJE 1BGXL 2V5YA 5T1DL 1XF2A 3T4AA 4YDKH 1N2RA 4RGNB 1S7RA 5E2TH 5KVGL 5IQ9B 3CMGA 3TBWB 4WFFE 1EJOH 3GSWA 4TNVK 4YHNA 2FHFA 3EW3B 5CKAA 5T1KA 3CK0H 3NFPA 3NTCL 2NTFB 4Y8AA 1A6AB 3U4BH 1JNJA 1F58L 1D7FA 3QUML 3K1DA 1HQ4B 2G75B 1G6RA 4POZC 3ZE1F 3PGFH 5SV4A 3GSNA 1KTRL 5ETUB 1H3XA 3PG2A 3DTXA 1HHJA 3BUTA 3DUUA 3VD5A 2Y72A 3X13A 1U8JA 4LGSB 5C3LD 5EU4B 2AXHA 2IBBA 4DVRL 1QFWM 2UWEF 2VLRB 5SWSD 1N8ZA 3ECBA 3VG9B 3OZ9H 4PJCA 3EDFA 5DZOA 1TVDA 3WLBB 3RQ3A 3STZA 3PWPE 4G6AC 4PJXB 3ARXA 4NRXB 1C16B 3MLYL 3O41B 4JHWL 2OP4L 1MREH 2YPLA 3CFEB 3IDXH 2J8UB 1CGSL 1T7ZA 4JFQB 1M6OA 1ZLUH 1AJ7L 4OCWH 5GGRA 5BRZD 3QNYB 3OAYH 2E7BA 3ABZA 4JRYE 5C0AE 1RMFL 1LD9A 4ZD3L 3ULVH 4JVWA 5HI4D 5B4MC 4K3EH 1FVCB 1IVLA 4EDWH 4OLVH 5AAMA 3TO4C 1D5MA 3C2SA 1MIML 4HIEA 4JQVC 1FV1A 4HIIB 3OB0K 1YNKH 5E03A 4GXVL 4FP8L 2B5IB 3DRTA 3MOAL 4IRSB 1C5CL 3P0VH 3NFNB 2AXFB 5IM7A 3P4OB 4LMQE 3SDCC 3BZEA 1XCQA 5T5FL 4YBLC 4P2QB 2DI7A 3REWA 2QHRL 4LLWA 3RUGA 3QQNA 1Q9LA 5KSAA 3RWJB 1UWEH 2BVOA 2IQAA 3K4ZA 1MWAL 3DVNB 4EXPX 3R8BB 1OD9A 4WHTA 3RDTB 4P0DA 4OKDA 2HT2C 3V0VB 5JNYA 5GGVY 3BH8B 1D3CA 4QRRB 3VFOB 4N1HB 4Q0XL 4HF5L 1CTOA 2P44B 3SJVA 5EZLA 3V7MA 1OAQH 5D1QB 1ZSDA 4C57C 4KDVA 4PJAE 2YSSA 3NIFE 4MB5A 1EGJH 4Z7QE 3GRWA 3CDGA 1VFUA 2BVUA 4LBEB 4OM0H 4K07A 4PR5B 1LP9F 2P24B 4HFUH 5T1MB 2HG5A 1RJLA 4YFEA 1JYXA 1AH1A 5MERB 4E5XA 2D4DA 2L0DA 2VN7A 4H25A 3IJHB 2J2ZA 4Y4FB 1LK2A 2QV2A 1AHWC 2HKFL 4O4YH 1RK0B 4G8FA 3UTZB 4XVTH 1HI6B 4Z8FH 1YEIL 3FZUC 4PIRF 4Z9KB 4WNQB 3TPKA 2GJ6D 3QHTC 4M62H 2IH3B 4CDHA 1T04A 3VFGL 3VWKC 5IHZB 1EVUA 3GB7B 4KKCD 2DQFA 4L4JA 5I1AB 5IEHB 3TBSA 2HVKA 3ZT7A 1QVOB 2BNRD 3KPNA 3WJJA 4BK5A 2P8MB 4X8JA 2CLRB 4LSUH 1JYWA 3HZKB 4EOWH 3MJ6A 1J88A 1IT9H 1VERA 2Y07H 4MQ7B 2J8OA 2NY4C 4FQLL 4ZOAA 4PJFE 4QRQA 3PWLA 4PJGA 2XZAL 4D9LH 4AEFA 1AGDA 4XC1L 4QF1A 1NC2D 5FECB 5MHSE 2BJML 4OV6F 2AEIT 3GI9L 4LU5H 5KOVC 5T5NG 1GYAA 4MHHI 4MNGE 4IHOA 4M61B 4Q9RL 1NAMB 3E2HB 4ZODA 4ZQKB 1SEBA 1XIWB 2CIIB 1HHKA 4PGDA 1QLFB 4Y5VB 3V5HB 4KK8D 3OXSA 3FAWA 1L6ZA 3WFDL 5JORB 3LZFH 1QZ1A 1A3QA 1FPTL 1ZT7B 3H8NA 2C3XA 5F7MC 2BXZA 3ARFB 1PQZB 1X5LA 3H9SD 1CICD 4KMTL 4X4ZA 4NT6A 5F88B 2YD8A 3BD4A 5F1IB 4P23C 5TQ2H 1EHLL 15C8L 1CFQA 5F9WC 2C1PA 3LB6D 5LGJA 2JK5B 2BRQA 1NUNB 5IWLA 3EJZD 4OI8A 4S11A 4JFZL 2J6EH 5GGTH 4EI5B 2D31B 3HI5H 2H41A 2IAND 3IDJB 3GKZA 1OAUH 1ORQA 3VXQB 1UM6H 1DBJH 4P4KA 2ZJSH 2HT4D 3P30H 5CGYC 4AMKH 3D25A 5EORL 2RCSL 3BUYB 4MA8L 4Y4HD 4KDTA 1G0YR 3CFDB 1G6RH 1P7HL 4ODVL 4O02H 4XVSH 3GSNH 4LSQL 3V8CA 4Y1AE 5JR1H 2FO4A 4CVZA 4LCYB 2BOCA 4P2OD 4R7NB 5DTFA 2B0SH 1ONQB 3IU4L 5DMGC 2F54E 1CVSC 1PX3A 5IB1B 5K9QI 1S78D 4U7KA 5SWQB 2D03H 3PXJA 3ZE0F 4JPIB 2XQYG 5D2LA 3DSNA 4LPCA 1IKFH 1KTDA 3HB3C 3BPCB 3Q5YA 1INQB 1S5HB 3MV01 1FBIH 3WN5C 3PE9A 5FA3A 2ICWI 4QGTA 5I16B 3KS0H 2X4RA 2X4QA 4M7JH 3TESA 1NCDH 2IADB 3C87A 3HAEG 1T1ZA 5I66A 2B1HL 4D9QD 3GEWB 2PCPA 5JMOC 5F7FA 1C8PA 3G6JB 5INCB 1I7RA 4N0FA 4FXLA 4URTB 5IOPB 3MRDA 1X6NA 4OD3H 