2CMKA

Cytidine monophosphate kinase in complex with cytidine-di-phosphate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
publication title Structures of escherichia coli CMP kinase alone and in complex with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 1998-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cmkA00
3UK6A 2OEPA 2QE7D 2Z5FA 3E2IA 4K81B 4DB2A 1AGRA 2JJ2A 2VEDA 4ARZB 5CJPA 1N5JA 2DY1A 4BZQA 1N3BA 1JEEA 1R6BX 2BM0A 5GVSA 1GRQA 2FSFA 3CO5A 5IDVA 4KLZA 4C0AC 2V55B 2RGCA 2H5EA 1N0VC 1E0JA 1ZD1A 1ZD9A 3V9PA 4LYHA 4DHEA 2REXB 4F38A 5JZVA 4RCYA 2J41A 4NU0A 4URUR 3U6BA 3EIHA 4TYNA 1R5BA 4M1OA 4JT4A 5C2JB 4P4SA 1D9XA 1JAIA 4CEHA 4QHTA 3IEUA 1VCNA 2EWVA 3TAUA 2BBSA 1ZC4A 4B74A 2OUKA 3PUYA 4OQXA 2GA8A 4YMUA 3NH9A 2LCFA 2WPDA 3K09C 2R6DA 1VKJA 3HR7A 1YZKA 2ZUCA 2FEOA 3K8YA 4OJQA 2V7QD 3K70C 3N2IA 3U3KA 2WIBA 4O0MA 4KV9A 2DFKB 2WMNB 1W36D 4L4UA 2VP5A 3OEHD 4KBFA 1T4GA 4LSGA 1NG1A 1NLYA 4TN1A 4BRWA 3O8BA 5CB8A 3NHAA 1OXVA 3EZ7A 1D6JA 1Z0JA 2BCGY 4MH0R 4TMXA 4ZDIA 4PSAA 3KJHA 1MKYA 5F3WB 2CNWD 4GP6A 1YZUA 1R0WA 4KYUA 1RYHA 3HU1A 3UG6A 2IYLD 2IYVA 4E03A 2VQSA 1S96A 3NXSA 2GXUA 4PHHA 2ZIAA 3SC3A 2O8EB 1JQJC 2R6CA 3RRYA 2IUTA 1U81A 2FU5C 1F2TA 3C15C 3DMNA 1FQJA 3DZDA 3RSOA 1Z0AA 2FFAA 1QHXA 2CLSA 2OFOA 3IQWA 4YC7A 3DHWC 1XX6A 2HJGA 3QKUA 3Q3JB 4IDQA 4HAVA 2DWQA 3R8CA 4W9MC 4M9QA 4WZ6A 1GTVA 4BGDA 2YWHA 3PR1A 3AVVA 1EWRA 4DVGA 1N5LA 2A5FA 1OIVA 3KUCA 1XXHE 1TF2A 2WVJA 4XJXA 3IEVA 2HCJB 2J0VA 1GRRA 4Q7KA 2IHYA 4BUJA 1ZUHA 4KHZA 3ADDA 4BFZA 2J0SA 2PLFA 4EQ6A 2CK3A 2FZLA 4IFEA 2IYYA 2J3EA 3QXCA 4QKQA 2YC4C 1PLJA 4TLDA 2CCGA 3AF1A 3AP3A 2QAGB 3MMPA 4JSTA 1XNJA 3SFVA 4OI1A 3PENA 3TE6A 3Q72A 1AJEA 2NG1A 5EQTA 1W5SA 4ARZA 3TUIC 2X2EA 2WICA 2WM9B 4LHYA 1MO4A 421PA 2YWEA 1Z0FA 3AGPA 3SJAA 2OO7A 3WRXC 3QNUA 4H9GA 1HTWA 2QP4A 2C96A 2REBA 4YMWA 3TSZA 4MRPA 1KAGA 3K70D 3HR8A 1ZM9A 2CJWA 5EXTA 3CNOA 4JJZA 5HR5A 2EFDB 3IUYA 1DARA 2Q0HA 4PO8A 3PQCA 3SFZA 5JEEA 1FP7A 1KO4A 4II7A 1UKZA 1YHNA 3D8BA 4Q1DA 3R9IA 3TQFA 1E1RD 4I1UA 4LZZA 2JIZA 4DCSA 4RY2A 3U60B 4PHGA 1T5LA 3ZIAD 3DPUA 1IN6A 3O47A 4ACBA 3MWKA 4PC2A 3D6TB 3THYA 1U0HC 3UANA 1AS0A 3KQHA 2ONJA 3B60A 5DH9A 3F5FA 1J8MF 3P4XA 4FMBB 4IVPA 4M1WA 4M53A 4TTQA 5C1BA 5UKDA 3WMFA 1P2SA 2XTMA 1VYTA 1M34E 4EJSC 4DXAA 4QBIA 4EKDA 2PEYA 4TL6A 4A6PA 4RD4A 3BERA 1KMHB 1OE0A 2ZI4A 2ZS9A 3RS5A 3T1OA 3GFTA 2QY9A 4NZYA 1SXJA 1CJTC 2E87A 3PEUA 4IEEA 3AVQA 2DFLA 2JLSA 2QNRA 4NYMR 2KB0A 2NIPA 4PC1A 1SXJE 4PO9A 3QSYA 2Q9BA 2H7VA 2G88A 2X8AA 4D81A 1ZUNB 2O8EA 2XGJA 5CDFA 4M4SA 4TYQA 2GNOA 1KDPA 2WWIA 4ZI2A 1W4CA 1JB1A 2YYZA 2ZUDA 3EWAA 5CDFE 3NEJA 4A8JB 3FFAA 3RVBA 2XOKA 3CKLA 4A1FA 2VHQA 5JMTA 3GLIE 4DIEA 3ZYCA 2ASEA 3OAAD 4P32A 2GCPA 5DYIA 2QORA 2BJVA 2JLUA 3W6PA 2XZOA 4HB0A 1XJCA 2VHUA 3AF3A 3U6KA 2WWFA 1ZNXA 2FX3A 4TMTA 621PA 3LWNA 2CCKA 1MABB 4LGMA 4PAOA 3V00A 5FL7A 1CJMA 3FTQA 2PH1A 4ZIRB 2XSZA 5E7MA 4ACAA 2ZRDA 4AKHA 3SNHA 2GHIA 3QUSA 1P72A 1R4AA 2QAGA 2QQ0A 2R6AA 3QEJA 4XVUA 1GVNB 4MQBA 2O5VA 4MRSA 5EE3A 4HDCA 1L8QA 2V3CC 1G19A 2NOAA 3VNVA 3U3JA 4V0LA 3GPLA 3CR7A 1DADA 2X1VA 1P2UA 2NQ2C 1N6KA 2ANBA 3WYGA 1N6HA 1WRBA 3AP1A 3GJ5A 3D7MA 1MRNA 5LBIA 3TSOA 2ZRFA 2IA5A 4HSEA 1MRSA 1LB1B 1LTQA 1AM4D 1Z5ZA 3KJGA 2J87A 2F1RA 2VP9A 4F4CA 1Z6YA 1E0AA 1M6NA 2GCOB 5M04A 4PTLA 2FMXA 4D82A 3OFNA 2FG5A 1BS1A 3A8TA 4NKRA 1E79A 4BZXA 1COWA 1VCOA 1W1WA 4URYR 8OHMA 4FMCB 1N25A 4LX0A 1PUIA 1KMQA 2VO1A 2J9RA 3B2EA 4KYIB 5LDDC 2D2EA 4TQAA 1FMJA 4GZLA 4Q7LA 1XCMA 4Q9KA 1Q21A 2PEZA 1W47A 3A4MA 3HU3A 3SBEA 3BH7A 4IHQA 3NIBA 4OHYA 4F4IA 3NBFA 1VMAA 5AJZA 1NNEA 2QPOA 3OIYA 4J0QA 3EPJA 1QBKC 1KY2A 1KO1A 4JL6A 4TZ0A 5LD2C 3BC1A 1N6IA 4EPXA 3EXAA 1GL9B 4PPFA 1KMHA 2ZR9A 4KXFB 5C18A 1KNXA 1UBEA 5EE9A 1DBSA 2A78A 4D4KA 2AKAB 4BE7B 2PZFA 1E2PA 1Z07A 2GAOA 1G8GA 2WKRA 2R2AA 4FCVA 2JLRA 3RC3A 1XMJA 4E07A 1HE1C 4FCTA 2OBNA 4EIWA 3THXA 2CMKA 3M1IA 3WY9A 3BJIC 3PUVA 4L5BA 3K0CA 2WAYA 1RKBA 2XNDD 4IDOA 2XJ9A 1CXZA 1E69A 3MUFA 2XXAB 3ASYA 3KJEA 4JLDA 4D80A 4A8JA 5AJYA 3KQKA 2ZSBA 1AZSC 1QG4A 1II0A 2GZHA 3NH6A 4Q1AA 4QL3A 2O8CB 1D2EA 3VKGA 4ERNA 2F9LA 3FHCB 5TY0A 1ZM4A 4MRVA 1H8HA 4C0HA 1XTJA 3ZD7A 5KSPA 1G8FA 2P2LA 1UBCA 2HT1A 1DG1G 1Q3HA 5AJWA 1W2HA 2QT0A 2A9KA 5HPYB 1CR2A 1E9BA 4DLRA 4ILEA 5CB6A 3MAAC 2JAQA 4NPHA 5DI3B 2YOHA 3I62A 2NO9A 4PR0A 3L8ZA 3RRMA 3SEAA 1IXZA 2VHJA 3PUWA 1Q3TA 2GEDA 1GL7A 4QRHA 5SZIA 4PSKA 2V1UA 1UM8A 1QHSA 2D62A 4TMWA 3SI7A 3KXKA 3W6NA 4KBGA 3ZS8A 5FPKA 2ZITA 3ECCA 2CVFA 3EASA 2DBYA 3LBIA 4D6PA 2ZAMA 4DCTA 4L8GA 2X77A 5AJXA 1I4DD 4B48A 3C4JA 3IQXA 2CCJA 2WAXA 2AFHE 4CEIB 2C9CA 3BRWD 5EE0A 3FYHA 3KQLA 2GCOA 1G41A 2WV9A 1NN5A 2ERXA 1TUEA 1KKLA 1P60A 4B32A 3NDPA 5BN3A 1IBRA 4C9BA 3CR8A 4LHWA 2G6BA 4QHYA 2IF2A 2A5GA 1UDWA 2FFBA 4PQYA 4G5QA 4AG6A 3UKDA 3Q7PA 821PA 4M2LA 1WF3A 1AZTA 3I5YA 1E9FA 4GOXA 4WOPA 2FPKA 4KJZA 2YWGA 3AVXA 2QMEA 4FXPA 4EFLA 4B3DA 2IYQA 4MKHA 1EFHA 1KAOA 2CHVA 4K8OA 1VPLA 3FFBA 3EWSA 3LVRE 1F48A 4QBHA 3A1WA 2CXXA 1F3OA 2JDIA 3JVVA 3M6AA 3OEEA 4WAUA 4GMDA 1P6XA 1NVVQ 