2CMKA

Cytidine monophosphate kinase in complex with cytidine-di-phosphate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structures of escherichia coli CMP kinase alone and in complex with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 1998-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cmkA00
3OIYA 2R44A 1NJGA 2CLCX 3BFXA 3HPQA 3IO5A 1AS3A 1KGDA 4QHTA 4UXHA 3AP3A 4EKDA 2EWWA 1KI6A 1M6NA 2IYXA 5JJIA 4QC2A 5KNBA 3ZS8A 3LXRA 2C77A 3SNHA 3T35A 1UAAA 2X2FA 2ZITA 3AQ4A 4Z51A 2PH1A 2XB4A 4C7OA 3PEWA 5IK2D 1KDOA 4AWXA 3VR1A 1KAGA 1W44A 3SHFA 4EFNA 1ZRHA 4Q7KA 1F3OA 4I1UA 4WZ6A 1OLOA 2OESA 5K8TA 2ZJ5A 4Q47A 4P3YA 1UKYA 2REXB 2BKUA 1G8PA 2BDTA 4B33A 5J5CA 4MKIA 2EU8A 5LPNA 3ZD7A 5AUPB 2QPTA 2AKAB 1SXJD 3KB2A 2JJ2D 2C99A 4PPQA 3AKDA 1Q1QA 3VAAA 3A1VA 4QJ5A 2ANCA 2VTKA 2WV9A 1G7TA 3R9XA 2CBZA 3CRRA 3IQXA 4QKQA 1YZUA 2QMOA 3RYTC 2OZEA 2DBYA 1DAMA 3T5DA 3H86A 3W5IA 2FX3A 4FWIB 1C9KA 1E2HA 1UBEA 1E2FA 1N2CE 2NQ2C 1E2EA 1O87A 2ZJOA 3FYHA 5TY0A 3IUYA 4Q4AA 5HZKA 3KQLA 3PG5A 1XEXB 2R6DA 4JLOA 4PO1A 2FDCA 4MDEA 4IVQA 1LVGA 2QRNA 2EFGA 4ZKDA 1U2RA 5FPHA 4OHVA 3MWJA 4A0FA 3ZD6A 4HAWA 2X19A 4TMWA 1KDPA 5BW8A 3EZ9A 1XTKA 4G3XA 5J4LA 2G3YA 2QY9A 5KO2A 1VG0B 1U0JA 3GJ0A 2XTZA 2OXRA 4F93B 3ZIAD 2IYUA 4LBWA 1KK0A 1H8EA 1XWIA 2OG2A 2O8DA 1ANKA 1H65A 3M6AA 4C0HA 1D2EA 1XX6A 2JLXA 4K81B 1XJ0A 3B78A 4XH9B 3QPVA 1NNEA 5FFMA 4Q9IA 5F3WB 1E4VA 2VBCA 4B47A 2QP9X 1GTVA 2OE2A 1W49A 4LSGA 4AG5A 1N6LA 2JATA 1KK3A 4QNRA 2QE7A 3BOSA 4A0GA 3A8TA 3OAAA 1NBME 4A6XA 4YC7A 1SKYE 2CJWA 1Z29A 4Y0VA 5C2JB 4NCIA 3PUYA 1CS4C 2WWWA 1CKEA 3D6TB 1EFHA 1E9DA 1DVRA 1XDBA 4HAVA 3UKDA 2JLRA 1CRPA 4WAUA 1E6CA 4DVGA 2MSEB 2ORVA 1GG2A 1G7RA 1AJEA 1IHUA 1NVVQ 2LCFA 4ZIRA 2YWHA 3RS7A 2ODWA 2ZJZA 2CE7A 5CLLA 4B3XA 2GAAA 4X8MA 2YVUA 4OKSA 4Y0AA 5B58C 4Q4LA 4BWYA 2KE5A 3ZGXA 4RY2A 4LJ9A 4OHZA 3AUYA 2C78A 2WWIA 3GJXC 4Q9LA 3DO6A 3QXSA 2G1KA 2Z0MA 2ZSAA 1W36D 4JKIA 1Z8FA 1EFRA 2ODNA 1N25A 2D62A 3T06B 2EYUA 3A1TA 2V54A 4NCHA 1GWNA 1VTKA 3EWSA 2A5JA 4DCSA 2JEOA 2WAXA 3U3RA 3OEEA 4WZBE 1AGPA 3IIMA 1G64A 1DE0A 3M4YA 5LBIA 5BN3A 5JMTA 3QIAA 2RMKA 5L3VA 2PL3A 3WBKA 5DH9A 4BEBA 2HJGA 1GKYA 2A7QA 3JZMA 1OT3A 2ZSFA 1JQLB 1OH8A 4JL5A 4PSKA 