2CLZB

Mhc class i natural mutant h-2kbm8 heavy chain complexed with beta-2 microglobulin and pbm1 peptide
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
99
structure length
99
Chain Sequence
b'IQKTPQIQVYSRHPPENGKPNILNCYVTQFHPPHIEIQMLKNGKKIPKVEMSDMSFSKDWSFYILAHTEFTPTETDTYACRVKHDSMAEPKTVYWDRDM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H-2 CLASS I HISTOCOMPATIBILITY ANTIGEN, K-B ALPHA CHAIN
molecule tags Immune system
source organism Mus musculus
publication title Distinct Orientation of the Alloreactive Monoclonal Cd8 T Cell Activation Program by Three Different Peptide/Mhc Complexes.
pubmed doi rcsb
total genus 16
structure length 99
sequence length 99
chains with identical sequence P
ec nomenclature
pdb deposition date 2006-05-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07654 C1-set Immunoglobulin C1-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2clzB00
3N9GL 2YA0A 4YBQC 1EXUB 5LXGH 1DQLH 4B50A 4XZUA 3TPKA 3A67H 2ZOKA 3KJ6H 3T3ME 4TPRH 5IB5A 4D9RD 3I9GH 2WIIA 1A9EA 1BWWA 4Q97A 5SX5K 3BKYH 4G6KL 3D25B 3FZUD 4LSDA 2X1WL 3PGFL 4N0CC 5TQ0H 4PR5A 1DQLL 5E9DE 1S5HB 1DQML 2XWBB 2GQHA 5D7SL 5FHAL 1FFPB 5HDOA 5T1DH 1WEJL 1BZ7A 4M43H 3BKMH 5J56B 1T5WA 4LOUD 1A6UH 2W65B 1U8JB 3I2CH 2WIMA 4FFVD 4YHNA 1BFSA 3OSKA 1DQMH 3MO1A 4K8RD 5FA4B 3C08H 3ZTNH 5F9WC 1WFUA 1CE1H 4MD5B 4KUZH 4OT1L 3BKML 3W11C 3CFBA 1IEHA 2OP4L 3KVQA 4M48L 1EHXA 5ADOL 4PREB 3BYTA 3GO1H 5D70H 2NXZD 3IAPA 4BYHA 5HD8C 1P69B 3LQZB 4DKAA 1KCUH 1BHGA 3V4PL 3O8XC 3OF6A 4Y5XA 1BIIA 1RK0B 2CQVA 4NZTH 3B2VH 2R1WB 1XGYL 4GKSB 1T1ZB 1C12B 3HAEB 3IB4A 3BZ4B 3TO2A 3THML 1JF6A 1ROWA 2Y7QA 2X9YA 4R4BB 5J57B 3ARGD 2ADGB 5ACMA 4Y1AE 3FQUA 4MDJB 3H3PL 2VZVA 2XQBL 1ACZA 4O9HL 2V6HA 5K9QG 2D7TH 2M2DA 3CFJA 2B5IB 3OAZH 2IPTH 4R3SB 4HGKC 2FB4H 5SWSE 2FYYB 4R8WH 4MNQD 4YC2C 3CH8A 4L4VE 1PDKA 4O9HH 3C60C 2JB6A 3QIBA 4XI5D 3TYFA 3ORJA 4JFXB 4BFIB 2NNAB 3MXVH 1FN4B 1I9EA 3UYPA 3MRDA 5E03A 4ODTL 2IPTL 3HNSH 5F89A 3BN9D 3VMOA 3VFPB 1KFAL 3GBNH 2W59A 3VMNA 4HLJA 1JGUL 3WO3B 4JFOB 4OCWH 3P4MA 3GMOA 2NXYB 1NCBL 2DQJH 3U4EB 2HT2D 2ZUQB 4LSTH 4FRWA 1PY9A 3O45A 1NANI 2EYRA 2W9EL 2Y07H 4LLYB 3VXUE 2UWEB 4BFEA 3C60D 4J3UA 5C7XL 2UVEA 1T0NA 3DMMC 3O6FA 5T1MB 4I3RH 1JRHH 3VGBA 1A7OL 3LH2H 1BVLB 3LQMA 3MRGB 5IBUG 5FM5M 5HHMB 4M93C 5D7LD 1FO0B 1U41A 4A2LA 5SWSA 4D9QE 2YK1H 4TRPL 3RUGB 1MCKA 4PY8I 5CEXA 1IAMA 4FQPA 1UCBL 3MRHB 2XN9E 3NIDE 1A7OH 3AU1A 4LLWA 4QRQA 3RTQD 5DZNA 5DHYB 2DI7A 2QQLL 3L3KB 3X14B 4C58B 3SDAB 1BD2B 2IG2H 4NQCD 4YZFF 2IAMB 5TDNA 4U1HB 3A6BH 4LLQB 2BHZA 2VXVH 2VXUL 4XP6H 1I4FA 1KBGL 5B39B 2GAZA 2JK5B 2QQLH 3OJVC 4XPBL 3PABA 1KCKA 2X4QA 3S35X 4AYFA 3PL6C 5ANMB 5L7XH 5MEOB 3LRHA 1YMHB 4P2QD 1TVDA 3A6BL 3WS3B 3QPQD 1UB5B 1BX2A 2C4FU 5EOCL 4RAVA 2EEDA 4NQEB 3KHQA 1IM9D 4ZFOL 3MUJA 4LDLB 3IT8D 5JW3L 3U2SB 3VH8G 2OR7A 2CSPA 1XGPB 3RDTA 2OQJA 3O4OB 3LKQA 1L7IH 5BVJB 4ONGL 3OXRA 3LDBB 3S9DB 3LRSB 4OM0H 5E2UL 4XMKL 4LIQE 2IWGA 3RGVB 4PRPA 2J88H 4LCUB 2BOBA 3BVNA 3DO7B 2GJ6B 2DS4A 3LEXA 3VA2C 4BSWA 3RY5A 1N5YH 1K4CB 4Q6IA 2FR4A 5H37H 2K1MA 4XHJC 4R0LC 2R1XA 3L1OL 5E7FA 5D1ZA 3Q2CA 3RRQA 1MCDA 4GAFB 4PB9L 4WVRA 5M94B 2HMIC 3IS0X 3LPGA 4L4VD 4KK5D 3BXNA 5KSBA 1HQ4B 5SWSD 4U7KA 2E7LC 4JFDA 3JV5A 1B0RB 2Z91A 4DGIL 5DRNB 1X5ZA 1N5YL 4PYHA 2P5EB 4LCCC 3FFCA 5FYKD 4IMLB 1SJHA 2IC2A 3WLBA 5A3IC 2HFGH 4JQXA 4X5WB 1GIGL 4ISVA 4HEME 2HJLB 3OKYA 4PY8J 2CIKA 1LK2A 4JFED 4NZRL 4XNMA 4JANB 2I07B 1GOHA 5CD5C 3MGOB 2J8UB 3UJJH 2E6JA 3KPLB 4TUKL 5D5MB 4BK4A 2NX5D 3MLTA 3MLVL 4CVZA 1BQLL 2GCYA 2P46B 4JZJB 3VXUD 2WBJA 2CUHA 1TNMA 3TZVD 3ZKMD 1NDMA 4UT9H 1SBSL 1CXKA 4KPHL 5GGUA 3RZWA 4PP2A 4M7JH 1OL0A 4JO3H 3HCVB 5IT2H 2WSKA 2CJUL 4PV9B 4S1RL 1MRDL 3SO5A 3AXLA 3RTQA 4FOMA 4U05A 2X4TA 4PY7B 4QCIA 2RGSA 3QQ3A 5CP7A 3WN5C 1FYHB 4HKXA 1BQLH 1O5DT 5DC9B 2XTJD 5EO1B 4D94A 5IW6B 1S78D 4Z6AT 1UJ3A 4PTTB 4UT9L 5DD5L 2VN7A 5IR1B 3S3JA 4S1RH 3MLRH 5IJKC 4EN3C 4JGMA 4J3OC 2XWJA 2AK4A 4NQDD 3ZKMC 1BVKB 2X89A 5C0GB 3PWNA 4JREB 3RDTC 5GSRB 4GW5B 2NY0B 4KUCD 4U6TA 2ESVD 3G6JF 3FB7A 2W38A 3QA3B 4CW1A 3FHQA 1CFQA 2E7LA 1RIHH 1KTLA 3HFMH 3MJ8A 4FG6D 4NGHL 3TIEA 5I8EA 3HA0A 4HH9A 1BZ9A 3UBXI 1CTOA 1MCWM 1OW0A 1OY3B 4Y2DB 4NCDA 5C0BD 1AGDB 1YA5A 4G8EA 3BJ91 4U1GC 4KQ4L 4OGYL 4R3SA 3DROB 2AV1B 1C08B 3NH7H 1FCGA 4KKCD 3L5XH 5BCAA 4Q2ZA 3RDTD 3HR5A 2V7NB 3L3IB 1JPTL 4P5KB 4CN6A 4EI5B 2B7DT 5INDB 5HHOD 4PP1C 4HGWB 5D7KE 5IB1A 2ZUWA 3STLB 2CPCA 1M71A 2ADIB 4PGCB 4ZTOL 3L5XL 3H2WA 3OJDB 3LKRA 3TP4A 4N0UB 3D25A 5SWZA 5ISZB 2CGRL 4HMEA 5HHPB 2AVGA 1MQKH 1EO5A 3ILQD 4FFZL 2DQCL 2VLKD 1NGWB 4XP5H 5JDSA 5IFAH 3QEGL 5JQHC 3JWDC 4AMKL 4APQD 4Y16B 2HVKA 3N1GC 4JHZA 1T0MA 1JTPA 5HHMD 4MWFB 1KLGB 3BAEL 4OF7A 4U4BA 4ZUSA 1OQOA 4U6VH 5EG6C 4GRWH 1Q1JH 3K4AA 3SJVB 4NKDA 3HPLA 1CBVL 5IFAL 4D9QD 1UJTA 4HIIB 35C8H 1JWUA 1A1NB 4W4OC 1MLCB 3R06A 4F15C 2CKBL 1P7KA 3TJHD 4YQXH 3VFMA 4JCMA 1IGFH 2EYTA 4AK1A 4EDWH 5FXCH 2DL9A 43CAA 4U1HA 3ZE1E 1HHIB 3QJHB 2KUTA 4HBCH 3C6SB 5EU6B 3VI4F 3UTTD 1AO7D 4P9ML 3QHZL 1BWMA 3TPUB 1AE6L 2H1PL 5TFSH 2ICWB 2BDNH 2HAZA 3UPCA 3O8XA 1QSVA 