4P2RD 4NSKB 1QKZH 3MV8D 4FQCL 3T09A 1IKNC 2KH2B 2NY5H 4LCIL 2BERA 3O9WC 2YD5A 2I9LA 5L0QC 2CGRH 4WUUB 3LCYA 3EKCA 5D2NE 1OLLA 3RVVC 1UADC 32C2B 5IIEB 3V0WH 1XF5B 4BQ6A 5DD6B 4J3TA 2R4RL 1I1YB 3QHZL 4QXGL 2ZUTA 1NDGB 4ZYKA 3RZCA 1DQML 1KT2B 1ZS8B 1HOCB 1NKRA 2CLVB 3MOBL 4MAYA 4TUOA 1YPZE 5AUMA 3DX6A 3VXUE 3HRZA 4EZMA 4TRPH 3FQNA 4XRCA 4NQDB 4LPWA 1SQ2N 5JA8B 3TFKC 3INUH 1ZA3B 4PGEA 5ADOH 4HX1B 3GIZL 3MZGB 3TO4B 2C7UB 1E4WH 1WWBX 1IZJA 4LHUB 1DBBL 4DKEH 4QNPE 4NBYB 2EEBA 5DRWB 3O2VH 1I3RA 4OBRA 3SDCB 1JNLH 4YBLB 3RWHA 3P11L 1ZGLM 4FTVB 3O6LL 1ZT1B 2ZPKL 1P4LA 4LLYB 2QQLL 1IARB 4OLZL 3WNKA 2VLLB 5BZWB 3E8UL 5IMKB 3VH8B 1P1ZB 1I8IB 4P3CH 4JZJC 4LRNL 3MLSL 3FHQA 2R1YB 3JV6B 4XAWL 4OD2B 4JHAH 4O58L 2BNRA 4NQEB 1FH5L 2V7HA 3R0NA 1MCPH 1QP1A 4I3SH 2AEQL 3STLA 2ORBL 4DWHA 4QT5A 3OKOA 3LD8C 4PRHB 1YMMD 2W65B 3VXNB 5EO1A 3PWJB 5I30H 4OZHB 1NC2A 4YO0A 2IPUG 4CW1A 3U9PL 4A6YL 1OAZH 2F8OA 4FFZL 3WFHA 3HNTH 1NFIA 2H26B 2HFTA 3REVB 2VABA 4G7YL 3D39A 5FYKH 1G7JA 3H0TB 5CD3A 4XP1L 2ZCKH 4NKOB 4OTXL 1NFDA 1WZ1L 4X7FC 2AABH 5BQ7A 3LSOB 3U7WH 3QPXL 5C0DA 3VWKB 2RB8A 5J12C 4KJWD 2ADFL 4F9PA 1CR9H 4ZFFB 1CGTA 1HSAB 4UBDC 2QSVA 4X7SL 5E2VH 3PP3K 5HYIA 3FO2A 5E2UL 2EO1A 2E9JA 1ETZB 4LIQE 2NY4B 4QY8B 3L7EB 5SWSE 5JZ7D 1QHPA 2XQYK 2M26A 1MLBB 3AGVA 4WHYG 5C07A 4KWUA 3ARED 1U8NB 2R2BB 5E0QA 4JM2C 5TF0A 5J1AB 3OAZK 1BP3B 5F7EH 3TO2A 2GITA 5HY9B 3T77A 5TE6H 3S35X 3W5MA 2WAHA 1XEDA 4XC3L 2R0KH 5J4MA 4HFWB 5H37H 1F97A 1WCQA 5A2FA 4Y4HA 4J3VA 1N64L 2HJFA 5IVOA 5BRZE 5D9SB 3BRDA 2PO6B 5IHUH 4WWKA 1U8OB 1I8MB 2W1NA 1TJIL 1ZTXH 2GSIB 5J1TC 2I9TA 5HYFA 4WUKH 1S7UA 5IMLA 3QNZB 4K2UH 4P2OA 4MQTB 4PJIE 2I5YL 5ICXA 5F9WB 1OY3B 4IOFC 4LCCB 3WD5H 4LIQH 4AH2B 1B2WH 3QIUA 1AP2A 1XF3B 2XNAA 5C2BL 4ZS6C 2A6JB 1CE6B 3K0WA 5DJYA 1CK0L 3WHXA 1JZ5A 2PUQT 2XWTA 5F8RC 3VMPA 1TLKA 1T83C 1XGUA 4JGUA 1AD9B 4GAJL 3X3GL 4LQFL 4R7DB 4GW1B 25C8L 2FWOB 3D85B 1HXYA 5H35B 5F3BA 3QQ3A 4PG2C 1RI8A 3IJSA 3RBGA 1RZJL 1Z2KA 5DUMH 2E9IA 4XTRC 2KUTA 1NMCB 1S9WA 1BF2A 1EIBA 3ZDYF 3ULUD 5DD0L 5I9QC 5LAXA 5L8KB 1WUNT 4TUJA 4Z7WA 1JWMA 5EB9A 4WI6A 5E2WH 3G08A 2RFXA 1LGVA 4B7LA 4ZTPL 4QOKD 5DMIH 2PYEA 3QIWA 4RMWA 4TOYH 1TITA 4IEFB 1BECA 4NJAH 5HHMB 3VD3A 3PHQB 3RVUD 5KVMC 1NANI 4LDEB 3NZHL 3MV7D 4EEEA 1ZHLB 1NGXA 1OWWA 4JDVA 5BS0E 1G7QB 3WN5B 1Q8MA 5EOTB 4HULB 1BQHA 5DD1H 3VWJC 3QQ9D 2UVEA 4G5ZL 4JQIH 4PJEB 3JTSA 1IC7L 5GHWL 3F7YB 2GJ6E 3GIVA 1UZ6E 5EUOE 5FA4A 4NOBA 5HGDB 3MBEC 1YEJL 5D6CA 4LAQL 3DURA 2ITDB 4HUMB 4KGLA 4NJ9H 4LF3A 4N8CH 1I1AD 3GUTB 3ARDC 1Q9KB 1DQJA 1I8LC 3GMRA 4KKAC 3G5ZA 4KKBD 1HEZB 3MGOA 2CR3A 4FQXA 5HDQH 5L8LB 4XPAL 2EXWC 2VDOH 3BVNB 2NYYC 2P1YA 3DMMC 3IXAB 2IC2A 1T21A 4S1QL 4RAVA 5E8PA 1A3RH 4YWGL 1AGBA 1QQDA 4AL8L 2DIBA 2MQ3A 3QDMB 3CU1A 3S3JA 4KKLD 2VR4A 1CFSB 4ZOBA 3LRGA 5CSBA 1UA6L 2FEEL 5B39G 4JFDD 5IF0A 3R1GL 1H8NA 4NFCA 3O3DB 4L4VD 1EAJA 4YXKL 3H9SE 4KVCL 5JO5B 4MSWB 2FDBP 1YYML 4RIRA 2Z31D 3NFSL 5I17A 1EHXA 5HHOD 4M5ZL 2EYTB 1LNUB 3DO3A 