1GM5A 3VR6A 2FOLA 1SVOA 2XB4A 1AKEA 4LJAA 2CL7X 5GJWC 3VR4A 1WQ1R 4JBWA 1U9IA 4FN5A 2EQBA 3H4MA 5J4YA 4PAQA 2RGBA 3DMDA 4V0ME 2OLKA 1RFLA 3AF4A 2AD1A 2V6IA 3RNLA 1DAHA 5CYOA 4FWTA 2BKEA 4M1YA 2ZYUX 3QVVA 3A1TA 3CH5A 4X8MA 3FMFA 4Q9IA 2WJYA 1GNPA 4M0LA 5JFGA 4DSNA 1YU9A 5DHAA 2WBLC 5EP1A 3I3SR 5FOXA 4AURA 2QZ4A 2VH5R 2ZRGA 2X19A 3AF0A 5FR1A 4ESHA 1HQYE 2CLDX 4M1KA 1OH8A 4ESVA 1L4YA 5IRCD 1S4QA 4RZUA 3BFKA 4C7OB 1DO0A 4C0JA 5DI3A 1G5TA 2B6HA 2ZR0A 4O25A 4ZCMA 2ZROA 1E0KA 4XTCS 3T15A 2F3RA 2FNAA 4P4UA 2ODBA 2V4ZA 2KI5A 3E70C 4JIMA 4DUGD 5JWOA 1JJ7A 1LV7A 2NZ8A 5D3MB 5KNBA 3WNCA 3CX7A 3C16C 4DT1B 3CZPA 3E1SA 2QAGC 4JLOA 2RGDA 5JCPA 4UJ5A 3QKTA 4D0NA 2XEXA 2B8TA 3ZZUA 2GTPA 2JA1A 1DPFA 3NC0C 4O2LA 2CL6X 3B1XA 3SS8A 1HURA 1PVOA 2EFEB 4Q02A 2PZGA 4A82A 1CRPA 1NSFA 4TSFD 4NYMQ 3REGA 4Q18A 2R6GA 4E5UA 2C8VA 5JJLA 3ZQJA 4O2RA 4NE2A 2CBZA 4YDSA 1QHNA 4K46A 5EZ6B 5JS8A 1TPZA 5D3QA 4RZ3A 3JZMA 1SVLA 3TK1A 1D5CA 1WE2A 3CH4B 3QBTA 2LKCA 4QGHA 4I1SA 4A2QA 1XB2A 1JQLB 5ANRB 5J4VA 3U4QB 2OE2A 5A0FA 2F55A 3ZGXA 2FWRA 1NN0A 4NH0A 1E2FA 2VHTA 2ZJOA 3B7GA 4QXAA 4YONB 5FR2A 3D31A 1WB9A 3LQRA 5JI2E 3Q8XB 4R7ZA 4FCWA 1NMYA 1HA3A 4GMXA 3KQUA 3LNCA 4U5XA 1L4UA 2QP3A 1OYWA 2BHRA 1CKEA 1Q57A 1OFUX 1TMKA 3IBGA 2RGEA 1WBBA 1JXMA 3S1AB 1TTTA 2ZRKA 3EAQA 3G0HA 5GVRA 4QGFA 4QC2A 3H1TA 2FEMA 1NN3A 1NLZA 2FFHA 2OXCA 2ZE7A 3K0CC 4IDPA 4QNMA 1WMSA 2FFQA 2H92A 3KKNA 4P33A 2RGNA 4WXPA 2F9MA 3KFVA 5BW8A 1W0JD 4Q48A 3AKEA 4WW0A 3EA5A 4A8JC 1EFTA 4ZKEA 5HE9A 3DOFA 3HPQA 3IIKA 3OIWA 2EW1A 4LPKA 3FMIA 5FL7D 1OH6A 2KE5A 2FA9A 2RB4A 1KNQA 2ZU6A 5EXPA 4NP6A 4NDZA 4EPWA 3CRMA 1N6LA 5JLJA 1DAFA 3UMFA 1D2MA 2ZI3A 5G3ZA 2E9SA 3WYFA 4C7OA 1NBMA 1OYYA 3CIOA 1QF9A 2OAP1 3X1YA 2RGGA 2IS1A 4L9WA 4UXIA 3BORA 1HYQA 3B1WA 3O8CA 3QXSA 1EFCA 1IOZA 2QMUA 2F7SA 2ZR7A 5D3MA 3RS2A 4W7SA 4DT1A 3OIUA 1W49A 2BBWA 1OKKA 4C2UA 3U3MA 1E2LA 1E2MA 3QOFA 2DFTA 3GJXC 1NJGA 3A4LA 4LJ4A 5HE8A 5GADl 1BYIA 2GAAA 2UZIR 1ZVQA 2IYUA 1G21E 1BOFA 1KZ7B 4PANA 4Q4JB 3VAAA 3W9YA 4B2LA 3TR5A 2YV5A 3NG1A 4IOMA 4X8HA 2JLZA 4PO1A 2QA5A 2QP9X 3PEWA 2G83A 4DC9A 1Z6TA 3KKOA 3TUZC 1KDRA 5TDHA 3I92A 3AKCA 3LAWA 1J99A 3DO6A 4CVNA 1FNNA 4D4MA 2D7DA 1N5KA 1E2NA 3M0EA 1OIXA 5DO9A 4G01B 3UWOA 1GAJA 1NKSA 1XP8A 4N1AA 5C4GB 4C4PA 2HF8A 3W3AA 1XXHB 4XH9B 3HJNA 4BFYA 3G82C 4KVGA 2TMKA 1EWQA 1W0KD 4HAYA 4XD7A 4XSGA 1PUJA 1YZGA 1Z08A 2VRWA 4PXAA 2OAQ1 4OJKA 4OL0A 1JBKA 4R9UC 3C14C 2B7CA 3MG9A 2XZLA 1OPXA 1U8AA 4H1UA 1BMFA 1SGWA 1IN5A 4AKGA 1E4YA 1G7CA 4S2EA 1QRAA 5L3RA 1CBUA 1GDDA 1GITA 4Q66C 4UJ3A 2FV8A 3BAFA 5BN5A 4TZ6A 3W3ZB 5CYPA 3NKVA 4HB4A 4Q03A 4RKFA 3RAPR 3X2SA 5FBWB 1YVDA 3AVOA 2J7PD 4LYFA 4BECA 3MLEA 3L2OB 5FTJA 2C77A 3S1AA 1IONA 1TQ2A 3LBHA 4Q4HB 4KODA 5EUQB 3ZVMA 1LS1A 3EZ6A 2WSSA 4JL5A 4NHOA 4NCJA 2C9OA 1CP2A 4HLUA 2CJWB 3MJRA 1KK2A 2D7CA 2GZDA 3A6PC 2HLDD 1NJFA 3U3OA 4Q1EA 2NGRA 1SULA 2W58A 1X6VA 3KKQA 2YINC 1X86B 3WP1B 1W2GA 4GRAA 2IK8A 4QJ3A 3BFVA 4B3GA 3KUDA 4LJYA 4U7DA 2AXNA 2NZJA 1XJ0A 1E32A 1P73A 1QVAA 3CRQA 3K9LA 3CF6R 3BFXA 3THYB 1E2QA 1IY0A 1OXUA 3REFA 5HKKD 4WBSA 3GJ3A 2AX4A 3BH6A 1I2MA 1X8KA 1E96A 4IJMA 221PA 1A2BA 3WMGA 4QGAA 1CJKC 3FPAA 1UBGA 4PHFA 1G18A 3ONWA 3BIFA 4LHZA 4F93B 4TYWA 1SXJB 1ZIOA 3B1YA 2YNMA 4B3FX 2J45A 3U61B 4OHZA 2ZSAA 2ODWA 1G8HA 2YZ2A 4PPQA 4Q4JA 4ZPXA 5A4JA 5G53C 4BLOA 2ZRNA 2N42A 2ZE8A 3VR3A 1P2VA 4ASUD 5JEDA 4LJ7A 4V02A 3AVWA 4CT4B 2W2TA 4IKEA 3X1XA 4DZZA 1UBFA 2IBMA 2C2HA 1JJVA 1N6RA 1TU4A 1XD9A 2VPPA 5IK2D 4MYHA 3WMEA 2HXSA 2GJKA 3CZQA 3GLIB 2BEKA 5HZHA 1KI8A 1LW7A 1JR3D 4HATA 1HE8B 1RJ9A 3DEFA 4OBEA 2GESA 3ZH9B 3LBNA 3VNUA 1NVXQ 1XXHA 4JLPA 1PJRA 3B5JA 2B21A 3N70A 1E9DA 2BOVA 1NVVR 2PX3A 3NC1C 1VIAA 2W6JA 4I99A 4JJKA 3U3RA 2R9VA 4IDNA 1W4RA 4M1MA 3WP0A 4WZBE 2BMFA 5EZ5A 1E99A 4B6FA 3NVAA 3AGQA 3BOSA 1G7SA 5KYKA 2P3SA 4A0HA 2DB3A 3NEYA 4NL4H 3J81k 4Q1BA 3DVLA 1P9RA 4CW7A 1OH7A 3H0KA 4CGZA 1N2CE 3UXMA 1E1QA 1AQYA 3AVPA 2VLIA 2IYSA 5KPJA 1OHHD 2IYWA 3DDCA 5JI3E 1ZUIA 4NYIR 4HAUA 5DYGA 1MOZA 2PJRA 1S3GA 5IF9A 2BC9A 4RD0A 3QXHA 3K9NA 3HPRA 2HV8A 1V5WA 4Q4HA 1NMXA 2O8BB 5FTMA 4LUCA 4TL8A 1EX6A 1YZLA 1I4LD 1XZQA 1G4UR 4DLXA 1YZTA 3RS4A 1JPJA 5FOUA 1L2TA 4RD1A 1Z06A 2B92A 2B7BA 2A2ZA 4JS0A 5G41A 1VHTA 2VYFA 1C1YA 4Q9LA 3QKSA 4Z8YA 1ZRHA 1T0HB 2WJIA 2DHRA 1FQKA 2IW3A 2UVQA 5JJIA 1MR3F 5EXSA 1NKTA 1QHIA 1G5PA 5CJ2A 5EXXA 2C5LA 1YR6A 1QHHA 1X1RA 5E95A 4B34A 1J8YF 3P20A 1JAHA 3LW8A 5JCZA 1KSHA 2EFCB 1G17A 1AN0A 3F3YA 1XBTA 2JLVA 1NSTA 2W6IA 1XF9A 4V0KA 1TU3A 4C30A 3X1ZA 5KU1A 2IS4A 4JLJA 1WBDA 3IKJA 3BH0A 4XIGS 2QL6A 4Q9JA 1YRBA 3TR0A 3ZVRA 4O3MA 1E2KA 4IFBA 1YQTA 3DM9B 1G7RA 4WVFA 3LVQE 2IYRA 3ZQ6A 2ZVQX 4IVQA 1G8PA 1UADA 3PJRA 2OT3B 3GJ8A 2IHBA 3P1JA 1T3LA 1LY1A 5DN6A 2AFIE 3ZZ0A 3THXB 1AKYA 1G20E 1KJZA 2A5YB 1ZBDA 4MGZR 4AY2A 4ZV4A 4TT3D 5AR1A 2IL1A 1EXMA 1FL9A 4D25A 3GLIA 5FBRB 3TVTA 1ZNWA 2GBLC 3W5IA 3NBXX 4HYYA 4AKEA 3U5ZB 3UMSA 2VP4A 2VF7A 4A36A 3FE2A 3K1JA 1GP2A 1CEEA 1KI9A 3MJHA 3Q7QA 1E2HA 4JVMA 4XOIA 5BQ5A 3UIEA 5KSOA 4HAZA 2O0HA 4KI0A 2EYQA 1MT0A 3GFPA 1TL7C 