2IT1A 1OF1A 2WSSA 3P4YA 4Q1DA 3R7WB 1P62B 3Q8XB 4BPBA 1XTRA 2X77A 1U81A 5J4YA 1JJ7A 2I3BA 1XCMA 3QF4A 4IOLA 3PUVA 3GLFA 1Z3IX 4CEIB 2IL1A 4I99A 3TW4A 4A2QA 4CRWB 5TB5A 4IOKA 5CYOA 2FSHA 4MRVA 4AI6A 1M7BA 3M1IA 2PX3A 4IW3B 2QQEA 3BC1A 4OL0A 3NTUA 1OXSC 5FTKA 4JVSB 2RAPA 2ZROA 3A1WA 4QBHA 2GF9A 2JAQA 4S2EA 1VYUA 3IEVA 5JEEA 1Z0DA 4WW0A 3FKQA 4L4UA 3W3ZB 3H84A 4KLZA 3R8FA 3LLMA 1O3YA 1T3LA 2NPFA 221PA 3P20A 3JZAA 4B3CA 3H4MA 2IF2A 1N5KA 2FH5B 3WRYC 2BBWA 4QM6A 3UIEA 1AS0A 1W4AA 5L3SB 2CLDX 3CX8A 2NO6A 3DMDA 5E4FA 2GEUA 2B21A 3CZPA 3P26A 2A5FA 4HAYA 3U3OA 4M1YA 2G0NA 4ZCLA 4NPHA 4RCYA 2V1XA 2PZFA 3BH7A 2P6RA 4OHYA 1CTQA 2IHYA 2WKPA 3K0EA 2H18A 5SZKB 4LCBA 3K53A 4KV9A 4KSBA 4FINA 4EFMA 2OFXA 4DDVA 2ZTSA 1EESA 1YR6A 3PVSA 2BM0A 4CT5A 3RRNA 1XCGB 3SS8A 2OCBA 4L15A 4PHHA 4JLKA 5AJZA 4BFUA 2JASA 4O3MA 3Q5DA 1I4DD 1RYHA 1KSHA 3O8CA 3MWYW 1TUIA 1HURA 3KJGA 2OO7A 4P4SA 2ZRPA 4TQ9A 5JWOA 1CJKC 3LQRA 1E2NA 3VTKA 1JEEA 2BEKA 2OBNA 2WJVA 3GLFE 1L4YA 1U8AA 2G0TA 2O52A 2W2TA 1C1YA 3VKHA 3KKQA 1RVDA 4A8JC 1TF7A 3CH5A 2Z83A 3X1DA 3ZYCA 2QM7A 1Q57A 3I3SR 1T5IA 3QBTA 3RRMA 1DPFA 3K9GA 4M8NE 4B71A 2WTUA 1R8SA 1Q3HA 2ZJ8A 5EUMA 1IY0A 1DBSA 5BWMA 1ZCAA 4D6PA 3EASA 3ZS9A 1P3JA 2YJTD 2EW1A 4OI4A 5JS8A 3CIOA 2OCYC 1NY5A 3O8BA 5JZVA 4B76A 4QHSA 1Y63A 4NKRA 2DCUA 3QXCA 2QSYA 4IDQA 1SHZA 4KBGA 4FXPA 1HEIA 2CNWD 4EPYA 2GHIA 4DSTA 3EPJA 4HZUB 2BMEA 4B43A 4TLCA 2XXAB 1U99A 3BERA 3N5CA 4EJSC 3HP1A 3WXMA 4DCVA 3PQCA 2J1LA 2UZIR 2OV2A 1GL6A 4ARZB 1RPZA 4DKXA 3EZ7A 2ZRAA 1PJRA 721PA 2VLIA 2VL7A 3GJ3A 1MKYA 3CO5A 3SBDA 5JI3E 2QP3A 3LY5A 1MO4A 3PITA 1P2UA 2QT0A 1HTWA 3CNOA 2FGJA 5L8VA 1NN5A 1Z2AA 2IWRA 3T15A 1FX0A 2P2LA 1KHTA 3AEZA 3RHFA 3BFVA 2OAP1 4ZV4A 5EQTA 4DLVA 2IS1A 4XWKA 3L8YA 3G0HA 1TX4B 1LY1A 1XCPA 2WWGA 3DOEA 2BVNA 4QBIA 5JECA 1DS6A 2HCJB 4OK3A 4FMDB 3VX3A 3GJ8A 2F7SA 4MA4A 2YC4C 2IHBA 1OJLA 2A5DA 4N0EA 4R9UC 3WP0A 3CBQA 1NN0A 2OCAA 3QKRA 5FTNA 1UF9A 3T1QA 4AKHA 4QXAA 4MKHA 4KYUA 5K8UA 1YJ5A 5CITA 1L2TA 3IBGA 4POAA 4WXRA 5EXSA 2HV8A 4TZ6A 4W5JA 2JLWA 1TMKA 4H1UA 4M1TA 5SZJA 4II7A 1G5RA 2GXSA 3GLHE 3L8ZA 4D4JA 4TL6A 1VHTA 2REOA 4P0TA 2H7VA 5BN5A 4GBMA 1G16A 5F9FA 1DEKA 1SXJC 5A0FA 2YZ2A 1E0AA 2F1RA 4DB2A 