2HA1A 3PWPB 1HHKA 4LKXB 2W60B 2DBLH 3P30H 1WBYB 4JFFA 3GK8L 1HHGA 1HKLL 4XNZB 5HI5D 1CFSA 2DM4A 3O3BB 4GBXD 2OTWB 5D93C 1KEGL 4L9LA 4P9MH 5DC4B 3VD3A 2CD0A 3VCLB 1CGTA 2OR8A 5B22A 4QRRB 5D1QA 1BAFL 2OQJB 2IALB 3TBSA 2VL5A 4KC3B 1QO3A 3GK8H 4ODUA 2FSEB 1FL3B 1D9KD 2LAAA 4RBPH 3B5GA 3LRSA 4TVPL 3RVXD 2GTWA 3QG6B 3ZTJH 3QIUC 5DJDB 4GG8B 4DAGH 4YDLB 1CE6B 3TM6A 5CLWA 2AXGB 4PLNC 3CLFH 4YNYA 4QT5A 3MV8E 3FB8B 3CSBA 5I75B 1SJVA 3CIQA 1X5HA 2NLJB 4HAFA 5T1LD 1BZQK 4M1CD 1AGEA 1VERA 4BQCA 3O4OC 3VI4E 1B88A 2OCFD 2EZ0C 2ZP0T 3JXAA 1RURL 4P2OD 4N8CH 1G6RH 4AL8H 1R6VA 1T4KA 5CLTA 2ZOKB 1J8KA 1CFTA 2J8UF 3FMGL 3C5JB 4YAQB 1T2QH 5FHAH 3H9SB 4G7YH 5ETUA 1GC1L 2KBGA 1A6UL 4H1LA 4K8RH 2FJGA 1J1XH 4PJ5B 4FXKB 3FFCE 3FMGH 2JTDA 4HV8A 2P5WA 1CE1L 1TTFA 2AJYL 2H32A 3FOLB 3OB8A 2ZG2A 3TH2T 1GC1H 5CEXB 1DUZB 5FGCE 2CMRL 5ADOH 4MJ5B 1QVOB 3U46B 1X5KA 4ODXB 4WFFE 2W0PA 4OFPA 3O6FD 4OIAA 2Z31B 2VLKB 5JA9A 1MI5D 4CMMB 3B2VL 5C07E 3HI1A 2X4PA 5MHSE 2KZ1B 1G7IA 4LPXA 4C57C 2NY3D 3MA7A 3UC0H 1YMMB 1CFNB 3RBGA 1P4LA 2Y06L 3GI8L 4QYOB 4XP4L 3QWQB 4X5XB 3EFFA 5JXAH 3DUHA 4NP4H 4HK0A 2AK4B 3O2VH 1I8IB 5HVWA 1IRAY 5C0IB 5KSUB 1B6UA 1YN7B 3DVGA 5ITBH 5K9KA 3QUXA 1NC2B 3LQAL 1MFCH 4WEBH 3B9EA 3O9WC 1HDMA 3G6AB 1KLUA 3U36B 5DK0A 2H8PA 4GS7C 3VMPA 4KHXL 4R8WL 3NPSB 2FECI 5IK3B 3LKQB 3F7PC 3TVMC 1NH6A 4PLJD 3AMLA 4LEXL 4JY4B 1A9BB 5LGJA 4M5YL 5ITBL 2W92A 1UWEL 4LLVA 1X4XA 4WEBL 3VXSD 3O2DL 2FYYA 1WJ3A 4XMLL 4Q9CA 5C9KA 5IROC 4WUUD 4KHXH 2EC9U 5LAXB 3QIBB 4UMGA 4LPVA 4ZNEA 3ES6B 5EOTA 3IETB 4FFYH 4EI5A 3MUZ1 1KIPA 3O2DH 5FB8B 2Q6WB 2Q87A 4XMLH 3GSVB 5DQ9A 3QQ9C 2ZKHL 1KGCE 3RWFB 1ORSA 2VE6A 4NWUL 3TV3H 1F2QA 1KT2A 3TA3D 5ILTL 4GO6B 5EUOF 4OZ4A 2AXFB 3GSRB 4FFYL 1EO7A 1CTNA 1SJHB 1YDPA 5KSVB 1AIFA 1C1EL 2WK2A 3IGAB 1S5HA 3OZ9H 4YHMH 1I1AD 4WWKA 5E95B 5TGBA 5F7FA 5C8JB 4MYWB 1INDL 1QFUH 2MWCA 2EEBA 3PDDA 5D1ZD 1F4WL 3KYOB 4D0DB 3QJFB 5D6DC 5D7LB 3L7FB 2O61A 4N8VA 3S4SB 1VACB 4KRNA 3TH3T 4DUXA 2F8OA 3PP3K 4ZOAA 4IJ3B 2BCKA 1BQHG 4NQVA 2XN9D 5EWIL 4ZUUB 4DN3H 4Z0BL 3MJ6A 1NCAL 4MSWA 1LD9B 2FD6H 4WW2C 5BV7H 2ZUQC 2MPAH 3IDYB 1RIUH 3RTQB 4MNHB 2D7MA 3BEWA 5D9SB 3NABH 2J6EH 4TQEH 1J5OH 2Q1EA 4O02H 4AEIH 4BH8A 1C7SA 4WI2A 4XPBH 3EZ8A 5DFTA 3NACH 1IGJA 1KIRA 4CVUA 3VXPB 3HAEH 4NCC2 2Q20A 5FGRA 5IW1A 3CZFA 4I18A 5CUSH 4GRLB 3UO1H 2ADGA 2VUOA 4LAJH 1UH2A 8FABB 5CIPB 1WWBX 3WS3A 4ZUWA 3TBVA 5CEYB 3PG2A 1E4XI 3B43A 1N8ZB 2EDDA 1NQBA 4P5MB 1ZLUK 2OTWA 2BNUA 2F15A 2VDQL 4GS7B 3G04A 4X6DB 4K7FB 4Z7NF 2AJSL 2DMKA 3MYJA 4MCYB 2XN9A 4Z8FH 4JFFE 4DFHA 2C26A 1IC7L 2XICA 1MFBL 3GMMA 1YPZE 3S7GA 4J6RH 4WDIA 5J06A 3RZCA 3SGEH 3PWJA 5JXEC 2QQNH 1FC2D 2NNAA 2VDQH 4GKNA 4Q2ZB 2F53B 5JHLH 1U42A 3DO7A 1J9CT 4PB9H 2GJ6A 1ED3A 1J1PH 3DX8B 3WFCH 1QLRA 3OX8B 4PRDB 1MFNA 3BZFB 1BOYA 1S78C 2ZCKL 3S5LA 1NBQA 4HUUA 4UIMB 1CQYA 3VWKB 4DGIH 5CS7A 5E9DA 3P4NB 4KVCH 3GMOB 1NAML 5C09E 3OKMA 3KR3H 3SHSA 1DDHB 4P2RA 1IEAA 3ULUE 4PJEF 3QRFM 1AD9B 3GSXB 3SKMB 4DVBB 3W2DL 4EKXA 1W72H 3F7QA 5DRNA 2NY6C 4RFEB 3SBWC 1RZ7L 3Q6FA 1AGCB 3UJJL 4UNTA 3CFDA 2I60L 4LNRA 1JNHA 2QTEA 4TUOA 3QUYA 4L3EA 4GRWF 3BRGC 1IARB 5HVHC 3AGVA 4WO4D 3MRCA 5DJ0A 3FT4B 2QHRH 3O3DB 3DRQB 3H9SE 4HW6A 4LBEA 1T83C 2A6JA 4M7JL 4JO3L 4HIXH 2CKBB 1FG2B 3H3KA 1VADA 3FO1A 5F1NB 2CDFA 4JR9L 3QO0A 2R29L 3G5VA 3TA3B 4G7VL 3ZSTA 3QNZA 5I1JH 3U0PA 4X99B 5DHYA 5GSVA 1U58A 5CEZD 1EFQA 1ZAGA 1T04B 2PNDA 5EZJA 5JPMB 2IPUK 4HIXL 1LE5B 1DUYB 1CGVA 1U0QA 1V3JA 5C0AD 5HDBF 3MV11 1FVCA 5IBLC 4YEEA 2YPKB 4Z7UE 2ITDB 4JLRB 2CUMA 4W6YB 2N56A 4NQDB 2ZUTA 1HI6B 3I6GB 1UEYA 2Z8WC 3HFML 2W60A 4YHIA 3IFPB 4U0RB 1WBYA 4IIQB 1T5XB 1IL1A 3S88L 4S0SD 2XRAL 1IZJA 1F3DH 3BI9X 1RIVL 3WNKA 4Y19A 5EC1A 1XGPA 4NFCA 1YN7A 3DVGB 4PG2C 4PJ5D 3WO4B 3WNMA 5AD0A 1SYVA 1U8LA 4NUJA 3QISA 3TBSB 1NMCC 4U3CA 4HH9B 4FQHA 4NM8H 3B3IA 1LE9A 3BGAA 2PO6A 3HB3C 4BQ9A 1I3GH 3S35L 4B53A 5B8CB 5EUOA 2F19L 3QI9C 3PL6A 4LLAA 5EO9A 3DROA 2ZOLA 1MHCA 1F4HA 1HWHB 1JYXA 3FB8A 5DJ6A 2X4OB 3LKSB 4LSRH 3QH3A 3REVB 2V5YA 4WO4B 5INDA 1ZEAL 4KK6C 3H42L 4WHYH 1HQ4A 3J7HA 3OKKA 2R1YB 4ENED 4PGCA 3IYLW 4K9EH 4N0FA 3MRRA 3NCJH 3HPJB 4KJWC 4K7PX 3L3OB 4DKFL 3E3QE 1A5FH 3EAKA 1RZJH 4O2CA 5DYOA 1CLYL 1OT2A 4FNLH 5DJCA 3CH1A 4L4TD 3D5OF 1ND0A 5A2KH 4LDOB 1CFBA 2FGZA 2XG4A 4R96B 5JNYA 5FK9B 4O2FA 4X9IA 5D5MA 1CCZA 3OAZK 4HV8B 3VXME 4LRIA 1Q9WB 1S9YA 2SEBA 4HFWB 1U93B 2ZCLL 4PJEB 2F5AL 4BELD 2XACC 4XTRC 2R9HC 4NQSA 1CLYH 3BW9B 1QLEH 3I3DA 3LKNB 4OCMC 2FLRT 4NNPH 4Q9BA 1ZT7B 3V6BR 2R0LL 25C8L 4EDWL 1BPVA 3BQUD 1YC7A 3E1F1 1TETH 1TJHH 4XX1G 4OLXH 3QUXD 5KW9L 2DQDL 2X4PB 5TFSL 3DLQR 1LDSA 4XCEA 1DN0B 2ITCA 4MS8D 1FLTX 4PD4J 1W72B 3TNMA 2R0LH 1S7SB 1HOCB 1U3HA 2H3NB 3VGGA 2G2RA 2HT4D 4YDLC 4NNYB 3FL7A 1TETL 1TJHL 4OLXL 4K94L 1CICC 4P9HH 2DYPD 4ZS6D 5C0IA 1HHKB 3DARA 1EPFA 2R4RL 4UT6L 2XQYK 2X6MA 4X6BA 1MI5A 3MCLL 1PKQB 1I1AB 5I1AA 1KELL 3RA7H 1IKFH 3PHOA 4Q9QH 1ZT1B 4LHUA 2DQEL 1VESA 3QXTA 4LCWA 4TVPH 2NY4D 1EJOL 1XGUA 4L8SA 1DEEB 3CPLA 3LS4L 2YBRA 5E5MB 5I1IL 1FL3A 3WSQH 5IQ9B 4XBEL 5FYLL 2V2WA 4PJHE 2J6EA 1HNGA 5KSBE 5HPOA 4P5KA 2KL6A 1R0AL 4XAWH 2PTTA 1CGSH 4K2UL 