1EFXD 3T3ME 2UYLA 1EEYB 3BP7B 2C3GA 4GRLD 1Q0YL 3DUSB 4HSQA 2AQ1A 2IANE 1GC1H 1MJ7H 3RIFK 4YHYB 5FUCC 1NAML 1P7KA 4GO6B 4J1UA 4F7PA 3KLSA 5E6IA 2X1OA 3AU1B 4OF3A 3VXRE 1QTYT 4JZJB 4XXCA 3CFCL 4XBPB 4BSWA 3BPNC 5D70H 2IBZX 1NEZA 2C9AA 4G8GA 5CP7A 1OP3K 3ZHLA 2AJSH 4HPYL 2NW3B 3TA3C 1KLUB 2XRAH 2X4SA 1OW0C 3GMMA 4DGIL 4JGJA 4E41E 1QRNA 5E00B 1GCFA 5A16B 2JTDA 4XP4H 1S5IL 4NNXA 1DVFC 5E5UB 4XZUB 4KKNA 3AREA 3VI4E 4HKJB 2VXSL 4MA7L 1T3FA 3CZJA 5F9OL 2LU4A 3ARYA 3F6LA 4OZIA 1NCAH 1XGRA 4O5LL 1FL3B 4AT6A 2JELL 5DJ8A 4XX1G 3MRCA 3QR2A 3MFFA 4GUPB 5FYJU 4Y5XC 1UZ8A 2GKIA 4XPFH 1A7PH 4QTHB 4I0KA 3DV6B 3D48R 5ADPL 1U9KA 3L5XH 5CBEA 5J12B 4GT7A 1Y6KR 5FYJL 4D9QE 5ITBL 2ITCB 3AB0B 1ORSA 2YUZA 5FKPB 1A6VH 1HIML 1JRHH 3BKJH 4CNIA 1HNFA 3P9MA 4R3SB 3RVXD 3BKCH 4P2RE 4GQ9L 3DV4B 3KXFD 3MV8E 1PY4A 3WS3A 3MACL 3FOLB 4QCIA 2VXTL 1CQYA 4JM2B 3LS4H 1BAFH 5FUOL 5E7FA 1AFVH 3KAAA 4ONHA 2VQ1B 5EOCH 5IG7A 5JUEH 1IM9B 1SBSH 2EH8H 3RTQD 3IFLL 4U6HB 2W91A 4YHPB 5KSBB 4PREA 1R3KB 5F7KC 4NNPH 5DHVB 3EJYC 4BKLA 4LCWA 3P9LB 2ICWA 1JZ4A 1HDMA 2G9HA 3WE6A 3QG7H 2NR6C 5C70A 2EKSA 3SGEI 4HHAB 3LN4B 2E9BA 2B2XL 2XYCA 3DVGA 4G6JH 5ILTH 2LTQC 1NBYA 4MVBD 3GSVA 3QZWB 5CEYB 3D18B 1RFDH 3DUHA 1QLRB 5HPMA 4UIMB 3O2WH 3FHAA 3MLRH 4ISVB 3AS2A 3BKYH 4OI9A 5D5ME 2BY0A 5E6ZA 4U7MA 3VFVB 1JN6B 4RWYH 2FJFB 1KCVL 3CPLB 5D7IB 3C5SA 1F4YH 5HHQB 1EVTC 5BOPA 3QDJA 1V3MA 4QYOB 5GGSB 2OR9L 5FF6A 2EICA 2O26U 1A1OA 4UDUB 2D7NA 2NY2D 5F6IC 1J1XH 1N0XL 1WK0A 5F9JA 2XN9A 3PQYD 2R2HB 5I9QB 4JZNA 3BSZL 1H5BA 4WEUD 1UYWL 2Y7QB 4XPGL 5DRXB 4RA0C 4X4ME 3D69A 1YMME 1NL0L 3MUHL 4K55A 1CFNA 4CMMA 3GMPA 1CGWA 2VUOA 1IE5A 4OFIA 1R3JA 5DJXA 2VOTA 4FABH 4OZFA 4WHDA 3W39A 1C5DA 1IGCH 1LO2L 3PV6B 4LEOA 1KEGL 5DJ2B 4BK4A 3MJGX 1XZ0A 2ENYA 3EFFB 1J0YA 4HEME 5AYUL 3V6FB 2ESVB 4L4VA 5JOFB 5E8DH 3MRPB 4U0QB 1IL1B 2W59A 4NO5B 1QG3A 1K3IA 3MBEB 4DTGL 3QO0B 2MWCA 3GMNA 2QR0B 2X4PA 2Z31A 5BCAA 1Z6JT 3QEUA 4JDZB 3ARDB 3QDHA 43C9A 5FEBA 2NY3D 1IM3B 1BVKB 3CCHA 2ARWA 3GO1H 1U8IA 2GSGB 3ARTA 2DL2A 1KJ2A 1WIPA 5EU7E 1RJCA 12E8L 3ZDZE 3HZVA 4NWTH 3DMMB 2N1KA 2DAVA 4RGOH 5FAAA 3T0ED 4Q58C 5C3TA 4J3UA 3KLAA 1FNEB 1MFDH 1U8QB 1A02N 1KENL 4KMLB 1U91B 4JKPH 1HCVA 4U49A 3M17B 5CUSH 5EWIL 3KPPB 1CL7L 1XT5A 4PRNA 1T0MA 1Q1JL 3DX9A 3HZMA 7FABL 3AFLA 4ZUTA 1A9BB 3U83A 5MP6H 1UB5A 4K7PL 3FOMB 3O8XA 4FQHB 5CILL 4S2SA 2VXQL 5IFAH 4XVJL 5C0JB 2KKQA 2R69L 2QTEA 5J11C 3LKOA 2WP3O 3VRJB 4RZCA 1MOEA 3L95B 2JCCF 3DETD 5BVJB 4KK9D 3QFJD 3BFOA 3F7VA 3VGDA 2A1WH 1CTNA 5JPNB 3LQMA 1ZWIB 1JHKL 2DLFH 3BRFA 3MXVL 3RWFB 5IK3B 3ES6B 3O2DA 4HKBB 1KG0B 5IB4A 2XZZA 4G9DB 1JZ8A 3X3FL 3O11B 3PDOA 4PJDF 5ABDE 4PJHB 2X4TB 2YD3A 1TNNA 3BW9A 3MBXH 4ODWA 2VZTA 1GZPA 1EO7A 3QUZA 4I4WB 4PJ7A 4JPKH 3JTTB 4MGXA 4X6DB 3WDJA 1M7DA 3OKDB 4DW2H 2AXGB 4JG0H 3ULUE 5JHLL 1NBZB 3KJ4C 5I8OL 1DVFB 4U1LB 1VDGA 3MYJB 3THML 4QOKE 4D8PB 1FVEA 3GM8A 3VFPA 5F9AC 4ZFOB 3F58H 1MVFA 5IWLC 5DEFB 3Q1SL 2AV1B 3MQIA 2RIKA 4OZGF 4X5XB 5CFHA 