1KKMA 2KWIA 4IXNA 3J81k 4C0QC 1XB2A 2ZXUA 2GCPA 4E22A 4MRNA 3LFUA 2ZSDA 4LYFA 4LV5B 4NYIQ 2OHFA 3KFVA 4JLVA 4MGKR 4JLJA 4DLXA 2E87A 1JALA 4PZLA 1T3HA 3DEFA 4QHYA 4A9AA 3KTAB 3W6PA 2AFHE 3VU9A 1NL3A 3P27A 2OT3B 3VHXA 4PHFA 3K0AB 1N5LA 3W90A 3CPEA 2R62A 3SYLA 1NY6A 4ESHA 3DKVA 1XTSA 2KBFA 1Z07A 3CW2A 4GOXA 2PCLA 1D6JA 2Q21A 5TARA 3U3KA 4MUBA 4BE7B 3MSXA 1UEJA 1ZNWA 2GCOA 4TT3D 3Q7PA 4G5GA 4F38A 2ZS8A 2BMFA 1SXJE 4UNSA 1UPTA 3B1XA 3W9YA 3UATA 1LS6A 4X8HA 2ZS7A 1CJVC 2ZS9A 2NOAA 5D3MA 3O8DA 4DUGA 2JLYA 1JJVA 4CGZA 3B7GA 5L3SA 4JT2A 4OJQA 1AIPA 2ZETA 2A5YB 3D3QA 4JL8A 3PUXA 3LX8A 1KOFA 3TK1A 3T1TA 1ZIPA 4PTLA 1E79D 4TYPA 4DCNA 3U7HB 2REBA 2FFHA 4QOSA 1T3SA 3GLHB 3GCGA 1KJWA 3DPUA 3NWJA 4V03A 1HQCA 2VSOA 4PHTA 2CK3D 4BFXA 2EQBA 2IYTA 3CRMA 3THXB 1AM4D 3CNLA 3CUEF 4ZO4A 3AGPA 4CEHA 2WPDD 4Q19A 3ADBA 2D2FA 3JVVA 2YNMA 4AY2A 2ODBA 4K8OA 4TLDA 4US1R 1OW3B 1JR3A 2W00A 5HE8A 3AKCA 1E32A 4V0OA 1CRQA 3QF4B 3VR5A 4AKEA 1P9NA 2V7QA 4KAXA 1E9RA 1E9EA 2PEZA 2IUTA 3DDCA 4A92A 5EP1A 4CT4B 4AYXA 1GKUB 1DG1G 1KAOA 3PUZA 1NLYA 2OAQ1 2FZ4A 1I2MA 5DYGA 4B6FA 4RFSB 2RKOA 4CEJA 1S9HA 1WDTA 1OB2A 4BRWA 1JXOA 3BB3A 3KXLA 4YQFA 4AK9A 2WSMA 1QZXA 4OI2A 1E3MA 2DWPA 4M1OA 3RABA 3RS3A 4EDHA 3A6PC 3VMFA 4QGFA 3DOFA 2G77B 3OE7A 4B34A 2VYFA 2RGNC 2QAGA 2QMEA 2ZRKA 3KB1A 4HAUA 4RD1A 5G3YA 3ZVRA 1ONBA 3QKUA 1U0LA 1FTSA 4QNMA 1VECA 2BCJQ 4OK5A 1XZQA 4NMMA 4YMUA 4A82A 4XTRA 3R9WA 2FFAA 2GEVA 3AVXA 1PLLA 4Z1MA 4TZ0A 4LZZA 2FFQA 4DDTA 3OESA 3EZFA 1KNQA 1D9XA 1KSJA 4ZIRB 1ZU5A 1QHXA 2AK2A 3MCAA 2ZJAA 1RJ9B 3U7GA 5EXPA 1KDTA 4PSAA 4YMWA 4HDCA 1G7CA 2Y8EA 5AWFC 4G0NA 3N2IA 4ARZA 2Q6TA 3OFNA 1PUJA 5LB2A 4TT3A 3AVOA 4MKFA 4DXAA 1OPXA 1RRCA 1N6OA 5EUQB 2W2VA 4FWTA 2ZREA 5UKDA 2DR3A 4UXJA 4TMTA 3C14C 4ACBA 4HB3A 1GILA 3C5HA 3EA5A 5H68A 4LRWA 1GNRA 2Q3FA 1E2PA 4IFEA 1XPRA 3IDQA 1WP9A 1YE8A 3SJCA 3I73A 2BM1A 5FL7D 1ZINA 1S4QA 5DISB 4XD7D 1KO7A 4JL6A 1ZYUA 1H8HD 2ZU0C 5GJWC 5KTYA 3FVQA 1HQYE 4CZ2A 2WPDA 2ZRJA 4ZCMA 4HAZA 2XEXA 4C2UA 2D2EA 1GP2A 1GDDA 2KSQA 5FBLB 1M34E 2AHOA 2JCSA 2XNDA 1F48A 3TJZA 1A2KC 5JJKA 4TYWA 1G5TA 3FTQA 1XF9A 4AYTA 2O8CA 1P2TA 4XWAA 2B8TA 3SYKA 2J45A 3VR4A 2J3EA 1HT2E 2JDID 3MD0A 1ZD8A 1UBFA 3K09C 1YZTA 4BRUA 