1LO2H 1RURH 4J3SA 3QO1A 3STLA 3IXAA 3VFGH 4LOUC 5GZOC 4QRSB 1UXSB 4AL8L 1HZHH 1AO7A 4PJBB 1QBBA 5AZ2H 1U3HD 1RZKC 1RHHB 3OKOA 3RPIA 1N6VA 3CVHL 1F3JA 4P4RB 3O9WA 1I9RH 3R8BB 3LKRB 3GSWA 1MVUB 3TT1L 1T1XA 2RBLA 1HKFA 4TSBL 4GRLD 5DUML 1KCVL 1NFDA 5A40E 4QRPB 3NCEB 4K7PH 2JCCF 4JFYB 4XVUC 5E8PB 3C5JA 4YAQA 4F7PB 4KJYA 5AZ2L 1Z0MA 4AQOA 2X70A 3KXFA 3MLWH 5D7IE 1N0XH 1UXWB 4LCWD 3F58L 2GSGB 2V7HB 2FJFB 2MFNA 2DF3A 3TBTB 3EYSL 1MREH 1DJSA 3S3SA 5B8CC 3MLYH 3JTSA 3LS5H 3QCVH 4FQXA 3ZDYE 1AXTH 4JGUA 2A6JB 2YEZB 1UG9A 4YHLH 3SDCB 3MLWL 5DD6A 5GS0H 1HCVA 3AB0C 3HMXH 4Y4KB 4DTGL 2OJEA 4HUWB 4NC1C 3HR6A 1X44A 1JNLH 3LS5L 4ZFOB 3BWAA 4Y5VC 3PGDA 5GGSY 1CI5A 2IJ0C 3QR2A 2D7OA 3MRPA 3IVKA 1IGJB 1KIRB 4LLDB 3WE6A 3NIGF 1ZSDB 2BY1A 1P9MA 5CGTA 4NYLB 5F1KC 1MFCL 1JNLL 3N1MC 3T77B 2C4FT 4X6DF 3O3EB 4FS0A 1HHGB 3TO4C 2XWTB 4OGAC 2VLJB 4CAGA 4YR6A 1I1AC 3BQUB 4NHUA 4LEXH 4G6JL 1UH4A 4W4OA 4KU1A 1IGIH 2R0ZL 4JCLA 2NY0C 3EO9L 4CN1A 3SDXE 3OKNB 5DLMH 4NRYA 1QG3A 1DANU 3RVVD 4X6FB 2ZSWA 5T33H 5IK3A 2VXQL 3FZUC 5MENE 1SYVB 3RNQB 1FSKC 3MJ7A 3GMLB 4WRLA 3G9AB 4BSVA 2NYYC 2GTWB 3B9VA 1MJUL 2UY6A 3MTRA 1NGYA 5DLML 5B8CA 3DYMA 3MBEC 4RAUA 4AM0A 3RKDC 3WHXA 4EBQL 3IFLL 2BSED 4XI5C 1XCTB 4FQ1H 5TE4L 1JL8A 1NAMB 2E9BA 2GUOA 5DXWA 2V9TA 1WSST 4M7LH 1ZHKA 3TV3L 4OTXH 2Z0BA 4EXPX 3D69A 3ULSB 1MJUH 2C5DC 1KB9J 5D1QC 5ILTH 4HXBL 1FNEA 1NAKL 1KIPB 4NPYB 1KSRA 3VFRB 1JFQH 1OQXA 3OZ9L 4YHML 1WF5A 4JRXA 1MCNA 1INDH 1QFUL 2DWEA 2IAND 1NLDH 3NN8A 3G08A 5KVEH 5DQJA 1P5VA 1S9WB 2AV7A 2ILLA 1G0DA 3GRWL 2EIBA 3SDAD 1F4WH 1WFTA 1R24A 3QCTH 3IJYA 1R5WA 4IRSA 5TGBB 3BX7C 3DGCR 4FQCL 3EDEA 2YA1A 1ND0B 4FXKA 3EGSA 5IM7B 2NX5A 3IDNB 5EU3B 4LBEB 2FD6L 2CRMA 5BV7L 2MPAL 3FO1B 5KVEL 4N0YL 4PGBB 4H26A 2ATKB 1DUZA 3HE6C 3EUUA 3TIDB 4PJ9D 1T1WB 4O02L 3DUSA 3D85A 5T3ZH 4PJDA 4HUXA 2UY7A 1H15A 3AAZA 2J8OA 3DX6B 1DFBL 3FO2A 5TDOA 1AP2A 4Y4FA 4PJ7E 1BGXH 1Q0YH 32C2B 4KTDL 3U82B 1JUFA 4EI6B 1DE4B 2B20A 4MQ7A 4ETQA 4LVHC 1T7YA 5CHNB 4M6OL 3NTCL 1BFOA 5DJAB 1OD9A 2EIEA 1OTTC 3U4BH 2D0HA 1A6VL 1OAQL 3SQBA 4G6FB 3VE0A 3QUZD 3QFDB 4DOHE 4PJXB 1OAYH 3FT2B 5DS8B 2AJSH 1YZZA 3SGKA 4GG6F 3DUUB 3DVIA 5I1EH 1HCFX 4XNXH 1CDJA 2A73B 4M02A 1MH5B 1MFBH 4HIHA 1Q94A 3N1QC 3M8OL 5IHLB 3CFEB 3HS0B 3BZDA 3GI9H 1OAYL 2GSIA 2JIXB 1GC1C 3QULA 4XPHL 1T22A 3QWOB 2B8OT 4UT7L 2PW1B 4MNQA 4JRWA 4MNGA 5DSCB 5JW4R 4HLZG 4OD1L 4OLEA 5DHVA 3ZLQC 5KSBF 2A77L 2IANA 4GAJH 4AENA 3FRUA 1QBML 3KPRB 1EHLL 2BNRB 4JFPB 3KS0J 3G9VA 5C6TL 2ZPKL 1ADQA 2A6IB 3ULVC 3VWKA 4QRTA 1DEDA 1GZPB 4MQXD 2VE6B 4GAJL 2DRUA 1D5IH 5T3XE 3CNKA 1CD0A 3Q3GA 4UDUA 4MQSB 1FQ9C 4G80B 4ZMAT 3LVEA 1ZOXA 1X7QA 3SQOL 2ZPKH 1BVZA 1FL5B 5KBNC 2QHRL 1JWMB 4XPAH 5EN2A 3C6LC 4KI5F 1Z3GL 4Y4FD 3CDGB 3SGEI 4R96A 5JNYB 1NMAH 1D5IL 4JR9H 5I18L 1HWGB 2C1OA 5T1KB 4PBWD 3R0NA 5D7LA 4NRZA 1A64A 1Q72H 2UVFA 4OZGB 5DVOA 3HN3A 4OZHB 2Q8AL 5CD3B 3IKCB 4ZSOA 1XF1A 4GKZA 3W0WB 4NJ9L 2HLFC 3SDCD 1Z3GH 4FFWC 3CFIC 2BXYA 2IQAA 1GGCH 4NQXA 4HWBH 5E2VH 1J05B 1A6TB 2OJEB 1T7VA 2O5YH 1Q72L 3ZYIA 2ORBL 4OF5A 3ARDC 5D1XC 2I24N 1W0VB 3LEYL 1IGTB 4HF5L 5JW5A 1F6AB 5IW1B 1Y6MR 3RVTD 5GGSB 2E27L 1B6DA 3SDDB 4I48A 4RMSA 4YHYB 5KS9B 4MD4A 1SY6A 3BIAX 3QIWA 2XTLA 1OT1A 5IMOB 4CL7A 2EDJA 4CDGC 2DLGA 1JGDA 1I9JH 3OR6A 5KJRL 2HTKC 2RCSH 5DMKA 2X4SA 2YPLD 3GIZH 1NC4D 4HKZA 2NTFB 4OLWL 4Z0XB 5HHXL 1I3GL 4QF1A 2F19H 2C4XA 5FDWA 1EHAA 4OJFL 3X17A 1FVDB 4JVWA 3QHTC 4LGRB 3BP5B 4HFUL 1QD0A 5EOCJ 2QBWA 4K9EC 1I9JL 5GS0D 4KZDH 5KJRH 4L8CB 1A1OA 3GIZL 1QLFB 4BSVB 5BOPA 3PL6B 4YDVA 1N4XL 1BQHB 1MSPA 3ZL4L 2VZ1A 4JGJA 2PTTB 2AS5M 1M05A 1S7VB 3I75A 3MV8A 3GM8A 1JYWA 4E41E 1ZLVK 1UWXK 2NR6C 3QPXL 3PXJA 3Q1SL 4E42B 3ALPA 5IVXE 4N1HB 2BK8A 2YUXA 2A74B 4O4YH 3ALXA 2XFXB 5F6HI 4OZHF 4DKFH 3QFJA 4I4WA 3V5DB 1IEAB 2AQ1A 4CJ0A 5C0JA 4XP1H 5CSGA 2P5ED 4PJ8B 4WV1C 5D5MF 4J3TA 3NCYP 5E8PA 4LLYA 3G5XA 3L3OA 1A9EB 2IFFL 1WZLA 1YEGH 4WENB 5IGXH 5LKNA 1L7TL 3VRIA 3QSKB 3P73B 3RAJL 2XXMB 5HGDB 4PRHE 4J2XA 1MFEL 3CFKB 7FABH 3MFFB 3MO1B 4OM1H 4X6CA 3NOIA 2ED7A 1EMTH 4U0QB 4C56B 4X99A 4ORGB 1HN1A 3HC3H 2XY2A 1ZA6B 4Q6IC 4WU5B 3JZ7A 1MFEH 2YPLB 4YFLF 3GJFK 4CADB 1AP2B 4KHTH 4XC3H 5C0CE 1FORH 4F80A 1VKXB 1JNNH 1MCLA 2YPKA 1D9KC 2R1WA 1AXSB 4OLUL 3V6ZB 2R4RH 4UT6H 2YPVH 3IRZA 1RI8A 2X4QB 3QYCA 5FHBL 1MRFH 3UTSB 5IP4A 4XVUD 4YZFE 3O6KL 3K2MC 1MIEL 3U1SH 1VFAA 2NY7L 2Z9TA 4G8FA 2DQEH 1UB5A 1J1OL 1E27A 4XCYB 4KK9D 1VFBB 1CS6A 1ETZB 5FO8A 4GG6B 1RUKH 1WWAX 5C6WH 2R56H 1G9NL 1UZ8B 5EIIB 2MCPL 3L6FA 2BFVL 3TFKC 2AEPH 4OCXL 3B3IB 3U1SL 1XEDA 3GMLA 2PCPA 4WHTB 2IADB 4FZEH 2VABA 2EIDA 3V7MA 3L3HA 5DVLA 2ARJQ 4DKEH 4NJAL 3V4VL 3QIBC 1V7ML 3C09B 4HXAH 5DA4A 1FVEB 4Z7UA 3VFGL 5L88L 4P2RE 4ZS7L 1X5IA 5I71B 4P48A 4RMQA 1IVLA 3CVHH 1NCWL 1I9RL 3AS0A 5C08D 4FQJL 3UPRB 4MZ2A 4R26L 3TT1H 1X3DA 4KROC 3IXAB 4LSPL 3D9AH 5F89B 4CU8A 5C0FB 4QRSA 4O2EA 3VGAB 1BM3L 2A6IA 3NPSC 1F3DJ 1F45A 5DD1L 3KPOB 1KTKE 1ADQH 4IHOB 1J0YA 1PVHA 3MRRB 1GZPA 5T3ZE 1BJ1J 1N0XL 1NCWH 2XXCB 4UUJB 2VN4A 4PRID 2X4NB 4DZBA 4QOKE 5I8CB 3O2DA 4WWKC 1HHJA 1FNGB 3VD4A 1DQTA 2J7LA 3QAZC 1AXTL 1VENA 4O2FB 4ZUVB 4HJ0C 