1MF2L 1CXEA 1FFQA 4NN6B 4R26H 4J8RA 4QHNB 1EXUB 5IMOA 4LHUG 3MV7E 2VNCA 4Y5XB 4QXUH 1HHHB 1I4FA 3H9YA 2VE6B 2EDBA 4PRIA 3P4MB 2ZP0T 4P4KC 2V7NB 4ODSL 5FHAL 1D5XA 3GHEL 1HKLL 4YEEA 2LVCA 3MRRB 4YFDB 1PG7H 1INEH 4N8VG 1MFAH 2DTML 4HWUA 4C59B 4PB0L 1QFUL 3PNWB 1OB1A 5I0DA 4IOIB 1I7UA 3L5WB 1KTLB 2YKLH 3K7UA 1P4BL 1B90A 1YN7B 2CLZB 3QIBB 2DI8A 1KEML 4OLWL 1DBKH 2X5PA 1YUHB 4NQCA 4OSUL 4D3CH 5FO7B 1TDQA 1BFVL 2VDMH 4U1MA 5JXAH 2EO9A 4BH8B 3RVTD 2ED7A 2Q86A 1DCLA 3QP3A 5MEPA 5C0BD 2FJGA 4UILL 5IW6A 4AIOA 1XF2B 3T4AB 1N2RB 1GGIH 1S7RB 1I85C 1GIGL 1IC4L 5CEZL 3GSWB 4QKXB 5T33H 4YHNB 3DARA 1P7QD 2VSCA 3CGTA 5T1KB 3L3JA 3NFPB 2QSCL 4OIIH 1NMAL 4JFDE 5HI5C 2XZCH 3OBAA 1V7ML 4IMKA 1G6RB 4L4VE 5KS9F 3Q3GA 4MMXC 1DEEA 3GSNB 3MO1A 3DTXB 1HHJB 3DUUB 3MJ7A 3OR7A 5DQDL 2WM0A 1U8JB 3X13B 1TZIA 3PJSA 5HHOE 3H3KA 1KCUH 3GNMH 4N5UA 2LTQB 3TN0A 3QUXD 4LHJB 1HCFX 3KPMA 2ZCHL 5FOBA 1N8ZB 3ECBB 2CK0L 4PJCB 2EC9T 3O0RL 5HTSA 3IKKA 3STZB 3V52L 1QYGL 2V2WA 1JHTA 3RZCC 2YPLB 4OZFH 1DJSA 3S36L 4MAYC 4KJYA 1PX4A 2YRZA 1FZKA 1M6OB 5GGRB 4R90H 1UM4H 4M5YH 2YN5A 4Z0BH 1LD9B 1FVDA 4XCEA 3H6JA 1Z3GL 4H0IA 5C0CA 1RVFL 2AJYH 5I1GL 4LLUA 4L8BA 1EH9A 3G5YA 4IRJA 2P7TA 1QBLL 4Z95L 2Q7NA 1D5MB 1PKOA 4HIEB 3SE8L 5KAQF 1G1YA 1FV1B 1A64A 1AI1L 3W5NA 1P2CA 1IGIH 3DRTB 1P9MC 4L3CA 5IM7B 1NBVH 3BZEB 1XCQB 1WWAX 1GAFL 2OMBA 3REWB 4NKMA 4LLWB 3OJ2C 1AD0A 3RUGB 1Q9LB 5A2JH 1NMBL 5KSAB 2BVOB 2DQEL 2IQAB 4LDOB 3LEVH 4WVRA 5L6YL 2D7TL 4WHTB 5ISZD 1I9IH 3VDAA 1IAKA 3SY0A 3V4PL 2DQGH 5JNYB 1R24A 4M48L 1BQUA 5KTEL 4LSRL 4LLVA 2LAAA 4RNRA 2D0HA 3H7LA 3HI6H 1IGJA 2H2PD 4ZPTA 5GRJH 3SJVB 5EZLB 3KPSD 1YJDC 2DYPA 1UACH 1MCQA 5F7UA 1EX0A 2YSSB 5GRZA 4OCLC 4M6AA 1EK3A 3D9AH 3MREA 3QWRA 4G8IA 3UPAA 3CDGB 1CT8A 1WIOA 4TTDC 2AEWA 3KXFE 5CS7A 4NBXB 3EDEA 3PL6D 4DGYH 2HG5B 1RJLB 5C8JA 1NCBH 3B2UD 1QSZA 3MODH 4E5XB 4H25B 3CFKA 3UBXG 4MAUH 1A6UL 3GMOA 3O2DH 1BBJA 1LK2B 1JF5A 1GVIA 1ZXQA 4G8FB 4KK6D 4U1NA 1Q94A 1WICA 5TFSL 1C5BH 1Y6NR 4P57A 1SEQH 3A6BL 2DJSA 1T04B 4MXWL 2CPCA 2DQFB 1TVHA 1A5FH 4UUJA 3TBSB 2EDQA 2HVKB 3EHBC 5J11B 3CXDH 3KPNB 5LKNA 4LVHC 1S7VA 3QA3A 3QH3A 1M7IA 4X8JB 5IFHL 4JFPA 3U1SH 3QRFM 2VH5L 3DSFH 2DQIL 2Q76A 4Y19D 4ELME 1JGLH 1TZGL 2EDTA 3T0BA 4QRQB 3A67L 4KRLB 3PWLB 2HRPL 4PJGB 1OAXL 3RX8A 1AGDB 2PXYD 3WO4B 2CRMA 4QF1B 4G7VL 3HR6A 4ZNCD 1KBGL 2QBWA 5A40E 5AZEH 5I1HH 4IHOB 1PJ9A 1SEBB 2DQJH 1HHKB 4PGDB 3QBTB 4J4PC 4C4KT 3EZ8A 4I3RH 4KI5F 3OXSB 1NSNH 3I9GH 4DKFL 5IBTH 4HJJL 2EEDA 4PV9B 2XY2A 5JQ6L 1JGEA 1OGTA 2BVEA 4WWKC 2E27L 3JV4A 3HNVH 4KAQL 3S34L 2HWZL 4CMHC 4NT6B 1PZUB 1S9YA 1T03H 1B88A 3PQYE 1CLCA 1RSFA 2DQHL 1CFQB 1SYSA 4ODXA 2QJDA 3EO0A 2C1PB 5LGJB 3I2CL 1NGQL 2Z35A 4JRWA 3QIUC 3TF7C 5FO8B 3GJFA 5C0BA 1UCTA 1OTSD 5D96C 2CRZA 4RCAA 2I25N 5E2TL 1EA9C 1CZ8L 2H9GA 5DWUH 5IFJA 2NLJA 1EJOL 4KTYA 2O5ZL 3FRUA 1CXFA 1P7QA 1MI5E 4KJPC 4P4KB 3ZDXF 4JRXA 3BKMH 3D25B 1XGTA 3VXPA 2KZWA 3OKKA 3PGFL 3NABL 2APXA 1ZE3C 5F6HJ 5GXBB 2JB6A 2EYRA 3MX0A 4L8SA 