2F43A 1TQ2A 4FMBB 4D0NA 3ZZ0A 1XEFA 4B74A 1CXZA 1E9SA 3EPHA 1NKTA 2OSBA 3CF6R 4P32A 1EWQA 1IN4A 2IYQA 2AL7A 2O5VA 3SZRA 3WHLA 2GCOB 2GA8A 3PR1A 5G3ZA 1VCOA 2DFKB 4B35A 1Q21A 3SEAA 5JBQA 2P6NA 3WNDA 2WWFA 1W2GA 4LJ7A 1NG9A 1FL9A 1XMSA 2JJ2A 1T5LA 2CHGA 2AXPA 4URXR 2C95A 1YZKA 1TL7C 5HKKA 2A30A 2V55B 3K0AA 2VF8A 1KZ7B 1J8MF 2PLRA 1Q22A 4JLPA 4OQNA 1RRGA 4DDWA 1XRJA 3QJYA 1G3MA 1NIJA 4Q7JB 2ZJBA 3A1SA 4GP6A 2P67A 4L9WA 3MWLA 4QGHA 3UPUA 1S3GA 4A8JB 4JZKA 4B73A 4EQ6B 1DO2A 3IHWA 1UDXA 2A3RA 2RH5A 1ZBDA 2AKYA 2BBOA 4Z1MD 2XGJA 2VF7A 4C0BA 2GBLA 2N1BA 1J2JA 2G9NA 3UG6A 1OYWA 4LBYA 1ZJ6A 1U9IC 4OI0A 4M9SA 4JBYA 1CEEA 2C5LA 1AA9A 3CLVA 2CE2X 2F6RA 2OLJA 2OBLA 1LFDB 2B7CA 4CEIA 2CL6X 3LBHA 2IYVA 1W36B 4DC9A 1XBTA 2C9CA 2O0KA 5C18A 2ZI5A 5DSZA 3UMFA 5JRZA 1AGRA 1TUEA 2DYKA 4B6EA 3U60B 2EFDB 4NYMR 2HT6A 3EZ6A 4Q18A 1LV7A 3R7WA 1A2BA 3SR0A 3L2OB 3VNUA 4W7SA 4CW7A 1P73A 4C30A 1N0UA 1DAIA 4EPRA 5D3QA 5KSZA 3B13B 4DCTA 4ASUD 1Q3TA 2CXXA 5JI2E 2EYQA 2ZRCA 1QHSA 3P4XA 1NIPA 1DOAA 4P33A 2J59A 2W83A 3SJAA 4A1FA 4IDOA 3AV0B 1ZM2A 4HLQB 3V00A 2WJGA 2FNAA 3W6OA 2ZJ2A 3GD7A 1N0VC 5C46F 2QBYB 1N5IA 1NKSA 3KTAA 3I62A 3RS0A 3A4NA 2YWFA 5IK2A 5FR2A 1NBMD 1US8A 1CIPA 1YQTA 2Q9BA 3TKLA 3ZJYA 3U44B 3OIWA 1TAGA 4KITB 4KSCA 2MSCB 2QEQA 5EE9A 2PT5A 1NG1A 3TQCA 4IDPA 4NBSA 1Q1ZA 1KSFX 2XNDD 3L0PA 2EFEB 4Q9KA 2BJVA 4PPNA 1JECA 4GMDA 4R7ZA 3CWZA 4EAQA 2A9KA 5JLJA 4ZI2A 1YZNA 1E69A 4XVQA 1V43A 5CK5A 2F9MA 5EE1A 1ZU4A 1J90A 3U44A 3Q85A 4HZIA 1OSNA 1DADA 1L8QA 3WYGA 4MQBA 4D82A 2KB0A 2ZIAA 1IN6A 5FOVA 1IY2A 3LH5A 1Z06A 1CU1A 1TQDA 1L4UA 1ZW6A 2Q3HA 5ELXA 2QQ0A 3DZDA 3UMRA 3SI7A 2QPOA 5B30A 4B75A 1PVOA 5FUYA 2VHUA 4A0RA 4DLYA 1G41A 5HE9A 4HSEA 2ZYTX 4Q5IA 4TLAA 5FBVB 3NC1C 1TNDA 3CF0A 1JB1A 1ELOA 3PUWA 4D4KA 1Z0FA 2JGNA 3QKSB 4IEIA 1D9ZA 1KK2A 4Q01A 3SN6A 1ZNYA 3H0KA 1UFQA 1W1WA 2WJJA 3IKJA 1Z28A 3VR6A 4URVR 5LD2B 5BYKA 1EFRD 2QORA 4I1VA 1AK2A 3EA0A 2JJ8A 1NMXA 1HY3A 1E99A 1E9BA 1FPMA 3HYTA 2ZSEA 1CLUA 1VYTA 2JLQA 2ZYVX 4FCWA 5AUOB 2VP2A 4GDFA 3KX2A 4TTRA 4TQUS 2IYRA 2FMXA 4PO9A 1E1RA 5B57C 2AD5A 1J99A 3BRWD 2O0HA 2XZPA 3K9HA 2IYYA 2X1VA 4I1SA 3GJ6A 3SJZA 1IN7A 4LV8B 2FSGA 5KDLA 3NBFA 4PC3A 5KSYA 4K46A 4FMCB 3T61A 4C0JA 