4N0RA 4X80L 4G5ZH 5GS0L 3MGOA 1AHWB 1YMMD 1N59B 1C5CH 1T5WB 1M7DA 2SEBB 4HFWA 3UJTL 1UWGL 3MLTB 3FAWA 4IRJA 2WWMD 5T3ZD 2DKSA 2Y25A 3DUSB 4M1GH 4Z7VE 2DYPA 1JGLH 3AVEA 5KSAB 2YMXL 4BQBA 5JLZA 2OZ4A 1S9XB 5TDOB 4HT1L 2OI9B 1Q8MA 1N2RB 3P77A 1CG9A 4WWKD 5DVKA 3P3YA 5LGHH 5D1QD 1A6TA 1DN0A 5GPRA 1MAML 4PTTA 2VH5H 2AEIT 4O5LH 2HRPH 5IB2B 3CAFA 4LRIC 1LP9A 3P0VL 3W11D 4EIZC 4G8GB 5I30H 1HQRB 1F6AA 2XA3A 1AQDB 5D93B 2OL3B 3H9SD 1VGKA 2XWTA 4X6EA 5EU5A 2VLJA 5KVDL 1T7XA 4QRUA 4JO4H 5FYJE 2MSPA 3P0VH 1KTLB 4UOW1 2NXZB 3QQ4A 1QTYT 4GMSH 2XQYG 3QHFH 1Q9LA 4AEHH 3MLZH 5EBWB 1OAZL 3D39E 3EJZC 4KK8C 2D4FA 4Y2DA 5CBEA 1WFNA 4P4KD 2FX7H 4NNXA 2VZUA 2BOBB 5IQ9A 3E8UL 3VWKC 2EDBA 1ZGLM 5I16A 3R1GL 4L8CA 3V6OA 3C60B 4NO5B 5GIRA 4YPJA 4GMSL 5GGRB 43C9B 1BQHA 3T8XA 5D1ZC 4QTIH 3M1BA 3MV8B 5ACLA 2V2XB 3X12B 3QUYC 4AH2B 1IE5A 2BVOB 5JZ7D 3NA9L 2BRQA 1A3RH 3WHE0 5GJTL 4AEFA 3FB6B 5ITFA 4Q6YA 4K7PY 3VFRA 4L3CB 4U3HA 1NFDB 1MWAL 3QCTL 1MCHA 3AMKA 4KZEL 4GW4B 5HY9A 4ZAKD 5TDPA 5KOMC 4PRNB 5C08A 3G08B 1ERNA 5MENA 1S9WA 3QAZB 4IMLA 4XNMB 4KMQA 3F5WA 3VFOA 5DDHB 1LEGB 2P44B 5F70A 3E6FB 2W1NA 4GG6E 4TN9A 3FT3B 3JV4B 1JF1A 4LP4A 3UTSE 3PWVB 3QXAA 1R5VA 2C3WA 3HCVA 4PJBF 4Z7WF 1NDMB 2GJJA 3PL6D 5CP7B 4C56A 2ZUUA 2HTLC 4HC1A 5KSAC 4HULB 4LRNH 3HZKA 1RMFH 1UC6A 4PJCB 4KI5E 2YD9A 3FTGB 4B7LA 5IR1A 2B2XL 5H2BA 4UIKL 2D03H 4PG2A 3IFNL 2LTQB 3VGDA 5IW6A 4OCLC 2GAZB 5EIQA 2JK5A 4JB9L 4I48B 4M6ML 4LRNL 3SJVE 3QDME 4GAGH 5KVGL 1VFUA 2YHGA 1VA9A 3QEQA 1MAJA 4D0CA 4MXWH 1UEMA 5JHDB 2ESVB 3UTPE 3ARYA 4UIKH 1GGBL 3I3EA 1RVFL 2R2CA 3ARBC 1FL6B 1OGAD 4JDVB 1U36A 5D96B 1DVFB 4Z0XA 2QADC 4M6MH 1F2XK 4CW1B 4XPHH 1KC5L 4GAGL 1KPRA 2CDGA 3VXQA 3EYQC 4W6WB 4LAQL 1Z9OA 4PG9B 1LQSR 1GGYA 4U1JA 1WZMA 2BNQE 4ZUTA 1DBBL 1QEWB 1NCCL 1TPXC 4HC1H 5E2TL 5DJDA 1T22B 3CU1A 5HVFB 2PW1A 5C6TH 1XCTA 2ERJC 5D2LE 3I75B 1YEHL 1VPOL 5K9OB 5HHNA 1PYWB 1G7HA 3MRQB 5BS0D 2FDBP 4HKJB 2EYSB 4L29B 4CVWA 1X4ZA 3QDGB 3B9KD 3I02A 3HMXA 3QPQC 4LHQB 1JJUA 2Q3AA 4QRPE 2V9RA 1OOAA 1H3VA 3IXTA 1YECH 4HKBA 1HH6A 1VPOH 3D39A 3WDJA 3FFCB 4HK3J 4TVPE 3VG9C 5L0QC 5J1AB 1SBBA 2X7LA 5GRWA 5ALCL 3TYGL 1EZVX 4PPTA 1NGWA 4ZUSB 5JDSB 2JELH 3NZHL 1IQDA 1NANH 4F9LA 4QOKA 2ATKA 4I77L 3CMGA 1EDQA 1E4WH 3TNNA 4HIIA 4PJDB 4UILH 1RK1A 1U91A 4JY6B 1XT5A 1Q9KB 2BC4B 2LU3A 2D3VA 4JFQB 2VLKA 2WMPA 1B0WA 4KK5C 1MI5E 3P77B 3SN6N 1DSFH 4WFFD 2ZG1A 2ZNWA 1V8HA 3K2UL 4NIKB 3V6ZA 4MA8H 4UILL 2X1PA 4V1DE 5DRXA 1RUMH 3O8XB 3V4UL 5TH2A 3QEQE 3ZT6A 3UTSA 3TBYB 3TPUA 4WW2A 4OLWH 1OAKH 4LASH 2RIKA 3TESA 3TCXA 1E27B 4XCYA 1XZ0A 3CUPB 3L9RB 4YXLH 4XBGB 2EDEA 2OL3A 1YNLH 5IESL 1UACH 1LEIB 3G6AA 1HEZA 1Q94B 2WINA 4KK6D 2UZYB 5EIIA 4OBSA 1UWXH 2NTFA 4LFHD 3RHWK 1QFOA 2QQQA 1ZLWK 4KJQC 2IADA 4JY4A 4KXZI 1NCDL 4S1SH 5LQBL 3KPSD 4PUBH 3L3JB 4EQ3A 5FYJU 1NDGB 5DHVB 5CJOL 4PV8B 1XF4B 5EFIB 2W0LA 1K4CA 3QPXH 4A6YB 5I1HL 5BXFB 2VQ1A 3ES6A 1PAMA 4H5SB 1DN2A 4XP1L 5LQBH 1QFWH 4PUBL 2P49B 1QUNA 3W5MA 4KKCC 1KCLA 1GAFL 5MP6H 1GZQB 2ADIA 2V2XA 4NN5C 5BVPH 1M1SA 3KPOA 3ILPA 2I26N 2Z91B 5FKAA 3C2AH 1CFTB 1TQCC 2EICA 1D5BA 4B7IA 3U48A 1F42A 5IGXL 1CDGA 2FIKA 1L7TH 2WLZA 1MCPH 3KXFD 1IQWL 3VJ6B 5EA0L 3ARTA 2I07A 1CU4L 5IIEA 4HMDA 3C2AL 1S7XA 3K1DA 3LPFA 3PQYA 4NM4L 4G9DA 3W82A 4CVZB 1WGOA 4HJJH 3WFHA 4PGDB 4LARH 4MWFA 2DWDA 4WFHD 5F8RC 1MVFA 1KLGA 4Z9KB 3QIUD 2HLAA 5CKGA 1YPZB 3GMQB 5CGYC 3UTOA 2VAJA 2B1AL 4FQIL 3MFGB 5K9JH 1KJ2L 1UM6L 4F7TA 5JIPA 2K7QA 3ULUH 5D7JB 1JYVA 3KYAA 5L6YL 1S9XA 1DBJH 4HWEL 4F33A 4WCYH 4F15B 1E28A 1KEML 1S7RB 4NOBA 3RY4A 4QHNB 5JOFA 3QRGL 4U1NB 1YMMA 1BD2E 1PG7W 1Z2KA 5FCSH 43CAB 5FHBH 4FQ2H 2XNAA 4M8QB 4PJAA 1PX3A 3HE7D 4L8DA 3JWOL 5FYKH 1MIEH 1VFOA 2BHUA 5H2BB 1G6RB 1LNUB 1KEMH 2ENYA 1D9KB 1HK6A 1QQDA 2ZNXA 3DMMB 4F9PC 1BOGA 3KNBA 1DQJA 4V2BA 3RNKA 3BPLC 2AK4D 2CRIA 5M95B 1R3IL 2R56L 5K9KB 4XXCA 5FECB 1J8HA 1I1FA 1KCSL 4FQ2L 2BFVH 1EBPA 5L8JB 5JR1H 4G8FB 2AEPL 2OXGA 4OQTA 4KAQH 4DEPB 1ULVA 1RD6A 4BSJA 3VFTA 5KOVC 3MLUL 4KFZC 4G9FD 4BJLA 4XWGL 3DV6A 4AQ1B 1G7MB 5HI5C 4ZFZB 4RA3A 3MRBA 3NFNA 4YIQB 1QO3B 3WFBL 1RJLA 5DR5H 4POYA 1CZ8L 3VW3H 1J88A 4KRPB 2R2HB 4KAQL 4N1CA 1TZHB 4H20H 1EGJA 5CSZA 4EUPB 4LLVB 1DZBA 5I66A 2R23A 1T7WA 4PS4H 4LSPH 3PV6B 2EKJA 4XWGH 4PRDA 1AHWC 3HI5H 5DR5L 4QXGL 1Y0LB 1CF8L 5C0ND 3U0TB 3V5DA 1UQSA 4OV5A 5I19H 5SWZB 1S9KC 4L5FL 1WWCA 3BE1L 2AXFA 4PJ8A 1S5IH 1Z9MA 5L8LB 4QWWC 4G8GE 3IGAA 1XIWA 4OF6A 5MENB 1P2CB 4WWID 4U49A 1F02I 3S37X 3ZDZE 4LCWE 1UWGH 5L8KB 5DMJB 4ZYKA 5IQ7H 4OQ1A 4JJHA 5EORL 2VLJE 5BQ7A 4MA1B 2GY5A 4UBDC 1UFUA 2G5RA 5KTEH 3PJSB 4ZDHA 1JGLL 1GL4B 2B1HL 3MFFA 5E24E 4CNIA 3L7FA 1CN4A 2BMKB 3TVMB 2I9LB 4ORGA 3GMNB 1FGVL 3JV6A 5JDJA 2DM3A 3VG0L 1MAMH 2NY0D 5AWNH 3ARFD 1K5NA 2V5SA 5J9PB 4HIJB 2VH5L 3T0XA 1BD2D 1Z5LA 1ES0B 2B1HH 2X42A 4LVHB 4WFGD 3FONB 4DUVA 1FZOB 1Q9OB 1CDYA 4IRSD 5I30L 1FNSH 1MPAL 3GSOA 4JO1L 1G7IB 1U8MB 3F6IA 3MA7B 4ONOA 3VD7A 5JHDE 3MRNB 2NYYD 1TZGL 1B0GA 2F74B 5AWNL 3FO9A 1JGVH 1SEBA 4IDJH 1X5FA 2MHAA 3VXPA 5GRUH 4JO4L 5DJ8B 4XNYL 2C1PB 5BZDA 4HIEB 5DK2B 4JO1H 3ARGC 5I1DB 1VGKB 3MLZL 5F1OB 3F65A 1TZGH 2KQNA 3BP6B 4Y5YC 2FO1A 