1DQDH 1TCRA 3ARGA 3QUXA 4MLSA 2FO4B 5IVNA 4CVZB 1YN6A 2ZUYA 2BOCB 3JZ7A 4XNZC 5DTFB 3IS0X 2F8VA 3OZ9L 2OL3A 1OAKL 2X1XR 2UUDH 4KHXH 3QCTH 3QIWC 3TYFA 4GLRH 4HLZG 3UJTH 2IJ0C 3A0OA 5D2LB 4P2CG 1J1OL 3TVMD 3T0EE 3GJEA 5CJBA 1Z9OA 1KTDB 4MD5A 5DC9B 2FJHB 4YFLI 1T4KA 2HRLA 5EULV 3WXWH 4AJ0A 5BRZB 5FA3B 1OGAD 1BJMA 4HUWA 4UOW1 4UV4H 4FQIH 2X4RB 3GDBA 2X4QB 3ULVL 2VRAA 2ZWLT 2JJWA 1J8KA 1T1ZB 5I66B 4OCXL 3SKNA 4OLVL 5A2IH 2PCPB 4NBZB 1BFOB 3UTTD 1I7RB 4N0FB 4PUBL 3ZZ1A 3MRDB 3I6LD 4JFXA 1YNKL 4OLYH 3NCFB 2DWEA 2X1WL 1DLFH 4IIQA 2FGZA 1ZLVK 2EXYC 4QXTA 4U6TA 1CLYH 3P0VL 3QFJE 4FQXC 3N85H 2I9LB 5I74B 2K7PA 2UWEA 4UAOC 3R8QA 3VGEA 1UWEL 4ZYKB 3RZCB 4M7LT 5F1NA 1ODAA 2Y6SC 3JUZA 4BQ9A 4MAYB 4TUOB 4NC1C 3O45A 1HH6A 4S0TD 2EEAA 3DX6B 3HRZB 3PABA 1E6OH 3T04D 3HAEA 1MCOH 3FQNB 4XRCB 1D5BA 3MRFA 3KPLA 3OXRB 5DVOA 3VJ6A 4WI5A 5DT1H 1OAQL 2W0LA 1BX2A 3CSBA 4YGVA 4PGEB 1KFAL 1AGCA 2X41A 2DDQH 3E3QC 2DLGA 4OM0L 4HFUL 1JE6A 3TLRA 2VDRH 5HYJA 1I3RB 1Q72H 1CXKA 1KCRL 3RWHB 4HUXA 2I60H 1NJ9A 1P4LB 1RIVH 1G9EA 3QZWG 4XVTL 3MLZH 5E6IC 1BOGA 5F3HA 3EYUH 3T1FA 1J1PH 2H2SD 2C4FU 4M62L 4XXCC 3V9FA 3WJLC 1CVRA 2BNRB 2CO7B 1FLTX 2V7HB 5F7DA 1K4DA 4MQXC 1ZANH 2XPGA 4EOWL 3STLB 1IT9L 4X7TA 4XXDA 4QT5B 4L8DA 1XR8A 3OKOB 2AI0H 5GISH 2ZSVB 2EDDA 3QAZC 3I84A 4ZO7A 5EO1B 5HDLA 4EUPA 3PHOA 1NC2B 4ZFOL 4YO0B 3X11A 4CW1B 3IF1A 3FO0H 4LU5L 5DK3A 3WFHB 4P99A 2WWKT 3W9DA 1LP9A 1U36A 1NFIB 2Q1EA 2NY6C 3VE0A 2YPKA 2Y5EA 2VABB 1BWWA 4M43H 4QHKI 4GG6E 2APFA 1G0DA 2W0KA 3D39B 4YR6A 3BISA 4PY7A 1A14H 1G7JB 1KSRA 5CD3B 4KQ3H 3BN9D 1NFDB 5SWZA 1VEMA 5BQ7B 4O2FA 4HZLA 4N9OB 5C0DB 2V5MA 4G80A 5TQ2L 4ORGA 1WCBB 4WCYL 5DMYA 4GS7C 4LVHB 3MA9L 3BT2L 3FO2B 4GAGH 5I1EL 4V1DD 2EE2A 1DFBH 2H32A 2D9CA 1T1XA 4ZOEA 3VI3F 4XMPH 1QBMH 3GJFH 5GGTL 3HI5L 2B4CH 5C07B 2Q87A 4PJXF 1OTTD 5JLZA 3TBYA 3TO2B 3WIFA 2GITB 1DBJL 3ESUF 5B22A 2J8UF 2ZJSL 3OF6D 4AMKL 1N6QH 3VXSD 2IPKA 1KIQA 2JJUA 3MC0A 4UOJA 4Y4HB 3UTPE 2HJFB 4ZFZA 4MNHA 1NCWH 1G6RL 1S7TA 4O02L 4XVSL 3GSNL 4CMHB 1I9EA 2I9TB 3BEWA 4PP1D 1S7UB 2VKXA 4JR9H 5LQBH 3SE3A 1T20A 5IMLB 5JR1L 4ZAKA 4K8RD 4P2OB 3GZKA 1X5XA 5ICXB 4FRWA 4C83A 2B0SL 4Z7OF 1WFUA 3QIUB 3ZE1E 1AP2B 5E94A 2XNAB 2D03L 4M9PA 3Q6GH 5D96B 2W92A 4IJ3C 2OL3H 4YHLL 4RMTA 4J6RH 5DDHB 3TVMA 5T3ZD 5C09A 5DJYB 3WHXB 1IKFL 4YGAB 1MJJA 2XWTB 3QXDA 3MRKA 1XGUB 1KB5A 1SJVA 1M4KA 2XA3A 1Q9WA 2O5XH 4YBQD 1HXYB 4DUWA 2X7LA 5EZJA 5F3BB 5ISZE 3M8OH 4QTIH 1EV2E 4M7JL 1J8HD 1NCDL 3IJSB 3O6KH 3KR3H 4GOSA 3KHOA 1ZHBA 3WV0A 4HMEA 4M9OA 5C0ND 5JW4Q 4ZUSA 3B83A 5EO0A 5IW3A 1S9WB 3KPSE 4RQQA 4I2XA 1RUQH 4OD3L 5LAXB 4TUJB 4Z7WB 1JWMB 3GHBH 2X09A 5HVFB 1H5BC 4WV1A 4XNZB 4I18C 4MJ5A 3G08B 2RFXB 4N5EC 2PYEB 3QIWB 2N4IA 5I1DA 2R29H 3V0WL 5M94B 2H45A 4XB8A 4HLJA 4JO2L 1CQKA 3FFCA 4JVPA 4K3JL 3V6OA 2RJMA 5C0EA 3N06B 1SY6A 1KN4H 5FYLE 2Z4QA 1NGXB 4XH2A 1QA9A 4JDVB 5JDSA 2WBJD 1JPTL 4GMTL 4KQ4H 4TRPL 1BQHB 4WO4D 4GKZA 3JTSB 2X89A 5J13C 3B4NA 5GQBA 3GIVB 1RZGA 3PGDA 2OI9C 