2KJQA 4ABYA 2F55A 1G6HA 3IEUA 3QY0A 4J0QA 1EFUA 2W2XA 3QVVA 4ASUA 4FIDA 4OK6A 3TR5A 2C96A 2BMDA 1G6OA 2PJRA 4OQLA 2B7BA 2P0EA 1KMHA 3UANA 1AKYA 3ZDQA 2JLZA 4GOJA 1G3UA 2RGGA 1IXRC 3LW8A 3TE6A 3U4QA 1ZAKA 1G3RA 2RGDA 1QF9A 1KYIA 2ZM5A 1XPOA 2LKCA 1Q1BA 4NHOA 2J0UB 2QG6A 4QRHA 2B8WA 1VHLA 1E96A 2BMJA 4Q4JA 2DHRA 3DVLA 2O8EB 3T5GA 3FFAA 1TEVA 4Q1CA 2B92A 5DE3A 5FPTA 1GRRA 3GQBA 1BYIA 3THXA 1J8YF 3RVBA 1IQPA 5M04A 4KVAA 4P4SB 2A78A 2J0SA 2AWNA 4FMCF 5FPYA 5E3HA 4FCVA 3TGPA 2NZJA 2FN4A 2FJUA 1F6BA 2PZEA 3NH9A 3W3AA 1OIXA 3KXKA 4F7WA 2ZYWX 4HDOB 4A6PA 4IRUB 3M0EA 4HB0A 5C4GB 2HLDA 2OILA 1MO3A 3FDIA 2ECKA 4QG7A 4B3FX 4BLSA 2XITA 4XTCS 2IYZA 5JHHB 2ZEJA 3Q3JB 1BS1A 4M1MA 2CEAA 4OJKA 5JWHA 1W47A 3B82A 2BJWA 1DARA 2G6BA 5HCNA 1VG9B 3EWAA 4DT1A 2FPMA 2QNRA 2XOKD 4V0ME 3MLEA 2J7KA 1LS1A 1OXTA 4NCKA 4M2LA 2J41A 2V8OA 3QENA 5KUTA 4KFSA 3F8TA 1R0WA 5DGXA 2C8VA 1CR2A 1ZNXA 3THYA 3I1FA 3OHMA 3T34A 3ZIAA 2GESA 5KOYA 4MYTA 3O47A 3SQXA 2TMKA 1T9HA 4YMSA 2D3WA 3IQWA 1GFIA 3RS4A 1VG1A 1GZSA 1T6NA 1C4OA 1NLZA 1U90A 1FFHA 5KDDA 3DHWC 2Z6VA 1ZCBA 2RGNA 1D5CA 1E1RD 1W4CA 2QA5A 4NYMQ 5FUXA 2IA5A 3PV0A 1SVOA 3AVWA 2ZRIA 3HR8A 1R10A 1PV4A 2GDJA 1YR8A 2CCGA 4JVMA 5EE3A 2O8BA 1KSGA 5K8LA 3BAFA 1N6RA 1RZ3A 1SKYB 4Q00A 1M1YE 2UKDA 3OAAD 3R8CA 1AZTA 3LVQE 2VSFA 2WZQA 4PAQA 1OXXK 1US8B 1VCMA 2WSSD 1CJMA 1R0YA 5DN6D 3KL4A 3LVRE 2QAGB 1IN5A 3PEUA 5L3QB 1N6IA 4R98A 1OXUA 5AK0A 5TVKA 2V6IA 4KVGA 4TN1A 1X6VA 4DLSA 1XTJA 3QOFA 1ETUA 1EX7A 4Q1EA 1IXZA 2D4HA 3GEHA 3QPWA 4B3DA 1ZIOA 1SXJB 1E2KA 4LUCA 1ZC3A 4WOPA 121PA 4LOAA 4KFUA 2PMDA 3GLGA 4BZQA 2N42A 2WMOB 3D7MA 5CDFA 2IS2A 3TAHA 3CPHA 2JJ1A 3AF3A 4MYHA 1Z47A 4Q4HB 1RYFA 2C04A 2R8RA 5JSZB 3AVQA 4AURA 4TYYA 4UNNA 3N70A 4PQYA 2O8BB 1E2MA 1BOFA 2WJHA 5L3RA 1ESMA 2QENA 1XXHB 3RAPR 4V0NA 2QAGC 4XJXA 4DWJA 4UNRA 5JWRA 3RWMB 4Q66C 4D4LA 4ZI3A 2CJWB 4RKFA 1W7AA 2FPKA 4LPSA 5CIQA 5JFGA 4FN5A 5GVRA 4JYBA 4NYJR 4XD7A 1G4AE 5CJPA 1R8QA 1G7SA 5DHAA 2BWJA 3TQFA 3HDTA 1LTQA 3KJHA 5IHPA 2Q0HA 4LC0A 4LHXA 1W4RA 2BBSA 2QE7D 3MRSA 4MH0R 4LJAA 5D3MB 2PMKA 2XOKA 1W0JA 1YR9A 4PSVA 2GKSA 1KK1A 1I2DA 2R65A 2JIZD 3ZZTA 3B9PA 3NBZC 1TEXA 4PZZA 4BFZA 4M1WA 3NDPA 3FPAA 2YC2C 3LNCA 1SGWA 2ZI9A 1OHHA 