1Y6NR 4NDMB 3RL1A 3V2AR 2FX7L 1DQQB 2HWZH 4O58L 4WW2F 4PJXE 4DOHB 5C9JA 2EDXA 2GI7A 2W0KA 1TENA 3UP1A 1FIEA 1RJYA 2ZCHH 4X9BA 2C3GA 2FJHA 4BH7A 1NFDF 3MOAH 3RGVD 3MREA 3DJ9A 1AGBA 3EBAA 4HS6B 5EO9B 5HYSA 4JM2A 2HTLD 5KSAD 5IEKB 2X1OA 1NDGA 2MCG1 2DTMH 3N85H 3ECBB 1S3KL 2X4OA 5CP3H 3NA9H 3UYRH 4MDIB 1QSEB 4PBXA 1A7QH 5HBBA 5J6HB 1G7HB 5GJTH 4YO0A 4X8XA 1T6VN 3MYZA 4OZIE 1MHHB 4JZNB 1MWAH 2ZUVA 3GSVA 2OTPA 1UENA 4JPWL 4NBZB 5GGVL 2DICA 4UIMA 1GZQA 2ZJSL 3RWFA 3RWGA 5I1CH 1HH6B 4OZFG 4XZUB 1NBZB 1F8TH 1EGJL 4UUJA 3S5LG 1D5BB 2F8XC 2VXTL 4L9LC 3BSZH 4LCCA 1DVFC 5ETUB 3VXOA 2FIKB 5I9QC 3AS3A 1HHJB 3QEUB 5DQDH 3GEWB 4HG4K 3HAEG 5HHQA 2FZ3A 2P8LB 3MRCB 3AROA 4RZCB 4X5LA 4H88H 4YGVA 3PP4L 4X83A 1Z6JT 3QDJE 3REWB 1F8TL 4L3EB 5IW3A 1OTTD 2JJVA 3BEVA 2NY2B 3FQTA 4WFEE 3G5VB 4IRJB 2P8PA 2X1QA 4P5TD 3LD8B 4I0KA 1R5VB 3IDXH 3O6LH 3PWPD 1U58B 4R4NC 1NUGA 2ARWA 1ZMYA 1U8KA 2GJZB 2GTZA 3RWJA 3S97C 4ELMA 1PEZA 4JY6A 1MJ7H 4JHWL 3RTQC 5D9SA 4JKPH 4Z76A 4AJ0A 3GSNL 1M7IA 4Q0XL 2DM2A 2MQ3A 1LE5A 5GHWH 3O4LE 2ITDA 4JPIA 4F2MB 5I1LB 1IEBA 1ZGLP 1YEIL 4NO3A 1JV5B 3TNMB 1QSFD 3WV0A 1XGQA 1CDIA 1MJ7L 3MC0A 3C8DA 4RDQG 3MROA 2E8ZA 3OJMB 3K8KA 3HUJB 2I25N 1YEJH 2NY6D 2JF1A 4NNYA 3BN9C 2PYEB 3S36X 3T09A 5GHWL 1KC5H 4U6YB 2F53D 4KQ3H 1FFOB 3UROR 5JOPE 3L7EA 1RJZA 4LSQL 4E41B 2IMNA 1ZT1A 2GK2A 2X9XA 5HHVH 1K4DA 2FECL 1DVFA 3WFZA 5CGMA 5AUMB 1Z9LA 4HC1L 5E2TH 1EAPA 1DEEA 3EOTL 2XKNB 4NNXB 3DOSA 4ZFZA 5B38A 2XYCA 2H2PC 5DMGC 4U1JB 1OD7A 2H26B 1U8NA 4WI3A 3PWJB 1S8DA 3NCMA 1CXIA 3UTZB 2YWZA 3ESVF 3KPMA 3VFWB 4J7RA 2FWOA 4IOIA 3T2NL 4TNWK 1FN4A 4FABL 5BRZD 4Y4HD 3T65A 1NBYB 1P4IL 1FFRA 1T03H 1ZT4A 3UZEA 4PJ9C 1Z0NA 4QXTB 3D2UD 5IB5B 3U0TA 4RGND 3P2TA 2KQMA 3DX7A 5C0RL 5HPMB 4OB5L 4X6CE 4G3YL 4KI5C 1FAKT 1KN4H 1SVZA 2PW2A 4G9FE 1PSKH 2GEEA 3V6OC 3JWDH 4TUJB 5DFVC 5JQ6L 3E6FA 2BVYA 2FJFA 2UZXB 4RMRA 5GGQL 3HB3D 5IHBA 4G3YH 3SKNB 4P2OB 1VEOA 3SJVD 4H1LG 1KULA 1Y18A 4I5BB 4P59H 5IKCA 4P23D 2CK0L 4Z7VF 1E28B 4FFWD 4ZQKB 2Q7NA 3EDJA 2DDQH 4H8WC 3RWDB 3GB7B 4NN5B 4MMXC 4BZ1L 1W2KT 4WU7B 3V0VB 1CK0H 4P3CL 3IU4L 3BUYB 5D71L 1K2DA 5F7UA 1U3HB 2H3NA 1FYTA 3IRPX 4LASL 3DURA 4XPAL 5HGHA 3U4AA 3QXDA 2CK0H 4B41A 4M9OA 4YXLL 4XB7A 3MXWH 3RKPA 1UACL 3RIFF 4RMVA 5HYEA 3BPNB 4P2QA 3T0WA 1IL1B 2O93L 4GW1A 1XR9A 2I9TA 2QKIA 4GBXB 4K7FA 1UH3A 5E9DD 1N3NA 2F5BH 1QPXA 2BJML 2PXYB 4LPCA 1JPFB 3N1FC 2BNRE 5EU4A 4UNVA 2X9WA 1YYLH 2W9LA 3I85A 2ZSVB 5E4IA 2DB8A 4GLRI 1PKOA 3OXRB 4J4PA 1OM3H 2ED8A 3D2UA 2L0DA 5KAQF 3VFNB 3LZFL 4XCFH 3X3GH 2F53A 4BH7B 3MJGX 1QFWL 2G5BB 4PV8A 3QQNA 4KJWD 1R3JA 5EFIA 3RX8A 3TWCL 3GRWA 1PW3A 2H9GA 1NAMA 3RVWD 4YFEA 4CMHB 1QSEA 5D1ZB 4QXUH 1N5AB 3MRIB 3OPZL 4X7EC 3MUY1 4JREC 1IQWH 3H7BB 1KJ3L 5MEQB 3CX2A 3TWCH 3VXSB 4MA3B 4N0FB 1QSFE 1AFVH 2XTJC 3ZDZF 1B0RA 3KJ4C 1MVUA 1JZ4A 1NMBL 3VXRD 5IVNA 2X70B 3KXFB 4NM4H 4K71B 3QUYB 4JJ5A 4DK3A 1A47A 3EYUH 5E4EC 4K94C 2YXMA 4RX4D 3RHWF 1UKQA 1XIWC 1ZKAA 4YUEL 3FT4A 4ZYKB 4ZNEE 1LO5B 1SM3H 2HJLA 5J0BA 2YN5A 5ERWA 2GJ6E 2B1AH 1I8LA 5EU3A 4XNUL 5F7WC 3ULUL 3REWA 4MA7H 3EYFB 5CEZH 3BKJL 5HI3D 3MACH 3TJHC 4FQXB 4NZDA 1BBDH 5DRZB 2A38A 4P46B 5ICXA 1OSZB 3NAAL 4HIJA 3WIIL 4JM2D 1NKOA 3D48R 5TPWL 3BKJH 4QHKI 32C2A 3MACL 2Q7YB 2VSDA 2D9QB 2E6QA 3STBA 2DLEA 5HDBE 1R3IH 5C92A 1EBAA 4PJHA 1UM4H 2AJVH 2GK0B 1TJGH 4GMTL 5ANME 5I1LA 4IOFD 4XCNB 3IFPA 5JR1L 3TC9A 1MFDH 3JUZA 4GLRH 4WUKL 4NOFA 3ZHLA 4WEUD 1C12A 3HAEA 3MBXH 4KMTL 1RUAL 3RNKB 4RAVB 1MOEA 3K74B 4NHUB 2CRYA 4PRIA 1X5AA 2NPLX 5DS8A 4X4ZA 4X4ME 4FMKA 4KROD 4FQQB 4ODHL 1MFDL 1CZ8H 3VW3L 5BVJA 1PLGL 1UA6L 4I0PC 1X9QA 1FZMA 3OMZA 4H20L 5CAYB 5CILL 3MRMB 1UYWH 1V3LA 4PJIF 3PGFH 4PS4L 3UAJC 3HS0A 3TZVB 2W0FB 1FYTE 3P0GB 1QBAA 3RNQA 4EN3B 3CXHJ 3BDXA 2BVPB 5F3BB 2Q8BH 1OSPL 2AK1L 3KPPA 1WEJH 3BPOC 2PO6C 4S2SB 5CILH 4P2OC 4X4YB 5C0CA 5KG9B 1YNKL 1QOKA 2VDRL 4H5SA 5I19L 3SCMB 4YO0B 4HMCA 1EXUA 4OCNC 1YEEL 2PTUA 3T65B 4HZLB 1S5IL 1CLZL 1RZGB 3QT2A 3ZTNL 2BZDA 1TTGA 2BY2A 3CMOH 3T4YB 3GJEA 1UQSB 2BNQD 2DWEB 3TCLB 1CL7H 5IQ7L 4P46D 1KPVA 3GBLA 5D70L 4WEMB 1XF2A 3G6JE 1ZE3C 3FCTA 4KJYB 5KTEL 1CLZH 5DZOA 3NN8B 3RVVC 4ZFGH 5IHUL 3CMOL 1CXEA 4GRLC 4JANA 3SY0B 3I6KA 2J3SA 4Z5RB 2AJUL 3THMH 4PGDA 3MRGA 4Z7NE 1PG7L 2NW2B 3HRPA 3VFUB 1U8JA 1BLNA 3C9NA 3O8XD 3GMQA 4L9DA 5ELIA 5SWSB 3HUJF 4NFBA 4OZHA 5I75C 3H3PH 1FAIL 3CC5B 3NPZB 5F7YC 4OI8A 3VXRB 1FNSL 4Y4KA 1NUFA 5FO9A 3ZHKA 3BP7A 3MA9L 4WTWA 1K5NB 1H15B 3AAZB 3DX6A 3O3AB 5L2JB 1HXYA 3EIFA 4LHUD 4LLMB 2VR4A 1JZ5A 3MBEB 4IDJL 2RAMA 4IMKA 4JN1H 5CZXD 3MRNA 1JZ2A 3RWCA 5GGVY 3O3EA 3HNSL 1IILE 1MF2H 1MIMH 2CO6B 2DQHH 2HWZL 4LKXA 1NL0H 1BX2B 1AGFA 3FJTA 3L7EB 3OR6B 1RZKL 4PJXA 4OF0A 1I8MB 4R4FH 1P53A 5I8EB 2APWA 1F13A 1HHHA 2DQJL 4G6ML 4L8SB 1L6XA 3KYKL 5DRWB 2ZSWB 2R2BA 1IM3B 5F6IB 5DT1L 1A1MA 1PZUB 3FOMA 3KPNB 2VWEE 5A2JH 1NGPL 3D6GA 4YFLI 3U30B 3W0WD 1S3KH 1AQKH 3BT2H 3UYRL 4E9LA 4PJAE 1JRHI 5EUKB 3PGCB 1A22B 3GSQA 1MFAL 1PG7X 2BNRA 4HJ0D 3KYKH 1BJ8A 2QQKL 4RDQF 5I6XB 3CDCA 3UBXA 1OGAB 1IAKB 1MY5A 1N26A 4QT5B 1UM5H 1U8QB 4TRPH 5DJ2A 2NLJA 3WXVH 2RFXA 5J6HA 1O7SA 4JFOA 4H25A 5E2JA 1NCNA 