4TLAA 2P5TB 2AHOA 4N0EA 2H1LA 4D26A 3EZFA 4R2IA 2QTVB 2W0MA 3K0FB 1H8ED 2HXYA 2WZQA 5E7JA 1ODFA 1DELA 2O8DB 3IPXA 1X3SA 1AK2A 3QENA 2ZUBA 4Q4LA 2ZJYA 1OLOA 5E7IA 4M8NE 1R0ZA 2QTHA 2XB2A 4M9SA 3TQCA 2O8FB 4JMPA 1D2NA 3P4YA 1Q1ZA 3LY5A 4HDQB 4GOJA 3OE7A 1KDTA 2VSFA 4B43A 1GNQA 4AK9A 3WNDA 2UKDA 2Z4SA 1AIPA 1S9DA 1S8FA 1YR8A 2JJ1A 3FKSA 2QM7A 4BLPA 2O8BA 1SZPA 3GD7A 4B47A 1PLKA 1AS3A 3B78A 1CS4C 2FE4A 2BM1A 3EPHA 2SHKA 1FTSA 1GL6A 2CDNA 5DNYB 2ODNA 5G3YA 3C5CA 3KXIA 1YR9A 1O3YA 4LJ5A 2CHQA 721PA 4DLSA 4OHVA 1ZD8A 3T35A 1YZNA 4MKFA 4D4LA 1J90A 2JCSA 3I8XA 4BLSA 5F2EA 1S1CA 5AK0A 4LI0A 2PT7A 4M9XA 5H68A 4AKIA 1KK1A 2JLQA 1SVSA 2I1VB 1EFRA 4DLVA 2JATA 2BJWA 1M2OB 3MFYA 4PC3A 1XTIA 3EW9A 5KO2A 1OKKD 3PG5A 1W7AA 2QAJA 1MH1A 2ZSDA 4TL7A 2J7KA 4FWIB 3GEHA 1R0XA 2G1JA 1KTVA 4JKIA 2RH5A 3CNNA 2XNSA 1RIFA 5FUXA 3I1FA 2GK6A 1DAMA 1XJQA 1WA5A 3L0OA 2HCBA 4TL9A 4PZYA 1UF9A 1W4BA 1RRGA 1ESMA 3LD9A 3LLUA 5KSYA 1UAAA 3I4LA 3LX8A 4Q19A 2FDCA 2LWIA 2MMCA 3IILA 3GLHA 1NVUQ 2QQEA 4BLRA 1KI2A 1U0LA 2MMGA 1ZAKA 3KKMA 4LV8B 5KPDA 1LFDB 3GCGA 3GLHE 4GFDA 1G3UA 3I72A 2FSHA 4IXMA 4FINA 1GOTA 2QPTA 4MA4A 4P4TA 2J1LA 4RFSB 4Z8XA 3GFOA 1XCPA 4DEXA 1F60A 3BB1A 4XWOA 1P75A 4POAA 3I8SA 5E3HA 3KZ1E 4B35A 4EPVA 4LYAA 4A0FA 1KY3A 1E0SA 3VMFA 2H17A 2ZI5A 2CHGA 1M7BA 2QE7A 1G6OA 3H86A 2QT1A 2ZRAA 2Q3FA 2VBCA 3Q5EA 5C46F 4BFWA 3TLXA 2ODEA 4GP7A 3K0FA 4LOAA 1P62B 1VG8A 2ZE5A 2XX3A 1DAKA 4OHWA 2O8DA 3LXRA 4Z1MA 1DOAA 3F8TA 5BYJA 2JJ2D 5FPTA 1EK0A 2WTUA 2NO6A 3SHWA 4ABYA 3LDAA 4JLVA 2O8FA 2GVZC 1JALA 2CE2X 2FSIA 2QG6A 4XWKA 3LQQA 1UDXA 2VP6A 1CRQA 2IYXA 4UXHA 4WZAE 4W5HA 4OI0A 1JPNA 1KI3A 1M8PA 1SVWA 1DG3A 3MWJA 2OFXA 4ON9A 3W8RA 2H8KA 3VU9A 1JEDA 2O52A 4WIAA 5LB2A 5BYKA 2IWRA 1TQ6A 1ZP6A 4GBMA 4BWYA 3GJ7A 1NIPA 4YMVA 3KJIA 2XTNA 3GLGA 2WPDD 1LNZA 1QHYA 1RPZA 1R5NA 1ZM2A 3W90A 3MGCA 3OEHA 4DCVA 3GLGE 4BFVA 1Z3IX 4ZO4A 3RDPA 2FPLA 3LV8A 3WXMA 2ZM5A 3AQ4A 5EP3A 5KHOC 4Q1FA 4BFXA 2CNWA 3L43A 3L8YA 3QG1A 3QPWA 1IN4A 3H84A 4TLEA 5K8TA 3B9PA 1W5TA 4UNSA 4EUNA 3PITA 2PMKA 4I1OA 2AWOA 3IDQA 2R44A 4AC9A 1J2JA 5B64A 1XCGB 4QJ5A 4BQSA 1OSNA 2HEIA 3FDIA 2HF9A 2OM2A 3C7KA 2BMJA 1S1MA 2CL0X 4DSUA 1JNYA 4LBYA 3KDSE 2J46A 3GLFA 1GIAA 4FD2A 3SYKA 2JGNA 3MWLA 2VA8A 1U8YA 2OCPA 1YKSA 3DKVA 3RWMB 5GJCA 4DJTA 4V0MA 1DO2A 4CDGA 2H57A 3GLFE 4P0TA 4RD6A 4OK5A 4BASA 4B73A 4PSVA 1Z8FA 1KOFA 3IGFA 4RJLA 2ANCA 1IXRC 1TF7A 5C4MA 1SXJC 4KFRA 1EX7A 2AL7A 1JR3E 5J40A 4MUBA 4YQFA 1G64A 4PQFA 1ZMXA 1Q44A 3SBDA 1XWIA 1UEIA 3AKYA 2C99A 3B85A 1GKIA 3EPKA 1FOEB 1XTSA 4NYIQ 1KJWA 1E9EA 3WBJA 4B76A 3CF2A 4TTPA 2G77B 4RFSA 3X1DA 1RRCA 1G7TA 2Q21A 2ERYA 3P26A 2GCNA 1RW4A 4F91B 1XEFA 4HB2A 3TVDA 1Y63A 2F1JA 2ZI6A 3JZAA 1WCV1 2CK3D 1HQCA 1NIJA 2BBTA 3UPUA 2OBLA 4RSGA 4MKGA 1IN7A 3ND9A 1VG9B 2PZEA 2F1IA 3CRRA 4IVRA 4LJ6A 3HP1A 4B33A 4RZXA 4LBVA 4OK3A 2XZPA 3FHTA 1XTQA 2HYDA 2WSMA 2C78A 4AI6A 3QPVA 3A37A 3C8UA 2HT6A 3K09A 5DISB 5H8WA 1IQPA 1NVWQ 2HYIC 2KBFA 3AUYA 2WOOA 1PV4A 3AH8A 3RANA 2V54A 3K9HA 1G4AE 3VFDA 2ZVPX 4QHSA 3A1SA 4TQUS 4DCNA 4Q1CA 5CLQA 4MYTA 3EPLA 1E1RA 1R2QA 4PC6A 2FGKA 3BK7A 1UJ2A 5TVKA 4HUTA 4D4JA 2JASA 2G3YA 5JSZB 1FFHA 3ZIAA 4B2PA 1FMLA 2R65A 4IEIA 1J70A 1G3IA 4Q7MB 4QOSA 2WJGA 3AP2A 3L0SA 2JIZD 4A2WA 1LS6A 1XEWX 2WOJA 3NBZC 3OF5A 5JRJA 2P65A 3FOZA 1E98A 3QF4B 1IY2A 2IT1A 1Z63A 2ORIA 1N6PA 3U7FB 4HAWA 5FOVA 4BRUA 5AUOB 4A15A 4GI7A 1YZQA 1U2RA 2ZREA 3CW2A 3GEEA 5JWRA 1OFTA 2W00A 5L3VA 4MRNA 5FTNA 4FI3C 2ZTSA 1CLUA 3OIVA 3K0AB 2IEYA 4TQ9A 1P3JA 2P6NA 1SXJD 1CR4A 2GILA 2IS2A 1A5TA 4GSYA 1IY1A 4Z54A 2CVHA 2QRNA 2KBEA 2O0JA 1U98A 2GEUA 2ZRHA 4IRUB 4EPYA 1VECA 2IUUA 2W0SA 1ESNA 4XVQA 2QU8A 5JECA 1LF5A 1E9RA 1T91A 2O0KA 3A36A 4LPSA 3ZD6A 1MO6A 5DIFA 3OAAA 3G5UA 4LHVA 3MWYW 5HTKA 1FX0A 1OJLA 1ETUA 4TLCA 1A1VA 4HLCA 3AF2A 1FTNA 1KSJA 1QHGA 2XOKD 1NY5A 1EG7A 1BIFA 3CX6A 1GKYA 4RCZA 3I73A 1E2DA 3NDBB 2PJZA 2ZANA 1Z47A 3UG7A 5F98A 3LO5A 1RE0A 4KVAA 4M1SA 5DSZA 2ZRJA 5L3QB 3ADKA 1ZW6A 3CPJB 4E09A 3SYLA 2CLCX 1SKQA 2W2VA 1Q1EA 3O8DA 3ZLJA 4MRRA 5BXQC 5BN4A 5GJVC 4C0BA 1M7HA 1M7GA 4KAXA 2XSZD 3AKDA 3JVUA 1VHLA 4ZDWA 3HYTA 3OZXA 2F3TA 1SKYB 1DE0A 3TSWA 2Z0MA 1ZM7A 2AR7A 3A1UA 2VTKA 3OE7D 1II8B 4KSCA 4ZCLA 1I2DA 4URXR 2CE7A 5B30A 3B1VA 2GDJA 2BMEA 2QENA 3FKSD 2B8WA 4YLGA 2AN9A 2YHSA 4C3ZA 4U02A 2ECKA 3K0EA 3PIRA 5IT5A 2YJTD 3TH5A 4JVSB 1GUAA 3SZRA 3PEYA 4EJSA 3OFND 4JLBA 5CIWA 5JSZA 4OHXA 1H65A 4F92B 1XRJA 2ZJ2A 2ONKA 4UQOA 1E79D 4DLWA 4HLDA 3FVQA 4ZDJA 1COWD 2JEOA 2VP0A 2D74A 3KX2A 3GQBA 1Y3AA 3QEOA 5EP4A 3SN6A 4CIDA 1K8RA 3RC8A 3VHXA 4LV5B 1Z0IA 3QF4A 3VX3A 5EJEA 4MKIA 2QBYB 1RJ9B 4HZUB 5K8LA 4TYPA 2R8RA 4W5WA 3ADBA 4URZR 2IXFA 2BIFA 5FUYA 2IUSA 3U7EB 5IHPA 4V0NA 1SQ5A 3EC2A 3PXGA 3MSXA 5JWHA 1E2IA 3K0AA 4C0SA 2Z83A 1Q0UA 3W6OA 3ASZA 1XPUA 2XNDA 1U8ZA 1QDEA 2VSXA 3B8HA 3TMKA 5JBQA 1Z6GA 1KO7A 4QM7A 4LC0A 4TYYA 4KFTA 3SU8A 2GJSA 5KTYA 3M4YA 3U44A 1RYFA 4QNRA 2WWGA 1Q1BA 2HDNB 2PT5A 5CK4A 3K0SA 1VG0B 1GILA 4GL2A 3QXXA 2KWIA 2R6FA 5CM9C 2YOGA 5KUTA 3CRVA 1R5OA 3KL4A 4LBWA 4PQRA 4DKXA 