1KI2A 2NO0A 4BEJA 3BJIC 2RB4A 4HUQB 1E94E 4OQFA 4UNPA 1IXSB 4PAOA 1ZNZA 4C7OB 1GVNB 2MSDB 1YVDA 5JEDA 2NO9A 4YMTA 2QGNA 2HYDA 3UWOA 4RD3A 3MGCA 1GKIA 1YHNA 2C03A 2NG1A 4PQFA 3FFBA 2L0XA 3PEVA 4M21A 1NVWQ 3VU9B 4JLAA 3WMEA 1G21E 4ZDKA 2ZJYA 4R2HA 3AVYA 3QF7A 4KU4A 5JHGB 2XSZD 4Q4AB 3U6BA 1X1RA 3A58B 3E2IA 1UBCA 1HT1E 4HI0E 5CLQA 1UM8A 1FTNA 1F2UA 2JLVA 1NRJB 1BKDR 2QAJA 4MRRA 1Q20A 4Q7LA 4GOKA 1R5OA 4KI0A 2WIAA 1D2NA 3RSOA 5FPSA 2HEIA 3SFVA 2X8AA 1XP8A 4GZMA 5ANRB 2ZUBA 3MMPA 1GUAA 2HCBA 1IN8A 4UXIA 4QJ4A 4RZXA 1OIVA 3NH6A 1JPNA 4ZKEA 1T0HB 3B60A 4M53A 4NU0A 2IX3A 1OH6A 3AP2A 3ADKA 4G5QA 3NBXX 4EIWA 3BD9A 1LF0A 5E7IA 5EXXA 4AKGA 3AUXA 4EPXA 3C16C 5FPKA 1GL7A 3EAQA 4KJZA 3TSZA 2O0JA 4LBZA 4QGGA 3K09A 3DKPA 1COWA 3EIEA 3ND9A 1OV4A 1TU4A 1VMAA 2ZRNA 4PAMA 5DYIA 1E0JA 3F0TA 3I72A 4HLUA 3ICQB 1RRFA 1ZUNB 4HB4A 3FE2A 1NSFA 5J4VA 1HYQA 4BLOA 5LB4A 2EWVA 2PJZA 1NF3A 5CJ2A 5KNDA 4QJ3A 2W6JA 4MRPA 4YDHB 3RLFA 5JRJA 1Z22A 2FEOA 2F43B 1XJCA 4OI1A 5FOSA 1UEIA 3RDPA 1UKZA 2VRWA 2R6GA 4P4UA 3QG1A 4WBSA 3UK6A 2SHKA 2A2ZA 2XB2A 4MITA 2GJKA 2GK7A 2ZR7A 1NMZA 2IW3A 3BK7A 4IJMA 5EXTA 3I61A 4NTZA 3CR7A 3TUIC 1EXMA 1G18A 5AJWA 3AF1A 4PC7A 5KU1A 1R5NA 5TDHA 1P4SA 2GXAA 1VPLA 2QROA 4A15A 3V4RA 3EX7C 2HYIC 5FL7A 1QHYA 1KJZA 3KUCA 5FTLA 3B2EA 4B2LA 4UJ5A 3LDAA 1N0WA 4DZZA 2V6JA 3NHAA 3BH0A 2FOLA 2NGRA 2AK3A 5FOTA 4LX0A 3OEHA 3TUJC 1U9IA 1G3IA 5EE0A 2HT1A 2WMNB 3SYNA 3FB4A 4B32A 1GOTA 3LW7A 2AFIE 2XXAA 1F5NA 2JLSA 3CH4B 3LV8A 4RFSA 3WNBA 1KKLA 2BEJA 4EFLA 3TR0A 1G8GA 4HYYA 1XZPA 3FKSD 3QSYA 3AGQA 1JR3E 4KBFA 3K70D 4A4DA 4Q1AA 3PJRA 5DN6A 1SVIA 4BQSA 5EZ6B 1W5TA 2DWOA 1A82A 1X8JA 4JIMA 4LY6A 1XEWY 2WVJA 4B3GA 5J40A 2OBMA 3RWOA 4Z8YA 2OUKA 3KKMA 4GZLA 3VR2A 5TV2A 5CYPA 1XD2A 1UKEA 2FWRA 2GVZC 2YHSA 3FHOA 4P31A 3T1OA 4LGMA 4OHXA 4IVRA 4TL7A 1Y3AA 5CIWA 4JYCA 1EG7A 4LPKA 3GJ7A 1ZC4A 3IIKA 2ERYA 3B6EA 4DEYA 3ICEA 4TL9A 2R6AA 4GNKA 4PANA 1R0ZA 1Z63A 3WBJA 1JR6A 2R6FA 3VNVA 5H8WA 1SHKA 3VR3A 4R71A 4IKEA 2V3CC 2DWQA 1II8B 1CR4A 2C9YA 2VHQA 2OCPA 2PZGA 2AWOA 2RHDA 1A1VA 2VIIA 3FKSA 2P6UA 4DLRA 2OXCA 4AC9A 3AKEA 1VKJA 3X1ZA 1T91A 2CMKA 2R6CA 4JT4A 5AR1A 4YMVA 1MR3F 3IIJA 3NEYA 2ASEA 3MG9A 3AVVA 3X2SA 4O2RA 4G5OA 