4YDKH 3ARVA 1ZWIB 1UCBH 2EC8A 2XPGA 2EXWD 2AJXH 5E94B 4OD3H 4QRPA 5JZ7C 1KPUB 2X89D 1HH9B 2DMBA 1KB5A 1UM5L 5HHPA 5B3JE 1T0NB 3CD4A 1YN6B 3SBWA 4RWYH 3GGWA 4X5WA 2F58L 3CGTA 1LK3L 1BVLA 1WC7A 3KYMB 1QA9A 5C07A 3V79C 2AKRB 4NKOA 3VU2A 5I76B 3O2WL 5L7XL 2D7QA 5L2KD 2E6PA 5I2IB 1N64H 1EUTA 5I74C 4PJFA 1G84A 4H8WL 3RUGA 3SDCA 3BH9B 1UKTA 3SE4C 3GIVA 5I17B 1DBAL 4HPOH 1R5IB 1QRNA 4GSDH 3FRPG 1J0JA 3WUWA 1IGCH 4YX2H 5MI0B 2J5LB 3MLXH 2Z31D 2UYLA 4YBHA 2EECA 1YEIH 3CSGA 3ZYJA 1GGIH 4PLOB 4PRAA 5EPMB 3INUH 2EYTB 1JUFB 1QPPA 5D1XA 1H0DA 1UJ3C 5DJYA 1K2DB 3KXFE 4Y7MA 4Y16D 1L4IA 5DUPH 3WHE1 4DKDC 2IH1B 2VDNH 4S10A 1EERB 1IGCL 4ZO6A 1WLHA 2J5LC 2YOCA 5F21B 3OAUH 1JV5A 1T66D 2GK0A 3GNMH 4Y2OA 4MVBC 3G5ZB 3B6SA 3IDIA 5GGSA 5BJTB 4DQOL 4PB0H 4QHUB 3ROLA 4GG6A 3QUXB 1ZA3A 2DLTA 4XPGH 5L9DL 4UINH 4HWUA 4QEGA 4HKZB 1BF8A 4N5UA 2EDOA 4JHAH 4MNGE 1IAIH 3BZEA 1H5BB 2NXYD 2QSVA 1KENL 3QFJD 4P4KB 3MRMA 2OM5A 1LP9E 3KYNB 4P5TB 5ESAA 2JIXA 1QRNE 4G43B 3B2UC 1GIGH 5B38B 4P23C 4AG4L 4JKMA 4XPGL 3IKKA 1T03L 2EO1A 4U2ZA 4NQED 1IM9B 1QLFA 5MEND 3V8CA 1T2XA 4QO1A 3FFDA 5D1XD 5DI8B 1PGRB 2HT3C 3ZE0E 4LHJB 4JFZL 1MNUL 3TLRA 2VDPL 3MCKB 3T0ED 1MHHA 1P84J 4JZNA 3V95A 5B21A 3PDOB 1TVHB 1NBYA 4WUUE 1OF2A 3ZDYF 3IFOB 5C0JB 1EEZB 2CJUH 1KN4L 1HYSD 1NEUA 2VLMD 2WP3T 4JFDE 1E4XL 1S9VA 2AJ3A 5EZIL 5AYQA 1ZLUH 3C5ZB 3OJDA 3EYVB 4X7TB 4JFZH 5JQ6H 3SEPA 4X0KA 5DD5H 3BRFA 2AP2A 1RUPL 4JDZB 3DBXB 1QSED 1ORQA 1IC1A 4BUGA 1NBVL 4RFNB 3T0EC 5CEZE 3VRIB 1JGEA 4OUUA 1PY4A 2H32B 3G6JA 5FYKE 5AZEH 3MRKA 4YJZL 4NRXA 3IKCA 3QUMH 2BSRB 4JKKA 4ZSOB 1ZV5A 4WI7A 4XHJD 4BZ1H 4PV9A 1SY6L 1F11B 2YUWA 3RVTC 2FGWH 1KJ2B 4WUUB 5BZWA 1JHKH 3O6ML 2QADD 3CZJA 4XNQA 2OXHA 5L2KE 4YXHH 1IMHC 4EUPH 5JXEA 2OYPA 5AZEL 1UJ3B 2ICES 4QKXB 4JPIB 5T1KD 1I9IH 4ZODA 5J7CC 4K3JL 2Z92B 1JHKL 4G9FA 5JW5B 3C6SA 5EU6A 1D6VL 1LP9B 5CJXC 3EKCA 3QXDB 1AXSA 1JPTH 1A6ZB 2IF7A 1G7LB 3GUTB 4I18B 4HUVB 1PEWA 2M8XA 2EDKA 1I3UA 4CJ1A 5HJ3A 2EKSA 1MH5A 1CFQB 4K3JH 1YYLL 1LO0H 1UVQA 5DMKB 1D6VH 1SJXA 5C0EA 2ZG3A 1EUUA 3Q6GL 4QF1B 4CBPA 4PJGF 4X6DA 5HI3C 2BRRH 2F53E 4ODVH 1DQDH 2A6KA 1I8KA 4JDTH 2P4AB 4XMPH 3CDFA 5F3BA 1A6WH 5LAXA 2BXZA 3EZJB 2C3VB 4XVJL 4OKDA 4YHKH 3E0GA 4GKNB 5FV1L 4JO2H 1QKZL 1R3LB 3IETA 3R4DA 1MWAA 2CIIA 1KACB 5D7IA 3H9HA 1A3LH 1SEQH 2D31A 4ZO9A 1Q1JL 3OX8A 4UTAH 3X13B 9CGTA 1GPOL 1OTUD 1RU9H 4XMPL 4ELMF 4YPGB 1CD8A 5CGYD 5F71A 4AH2A 4TVSa 3QFJB 4I4WB 4TSAH 4GKOA 1QKZH 4XPTH 5BMFL 2RR3A 5CCKL 4YUEH 1KTDA 1KPVB 4NBXB 3GSXA 3M07A 1SM3L 4G8IA 3S34H 3SKMA 2HG5A 4MJIA 4QHMB 3VXTB 3L3GB 1AGCA 3BP4B 4WTZG 5D2LA 3I6KB 1HSBB 4M93B 8CGTA 4I0PD 2HVKB 4S0TD 3IDMB 1FNGA 3TO4B 1K8IB 3VFUA 4YFDB 3FT3A 4ZUVA 3E3QC 4P2OA 1HKLH 4NKOB 5I76A 4S1DC 1AJ7H 2CKBA 1MEXL 3WCYA 5C2UB 1VADB 2XZCL 1EVUA 3L5IA 5CIPH 5TPWH 3WS6A 5JO5B 1N2RA 1BAFH 3P0YL 5HI4C 1DCLA 1RFDL 3E2HC 3KDMB 4CADA 3QUKB 1AJ7L 2W9DL 2WLYA 4BKLB 4JZOB 4UQ2B 1JCKA 3K81A 1WCQA 4YE4L 1HQRA 4TTGA 3AFLA 2F9BT 1AQDA 5TQ2H 3BIKA 1OP3K 4JFDD 3F7VA 3SPVA 4TTDC 1CFSB 2VSCA 4ZUWB 3ARGA 3QIBD 5BJTA 5CEYA 5KSUA 2ICWI 5DGQA 2HRLA 4Y5VB 4FQQA 2O5XH 5EBWA 3MYJB 3L6FB 4MCYA 3LN4B 4UOW0 1IGMH 3HZMB 3C08L 1A1MB 5TQ2L 4QLRA 3EO1A 3FOMB 2Q8BL 5JA8B 2HJKA 5SWZD 4RGOH 4PFEA 2A1WH 1FYTD 3HLAA 4GG8A 4Z7OF 2IBBA 2OP4H 5IWLA 4IMKC 5CZKA 3KYNA 4P5TA 5BW7A 5HDLA 5FUZL 3W39A 1RZJC 1SMAA 3TGXA 5F96H 1F6LL 4GXVL 2P5WE 1IAKA 5FYJD 1YEFH 4IM8A 4PJ7F 4NZTL 3UEZA 3UPRA 1YNTB 1PYWA 3MRQA 3OF6D 5KAQG 1RUQL 5HXMA 3MRIA 1OVZA 2CMRH 3MODH 4HZLA 4S1QL 2CLRA 3D3VB 4JG1L 3L95A 1F5WA 4MJ2A 4YDIL 2HH0L 4D0BB 3T4YA 4ZFGL 4PLKC 2R1YA 5TDPB 2VKXA 5EBLB 2OMNA 4DK6A 3OG4B 1V5JA 3O11A 4GFTB 2K3TA 2AJUH 3DTXA 3O4LD 3UC0L 4JEGB 1JNHB 4TUOB 4JRYD 3OXSB 1KTRL 3MODL 5I15L 1EEUA 1AD0A 3MMEA 2H2SD 4PRNA 2Y06H 4L4TA 2A2QT 4F37K 4XP4H 5C07B 4Y1AB 3CFKA 5JXAL 2HH0H 4JRYE 5BO1L 1MCSA 1ORQB 3S4SG 3MGTA 3O2VL 2CDEA 1IGYA 1CYGA 2NXZC 3TA3A 5BV7B 2BCKB 3ULUF 4L8SC 5I15H 3HE6A 5LGKA 4NN7C 1CIUA 1KFAH 1YJDH 1LD9A 1MJ8L 2Z31A 1G1CA 2GY7B 2K9UA 1JGUH 4NO2B 4PRAB 1RHFA 4EI5D 1CLCA 5GJSL 3I84A 2CLVB 4QRRD 2F54B 4QY8A 5ICZB 4MHHI 3U0WL 3OJ2C 3ZZ1A 4Z7WB 5IB2A 2DD8H 4IRSC 1YJDL 3CSYB 1W72A 3LQZA 1F90H 1OTSC 4G8GA 1HI6A 2P7TB 3I6GA 1WCBB 4KRPC 3D0LA 3G5ZA 5TH2B 1NSNH 4HK0B 3H3BC 3LOWA 1JRHL 1OP9A 5GZOD 2OX5A 2QL1A 1JVKA 3V5KB 1S7UB 1TTUA 4QHUA 4XAKD 2HFTA 3NIDF 5TF1H 4I3SH 4CMHC 3DWTA 2B4CC 1GCFA 3RP1A 1LEIA 1MI5B 3FKUS 3KWWB 1F90L 3U6RB 4F9PA 2YK1L 4U1MB 2GW5A 5E1AB 4YHOL 1AQKL 3BT2L 3L5JA 4ELKA 4JE4B 1GXEA 1Q9LB 3AC0A 5IWLC 3DRTA 3W9DA 1G7QB 4JAMB 3LIZH 3HRZB 1WT5C 2XOTA 2YUZA 5TF1L 5EUOB 4QHKJ 4ZXBA 1OTSD 2E7CA 3L3JA 2FO4B 2GHWB 2VLME 3G5YA 4KRPD 3MPCA 4PJFE 4C83A 5IEHB 4PLJC 2WBKA 1MUJB 1H3WM 3BHBA 4I18C 3WXVL 3PWUA 3RKDD 5C0CB 2HT2C 2C3VA 1MCBA 1INEL 4XP6L 4WGVB 1EAJA 3LIZL 4OZFB 2EYSA 4L29A 5EWIH 2DKUA 4Y16C 3M1BB 4OD3L 4L3ED 5EIVA 3B9KB 3Q48A 1B4JL 4OGXH 5DJXA 2OK0H 3DSFH 2IH3A 5EOCH 1I75A 5FKAB 4DGVH 2VC2H 3HZYA 1U8IB 3I02B 4DVRH 3GMRA 2J6EL 4TQEL 4JQXC 1T89A 5E94A 3UMTA 4CN4A 4C59B 3H6JA 2AABL 1I7TA 3NCYS 4HX1B 3QQ9D 4OF8A 2NTSP 5FYJL 3FQXB 1QP1A 1L7IL 4QHLA 5DURD 2HG5B 