2K5UA 1U9IC 1EGAA 2G1KA 4HB3A 4Q7JB 3LH5A 1TF5A 4LK2A 4LJ8A 4L9SA 2FH5B 1T3HA 4MYCA 1XMIA 5DHFA 4A6XA 3EG5A 2ZJAA 1IJFA 2ZJ8A 3QKRB 5SZKB 2Q9AA 5L3QA 1H8HD 4F4JA 4S35A 2R62A 4EAQA 3OHMA 1O87A 4JYBA 3ICEA 3QKSB 4M1TA 4XTRA 3N2EA 4UNNA 3THOA 3WHKA 1FP6A 3LW7A 1MO5A 2EWWA 4OI4A 2X2FA 4L15A 4PX9A 2AXPA 4Z1MD 1ZJ6A 5FTLA 1JI0A 4GT1A 2WJJA 1GNRA 4G5OA 1W4AA 2ZRIA 1QHHB 3L82B 4LCBA 3HU2A 2G0NA 4JSYA 4X8OA 2RCNA 1SKYE 1UPTA 2I3BA 2OV2A 2C95A 2ZRCA 5HCNA 4OQFA 2OCBA 2AK2A 1II8A 2WJVA 2BWJA 4JLMA 1XMSA 4US0R 2AWNA 5CITA 4B44A 5KNCA 4LHXA 1JECA 4BFSA 4GZMA 2DWPA 2GZAA 1C9KA 2ZS8A 1D8TA 1A7JA 1XEWY 5FPHA 1A2KC 1YE8A 3RHFA 3U7GA 3W8NA 3BGWA 1OT3A 1CR0A 2RKOA 4TMVA 4XSHA 4F7WA 2OCAA 1G3MA 3VX4A 4M9ZA 1ZNZA 4P3YA 1E9AA 4RKEA 5TARA 2XITA 4ZDKA 4TWZA 2BV3A 2H18A 4ZCIA 2KJQA 4Y0VA 2OZEA 4NBSA 1G1MA 1Z2CA 4B75A 1KI7A 1E9SA 1JXOA 1MO3A 3AB3A 2J0UB 4LDJA 1OXXK 1P9WA 4WA7A 3RRZA 3ZJYA 5HZKA 2QBYA 4DBLC 2FGJA 3GP8A 4HZUA 4LJ9A 4NTZA 1T6NA 2RMKA 3CNLA 1U0JA 4G5RA 1UFQA 2QMHA 5AUPB 1XD8A 4DDTA 2YC2C 1TNDA 3GJ6A 3HWSA 3AM1A 4BFTA 2EYUA 2JDID 4BLQA 3OEED 1WP9A 2BBOA 1I4TD 5JHHB 4UNRA 2Q3HA 4OK6A 4LYJA 4A4DA 4QG7A 3SHFA 1KSGA 2WWXA 4FIDA 3SYNA 3T34A 121PA 3TW8B 4XWAA 3KQNA 3SJZA 2V8OA 2QMOA 4JT2A 5KDOA 4A92A 2V9PA 4OQLA 4RZ2A 4RFVA 6Q21A 2GKSA 2QSZA 3MRSA 4H1VA 5E4FA 2GWHA 2EU8A 2YOFA 3UATA 4Q00A 1M74A 1T0JB 1AS2A 3E5HA 4QBFA 3P32A 3AEZA 3TRFA 1OB2A 4LC1A 2PBRA 2C98A 3NTUA 4JVLA 3T61A 1IM2A 3QKRA 1NF3A 1KK0A 1ZINA 1N6NA 4CT5A 3TIFA 2F43B 4B3XA 3RSLA 1OW3B 1W46A 3SQWA 3LRPA 4Z51A 4PC7A 4FMDF 4A2PA 1T9HA 4IOJA 4DUGA 2QPAA 2RGNC 4LBZA 2QSYA 1OFIA 1R10A 4FMDB 2Y8EA 4AYTA 4URWR 5EE5B 2IC5A 4OKSA 5FUVA 2ZI9A 1FUUA 1LVGA 1SVMA 5FOSA 3SE0A 3AVYA 3DZ8A 3FHOA 2G0TA 3VQTA 2NO7A 2IYZA 1P61B 5J5CA 1F5NA 4UXJA 3TKLA 2OILA 4YMSA 3PUZA 4TSFA 5J4KA 1F2UB 1F6BA 2IX3A 4DDUA 1VYVA 1BYUA 1US8B 4C0LA 1G6HA 3VHLB 1B0UA 2QI9C 1KSFX 3PV0A 4X8LA 3T5GA 1CR1A 2ZJBA 1GG2A 4MGYR 2VIIA 1G5RA 3GEIA 1Z6XA 1EFUA 2ZRPA 1ZM3A 4DLTA 2ZYWX 3O8RA 3CWQA 4EFMA 4W5JA 3GLHB 4DWJA 1Z29A 2ZI7A 1Q22A 3K9GA 5JRZA 5BWMA 1KO8A 5FTKA 2FN4A 3EC1A 4AD8A 5AUQA 1KHTA 2XAUA 2ZS7A 3Q9LA 2JLXA 2L0XA 3CRW1 4I1VA 2YVUA 2ORWA 3Q5DA 2E1RA 5FPYA 2J0UA 2WWWA 4OQNA 1OH5A 1KK3A 3DM5A 3T1TA 3QXJA 5FBVB 5J4LA 2H16A 2VL7A 2WWHA 1E2EA 5EE1A 4DSOA 1Q20A 1HUQA 1E6CA 4HI0E 3IHWA 2I1QA 3QBVA 5CIQA 4BZPA 3IHLA 2J5XA 3U2QA 1V43A 2OXRA 4NYJR 4NMMA 3BWDD 3FWYA 5J4HA 4KITB 3IO3A 4TLBA 5KNDA 5FL3A 2W83A 4YXWA 4Q21A 4OQMA 3ZVLA 4NCIA 1OB5A 4PHTA 4KSBA 4I81A 1PZNA 2RGXA 4V03A 4YMTA 1W0JA 3ND8A 1NMZA 1Z0KA 3TJZA 3IIMA 3CB4A 4EFNA 1DTSA 3Q85A 1NN1A 1HY3A 2EFGA 2ZEJA 3VU9B 4IW3B 2YWFA 1KYIA 3BE4A 3WNBA 4ZI3A 4DDVA 1KI1A 3B13B 2F43A 1Z22A 5B57C 2C03A 2KSQA 521PA 1TADA 4CYMA 3GLGB 2GEVA 5B2ZA 3QJYA 1W36B 4NCHA 4PZZA 3CWZA 4CEJB 3LA6A 4HLUC 5AWFC 3QQ5A 4OYHA 2W2XA 1KI6B 1XTKA 1NBMD 3GMTA 3C41J 3R7WB 2YKGA 5LPNA 3VR2A 2PLRA 4GOKA 4U00A 4MUAA 1FUKA 1RVDA 1P9NA 2N46A 2QGNA 1Q12A 4EPRA 1R8SA 3L0PA 4P31A 4A0RA 3VKWA 2WKPA 1GFIA 2JLWA 2WJHA 3KXLA 1KI4A 5HCIA 4R2HA 4FMCF 2FPMA 3R20A 1XEXB 2J0QA 2ZRMA 1AGPA 2AK3A 4TTRA 5KDLA 3RRNA 2ZSEA 1F2UA 2IF0A 3GLFB 1US8A 2OSBA 3RWOA 2REOA 1G8YA 2MSCB 1TQ4A 5CM8B 1ZCBA 2GRJA 4WXRA 1E4VA 3LX5A 1NLFA 3D3QA 1KJYA 3KFXA 1T3SA 3I61A 4US2R 1GKUB 1E3MA 5JJKA 5KOYA 3SJBA 3SR0A 5L3SB 1N0WA 1W0KA 2PL3A 3ZDQA 4IOKA 4BFUA 5DLQC 1G16A 3CUEF 3B6EA 2P67A 4CZ2A 1W48A 4XD7D 3BXZA 1AQUA 3T12A 2NMVA 3UMRA 5DGXA 3QIAA 3PCRB 2CEAA 3TAHA 3IBYA 1RRFA 2VSOA 1G3QA 3THWB 2GJ8A 2IWHA 3QVUA 1BMFD 4RVCA 5H70A 1XD2B 1GRNA 1TUIA 4JBYA 2ZSFA 2DWOA 4LY6A 3SOPA 2A30A 2D4HA 2J7PA 5FOWA 1ZCAA 1T5IA 2DYKA 4DLZA 3L0IB 4V0OA 2BDTA 3VR1A 3RS3A 2RHDA 4A9AA 2PMDA 4C0QC 4KO8A 1NG9A 3K70B 4ITRC 3IIJA 3T1VA 2HLDA 2BKUA 2DR3A 1QVRA 2NTYC 4QGGA 5LB4A 2WSSD 3TGPA 1UEJA 3A1VA 1FNMA 1AA9A 2GETA 2Z43A 3T06B 1MABA 3TNFA 3CPEA 3MCAA 2BVNA 5K8UA 2EVWX 4ZIRA 1HH4A 1OXSC 3BB4A 3DL0A 3WBKA 2A5JA 1NY6A 2V7QA 2XJ4A 3LXXA 4HAXA 3CBQA 5HKKA 1GZSA 1RC8A 1XDBA 3BS4A 3NHBA 1Q1QA 3F0TA 3QG5A 5TMPA 3EZ9A 4CEJA 2DCUA 2GVDC 5FUWA 4PPGA 5FPSA 2C9YA 4GNKA 3P27A 1TEVA 5K8IA 1KI6A 2QRZA 4PAMA 4PPNA 1OV4A 1A4RA 3R7WA 1U99A 1BO6A 2XTZA 2OESA 4AYXA 2Z4RA 3BB3A 5FH9A 2GF9A 1KIMA 3I5XA 1HT1E 2GJAA 2P6UA 3A58B 1Z0DA 3RS7A 1TAGA 4QJ4A 4MGIR 4E22A 5EP2A 1IJEA 5AJVB 1ZU5A 1FW6A 2D3WA 4PZLA 4ASUA 2QN6A 5F9FA 1XEXA 1FPMA 3FGNA 2WMOB 1KO5A 2F1HA 3B82A 1A82A 5KSZA 1IXSB 4FW9A 3RLFA 2QROA 4YDHB 5IK2A 1X1SA 4UKDA 2ZU0C 2N1BA 1VG1A 4DEYA 1E2JA 5SZJA 4RD2A 1P4SA 2ZYTX 1U90A 5GJBA 1MV5A 4AYWA 1XPRA 1JR3A 1OF1A 1ZIPA 1BH2A 1FX0B 3IPYA 2BCJQ 1NRJB 2UZ3A 2NPIA 5L3SA 3ZVNA 2EFHB 4HUQB 1G9XA 2QGZA 3SJCA 3W5JA 1SHZA 1X8LA 1T8UA 2VP2A 1JR6A 3KB1A 2OCYC 3V4FA 1WDTA 1ZU4A 2RAPA 4R98A 4EPTA 3PUXA 3DKPA 2ZYVX 2GJ9A 2FJUA 5DI9A 1XPOA 2W6JD 1L7VC 1D9ZA 5FI1B 2PCJA 1X8JA 1KZGB 1SVKA 2GK7A 4NCKA 3NWJA 3BBPA 4DCUA 4C2TA 1S0UA 2ZETA 4MGKR 2P6RA 4M21A 2FF7A 3KKPA 3THWA 1Z83A 3QPUA 5CLLA 3UWKA 4GDFA 1U94A 1XTRA 1OHHA 2XXAA 3PFIA 2V1XA 1XD2A 3FMPB 5SZHB 2MSDB 1VIYA 3EARA 4KFUA 5AUNB 5KDDA 3EX7C 