5FA4B 4MXQD 1DE4A 5ADOL 1A3LL 1CWVA 3WO3B 5D6CB 3DURB 2F19H 4HWBA 4MCZA 3LVEA 5I8KL 4LF3B 5J7CC 1E4WL 1NCTA 5EN2A 4ERSL 1DQJB 3GMRB 3GRWL 4PTUA 3KYNA 3G5ZB 2OTUA 4Y19E 3MGOB 1KXVC 3O2VL 4FQXB 2E6PA 2A77H 2LABA 1P6FA 3D3VE 5GIRA 3TBVA 1WT5A 4UAOB 5FHBH 3QI9D 1T21B 4RAVB 5E8PB 1ZKAA 2VXVH 1QQDB 3O6FD 4MZ3A 4Z7NF 5BMFH 1H3PH 3CDYA 4GG8A 3PIQA 4P3CL 4HUNB 5HD8C 2CXGA 1CL7I 5IF0B 1MVUA 2NY1C 4CADA 2R0LH 3UYOD 1MCPL 1G84A 3LY6A 4I3SL 4YAQA 3O8XC 4PRPE 3OAYK 4X5WA 4RIRB 1YY9C 5I17B 4NKQB 2JIXD 4MDIA 5DFVC 1IAIH 4QHKJ 3BZ4A 4H1LA 3VFSA 5I30L 3RI5F 4P49A 3SBWA 1JTPA 1DLHA 4JCMA 2WUCH 2UYLB 4XHQA 3WNPA 3D2UD 1OAZL 4EUPH 2BSTA 2AK1H 2P42B 3ARRA 1F45A 2W9EL 2GY5A 5CZVL 1X5GA 3JWOC 3K46A 2WANA 1R0AL 2DMCA 1P7KB 5FYKL 4J1UB 4F7PB 5B39A 1FGNH 1F4WL 4W4OA 5E6IB 5GS1A 4HJ0C 5E4IA 2ZCKL 4L4TD 1UEMA 4DN3H 1MELA 4BSWB 4F58L 3PHSA 1NEZB 5CP7B 4G8GB 4K94H 3QUZC 3ZSTA 1CR9L 3TWCH 4JFED 2X4SB 3GMMB 5E2VL 1QUNA 4ZS7H 3DOSA 5EU6A 1U42A 2IFFL 3GI8L 2FLBT 1QRNB 3RKDD 5HI3D 3SO3B 3SDAD 1Q0XH 2FH6A 3KLHC 1XGYH 4NNXB 3QAZB 2FCBA 1F2QA 3AREB 1K85A 4R2GD 1B0WA 1T3FB 4DZ8A 4KZEH 4OZIB 1XGRB 5KW9H 4P48A 1F3DJ 3HE7D 3BMWA 5TE6L 1E4KA 4AT6B 1Y0LA 5DJ8B 2R0KL 3VXSA 3MRCB 3MFFB 4LPYA 4YK4C 6CGTA 1Z9MA 4WW2A 5BO1L 1UZ8B 1CLZH 2KQNA 5AZ2L 1OGAE 3L1OH 5IHUL 1ZTXL 4WUKL 4XBGA 5CBEB 3LV3A 1YDPA 1W0VA 4GS7B 1T80A 1ORSB 5F89A 3UTTE 3JWNC 4DOHE 3WD5L 4LIQL 2NXZC 1B2WL 4CNIB 3UXFA 3P9MB 4MLIA 2Y36H 3UBXI 3WIHA 3WS3B 4QCIB 1UH3A 4R4FH 2QADC 3LIZH 1CFVH 1P53A 3ZKMC 1FNAA 1SHMA 2XWJA 1N5YH 2VZOA 1YEEH 4ONHB 5IG7B 4X4XA 1IGYA 4N68A 1KXTB 3NGBC 4PREB 1J8HA 5A3ID 2R2EA 2WWMC 1LO4H 3ZE0E 4DEPC 3BZFA 1NCUA 3X14A 1VSCA 4R0LC 4MS8C 1UZ6F 5DUML 4BKLB 4LCWB 1FE8H 2ICWB 1LWRA 1HDMB 2NY2C 3UC0H 4JKLA 4N8PA 2D9QB 3V0VA 4K3DH 1B0GA 3WE6B 2P8PA 3HPLA 2EKSB 5E2WL 3QEQA 2WK2A 3MJ9H 3VMNA 3DVGB 4FQ1H 1XMWA 1RZIB 2A6DA 5DMIL 5D7LA 4L3ED 1NBYB 3TN0C 3GSVB 2ATKA 4H0HB 4IJ3B 4TOYL 4NJAL 5C2UB 3SHSA 2Y06L 5HPMB 3FL7A 4ETYA 4M93C 2DL9A 4BH7A 1MAMH 5DJAA 4PR5A 1DL7H 2ZCLH 1YC8A 3RY5A 4WO4A 3C5ZD 1SY6H 1H0DB 4JQIL 3T0WA 4S1DC 3C5SB 4PLJD 4U1SA 5C71A 2FIRT 4LEXH 1NAKH 3C60D 2P5EE 3OWEA 2AGJH 4D0CA 1RK0A 5L7XH 3WUWA 1A1OB 5GGUA 4QRPA 4G9FD 4N8CL 1BF8A 2PW2A 5F9JB 2XN9B 3ROOB 4HWBH 3OAUH 2X44D 4JZNB 4IRJC 3DPBA 4JM4L 1H5BB 4XHJD 3H42H 1MFEH 5C08D 5HDQL 1QVOA 3D69B 6FABL 2VDOL 1T0NA 1LEKA 4CMMB 2CIKA 2QEJA 3GMPB 3O6FA 3D5OF 2CLRA 2OTWA 1R3JB 3EBAA 5DJXB 3TT3H 4DCQA 3MR9A 4OZFB 3W39B 1PDKA 1C5DB 4YX2H 2WLYA 4MNQA 4FMKA 4LEOB 5BZDA 5IMMA 3PDGA 1XZ0B 4NC1E 3O4LA 1ZT4B 4OQ1A 3FTGA 3CSYA 3ARQA 4L4VB 3FAXA 3PGCA 4TPRL 2OI9B 3WFCL 4LOUD 1N3NA 3C08H 3ARSA 3GMNB 2X4PB 2Z31B 5HHOB 3QEUB 5H37G 4RMRA 2P48B 1K8IA 5DURD 3QXUA 43C9B 3CCHB 1U92A 4V1DE 4X80L 1F6AA 1EFXB 2FX9H 3E3QE 4H8WH 2XTLA 4U1IA 1U8IB 5I8EA 3V79C 5DK2A 1KJ2B 4QHMA 3VI4F 4H1LH 3VXMD 3VU2A 3WMSA 2GTZA 1MFBL 5DO2C 1UVQA 3HZVB 3M1BA 3TYGL 3MOQA 5E1AA 1GC1L 1MJ7L 3LKRA 3S35L 4P9HH 4TSCH 3MV9D 2YA0A 4FFWD 3S6CA 1FYTD 4P5TC 