1XFAA 2BOVA 4DEXA 2W0SA 4PC1A 2WWYA 5J4HA 3WRXC 1MRSA 1VIAA 2IC5A 3GEIA 3GJ4A 2WWXA 1JR3D 2IXEA 4TLBA 1KO5A 2JDIA 1ZM7A 4XSGA 4OYHA 3F3YA 4F4CA 3EC1A 2QP4A 4EUNA 3TH5A 1RIFA 3HPRA 3A4MA 2N46A 1D8TA 2YWGA 4HATA 3L43A 3WYAA 1DAHA 2WOJA 4CYMA 2VHTA 4A8JA 2YWEA 3EARA 4BLRA 1U8YA 4EQ6A 4F92B 2QM8A 4LJYA 3EIHA 3KQHA 3SDZA 2O8EA 1PZNA 3KXIA 2DFLA 1MO6A 3BE4A 5GVSA 1FW6A 5FBRB 2ZRFA 2ZQ5A 1IOZA 2IS6A 2NPIA 4PX9A 3C8UA 3WYFA 4BZXA 4JKYA 4L8GA 5FUWA 3GLHA 4U02A 5B64A 1G8YA 3AP1A 3CRW1 4NCJA 3CB4A 1FOEB 1B0UA 3SHWA 3GLFB 2IUUA 3DM5A 4WZAE 3BBPA 1KI7A 3PFIA 2CLSA 2ZVQX 3OE7D 4ILEA 3WMGA 2FG5A 3A36A 4TTQA 4PQRA 4ZCIA 3DMNA 2ZE8A 1E4YA 4KCGA 4IXMA 1TPZA 1R7RA 1Z0KA 2WOOA 2K5UA 5EP3A 4DRZA 4ZDIA 5A4JA 1KI8A 2D7DA 2ZUCA 3C15C 1MABA 1P7CA 4MYCA 4XVUA 1E2QA 3VKGA 2XNSA 4IOMA 3TSOA 2VPPA 1Z08A 1KY2A 5CM8B 4HLCA 1U8ZA 3KFXA 1N6PA 1GIAA 2O8FA 2DY1A 3BB1A 1X8KA 3CM0A 4DB4A 2UVQA 1ZMXA 2XX3A 2QT1A 5F9HA 4D25A 1KDRA 4Q7MB 4Q9HA 4Q48A 2O8CB 2VEDA 2GXUA 1TF5A 1DAGA 1R2QA 1QHGA 4IFBA 2J0UA 4GT1A 1FP6A 2W6JD 3KDSE 4E03A 1XD2B 1HA3A 1ZM9A 4JJKA 3X1XA 3G82C 4L9SA 2C9OA 3PENA 4KFRA 4YXWD 4JVNA 1SVLA 3KJEA 4URYR 4W5HA 3CZQA 1FP7A 2ANBA 4RCZA 4RVCA 4NE2A 4MRSA 4JBXA 4MKGA 4DIDA 3RNLA 1NVUQ 4KHZA 1W0KD 2J87A 3ECCA 2YV5A 3AF0A 5DNYB 1A4RA 4M9QA 1F2TA 2WIBA 5BN4A 4Q03A 3RC8A 2QI9C 3OFND 1OH5A 3LAWA 5FOXA 3I5XA 4HLDA 2DFNA 1M8PA 1EX6A 1Z6YA 3OEED 1JQJC 3A1UA 1F60A 1T8UA 5K8IA 3O8RA 1XPUA 3L0IB 4AG6A 4P4TA 4MYUA 2WJIA 4D80A 3T12A 1IY1A 1EWRA 1VIYA 3BORA 2QUZA 3AF2A 4LJ8A 2O8DB 2ODEA 2GAOA 1P72A 3B5JA 1OKKD 1AQUA 4DDUA 2OFWA 3QI2A 2XTMA 2RGXA 2GVDC 3EIQA 1G8HA 1XD8A 2NTYC 4TMZA 4Q4HA 2GEDA 4BZPA 1KO1A 3LD9A 2GK6A 3QXJA 3S1AB 4M22A 3ASZA 1RKBA 1DELA 4B2PA 2F1JA 3LA6A 2ONKA 4DJTA 3RRZA 1SQ5A 1KI3A 1WF3A 2QTVB 4FCTA 1YU9A 2AR7A 3CX7A 3OIUA 4CEJB 4RZUA 3FGNA 4QFMA 3BH6A 2VH5R 1NMYA 4PR0A 1YRAA 1YZQA 1UDWA 2F3RA 2GF0A 3CPJB 3UWKA 3B85A 2FPLA 4M1SA 1M7GA 2GCNA 3SFZA 4F4IA 3ADDA 1XMVA 1MABB 5H70A 1FMLA 4MGIR 2XZLA 1CJUC 2CVHA 4RSGA 1JPJA 3LXXA 1I4TD 3QVUA 4KO8A 2R9VA 5FOUA 1L7VC 2ZAOA 2ZRGA 1FMJA 4TWZA 3MWKA 1S1CA 2QGZA 2V1UA 4OQXA 2AXNA 1RW4A 2P65A 3C5CA 3K0CC 4IDNA 3NKVA 3CNNA 4RZ3A 4C0KA 3THWB 4EJSA 2HF8A 3MAAC 3GPLA 2H5EA 