2GXQA 3PVSA 1E1QD 5F9HA 3FMOB 1B23P 1P7CA 4DSTA 1P2TA 4MYUA 2A7QA 5TB5A 1XU4A 2O8CA 4B2IA 3H2YA 3QI2A 5EUMA 3CX8A 2VHCA 3R8FA 4B71A 3OESA 4QBGB 5FBLB 1HV8A 4HZIA 2QM8A 4PFSA 1IN8A 1XMVA 2NO1A 1Z2AA 1HT2E 5H1YA 4IXNA 3MD0A 1CTQA 1SHKA 4JYCA 1E2GA 2ORVA 4NCNA 4MDEA 1CU1A 1KGDA 5FOTA 4EJSB 2NO0A 1UKEA 5FBQB 2GXAA 2RGAA 3GJ4A 1ONBA 4R71A 4G0NA 3CONA 4A0GA 4OI2A 1ZNYA 1YJ5A 4Q5IA 4JLNA 4Q9HA 4DIDA 2WHXA 2JJ8A 3VTKA 3LLMA 2VF8A 3ICQB 4US1R 4EDHA 3ZS9A 2OBMA 3ADCA 4LV6A 4JVNA 1LF0A 3ZZTA 4Q4AB 2Q9CA 1R8QA 1NL3A 2P0EA 1S9HA 3EZ2A 4Y0AA 3X1WA 4B3BA 3ETLA 4UNQA 2D06A 1DAEA 1G291 3A4NA 1K6MA 4JKYA 5TXGA 2BMDA 4N3NA 4CEIA 1ANKA 2W6ID 4C0KA 2GXSA 2LKDA 4HDOB 4TMZA 3T5DA 1VCMA 4DDWA 4AG5A 1J7KA 2DPXA 3WHLA 4Q01A 1XZPA 4IDHA 3TUJC 1SVIA 2ZE6A 2D2FA 2PCLA 2JLYA 1VDZA 4G5SA 3R9WA 4TT3A 1N0UA 1QG2A 3KTAB 3HYRA 4LRWA 2OFWA 1GSIA 1RZ3A 2IS6A 1M1YE 1Z28A 1VTKA 5DN6D 2MSEB 3AVTA 3LFUA 5JS7A 1WXQA 3U44B 4NYJQ 2F6RA 4B6EA 4HEJA 2Q3MA 3K53A 2ZRLA 3QE0A 5B58C 2V6JA 4D0GA 3VKHA 2A3RA 4KCGA 2NPFA 1S2MA 1BKDR 1P5ZB 4HUQA 1T8TA 4UNPA 1CJVC 1DS6A 1ELOA 1QZXA 1G3RA 3AV0B 3GJ0A 5CK5A 3TBKA 4LWZA 2ATVA 1DAGA 2PX0A 1R7RA 2Z6VA 3T1QA 1YR7A 2I4IA 1H8EA 1DVRA 1VCIA 3NBYC 5FI0B 1CJUC 2ZAOA 3C5HA 2ZJ5A 3BD9A 2ZPTX 1YRAA 4JBXA 3U7HB 2ATXA 3EA0A 2ZQ5A 1KKMA 3WYAA 1II9A 1ZYUA 1NP6A 2HJVA 3B1ZA 3PEVA 1FZQA 2HUPA 4G3XA 1OXTA 1N6OA 1CF4A 4YXWD 3FKQA 3RS0A 2G9NA 2WIAA 5P21A 4ZKDA 4N0DA 1UKVY 2A5DA 3QF7A 4CRWB 1OFHA 1K5GA 4G5GA 3FB4A 1K5DA 2WKQA 1E9CA 2DFNA 2ZRBA 4P4SB 4HLQB 4BLTA 4URVR 4CEHB 1XFAA 3CF0A 2IXEA 4D0LB 4JLAA 3HDTA 4JZKA 4KU4A 2JJ1D 1CIPA 1C4OA 3TW4A 3SDZA 2AKYA 4IOLA 2ZXUA 2J59A 4DRZA 1TX4B 4DLUA 3VR5A 2QEQA 3QY0A 5LD2B 1DEKA 2OG2A 4B3CA 4BPBA 4GPTA 4QFMA 1GWNA 4G1UC 3RYTC 1E94E 1EESA 1TQDA 1NI3A 1NBME 1OIWA 4I4LA 5G40A 3KB2A 3DOEA 2GF0A 3EIQA 3AVUA 1UKYA 1PLLA 2Q6TA 1CULC 2ZJZA 4Q4AA 4AWXA 4RD3A 4Q47A 1IAQA 1Z6AA 1RRPA 4D2IA 4NONA 1EFRD 1IHUA 2WWYA 1W36C 5JHGB 2OHFA 4JLKA 1KDOA 1DAIA 2GBLA 4M22A 3IO5A 1W44A 5TV2A 2FSGA 4BEBA 1F2TB 1S3SA 3CPHA 2FZ4A 5A5GA 4KLNA 2BEJA 3RABA 5J47A 3B9QA 4DLYA 4QM6A 3CM0A 3KTAA 2IYTA 2IEZA 3CLVA 3R9XA 4TMKA 1HEIA 5DE3A 4MITA 4AIIA 5FFMA 3WRYC 5ELXA 1VYUA 2C04A 2QTFA 4XVRA 2QUZA 3U4QA 1R0YA 3N5CA 2AD5A 3SQXA 4JL8A 3I32A 3W34A 3EIEA 2P5SA 4EQ6B 1TEXA 4KFSA 4BEJA 4CF7A 2OLJA 1ZC3A 1N5IA 2IXGA 3V4RA 4DB4A 5L8VA 4L16A 3AUXA 4MDFA 2RHMA
chains in the Genus database with same CATH superfamily
1SD5A 2JKZA 4OJNA 4U6SA 2P90A 1JIXA 4DB2A 3VO1A 1KMMA 5CJPA 1PWXA 3H65A 1R6BX 2OOKA 4L75A 4MW7A 1KAHA 4KLZA 1JB9A 4ZJYA 3ZHTA 3ACCA 3CURA 3OTOB 2FQQA 1WSWA 4W5TA 1PVDA 3OQNA 4UHBA 5TQ0B 1NR7A 1WLSA 1F9EA 4IHKA 1IBSA 5JS1A 4TVBA 3V80A 4OJTA 4NU0A 3WOHA 3UN1A 1X7YA 3EIHA 1R5BA 1I1HA 2FKAA 3R0QA 5C2JB 3DEZA 6ABPA 5LMZA 1NNUA 1LDMA 1D9XA 1NATA 4EK9A 4QHTA 1FY2A 2KS6A 1YBFA 1EVEA 3NP9A 4H31A 4B74A 1Y0BA 2OUKA 3KSZO 1DRVA 3VOAA 1FNBA 3IKLA 2LCFA 2ZB3A 3MJ4A 2PYIA 3O82A 2E37A 4JODA 3TTVA 2V7QD 5A4IS 4UUOA 5D2CA 3K70C 2PUHA 1FPQA 3VNQA 5CMLA 1IHPA 1QCCA 5KOIA 2YH2A 5TS2A 5EJ2A 3KYDB 1A9XB 2K7ZA 4WN9A 3SM9A 4L4UA 1YIDA 3NHPA 3I05A 1CERA 3O2SB 3OEHD 5LQSA 5DP1A 1NG1A 1H2ZA 1NLYA 4KJZA 4ATNA 1PS0A 3OE4A 3O8BA 4GMGA 5CB8A 1Z5PA 3NPAA 1D6JA 1Z0JA 2HGSA 1O94D 4ZO9A 5AM2A 3L7AA 5DJ5A 5DFAA 4BRSA 1GQOA 2VZ9A 3MQ2A 4WK2B 4OHMA 4ER3A 5D84A 1BXGA 4B4UA 3PHGA 4WNAB 1PS9A 3I52A 1P0CA 5I5GA 5I4CA 3EMDA 2G5CA 2BFMA 4BV2A 4EF4A 5DMHA 1VFPA 5EWLA 2H4ZA 2GXUA 2JIMA 4PHHA 4XWTA 2ZPAA 3RAGA 2ZJ3A 2HU8A 3RRYA 2YWCA 2IUTA 2WP8J 4ZU6X 4EKYA 3KTDA 2FU5C 1F2TA 1V1RB 2ZIVB 3DMNA 3THRA 4BKRA 1GU7A 1NP7A 4M6WB 4M98A 3HLKA 2OFOA 5BNIA 2RDMA 2IPNA 1LWOA 2HJGA 3MRVA 1RI5A 2OZPA 4BNHA 3GFRA 2Q28A 2WZDA 1UK6A 3U80A 5I7WA 2DWQA 3PNSA 5DOVA 3OZTA 4W9MC 5EIWA 1Y1LA 5CM2Z 4ZEOA 2FW0A 3PR1A 1PAUA 2O06A 3AVVA 5I3ZA 4D9CA 3RYIB 3Q3HA 2J9ZB 1CDZA 4D8WA 2BP7A 1RWMA 1TF2A 2WVJA 4C4AA 3IEVA 4Q7KA 1XDWA 4NMXB 4MVJF 4BUJA 4CE6A 1ZUHA 3HFGA 2FRDA 2J3KA 13PKA 1VRWA 4BFZA 4UTRA 4XZ3A 4EQ6A 4KREA 1BJTA 1TJ5A 2FZLA 2IYYA 3QXCA 1Z13A 2YC4C 1L3BA 2CCGA 3MMPA 1DOHA 2QAGB 1V9CA 3AP3A 5I4BA 3FCAA 4JSTA 1XNJA 2GZSA 2OWEA 4G89A 4F96A 4OU4A 3U4MA 1SNYA 4BVBA 4CMIB 1XVTA 3QBDA 2PAFA 3PF9A 2NG1A 4PFQA 5B37A 5EQTA 2TMDA 2AZ4A 1W5SA 2SCUB 1Y6GA 1GT91 2WICA 3I39X 3W6UA 3PXCX 3RWBA 4DMHA 2YWEA 3RBVA 4O8ZA 1ST2A 4ALMA 3ER6A 4MVJP 2PRZA 1H3FA 1RQGA 3PA8A 3SQOA 1U8FO 3GUZA 1WNTA 4Q16A 3QNUA 5BWLA 3FCUB 5LVAA 2HQRA 2QP4A 3NYRA 4KQIA 4X7RA 5TQ0A 1DINA 4FXOA 5IKEA 2DLDA 3CVUA 4GKBA 1KAGA 3DFFA 3HB9A 1ZM9A 3V2IA 4E4YA 2E21A 1E3EA 3K70D 5HKBA 4GLLA 2VNIA 1HFKA 3HCPA 1DIRA 4QQRA 4Q1DA 3S4YA 3ERCA 2H1CA 3R41A 3N0VA 1O57A 1ULTA 1X70A 3LC1O 4LZZA 4BEWA 4MUYA 3A31A 5HZGA 1L8AA 1USVA 4JP8A 4PHGA 4YYEA 3CF4A 1IN6A 2HCRA 5TQ2A 4ACBA 1ISRA 2XQFA 1NXXA 3D6AA 4C7VA 1AG9A 1RI2A 1U0HC 2NVUB 1OZAA 3UANA 3FD8A 3AXTA 3E3LA 3KYJB 1PEAA 4EHNA 2ZULA 3F5FA 3KYDA 1J0CA 4BNIA 2QLLA 4TTQA 5UKDA 4XRRA 1M2GA 3WMFA 1AE1A 1KQOA 2Y77A 3WWZA 4AZVA 2XTMA 4HTFB 4B1FA 4EJSC 4DXAA 4X6LA 3FBGA 4A6PA 1QGUB 1V45E 1WJGA 1MJNA 2QLJA 3BERA 