3KLAB 3C8HA 2FX7H 4JB9H 3FMGH 3ZT5A 3FFDA 3D1MC 2BP3A 3TZVA 4JY5H 4Z7VA 5D70L 3SDXA 1KCLA 5F21B 2NY1B 4PRNB 4CL7A 1JZ6A 1T0MB 3UZQA 3DX9B 3HZMB 4JFEA 4ZXBA 2VO5A 2XRAL 4ZUTB 1BMGA 1JI2A 1UB5B 3O8XB 4S2SB 1YEFL 3BUYA 3F5WA 3KPRA 4QRSA 1LHZA 4ZSOE 3PUCA 3LKOB 5DD3H 4PJ8A 4RZCB 2R39A 4JEGB 4W6XB 3S88H 2AJVH 4G6FB 3CZFA 3F7VB 1F90H 4Y4KD 4EN3C 1NQBA 5T3ZE 2OQJA 3MLTA 5IB4B 5ANMA 4U7SA 3PDOB 4FQQA 1Y18A 3BW9B 2PETA 3L5XL 4ODWB 1XCTA 3VGFA 3NACH 4Z7UF 1GZPB 4X6CA 3QUZB 3NCYS 4OFDA 1EBAA 1M7DB 4K8RH 4NCC2 5E5MA 4AYFA 1A6VL 1JRHL 3OJVC 1BM3L 4IMLA 5I76A 4L9LA 2A38A 3BKCL 4R96A 4JPWH 3P40A 2GUOA 5FCUL 3EDJA 3WIHH 1FVEB 3VFPB 5GGQH 3LS4L 1BAFL 5GS0H 1MPAH 5DLML 5HXMA 3VW3H 1AFVL 2AERT 1N6VA 5JUEL 1U3JA 1H3UA 4YXHH 1SBSL 2EH8L 4J8RB 2YPVL 5D1XD 4XNXH 5IMOB 4YK4B 1T5WA 2YD4A 4KUZH 1I4FB 4OZ4A 4NNPL 4PRIB 1CD1A 1AKJD 1NDGA 1HOCA 5E5RB 3L5HA 1U2CA 2VDQH 3QG7L 5IVXE 4L5FL 4LLDA 1OB1B 3I3EA 4PJBA 5IUSA 3BDYL 3LN5A 1I7UB 1KJVA 4L8SC 3ARGC 3K2UH 1ADQA 2Y5TA 4GSDH 4D94A 1QR4A 1QSVA 4HX1A 2A6IA 1BOYA 1RPQA 2DQCH 4NQCB 1EUUA 3ZDYE 4BUGA 3HUJA 3O2WL 3ARBD 4U1MB 2Q86B 5MEPB 2FJGB 2IQ9L 3BKYL 5IW6B 3VDCA 2VLJD 2AK4A 5EBLA 2VQUA 5LGHH 1KJMB 4RWYL 3UTSD 4W68A 1F4YL 3C60A 4N8VA 2D7MA 3L3JB 3BWAA 1B9ZA 4JJ5A 2FATH 2FB4H 4HGWA 5ESQA 2NY2B 4NPYA 4G9FA 3Q3GB 1FZJA 1J1XL 1DEEB 3MO1B 4C56E 4HGKC 4HAFA 3MJ7B 3OR7B 1FL6A 1TZIB 4ONOA 4KVNH 1T66D 3PJSB 2MCG1 4NO0A 3TN0B 3C9NA 4IIQC 5JXEA 3KPMB 5FOBB 4M93B 1A1NA 3O3AA 3LKQA 4LRIA 4FABL 1NC4D 2OS7A 5DD5H 2WINA 2CK2A 2W65A 3C6SA 2V2WB 3VXNA 1IGCL 5KANG 4X9IA 1JHTB 2P5WA 1IQWH 2XY1A 4JQXC 5EIIA 1P4IL 3HFMH 2HTLD 1AR1C 4KJYB 4RFNC 1FZKB 4L4TE 5E8DL 3WDHA 4C4KO 2ED9A 5GRXG 3GSQA 3X12A 5MEOA 1LO5A 2UZXB 1FVDB 2NX5E 4HT1H 5FIEA 4XCEB 1MRDH 5C0CB 4LLUB 4V2BA 4L8BB 2E6QA 2NY3B 1H8SA 3G5YB 2P7TB 3GO1L 3MZTA 1S7WA 3DXAD 3QUYA 3W81A 3DVIA 4F57H 4ZFFA 4N0CD 3RIAF 1T0PB 4NWTL 2JJSA 3QG6A 5E7BA 4LMQI 4L3CB 5LBSH 3P3YA 3P9WB 3OG4B 3LRSA 4JGMA 1MFDL 1MRCH 4YHZL 2Z8RA 4NKMB 1A9EA 1AD0B 1T6VN 4R97B 1IGML 3QJHA 4JKPL 4NN5C 3WFBL 5I19L 3Q0HA 5CCKH 5DUBA 2FD6L 2WUBH 1X5AA 3I50L 1IAKB 3SY0B 1MEXH 1S7QA 2HFFA 1R24B 5HY9A 3L3KA 5MP6L 4LLVB 2I27N 2R8SH 3PWUA 1EO8H 5DQ9A 4RNRB 5IFAL 1IGJB 4ZPTB 2HMIC 4RRPA 3MCKA 1NGZA 2DYPB 2DIAA 1RIHL 4RX4D 3ALXA 5F7YC 3MREB 1UB6A 1U0QA 1UKSA 3QFJB 5DFTA 4G8IB 4Y4KA 2F8XC 4MJIE 3QFDA 1CT8B 4CDGC 1U8PA 4XGZA 3UO1L 5KG9A 3SE4A 3MGTA 4TUKH 5C8JB 4JM2F 3WCYA 1JGDA 4Y16C 2CMRH 5GGVH 1QO3A 3AM8A 4LKXA 3CFKB 2IAMA 1CDYA 1CE6A 3GMOB 1BBJB 3W9EA 5KSBF 1U8HA 5CZXC 3WXVH 2ZOLA 3MBXL 4U1NB 2ERJC 1Q94B 2BSSB 4HJGA 4P57B 2IFGA 4JPKL 3OPZH 1INDH 2J12B 4JKWA 4KY1H 3GK8H 1WZMA 1U3HD 4DW2L 4K9EH 4JG0L 4Q74A 1F11A 3C09C 1TVHB 4UUJB 3VG0H 3RHWK 2A74A 1A0QH 4PY8I 2J8HA 1F4HA 1S7VB 3QA3B 3QH3B 1M7IB 1MNUH 4JFPB 1LO3H 3ZHKA 2Q76B 2UV3A 4L3EE 5E8OA 1YEKL 3MUY1 3RJDA 2QQNL 2JCCA 4JDTL 5CJ5A 4JY6A 4PJ9A 3UBXA 3H3PH 1MJUH 5D1XA 3LMJL 4OGAC 1SYVA 5D7KD 3BDBA 5AYQA 4F7TB 5BV7H 4QXUL 4N1EA 2YMXH 