2EYRB 2OK0L 2P24A 4YDJA 4OM0L 1FFNA 2VC2L 5BRZA 4DVRL 1X4YA 5JPNB 1FFPA 5D2LB 4J3WA 4BZ2L 4M62H 1U92A 5CKAA 4C56E 5FF6B 2V2TB 3H9YA 2CDFB 4KV5F 3QO0B 1RZFH 1F11A 4HS3B 3QNXA 2YUVA 2BX5A 2X4UA 1FZKB 4Y4KD 2ZUYA 5DUPL 4BZ2H 5KVFL 1MCOH 4OZIA 1K8DA 2IAMD 3CFBB 4HLZH 3OAUL 3V9FA 1YEKH 3L3KA 2VWEC 3X14A 2ICEB 3SDXA 4OKVB 5C3TA 1F4AA 4X4MA 3TN0C 4M6NL 1S7SA 2PR4L 1ZSDA 2HFGL 1T0PB 2VOTA 5KVFH 4M7KH 5F7DA 1TQBB 4WJ5A 4NQDA 2CK2A 4HDIB 5SV3A 3R8QA 2VLJD 4UINL 5IVXB 2EKSB 4LCYA 4M6NH 4K3EL 3FN3A 3N06B 5BRZE 3KR3L 3IDUA 3C8HA 3B4NA 3STZA 3MGAA 4XBPA 4NSKB 2LVEA 4I3GA 4NC1E 5HGBB 3MV7D 4LGPB 4AG4H 5ID1A 3ZKXB 4YIQA 4E5XA 4MCZA 3ULUD 2HJKB 1G9NC 2I60H 4ZXBD 1MCIA 2YD8A 3L5WA 2R2HA 2BVQA 4P57A 3WIHL 3DV4A 4F8QA 3ARSA 1WBZB 2BSTA 4AM0B 3QO1B 1LO3L 4JVPA 1CDUA 3HZVA 2VISA 2WW8A 2XTJB 1E4XH 5EZIH 5KANI 4H25B 2R29H 5DJZB 3FB6A 3W0WE 2DLHA 3V52L 4NQDE 1KB5B 3U4EA 5INCA 1RUPH 3C5SA 5ESVB 5HGGS 4JFDB 1W0YT 4Y5YA 1YN6A 5EBLA 3T2PA 2HKHH 1LEGA 1S7XB 2VLRB 3PQYB 1ZVSA 3S96A 3IDMA 3EDDA 3JV4A 5C07D 3V52H 2AKRA 1JN6B 3ARBA 1SY6H 2BY0A 3PJSA 2NX5B 3IDNA 2F8VA 4CRPA 4RCAA 3D85D 3EOAB 1QRNB 4NQSB 3TIDA 1AKJB 3CK0H 4QRPD 2YZ8A 3HE6B 4QRQB 1FH5H 2UYLB 4JN2B 4JKWA 5B4MD 4NM8L 4I2XB 1BFTA 2IAMA 5HYQA 2CR6A 1WBXB 1FZOA 2PXYD 2L7JA 4M00A 3S35H 3VRLF 3DGGB 2NY4B 3CLEL 4J8RB 2XZQH 5E8OA 5AAMA 4U1NA 2LFGA 3QZWG 1QQDB 1WTLA 3DMMA 5DRXB 1DL7L 4FFZH 4Q7DA 2BHYA 4HZAA 5DF0A 1LO0L 3KPSB 4OCYL 5J3HD 2RQ8A 5F7EL 4X8JB 1CXLA 2XWJB 3EHBC 1E4KC 3Q6GH 4ZFFB 4KVNH 1ZEAH 3H42H 4P3DA 4GW5A 1BJ1H 1HEZB 3CFJB 5D2NC 4OCYH 5ENWB 3TT3H 3ZE1F 3BPOB 5E8NA 5C9JB 1A6WL 3OB0H 3ROOA 2A0LC 5GZND 4HBQA 4YHKL 2Z35B 4GUPA 4ACPA 4KVNL 5C09B 3W39B 2QADB 2EH7L 1I3VA 3MJ9L 5B3JF 1GPOH 2JB6B 5ESQA 3C6LA 4HBCL 4RIRB 1E6JH 2R23B 5IHZA 1Y0LA 1AE6H 3C5ZC 1PD6A 2H1PH 4RQQA 4CU7A 4TSAL 3PHSA 4NPYA 4Q9RL 4X9FA 3S34L 3P30L 4NNPL 25C8H 1M71B 4ODBD 2APBA 1F3JB 1KIQB 12E8H 1QFPA 3RWGB 3LQAC 3ZDXE 1E6JL 3WJLC 5IOPB 2Z8VC 1BF2A 1KTDB 1AO7E 4XHQA 4HX1A 3OXSA 4X6DE 4Q9RH 3GSNA 4W70A 5AG9A 4QHLB 5F7HA 5IIEB 2ADFH 5EZLB 4M9PA 1MEXH 1FO0A 1VGEL 4FQLH 4PRBA 3WBDA 1BZ7B 3WMSA 5IVXF 2J8UA 3WFHB 2CDEB 3BEVB 3CFCL 5E4EB 2CXKA 5ID0A 5KS9F 2WBJB 4R7NB 3P0YH 4XRCB 4LLWB 1H8SA 3RA7L 5DWUH 1KJ2A 4WUUA 5FA4A 2GFBA 2ADFL 1BD2A 1L9NA 2W9DH 2EDTA 2I9LA 4U6XA 3HPLB 1ES0A 2R9HD 5HYJE 1QSEE 5MI0C 1J05A 2XG5A 2AAVA 1AC6A 2V5TA 5J9PA 3CSPA 5HYJD 1DE4A 4Y5XC 3H9ZA 4TNVK 2YZ1A 4N8CL 5I1IH 3LKOA 3KDMA 1XGTA 1P7KB 3MJ9A 3WSQL 5FGSA 4XBEH 4WHYG 4LIQH 2BSSB 2Q76B 4JZOA 2D0FA 3GSOB 1P9MC 4Y2DD 5C0BB 4G7YL 4PGJA 4OZGF 4HK3N 4XAWL 2F74A 4CDHA 3MV01 4R4BA 4K8RL 5DK2A 2MTPA 1J1XL 5EH1A 2OR9L 4MHHG 2O5XL 1A7NH 5DJ8A 4MDJA 2DAVA 3BP6A 2VITB 3QA3A 1FG9C 4YWGH 1JGDB 1JF5A 5I8KH 2E9IA 2A1WL 2IPKA 4E41A 2P5WD 1XGUB 5DUMH 1TZIB 1ZTXH 5LJYH 3QDGD 5LWYH 4M7ZC 4XBPB 1RAMA 3MV7B 4X6FA 5FUZH 1LDPH 5T3XL 3HRZA 1EAPB 3DVFA 4K7PL 3BQUC 4IRJD 3RGVA 1RSFA 3QULB 5F96L 3QFJE 4GXVH 1VEMA 1LP9F 2X41A 1YEFL 4ODUB 4YWGL 4WV1A 5GRYA 3QDMA 3F58H 1RUQH 4EI5C 2ARJB 2BVQB 3MR9A 4Z7QF 5GS2D 1LDPL 4S1QH 4OZFA 4IOIB 4R6UA 4OZIF 3M17A 4EVNA 4L8BA 4J3VA 4XWOD 4YDIH 4Q6IB 2FR4B 5FA3A 2A83A 4JM4L 3BXNB 2NY2C 3RPIB 1G9ML 2O26U 2VXSH 1QSFB 2VQTA 3BO8B 1KXVC 4DTGH 3LQAH 3T2OA 4WTXA 1ZS8B 3QUZA 4GRMA 4RGMC 1QYGH 2DLIA 2AI0L 2Q86A 4HG4J 2MOVA 2WUBH 5BO1H 4F3FA 2DN7A 1XGRA 2ENSA 3WLBB 4G9DB 3PQYD 4R2GB 5HHOB 4V2CB 2EE3A 4XNZC 4KY1L 2I27N 3SDYH 5L2KA 1CGWA 1JPSL 2EH8L 3P73A 4FZ8H 3F62A 3V5HA 2NY2D 4ZDHB 1MJ8H 5FGCB 3BGFB 5D8JH 2V2TA 3HG1A 2GJZA 2GTZB 3ZDXF 3PNWA 3EO9H 4NHCH 3C2SA 4KKBD 2P8PB 4LSVH 4UBDD 1MCRA 4QHNA 2NX5E 1UB6B 2EH8H 2VLLA 4FZ8L 4MJ5A 5D4QA 3U0WH 5HTSA 1H8OA 2DD8L 3AXLB 5CBAA 1IT9H 5D8JL 2Z8RA 4M8QA 5F8QC 4NO2A 5JIHA 4Y5XB 1NSNL 3WIHA 4Z7UF 3BUYA 4D9LL 3LSOA 4LSVL 2JE8A 1OARH 2OZ4L 4LNVA 2FL5B 4APQA 1RY7B 4NN6B 5GGTA 4Z7WA 2E9WA 4I3SL 2NQCA 3N9GH 2R2EA 4FQ1L 5TE4H 5GSRA 4HDIA 1I1FB 3D0LB 2EO9A 1L0YA 1BQUA 4ZAKB 3ARGB 3VI3F 1LO4L 4YHOH 3EOBB 4YHPA 1OARL 4ZFFA 1ETZA 5FO8B 4OLVL 3RPKA 3FB5B 1PQZB 5F6HJ 5DTFA 1UZ8A 2YSSB 3B5HA 5ENWA 1NLDL 1SYSA 1C08A 1YY9D 4Y0GA 3W9DB 5AUMA 2IBZX 3GHBH 3ROOB 3NABL 5T1DL 1INEH 1A1OB 2GSIB 1AGDA 3CDYA 4BFIA 5IB3A 3QXUA 3BD3A 3VFNA 1EFXD 3PWLB 3NACL 3QDJA 2QSTA 4XB8A 4TNVF 3DSFL 3AY4C 5FFLA 3T0EA 4C4KT 3DSNA 4MDIA 2H9GB 2WWMC 3IU3B 4JFEB 3ULSA 3FRPA 4DGVL 1LVEA 4HUKB 5BS0B 1PKQE 4OFYD 3UO1L 4OV5B 1D5MA 5E6YA 1JBJA 4IBLT 4UQ3B 3RWIA 4HCRA 4NBYB 1NCTA 4X6CF 2OJZL 5CWSB 3VXUA 2UUDK 3ULVL 1BGXL 1DANT 1KCUL 3K80A 4R97B 5DQJB 5J12B 1KT2B 3ME0A 3VXMB 5T1MA 3DTXB 2WWKO 1XGYH 5ISZA 3NA4A 4JJ5B 4D8PB 4QRRE 3MMEB 5EO0A 5I1KL 4M6OH 2ERJB 1IC7H 3TN0B 3MRLB 3U4BL 2OJZH 4J6RL 3ULVH 1RZFL 5T1KA 1D5XB 4JVUA 2XQBH 1JI2A 4ODWA 1KN2H 3MRFA 1TQBC 3VGAC 5JHLL 5GGRY 2D7TL 4RFOH 1T1WA 4QGTA 2WBJD 2QEJA 5SX4I 5I1KH 3SGJA 1B3JA 4LFHG 4MGXA 4MD0A 4GKZB 2ZCKH 1AKJA 1YEKL 1D6EB 4HS3A 3GSUA 4LMQE 4Y19D 3RWDA 4DCQB 2FB4L 4XVTH 4R7DA 1UGNA 4KVCL 4PJ7A 2PR4H 1K6QL 4HPYH 1KN2L 1E6OH 2QSCH 5FO7B 5HYQB 2H32H 4MAYD 5IVOA 3WNNA 1VKXA 4M7KL 1KJVA 3W2DH 4O51A 4ODTH 4OD1H 1U3JA 1P4LB 4QYOA 1RZ7H 4G8GD 4XVTL 3KPSA 3QXVA 