2GPYA 2YJ3A 3CHYA 3LA8A 3MIZA 3RS5A 2EHDA 3TNJA 3HU5A 4MVXA 3ZWYA 2PWBA 3MTAA 1E61A 2E87A 4WNAA 3TG8A 2I65A 1ODLA 2DFLA 2JLSA 2MTBA 4AMGA 4F11A 3AEUB 2KB0A 4PC1A 1ISGA 4PO9A 3LY8A 1XSEA 2Q9BA 2H7VA 2HHJA 1EXVA 2ID7A 2R0QC 4P93A 2XGJA 1UK9A 4M4SA 5KWJA 2HF2A 5BRAA 3L4JA 4MP6A 4I5IA 3KT8A 1NPYA 3WGUA 5JYDA 1KDPA 1D7OA 2WWIA 3NVDA 1V1RA 1W4CA 5JD4A 1DLIA 2ZUDA 4EG1A 2C1EA 3HXMA 1EDOA 1LRJA 1EHYA 3RVBA 5JR3A 2XOKA 1DU4A 4FILA 3EQZA 4D3ZA 3M8KA 2WSYB 1P1CA 5B4VA 3OOJA 2F62A 4R9NA 4HXEB 4BWFB 2ASEA 3OAAD 4LS3A 3H99A 4FHFA 4KNYA 5FLYA 1RR6A 4PFJA 5FFFA 2ST1A 1BFDA 3W6PA 1YB7A 3E03A 4OYLA 4RKWA 3RK1A 3BXHA 4L5IA 1XJCA 1Z6QA 2QTZA 2P2GA 3AF3A 3O0DA 4ZCSA 5U1PA 3T7DA 3V97A 1D6SA 3H2HA 3WIDA 4CN8A 1J49A 2Q1UA 3GGDA 1GAXA 2FX3A 2Q3JA 2HOQA 4TTSA 4UBOA 2AB0A 5H4GA 4ALLA 4L2IB 3PR2B 4LGMA 4C87A 4HFRA 4MSUA 1GZ6A 4HX5A 1DRKA 1H4TA 1EFKA 2SNIE 2QAGA 2R6AA 2Y1LA 1GVNB 1Q0QA 1Z4IA 2DLNA 2O5VA 2VG8A 2HNBA 1EUQA 1P4HA 3M5PA 4UBMA 3SYMA 4F9EA 3AJDA 4HDCA 4QRIA 2QKYA 1E5TA 1M66A 1C7RA 1QO0A 2OFPA 3NLLA 4JHXA 1XJ5A 3UY4A 4X64B 3CR7A 1P2UA 1Y8RB 5C1DA 2PMBA 2V0CA 3WLOA 4IIJF 3WYGA 1WRBA 3AINA 3AP1A 3D7MA 5K5EA 5K3BA 4AMUA 3O21A 4EM6A 4ZYLA 4TQGA 2CKMA 1D6MA 3KJGA 4F12A 3DE1X 5M04A 1CEQA 2FMXA 4D82A 5BN3B 2XUGA 3DAGA 4P08A 1A77A 3K96A 4E5YA 3NHSA 4BZXA 5GY7A 1E1YA 1VCOA 1EH5A 1KC1A 1UFRA 2A9RA 1QTQA 4FMCB 2B6NA 1SM4A 4D8VA 2P7HA 1QFZA 4C89A 2PX6A 2I5PO 2J9RA 3ETGA 4L50A 1T5HX 2FOXA 2M32A 2D2EA 1LRLA 1XCMA 1FIUA 4UTXA 3HU3A 2ORYA 1U3VA 1U8UA 4OKIA 4XXHA 4DUYB 2NO4A 4R2XA 4OHYA 4I4NA 1CK4A 3PC6A 1D2CA 1L7EA 5AJZA 5DWVA 4HTFA 1RYMA 3DTVB 1YCFA 3LYLA 2O8NA 4ZQIA 2R97A 4AP6A 4HXGA 5EIXA 5ALZA 1PR0A 1C7EA 3PF8A 1QGUA 1GZ4A 3EXAA 5FJJA 3QNWA 4NLLA 1KNXA 3D8UA 1L5LA 2FY8A 2WIKA 4BE7B 2HQ1A 4DE5A 3BWXA 1Z07A 5FLXA 3E4CA 4DLAA 3BULA 2WKRA 2JLRA 3E0XA 1XMJA 3QLUA 4FCTA 3H5AA 3OCVA 2MHCA 3ZN2A 1VHWA 3THXA 4E2ZA 3WHPA 2ZT6A 4Q24A 4L5BA 1YS9A 4DZRA 3H5IA 3G79A 3SSMA 7MHTA 1RKBA 3LLCA 5A0TA 1E69A 3MUFA 1JFLA 1GPKA 4X0EA 1IZ7A 4BVJA 4N40A 5I7HA 3U16A 1CHNA 1ZH2A 2YN2A 4Y2HA 5AJYA 1KKUA 1QG4A 2W2KA 4LMRA 3VI3B 3E8MA 5JC1A 1II0A 1BGXT 3GA0A 3O93A 3PJGA 3PHIA 2CFTA 1U28C 4XYMA 4ND7A 1Z5WA 4UMEA 5CCDA 3T1YB 3BXGA 3GLRA 2F9LA 3R24A 4MO2A 3V4VB 2CWDA 3FHCB 3ZCVA 3ZD7A 3QPBA 5KSPA 1G8FA 3UK0A 1UBCA 2GZ2A 2R5FA 4K6HA 3ZY6A 1DG9A 4FHGA 1CUCA 2A9KA 3FPHA 3P8ZA 4H27A 1M2HA 5F78A 5H9VA 4L2IA 2DQ4A 5HPYB 2XZDA 4ILEA 5AK3A 3NKFA 4ZV7A 2PUFA 2XE8A 5CH8A 1VE9A 4NPHA 1GTJ1 2ZUWA 4BQNA 3UTDA 4HVAA 5DI3B 3THWA 3BL5A 4PR0A 3TPFA 1RZRA 3RRMA 5HM8A 2C58A 2QAIA 4XR9A 2DPHA 5BUCA 2VHJA 1ES9A 1W88A 3JCZA 4FOSA 1GL7A 2ZW9A 1IEVA 4FGJA 4L9AA 4QRHA 3IVRA 4MDYA 4CFZA 1TTQB 1QHSA 3SOZA 2C3MA 3N5KA 3ZWWA 4PFKA 4FU0A 1Y8RA 1F8XA 4IMJB 5C5EA 1QFMA 3UMCA 4I1RA 2BE7A 3EASA 4FSXA 2OC9A 3K1AB 1L1QA 5DT9A 3STXA 4C06A 3S68A 3NAZA 3A6JA 3NI2A 3R7NA 3SX2A 3KOYA 3WV5A 3JVEA 3FYHA 1OV6A 4OCZA 4K87A 4TRJA 5KOJA 4V0SA 1P0MA 1G41A 1C7FA 3L4SO 3KQLA 1TUEA 5BN3A 1U1CA 5ISMA 2Q5IA 2O14A 3FR7A 5KNCD 2IE8A 1UKAA 5ITVA 3ZDAA 1E4EB 1B16A 1FDTA 1PKXA 1IQ0A 3FTDA 3VHQA 1UDWA 3EIXA 1EEHA 4PQYA 1O95C 3IUJA 1PWHA 2JGJA 4A03A 1P4JA 4AG6A 1GQQA 2FP4B 2WF7A 5F12A 1YMUA 2OHVA 5AESA 3QBEA 2Z9CA 4EZBA 5BPFA 4MV1A 3I5YA 1E9FA 1B6RA 3PQ5A 4WOPA 1UMDA 2P3OA 2EATA 3SYRA 3PTAA 4CMEA 4XA8A 3INTA 1X7GA 1KMIY 4FKBA 2JAXA 2CB9A 7REQA 4B3DA 1ADBA 4M1QA 2CHVA 3PQ4A 2NQ8A 2QQ5A 4K8OA 1VPLA 3FFBA 2VUUA 3IAS6 4M8IA 2GCIA 1DQZA 3O9VA 3LK6A 4QBHA 1COZA 1F3OA 1OC4A 1LPPA 3VR3D 4L22A 1X1EA 4YCDA 1YCDA 1ZIYA 1GPWB 3DHNA 5E2BA 1NVVQ 2H7XA 4K9RA 4OV6B 3RS9A 1RXCA 2CZGA 3ITKA 4LSMA 2RAFA 1SVOA 2FDXA 2OO3A 4EDFA 4L95C 4FN5A 3BZWA 1QLJA 3DPIA 2W6NA 3P9QA 2CFSA 4JELA 4BMDA 4B3MB 1NBIA 1L7MA 2ARKA 2NV6A 1O6CA 2FLVA 4JOBA 5HZMA 4V0ME 3GRVA 1GEEA 1FP1D 3FWZA 1QKKA 2C5FA 3EBPA 3GG9A 3LG2A 4YASA 4MWEA 3ZHBA 2GPNA 4BO9A 2CKDA 2V6IA 2YJ6A 3LQYA 3RNLA 3EAFA 2FMIA 3CLUC 4EF6A 3IQEA 4ISCA 2BKEA 3VKVA 3RS8A 3WI7A 1T1EA 1VHDA 4PCVA 1LA2A 2WD8A 3MUOA 5CHEA 5DCWA 3X2FA 4CKWB 1XKXA 4HMPA 2ZIUB 1TK9A 4INZA 3O1JC 4TUYB 2R47A 5FLKA 2QX7A 4M0LA 5JADA 5DHAA 1WB5A 4PAWA 3TB6A 2WU1A 4GPD1 2FZWA 4UPDA 5FOXA 5IF3A 4AURA 5A7GA 5A3RA 4RY0A 1CUSA 3VZRA 1N57A 1QB7A 5HTOA 3SDBA 1IK6A 4NZPA 5H80A 4M1KA 1K7EB 4TRRA 3H5NA 1PFKA 3DBRB 4MK4A 2NACA 3TQOA 2TS1A 3ILYA 5HXAA 5LZ4A 1L8OA 1NAHA 2C83A 2BMWA 4C07A 2G67A 2ZRQA 3CVYA 2D2XA 4RSHA 1L7QA 1XCJA 1HI9A 2RJNA 4KTVE 5HS6A 4MVCA 3SY8A 1SZJG 5MFZA 2UYHA 2I2DA 5DI3A 1G5TA 1PJCA 4O25A 4B3RB 2OYSA 1I7PA 4H7FA 1E0KA 2DUUA 2VZ0A 4AP9A 2FNAA 4P4UA 2F48A 2ODBA 4G36A 5ESDA 2Z08A 4OGWA 1LV7A 2PXAA 3L7OA 1U2DA 3NMUF 2WA2A 1Z0ZA 2IGBA 4H0CA 1VIVA 4I0WB 1ZH0A 1QZ3A 2XW6A 3QKTA 1R64A 2H2DA 2B8TA 3EGIA 3EMVA 2E6KA 3FMGA 1O95D 2QX9A 3K1AA 3K6KA 4MAMA 2GTPA 5L4NA 1Z4QA 3SC4A 3I2KA 1AHIA 2QG4A 3TD2A 3NC0C 3HCOA 1HURA 2FVYA 4A82A 3VDMA 1NSFA 3O38A 3Q15C 4L02A 4X24A 4YO8A 4ZVRA 3ROQA 4HWKA 2DPMA 2ADOA 1CDDA 3ESZA 3SKVA 4E5UA 2PUGA 3OSUA 1SBYA 2B9EA 3ZQJA 1PBTA 4EB0A 3EVTA 2X0RA 3V33A 2CBZA 1JLLB 4L78A 4X6UA 4K46A 4MUFA 1JVSA 2ES4A 4NFHA 