4AEHH 5INDA 3ROLA 3GSXA 5D7IF 1PG7L 3KPQA 1MFAL 3SDDD 4M7LH 4DN4H 1JGEB 1OGTB 4JG1H 4JPVL 3W0WD 2DKMA 2BDNH 3SGDH 1S9YB 2YKLL 3SE3C 3NPSC 3BJLA 4ZAKC 1SYSB 3DGCR 4ODXB 3EO0B 2M8XA 1DBKL 4JFFA 1ADQH 2NY0D 4UTAH 2Z35B 5BW7A 1Q38A 5C08E 2PKDA 1KB9K 2R23A 4D3CL 3GJFB 4OD1H 2WMPA 2AKRA 2M2DA 5C0BB 1RHHA 1RUAH 1HILA 1Q9KA 4B5EA 5DRZA 1VFMA 2VLJA 2JJTC 2H9GB 5IFJB 1CDIA 2NLJB 4ZTOH 3SKJH 1ZHKA 5IROA 5E8EA 2NZ9D 3FRUB 5DS8A 1T2XA 1P7QB 2XTJD 3IDIA 3BIBX 1J0HA 2FBJL 4OIIL 1Z9LA 3RVWD 1K5NA 1NGWA 4JRXB 1ZLSH 2DM7A 3IKCA 4I48A 1XGTB 3VXPB 3OKKB 4GRWB 3ZYOA 1GH7A 2GAZA 4OKVA 1VPOH 1D5ZA 2JB6B 5JQHC 2ILLA 2EYRB 3HG1A 2BCKA 4KI5D 4GBXD 3DI3B 4L8SB 1TCRB 3ARGB 4NO2A 1KCUL 3QUXB 3GNML 4XWOC 1YN6B 3DI2B 4WI9A 4WV1C 2EDRA 2OL3B 3VXME 3WLWC 2EDFA 3TYFB 3V6BR 4Y8DC 2VZ1A 4ENED 2CUMA 1I9JH 4X98A 3MV9E 2YD2A 1QSFD 3GJEB 3T4YA 1FYTE 3HMXH 4MD5B 3T8XA 2WWKO 2AEPH 2D0FA 5ACMA 1T4KB 1MHEA 4M1CC 4OCRH 3MNWB 3QCUH 4HUWB 4R90L 3JSSA 3B6SA 4Z0BL 4YIQA 2IMMA 3B2VH 2NXYD 4I13B 2AJYL 4U3CA 3SKNB 4CVXA 1FHGA 5F8QC 5A1AA 3S36X 5IP4A 2FIKA 2C5DC 2UZYB 4JFXB 5I8CA 3R0MA 2DWEB 2NW3A 1KJ2L 1IGIL 4QXTB 5GZND 1XFPA 5K9OA 4BZ1L 1NBVL 2UWEB 1UWXH 4UDTA 2OM5A 4N9GA 2BOBA 4X5LA 4NGHL 5E9DD 1WAAF 3T2OA 3MA7A 1O7SA 3EO9L 5F1NB 3LEVL 3QDGE 5ISZB 4KZDH 5HSFA 4RFNB 3O45B 1HH6B 3LN9A 2DQGL 3HAEB 4F37F 2LFGA 3HTLX 4KROD 5EO9A 1D5BB 5EZIH 3MRFB 1BD2A 3HI6L 3K81A 3KPLB 4APQD 2M1KA 3FN3A 5GRJL 2F53D 3VJ6B 1CDUA 3FT3A 5TF1H 1NCCH 5JHDE 1BX2B 4RX4A 1UACL 4YGVB 3ARVA 1AGCB 3D9AL 5EOQH 5TPWH 2AVGA 3NH7L 3FQWA 4H8WC 4ELMF 2CH8A 3MRIA 3WEXA 3UAJD 4DGYL 4XCCH 1NCBL 3SBWC 1SJEA 3MODL 2KDGA 3WNOA 5HYJB 1KC5H 2BNUA 1JZ3A 4MAUL 3O2DL 4PJ5E 4X6BA 4OFVA 4HUXB 3S37H 1AO7D 5GZOC 1NJ9B 1CCZA 5I18H 4PY8J 1C5BL 1S3KH 4RSVA 1BOGB 5F3HB 5C7XH 2FHBA 3T1FB 3MLUH 5J3HD 1QSEE 3HN3A 1X5KA 4KRNA 4PJDE 1OVZA 3CXDL 3I6KA 1DN2A 3VXOA 2XQBH 5F7DB 1J0JA 1K4DB 5TDOA 2XPGB 3U1SL 5J89A 3MRHB 3DSFL 4JN1H 4X7TB 4XXDB 3UPRA 4L8DB 1JGLL 1A7NH 3ILQC 1JNNH 4HH9A 3LN4A 4EUPB 3PHOB 3X11B 1AR2A 3IF1B 4JFYA 1RZFL 4O2CA 5AZEL 1LP9B 3W9DB 5IBLD 3VE0B 1FQ9C 4TSBH 2VLJE 1E4KC 1C7SA 2X4OB 2YPKB 3NOIA 3UTSE 2ERJB 1NSNL 3I9GL 4YR6B 3SDDA 2W9DH 1IAMA 4WW2C 5IGXL 1OQOA 4PY7B 1KELL 1TQCB 4OZGE 3K1KC 3W11C 4BFIA 1NDMA 3TIDA 1LILA 5SWZB 1QRKA 2LAGB 1UQSA 1JGUH 1NH6A 3TNMA 4O2FB 4HZLB 4OZFG 4G80B 5F7WC 1E4JA 5MENA 3C09B 1T03L 5HHVL 1VB9A 2XFXA 4NP4H 4ORGB 5J0BA 3TNNA 3UROR 4NZUL 2HKHL 1RZJC 2HH0H 2H32B 1T1XB 5CIPA 2DM3A 3TJEH 3FQRA 2LE9A 5B3NA 4PJCF 4EIZC 5GS0C 1HNGA 1MCBA 1X3DA 1E27A 5D1ZD 4WI8A 3WL9A 5JLZB 1U41A 3TBYB 4NZDA 1PGRB 5HHPA 3WIFB 4D0BA 1KYOJ 1SMOA 4IRZL 4Y2DA 3OHXA 3AMKA 1AGEA 2A9MH 1BGXH 4NRYA 1WEJH 3ALWA 1KIQB 4RGND 2B8OT 3UTOA 4ZFZB 4MNHB 3ZE2E 4LSSH 3LPFA 1VGEH 1S7TB 4M6MH 1L6XA 3BEWB 1H3TA 4X83A 3NTCH 3WKNA 1T20B 8CGTA 3NPSB 4ZAKB 2EE3A 1FYHB 4KK5C 4C83B 5ESVA 2FX8H 3KGRA 3DXAE 2FGWL 1N59A 3ALPA 5KS9E 3IETA 2IBZY 4XP6H 3QCTL 3B5HA 4HKZA 3TVMB 3MXWL 5C09B 4GAFB 1YNTA 4DVRH 1MJJB 4IS6A