3SKJH 3DURB 4HPYL 1E6OL 2QSCL 5I1DA 4OCWL 3PWNB 3SDDC 4R90H 3CZFB 2H2PD 1WZ1L 4GRLA 3QG7L 4U6YA 5DFVD 1J18A 3VCLA 3BKCH 4NDMA 3RJQB 3RL1B 2PYFA 1KNOA 4X9HA 4JFEE 1N3NB 1JI1A 2PXYA 5C08E 1CGXA 4ESKA 3RI5F 1RJZB 1IBGL 2Y07L 4URTB 3IAGC 2VL5B 3C8KA 4BA8A 5DFWH 2DL2A 5C7XH 3CFEA 2BNUB 2CUIA 3QIWC 4R90L 3G04B 3Q5YA 4I3RL 5F88B 1WIUA 3QG7H 4LCUA 4GUPB 5EU7C 3LH2L 2DLFH 1P7HL 1HSAA 5DVMA 1BMGA 1LO3H 5ISZD 1NMAL 4RGNC 3B9KC 1RPQA 1F6FB 4QNPF 5B4MC 1CE6A 2D2OA 3OBAA 4Z77A 4TULL 3UCRA 2G5BA 4NUGL 4KXZH 5EOTB 2EDQA 2Q8AH 2DLFL 3HZVB 1OGAE 3M17B 4UOJA 4DZ8A 3MNZB 2BVUA 1TCRA 5CMAB 4WI9A 4OCRL 1GGCL 1N6UA 5M7QA 3GJEB 3S37H 4JKLA 4RISL 2QJDA 4D3CL 3H7LA 1Y6KR 2VXVL 4OZ4B 5H35B 4LSUH 1AD9A 4LU5L 4DVBA 1TNNA 2DIBA 2FHCA 4U6HA 5GS3A 4PJ5A 1A2YB 3QZWA 5DO2C 1XCQA 3BPNC 4I9WD 4OCRH 4F3FB 4NQCA 3K8MA 4TUJA 5I6XC 3MSPA 2LTQC 3VFOB 2FEDC 2AERT 4MB3A 5DDHA 4Y16A 4CU6A 5FV2A 1M7DB 4D3CH 3DIFB 5JW3H 4P2QE 5DJ0B 5GGUB 1P7QA 4XRCA 5ICXB 5D2NB 3IDYC 4ONGH 5IBLD 4QCIB 4EDXB 3VXRA 5HHXH 3TBWA 2YRPA 3BEWB 1V3MA 1QVOA 3U46A 5E2UH 1U8HB 2Q7YA 1OSZA 2Y1VA 2ICEA 3SDXB 1F58L 5IV2A 3V0WL 3LKOB 1NEZG 4NO3B 4UTBL 3FTGA 1H9VA 3B2UD 2FEDD 1IFHH 5H37G 2VDLL 3ZYOA 3EFFB 3WNPA 2P5EE 4HH8A 3UYOD 3ZL4H 3IJSA 4L4VA 1I8IA 3B9AA 4JLRA 3W9EB 2BNQA 4PRHD 3UTQB 1CXHA 5I71C 4PJGA 3RGHA 1FFOA 4N9GB 4P9HC 3U7YH 4UTBH 5ICYA 4GW1B 4XH2A 5J1TC 5HDQH 2VDLH 2JJUA 2VO5A 2UUDH 4L1DA 2ZCLH 2EIZB 5L0QB 4AIZA 5GRVK 4WY7L 3FB5A 2GKIA 3TH4T 2CDGB 3VXQB 3CVIL 2X4RB 3ZKNC 5AD0B 4KJQD 4MCZB 3BDYL 5F9OH 2DMCA 1A9BA 2Z35A 1LE9B 5I16B 5KW9H 2V7NA 3U79A 4AIXA 4UDTA 5C09A 2BVPA 1OLZA 4JQVC 4FQXC 3RAJH 43C9A 4WY7H 5GS0C 1A4KA 3HC0A 1OGAA 3ARXA 1SBSH 4KPHH 3VD5A 3EDFA 4OM1L 1MRDH 3QUMB 4ONFL 3QH3B 3OKEA 3BO8A 5D6CA 3QDGA 2Q6WA 2YA2A 1PZ5A 4L3CA 1DDHA 2HTKD 5FDYA 5SWZE 3MCLH 3P9LB 4HQQH 2NR6D 1S7WA 2H6PB 3T3PE 1KELH 3LHPH 4G6FD 3ARQA 5C0BE 2MJWA 3P40A 1EA9C 1R3HA 2Q86B 4CGTA 4I0CC 4KHTL 1KUMA 3MLRL 4XC3L 1UCTA 3JV0A 4ONFH 2P45B 1EJOH 3CFDB 4MQTB 5E6IA 5EBGA 3CFCH 1JN6A 2AQ2A 3RZCC 1YQVH 1QHOA 1I7ZB 4UB0H 3T4AB 3PWVA 5FYLH 4LPWA 2NY7H 1FNAA 1N59A 3UXFA 4I5BA 1Y18B 4PJFB 3B8YA 1I7RB 5E1HB 4MXVE 2IANE 1MRCH 3MRFB 3A6OA 4NQVB 4WU5A 1LO2L 3BESR 1JMXA 4MB5A 3GHEH 2GYSA 4P46A 4ZO7A 1YQVL 3CC5A 4OI7A 2HT4C 3KPTA 4KTYA 4PJ8C 4UB0L 4OGYH 5EZJB 3WL9B 2HKFH 2Y6SC 3ARFA 2BC4A 5F9DC 1TVBB 4HSQA 5DUBA 3WEXB 4X98B 1P1ZA 1F4YH 4TSBH 4BH8B 1KB5L 3ZKSD 1CFNA 2ICWA 4A6YH 3JTTA 4I1NB 3UZVB 3UPAA 1A7NL 5SV4A 3ZO0A 1TXKA 2HKFL 4HS8H 4ALAH 3UAJD 2OSLA 3RWCB 1C7TA 4EXKA 4R26H 5JHDA 1F4YL 4LPUA 1MCJA 1ZTXL 1I8MA 3ZT7A 3BISA 1JPFA 4GRWB 2VITA 5EU4B 5DRWA 3GBMH 1G0XA 2KKQA 4RAHA 5DTFB 3WNLA 2Y4SA 4UI2A 2DQCH 3HMXL 2B39A 3VXSE 1WT5A 2FIRT 4WDIB 5FOBA 2R2BB 1TCMA 3TFKD 1BREA 3DX9B 1J10A 1FVEA 2EDWA 4N90E 3GBML 5E6ID 5IVZA 1EEQA 4LVNB 4QNPE 1G9MH 2VXSL 2V2WB 2LU4A 5HHNB 4X4YA 4FFVC 3UJTH 4KROB 1T1YB 3LY6A 5B38G 4K8RC 1XH3A 1SQ2N 3L3DA 4HKJA 3U30C 35C8L 4Z7VB 3S5LB 3H7BA 1TVHA 4XAKE 1T4KB 2XT1B 2AI0H 1G7JA 3OKDB 2YMXH 5B39G 3WN5B 4YQXL 4HT1H 4UZGA 1RHHA 3KLSA 3OKOB 4G6JH 4OD2B 1G9MC 1URLA 1B4RA 5DA0B 3ZKQD 3GGWB 3QHZH 5T33L 2I5YH 3CXDL 2HRPL 1JPGB 3RFZC 2EEAA 4PR5B 2G60H 1NGXA 3O3DA 5IUSA 3O41B 2EDHA 3QP3A 2P5WB 3QJFA 4N68A 5L2KB 1WC7B 4IJ3C 4YXKL 1V05A 4QOKB 4ZPVA 2MMXA 3OR7B 4MAUL 4RMUA 5ID0B 1KEGH 5C0DB 3BPLB 5I2IA 3CXDH 4GQ9L 1JK8A 2APFA 1JHTB 4MD0B 5LXGL 2G60L 1ZK9A 5JW4Q 2GJ6D 4U6XB 2Y5TA 5CINH 2A6DA 2OMBA 4PBVC 4D9LH 1X5YA 1NAKH 1CG9B 4AEHL 3AS2A 2OZ4H 5D1XB 5FGBA 3SOBH 4WIQA 2BOCA 1JFQL 1BBJA 5F3HA 3RBSA 4XCEB 3FHAA 2YR3A 3E8UH 2YC1A 5F9WB 5TQ0L 4XCNA 5F44A 4O51B 2KZWA 4W68A 1H0DB 2OS7A 2HFEA 3T2QA 1HOCA 5FKPA 2NY5H 1YEDA 3B83A 2C3XA 4LDEB 4LEOA 1MJJB 3UDWA 2R2EB 4QTIL 3KAAA 3CUPA 3L9RA 2ADJA 3UTQA 1NJ9B 4XBGA 5DK0B 1IKNC 3WYRA 3ZKXC 5HJ3B 1G6RL 1CWVA 1J8HB 5FUCC 1HXMA 4ONHA 1CICA 5ICYB 2WINB 2WAHA 3PHOB 1ONQB 1T2QL 3QQ4B 3MBED 4E41D 4KUZL 4OT1H 3GKZA 1A3QA 5HYJA 1BECA 1PQZA 2K7PA 3TZVA 5T3ZL 3AM8A 4AIZB 3KPNA 4X4XA 1DFBH 2JJSA 3RIAF 4WV1B 1JPST 4Q74A 2EDLA 3QWRA 3T1FA 1KJMA 4PGEA 5HGAB 4G43A 3CVHA 2ARJA 2AJYH 3OKLA 4JFXA 1MLBB 4MAYC 4RAUB 3ZSSA 3NTCH 4EVNB 5IFHL 3EYOB 3AB0B 3MRDB 4Y4HB 2DJSA 3V6FA 1OAQH 1EEZA 2YPLE 3ARZA 3EJJX 3HNVH 2FCBA 3I6LE 4HJGB 4WNQA 5K59E 1D5MB 4YH6A 2DQUH 3BDBA 3IDJA 3OKMB 3NZ8B 3J8F7 3RWIB 4Z7OE 1XMWA 3ELAT 4J3XA 3DMMD 1RMFL 3KJ4B 1KPUA 4XNXL 5B3NA 5IFHH 4LGSB 5EU7E 4O2CB 5DMYA 3D0VB 2IAMC 2B2XH 2HFFA 3GI8H 2P8MB 3HNVL 2ID5A 4ZOCA 1XIWB 4K3DH 4NP4L 1T83A 2DQUL 4ZPTA 3KYOA 2VQUA 4JB9H 4KH2A 1JGEB 1IC4L 1PFCA 3MXVL 5JMOC 4UT7H 3VG9B 3CX5K 2Y5EA 1J11A 1YPZA 3HUJE 4MJ6B 3LPWA 4J4PD 1GGBH 4OUUB 1EHLH 1K6QH 3QNZB 4K3DL 1W0WA 1T66C 1R5IA 1S7TA 3BH8A 3MNVA 1K3ZA 1IC4H 3AM8C 1S7RA 4HUWA 1UWEH 1ZT7A 3DI3B 1YC8A 1XF3B 2W9EH 3JSSA 1IJ9A 3SKJL 2AGJL 1DBBH 5FO7A 2Y72A 5C0AA 1MHPL 4LLDA 3WE6B 3WEXA 4FXGA 2VUYA 2R8SH 4GKSA 1EK3A 3KS0H 3SQOH 5ISZE 4FTVB 3Q0HA 5MEPA 5E2WL 4RGNB 3F12A 3NGBC 3PE9A 4U0RC 1YEHH 1SEBB 4UAOB 3WIFB 2NY5C 2Z8SA 4OZFH 4TNWF 5MEOA 2AGJH 1T21B 1WVZA 2C1PA 2R8SL 4L3EE 3WO4C 2HN7B 4RRPG 1I1AA 5I1AB 1KPRB 2EIZA 4ETYA 2YSSA 1ZANL 3ZHDA 5E00A