1SHTX 3JZMA 1SVLA 3A9CA 4NAUA 1D5CA 3LQ4A 3ONDA 4G5XA 1VA5A 4I1SA 4EHLA 5C4IA 1FCJA 3DDOA 4GNRA 5KTNA 5BO5A 5CB4B 1N1DA 3U4QB 3MBOA 2FN9A 2XT6A 1JLMA 2ACVA 2OGSA 3I6YA 4P58A 1J0DA 4NJOA 5TQJA 3TIXB 4GOND 3VV3A 2FWRA 3UEOA 1NWHA 5FR2A 4FYJA 1G5QA 3B7GA 3IOCA 4QXAA 1CQIA 2JH9A 4FS3A 1WB9A 5JI2E 1KQ3A 1QK4A 2PT6A 1FS6A 1HA3A 2DBQA 2WUGA 2XUOA 3CLUD 3IKMB 4FGLA 4KVFA 2NZYA 2WP0A 2JIDA 1PYOA 3DR3A 2OV1A 1U65A 3JU3A 5D3KA 2EOAA 1J0EA 3HBAA 4Y98A 2Z6AA 4D92A 4ARIA 3BRCA 4U5XA 1VRVA 1THGA 4XQ0A 3E82A 3PDIB 4AMZA 1OFUX 2GR9A 1MQSA 3D6UA 1PUXA 4LHEA 3B2NA 4YRDA 3TCXB 2VCHA 4D9IA 4MIYA 2RGEA 3R3JA 5AK4A 5KJEA 5T4FA 3T9AA 2PWAA 2BF7A 5ENDA 4EJ0A 4IIVA 5KNDD 4QC2A 5CNMA 1Z3CA 5AO9A 4CKWA 2FFHA 4FCCA 4LYDA 2OXCA 1ZRSA 1XWWA 4TUYA 1A97A 3QX8A 2LV8A 1QGAA 3HO6A 2XCTB 1OA1A 1YOVB 1WMSA 4GSKA 1JLHA 2BFFA 2FFQA 3KKNA 2RGNA 1SCAA 2F9MA 2XCIA 4Y0NA 5DHTA 4YI3A 1W0JD 3UC9A 4CQMD 4EBFA 2AEJA 1IPHA 1VLQA 5EHNA 4ZKEA 3R7LA 1R74A 3KKEA 3IIKA 2B1QA 3MBIA 3OIWA 4LPKA 3FMIA 4YRKA 2IY7A 2KE5A 3CW9A 2RB4A 3DBRA 4XE5A 5IX8A 1KNQA 1W1UA 5EXPA 1DUSA 5H59A 1ECJA 4OLHA 4BNWA 3P0HA 3L7BA 4FYWA 1U7OA 5JLJA 4CF6A 1XG5A 1LNQA 2EBFX 3KSBC 4L5YA 1Y5MA 5GZ6A 2P68A 5LN1A 5CT9A 3ZZMA 4BMVA 3C8MA 1YASA 1RM0A 1DMRA 2Z30A 3IEIA 3N59A 1HYQA 4XOUA 5AFSA 5K9ZA 1EFCA 3GK3A 4FFVA 4I50F 2Q2WA 4NMHA 3RD5A 1VA4A 2P75A 3RG8A 1MAHA 1HDIA 3PWTA 4ND4A 2WM3A 1DAOA 2RKBA 2YWDA 4W8OA 1BH6A 1KJNA 2P77A 1E2MA 3C6KA 4H17A 4LJ4A 4X94A 3NGXA 5DTQA 4E0BA 5GADl 1JX6A 2GAAA 1ZVQA 3OWXA 1G21E 1UXHA 4OGGA 3TR5A 4B7XA 4E15A 5EGSA 2FMUA 3NG1A 4ZV9A 3N6RA 4I6EA 3OX2A 2AI2A 4IF6A 4PO1A 4C1NA 4N5MA 3OTIA 2GM4A 1Z6TA 5TDHA 4QYWA 2EJUA 3VAZA 4RVGA 3CUKA 3LAWA 1R15A 3ZGYA 2C8KA 3KKZA 4MZXA 3STYA 2OAGA 1JLKA 3TQQA 5IAKA 1JLLA 3BM5A 1FNNA 3DE5X 4G0WA 1DRUA 2H4WA 5BW5A 4A2CA 1WTCA 3FF4A 3KVYA 1IXKA 3OQMA 1N5KA 1XA3A 1P5RA 4PX5A 3KFLA 5H02A 5JSFA 1NKSA 5DM70 4UMFA 3E18A 5F1YA 3UA3A 2GHRA 2EHJA 5JSQA 3COJA 1NRIA 1JHDA 2B37A 3G82C 4KVGA 4XD7A 4XSGA 3ND7A 2EG5A 3WWPA 2OAQ1 4RWEA 3EEYA 1G38A 4FHZA 4H6WA 5LM3A 4EGCB 5ERGB 5EY5B 5LMNB 4B17A 1QLHA 4Q3AA 4YJ2B 4J43A 3NGLA 1U8AA 2ZUVA 3NW9A 4ZVQA 1R6AA 2P2ZA 4FOTA 4A8TA 1BMFA 2EZ9A 3DCIA 4UEJA 5AQEA 1E4YA 2JLBA 3G2PA 3E9CA 4B7UA 3T3EA 1FEZA 2WHYA 1P2GA 4URHA 5L3RA 4QE3A 3MWGA 3SSOA 1GDDA 1CUIA 2GK4A 4J49A 1MDFA 3PDIA 1S5PA 4FZ3A 4IDFA 3T9DA 3X2SA 3DZKA 4Q03A 1IHYA 1RKXA 3USCS 4FLFA 4CU5A 5FBWB 1YVDA 1A7AA 1S2DA 4LYFA 1ML3A 3MLEA 4GE0A 2KMLA 1R50A 3UXEA 1FNSA 1TQ2A 3KVOA 2XUJA 3LBHA 3MCZA 4Q4HB 3IT3A 2ZJ7A 4JC8A 1JHPA 3EZ6A 2C7PA 4QUJA 2PKXA 1QANA 1YNSA 4RK0A 4BNZA 1JZQA 2C9OA 1CP2A 4HLUA 1NBWB 2VDPB 3MJRA 3MFQA 4TN5A 1F20A 1YJAA 4Z7OB 2D7CA 2YQZA 2O54A 1DT5A 3KQTA 1SULA 2UZ4A 1JWAB 2H4JA 2G08A 4KAAA 2EV9A 4A23A 3BQ9A 1CUVA 4GRAA 2WF8A 3GX1A 3G2LA 2Y1WA 4QELA 3GRPA 3WWDA 4EYQA 5JZMA 4LJYA 2V5AA 3T9FA 1ORIA 4L8LA 2A1IA 2AXNA 3PA6A 3OZVA 1QVAA 2ZWIA 3KV1A 2F4NA 4G4GA 4AJJA 1EPUA 3THYB 4TOIA 4WGGA 1EI9A 1WUTA 3IP7A 8AT1A 4M37A 1W34A 5ENVA 2NUAB 3BH6A 4P7BA 1M34B 5LC1A 4MV8A 2OBXA 1SUAA 221PA 1A2BA 2PA3A 2XECA 2XKJE 3SZMA 1EM8B 1R66A 4LDRA 3DGEC 3SR4A 3KHTA 5JE8A 3I6BA 2AUTA 3IB3A 3ADDA 4FNMA 1E7RA 3GNLA 5EWMB 4DQLA 1UPAA 3BIFA 3PQ3A 1OBHA 2IOFK 4EP1A 1D1TA 2OY0A 3NOXA 2JB9A 1OI4A 1J9ZA 3B1YA 1O03A 3U61B 5CLHA 3L1KA 3O4IA 3C8DA 2ODTX 3V8BA 2ODWA 1L4MA 2HRCA 2Q5LA 2YZ2A 3O4FA 5JDCA 2VTBB 5G53C 3UAWA 3FCXA 2ZRNA 4MJ3A 4DR1B 4JDUA 1P2VA 2JG3A 4MQEB 5DX0A 4IKEA 3H8WA 3L46A 3OO0A 1UBFA 4QXPA 3PPWA 3F7TA 3LKBA 1CDEA 4YV7A 2Y1XA 1XD9A 5IK2D 1RQRA 4WLUA 3RBAA 3CZQA 3GLIB 4UEKA 3V4ZA 5HZHA 5ELMA 3KTOA 5F3DA 5EMHA 5JSUA 3O9ZA 1NQUA 1OVGA 1R16A 1XWFA 3E9QA 1EDEA 4ENTA 1RDFA 4ZC1A 3SVLA 1NULA 1YS1X 2FSVC 2EQ5A 4HP8A 3MGKA 5ESXA 5C37A 3EG9B 3MWEB 1NVXQ 4E5NA 4A73A 1UWKA 4IY1A 3CC8A 1L7AA 3O4HA 3N70A 4K9MA 4PYRA 1ZMOA 5AW8A 1U0GA 3DDNA 2PX3A 3MAGA 1TQHA 2W6JA 2FPIA 3K4HA 4IUDS 4LRUA 5FBKA 4E1VA 5FWNA 1W4RA 2CNKA 1NUTA 1DC5A 2I76A 1X2EA 2BMFA 5EZ5A 2NQTA 5JNTA 4YJ2A 4F1KA 5ECDA 3LIPA 3FCCA 5KYKA 4A0HA 2DB3A 1V1MA 1R1DA 4Q1BA 1OYOA 2H07A 3EHEA 2YVQA 3MBKA 2RE8A 1E5DA 2QYOA 3VPDA 2ZXEA 2DM6A 3A0RB 4KQ9A 3L9WA 1IDN1 5F2NA 3AVPA 2IYSA 5KPJA 1OHHD 2JHCA 1GNLA 1M8KA 3PGJA 1ZUIA 1RWXA 2JRCA 2R96A 5JDIA 1S3GA 5IF9A 5JPDA 1UM9B 2PUCA 4ZJUA 4ARCA 3HVKA 2V7EA 1SG6A 3MCUA 4Q4HA 3ZKWB 2EBWA 4MCAA 1AGYA 5FTMA 4BE9A 1R4MB 3GCXA 4WECA 1FMFA 1KPGA 2I7CA 5K8CA 3LF2A 5KVAA 3I2FA 4DA0A 4MKRA 5B7QA 1I3OA 1K4MA 1Z06A 5C35A 5IUKC 5G41A 1HG0A 4ETMA 2AG8A 3BHJA 3GOQA 3R3UA 3CSDA 2OQVA 4LSZA 1T0HB 1UZNA 1NURA 4X93A 4ITUA 2DHRA 5TC4A 1FQKA 3U3ZA 5JJIA 2XNJA 1YOBA 5EXSA 5D01A 3G5TA 5CJ2A 4FFWA 2GD0A 1C3OB 3CH6A 3JWJA 4BAGA 4CLXA 4DIKA 1CUAA 1X1RA 4IVNA 1CY8A 3L6UA 4IX1A 4N9QA 1Y9JA 4B34A 1M34A 1WP4A 2D4AA 1KSHA 2EFCB 1G17A 1YL7A 1IMOA 1X74A 2AE1A 1EM8A 1ODTC 3MT0A 1NBAA 1IY9A 2WTBA 3ZGZA 3G2OA 3NX4A 1NA5A 5AOBA 4C30A 3FOEC 2IS4A 2X9LA 2GKGA 4OP1A 3VU8A 1UINA 1GCGA 1I2AA 3I9MA 4B3HA 4YX9A 1WBDA 1VCHA 3VBCA 1DXHA 3QX3A 2QL6A 3HJRA 3SR3A 1NMSA 2D54A 2ODAA 3OT1B 6ADHA 1K0UA 4G1VA 3S2GA 1CCWA 1G7RA 4DA6A 3LVQE 2ZVQX 4JA2A 2PL5A 2VTBA 4I6JA 1MX5A 3VYRB 3PJRA 2OT3B 2YIDA 3GJ8A 3P1JA 3QXGA 4CMAA 3QEKA 2Z6UA 1G20E 3PNQA 2A5YB 3CXUA 3NYIA 4MGZR 4HN4B 4URFA 5K3AA 4HNUA 3EVZA 4EUSA 3USES 2IL1A 1EXMA 3EPPA 1YVUA 4JWTA 4PGMA 2R8ZA 2LRHA 3GLIA 4RQBA 2L19A 4DYVA 5FBRB 4MJXA 1NDQA 3LBAA 5T3YA 3W5HA 7GPBA 3NBXX 2H2WA 3KG2A 1Y6RA 4LFBB 1VFNA 1XA4A 2AW3A 4X3OA 4A36A 1D2GA 1QWOA 3GT3A 1CEEA 3TSAA 3EG9A 3MWEA 3MJHA 2HO4A 1E2HA 5BQ5A 3M3DA 4S05A 1JYEA 3WQHA 4HAZA 4DJFC 5L45A 2GZMA 3GFPA 1F9AA 1NDHA 2Y1KA 4BV3A 1SEVA 2AHOA 4PLGA 2RFLA 3JPYA 4R1TA 1KBOA 2I22A 2JFOA 3ISTA 3KR2A 3O3NB 4N0EA 4R2IA 4D3XA 3CCBA 2I62A 3N07A 3BDIA 2QJWA 4P4GA 3M5DA 4QLOA 3DLBA 1ZR2A 3TF5A 2O8DB 1UOQA 1X3SA 2YHIB 3ON5A 4R31A 3ZK9A 2ZUBA 2NU8A 1SU4A 2IHVA 4RIIA 3TW8A 1OLOA 3OJEA 4MW5A 1Q6YA 5ECYA 1OPRA 4M9SA 4IV8A 3ACBA 1LGYA 3TQCA 2O8FB 2EX1A 3ZHVA 3TFOA 4JMPA 4FR0A 3LY5A 3V6LA 1A7KA 5CAEA 4QJIA 1KDTA 2VSFA 5T57A 3VM6A 3WNDA 1T2CA 2UKDA 1NTOA 3WC4A 1AIPA 1UM9A 1EFVB 1YR8A 2JJ1A 3FW1A 3PICA 4JU9A 5EKUA 8ATCA 4DUPA 1O9GA 3MTBA 5FV4A 1R4MA 3T7SA 1AS3A 1BMTA 4CLRA 2BM1A 1KOJA 3EPHA 3ZWOA 1T8PA 2MYPA 2EJBA 4IV5A 4JJFA 4IS2A 2CDNA 4LXUA 5BNFA 3C5CA 5E4TA 1O3YA 1KQNA 3CX4A 4DN6A 5LXTF 5EA2A 1VDMA 1OXMA 1YB5A 3PPVA 1W73A 3ICWA 4F2PA 3Q0EA 4DV4B 1YZNA 2Q6IA 4ZVKA 3AUSA 3MOIA 3VR5D 4D4LA 4KR2A 2YDYA 4XJTA 2VYQA 3Q0TA 4M38A 3QLVC 2W4QA 3V1UA 1WHTA 3R1IA 4ZI5A 4NICA 1SVSA 1C3OA 4Q4DA 2G07A 1SH7A 3ELBA 3GZTB 1HDEA 4YDQA 2JKVA 3BMXA 2QQGA 1Z4OA 3DCJA 4UE2A 4C4XA 2VJCA 1VPVA 4EY4A 3NNNA 4C4TA 1B8PA 1WXWA 3KZMA 1XTIA 3GAZA 2AR9A 3OE5A 4YRCA 1W7AA 3OZIA 1Y7PA 2JBWA 3BJRA 4NESA 4RC9A 4TL7A 3DAHA 3E1KA 3LBYA 2G1JA 2BZSA 4JKIA 4QYTA 4X7PA 2J3QA 5FF9A 3WFJA 2XNSA 4CR8A 4ZMSA 2ERCA 1UZMA 1DAMA 1XJQA 2MR5A 2UZ1B 4KSYA 1JDNA 1FUIA 1WUKS 3GFFA 3TIGA 4M7RA 3V48A 2BHTA 5TEVA 4ARVA 4JVOA 4PZYA 1UF9A 4UMDA 5KYYB 1JF8A 2Z5VA 3I4LA 1XAGA 2ZFUA 4L08A 5DCUA 4JI2B 4TLMB 1CIJA 3IILA 3KZNA 2AC4A 3GLHA 2DQZA 3A7DA 3RVDA 2YS6A 4A5OA 5J58A 3AFHA 1ZAKA 1MV8A 2X9QA 3WK8A 1ZI9A 3KKMA 4RSRA 1LFDB 1SXPA 2XTJA 3GLHE 2H0AA 2X40A 4J0CA 5CX1B 5EZQA 3E84A 1XRNA 4R0VA 5CLGA 4LXTA 4QZVA 4L74A 1N7IA 1TZ2A 3EGWA 1T9BA 4ZYXA 5L4LA 5EWJB 3MVEA 2ZIZA 5MF6A 2EQAA 2QPTA 2UYOA 4MA4A 3TGLA 1YFJA 1QH9A 3C3MA 4BX2A 1H9BA 3BB1A 3H0EA 1RYEA 4POAA 2WWRA 3I8SA 5B1SA 5E3HA 3PVCA 4YCCA 2BKXA 5JNVA 4LYAA 1UEXC 1KY3A 1E0SA 2J48A 1JLRA 2FWAA 2ZG6A 2CN1A 3GO4A 1D0VA 2QT1A 2VBCA 5K4GA 1EGMB 1G5FA 2GMWA 1C41A 1K8ZB 2Q9UA 4G8CA 1HEUA 2F2TA 4LOAA 1SZDA 1VG8A 1SFRA 3CUSA 2XX3A 1RADA 2O8DA 3LXRA 5JMPA 3T0GA 1XDSA 3VZDA 2YHIA 1M8JA 2G5TA 3F8TA 4FPXA 4ML3A 5BYJA 5EJ8A 1FX1A 2BD0A 3GNSA 2NO6A 4NZZA 4TKVB 2WTUA 1J24A 3TKAA 1USIA 1F8FA 4UEWA 4JLVA 2O8FA 3MTQA 3W9UA 2FSIA 3DCNA 5F35A 1NDUA 4ZCIA 3AZOA 4K9KA 1UDXA 1SG0A 3M5CA 4RF2A 4Z4EA 2E4ZA 5JQGB 4W5HA 1MPTA 1M8PA 4F5YA 1DP4A 3SVZA 1DG3A 3MWJA 4TKZA 2OFXA 3KVVA 1PJQA 2W11A 3VU9A 3PQEA 3P0FA 1K3FA 2DHEA 1I33A 4KMOA 1B0AA 4KIFA 4QEDA 3H17A 3Q6NA 5F21A 1MQ9A 1CUHA 1SVNA 1TQ6A 3SQLA 4BNNA 4KO3S 4BWYA 5IZCA 5JUWA 2D0DA 1VKRA 2MJLA 3E6AA 4QFCA 2WPDD 1LNZA 1OZHA 4UHHA 3MGCA 1V2HE 1ORHA 1SCJA 1HZZC 2IV2X 4RXTA 4BFVA 1QRTA 1CUDA 1QO7A 4GRDA 4WDRA 2E89A 2AZDA 2WYWA 2FPLA 4CTKA 3WXMA 4ZQHA 3ZWMA 4Q1FA 3Q7RA 2VCEA 2CNWA 3FNRA 4FDLA 3QG1A 5JISA 4EHKA 1I1QB 3B9PA 3CB2A 1W5TA 1Q95A 3C7TA 2K87A 4EUNA 1TM5E 2WABA 2AWOA 3EY9A 4L6AA 1KVSA 4QJ5A 2PPLA 2H4HA 4BNFA 2WAAA 2DKFA 1XZDA 4L6CA 4U0KA 3TCKA 1Z4MA 1XA0A 2YICA 4YVFA 4RJKA 2H08A 2CL5A 2OM2A 3C7KA 4JQOA 4OF4A 4MLPA 5IJAA 3WRYA 4DSUA 5IN5A 2DFVA 2NLOA 3GJSA 4FYVA 4LBYA 5BR4A 2UXCB 1PHRA 3GZNB 3GLFA 3PQ6A 2UAGA 1OAKA 2UZ1A 2QDKA 2UUOA 1WIWA 1PL8A 3DKVA 4TWJA 1DO2A 3OX1A 3WLRA 1L5WA 2PGOA 4IDBA 2JZOA 4KACA 3ZLTA 4C6SA 5KYYA 1RBZA 4KWCA 3FA2A 4PSVA 4O2AB 4ZAGA 4N7RA 4RJLA 2QTWB 3GDHA 3ROMA 1DBVO 2H2IA 3L1HA 4TROA 4KFRA 4HL6A 5HF9A 4PQFA 3QU7A 1Q44A 3SBDA 5ABPA 5L3ZA 1K89A 1UT5A 2JI6A 3V8RA 3TNDA 2WNSA 4G0VA 1HTBA 4KWTA 4O4JA 1N8KA 5B1YA 3INGA 3S1SA 3OFJA 3S2YA 4R3NA 3B85A 5BSUA 4W5QA 1F8GA 3I6QA 1XTSA 1T6YA 2VXCA 3P9XA 4QOGA 3OG9A 5EWJA 2I9PA 5IC6A 1ND6A 3GLVA 4X1IA 3L7KA 1LRKA 1G7TA 3TL6A 3L7MA 3P26A 2FSSA 3ML1A 1B3BA 3QLTA 1CZLA 1XEFA 3FZNA 3S3TA 1BKSB 4F91B 1I3NA 1VMEA 2J8ZA 4XIIA 3TVDA 4PIPA 2F1JA 4BATA 4DNFA 3JZAA 1YZ3A 4DMKA 1WCV1 1PW7A 2D1SA 3TQTA 1Z75A 1HQCA 1NIJA 2BBTA 3UPUA 2Z3ZA 3E7FA 2HA2A 1Y6FA 1IN7A 4KMMA 2PUEA 4E5DA 2PZEA 2F1IA 3GRZA 3WZ2A 4LJ6A 3HP1A 3LFHA 5JT1A 2PGIA 3H5TA 1AB6A 4RZXA 3RVJA 1KQFA 4MULA 1ST3A 4KQHA 3GEGA 3MB8A 1NM5C 5KTOA 4AI6A 3TBHA 3VZPA 3A6DA 3C8UA 1NVMB 1ZOOA 3K09A 2C42A 3IT1A 4TKVA 3ZDCA 2NZXA 1NVWQ 4HG2A 1Q19A 3AUYA 3IV6A 2P91A 3GUVA 4GPAA 2WOOA 2BELA 3JZFA 2IEAA 3AH8A 3CKMA 3KUUA 3K9HA 1YB6A 4UVIA 4XM1A 3SJUA 4W5OA 2IHNA 4QUBA 3A1SA 3DONA 3HS3A 5CLQA 1M1NB 5D6NA 2GZ1A 4E2XA 5JQGA 4MHSA 1E1RA 2FGKA 1I2ZA 2AT1A 3AR5A 4LXXA 3ITDA 1T6ZA 1WB6A 4LCEA 2JASA 4QXQA 2G3YA 4ZQBA 1FFHA 3ZIAA 1JMKC 3RCBA 2QMYA 1CQPA 1J1ZA 1HFEL 5C1IA 1FMLA 1P17A 2XCUA 1H2BA 5K3SA 1YQXA 2ISCA 3Q3EA 4TWRA 5C3MA 2WJGA 5IJZA 4KRXA