4IEEA 2OFOA 2D74A 3AVTA 2BC9A 3HU1A 3IILA 5FOWA 4URZR 4WA7A 4KXFB 4GL2A 4TYQA 3WNCA 4ITRC 2CDNA 3Q5EA 5FBWB 1OE0A 3OIVA 2WM9B 2HDNB 3CWQA 3I5YA 1AZSC 1XD9A 3TRFA 2ZI4A 4LV6A 3TBKA 2ZRBA 3I32A 2WJYA 5CM9C 4M0LA 5KDOA 1GL9B 3FHCB 5KSPA 2FV8A 4XWOA 5J47A 3CONA 2CVFA 1WA5A 521PA 3HJNA 2I1VB 3SBEA 3PIRA 4JBWA 2QZ4A 3NHBA 2FSIA 1P2SA 2I1QA 3IHLA 3U3MA 1SKQA 4V0KA 3TUZC 2W6ID 1AKEA 3K0FB 1COWD 3CRVA 4HUQA 5A5GA 2AD1A 3FMFA 1X3SA 3I8SA 3C41J 3TAUA 3ZVLA 3BS4A 4JLMA 1ZD9A 5LDDC 1XTQA 2D06A 4ZDJA 1NP6A 1U98A 1Z6XA 1SVSA 4KLNA 4EPWA 3U61B 1XEWX 4YXWA 1ZP6A 1A7JA 4YONB 4JLNA 5HTKA 4URUR 3K0SA 1CF4A 1OB5A 4DCUA 5KPJA 4A2WA 1WXQA 4NL4H 2GTPA 3CF2A 3EW9A 3PCRB 1J70A 1IAQA 1DG3A 1ZVQA 1P61B 2XJ4A 4E07A 4XSHA 4ZPXA 4JS0A 1N6HA 2H17A 1Z83A 2ZE6A 5FI0B 1U94A 1J7KA 1W2HA 3D8BA 1MRNA 4QBFA 4UJ3A 4TYNA 4LBVA 4GMXA 2GJ9A 3VX4A 2ORWA 1NSTA 2J9RA 2IEZA 1RC8A 4JVLA 2ZPTX 1EFTA 4X8LA 3CRQA 821PA 2PX0A 4C0LA 2VP6A 3CR8A 2QMHA 4QGAA 3QBVA 1FQKA 4TLEA 2JJ1D 2YOHA 2R2AA 1MO5A 1BMFA 2CHVA 4RD0A 3U4QB 3LRPA 3TLXA 2DFTA 1MOZA 2IS4A 1VCIA 4MUAA 1KMHB 1QHIA 2H92A 3QPUA 1T0JB 4FI3C 3THWA 2WHXA 5KHOC 2PLFA 1G17A 3UXMA 4DHEA 3GLGB 1RRPA 3QKRB 1QHNA 2J7PA 3QG5A 2RGCA 5TMPA 3ZVNA 1CR1A 1KIMA 2W58A 4D0LB 2V7QD 1AS2A 1N3BA 4D4MA 2IEYA 4JMPA 1QG2A 1W46A 3UG7A 1QHHA 5HCIA 3QEOA 4BFYA 1NN1A 1Z6AA 4FMDF 4US0R 5E95A 2HLDD 2WICA 2G83A 1GM5A 3MUFA 4C2TA 4A36A 5F2EA 1NJFA 4WVFA 3ZQ6A 4DSOA 1M7HA 1FX0B 1ZUHA 2C98A 4ACAA 2J0QA 2QTFA 2YKGA 1JNYA 2GILA 4HLUC 1GRQA 1CBUA 5BXQC 2E9SA 3K9LA 4QM7A 5FL3A 3DM9B 5EZ5A 4NZYA 3H1TA 4O2LA 4E09A 2V4ZA 4H1VA 2ERXA 3ZQJA 3P1JA 5GJVC 4LYHA 3V9PA 5JCPA 4RZ2A 3QKSA 1IJEA 2PBRA 3IO3A 3FMIA 1LF5A 2ZVPX 4IVPA 3W6NA 3KQNA 3TMKA 4Z8XA 3WP1B 2ZI7A 4HZUA 2GWHA 3U6KA 3HWSA 2G1JA 5FBQB 4DUGD 5KSOA 3THYB 2F1HA 2X2EA 3IPYA 3U3JA 3H2YA 2RGBA 3DZ8A 5CB6A 4I1OA 3ADCA 3WMFA 1WE2A 3N2EA 2JIZA 1XXHE 3KJIA 4LYAA 3BXZA 4PXAA 4NP6A 1F2TB 4C3ZA 5JCZA 4OHWA 4CIDA 1YRBA 4N1AA 4U00A 2ZYUX 1G3QA 3QUSA 5BYJA 1RJ9A 1SVKA 1WBBA 2A5GA 1Q12A 3BFKA 1QVAA 1XMIA 1IM2A 1U0HC 1FZQA 3Q7QA 3C7KA 4BASA 2ZRMA 5DI9A 1PLKA 1QRAA 1E2JA 2BV3A 3VHLB 5LD2C 4G5SA 1XJQA 4UNQA 3GMTA 3Q72A 2BKEA 1E2GA 1OFUX 2UZ3A 3EC2A 4E5UA 3G5UA 4PFSA 4HDQB 2BCGY 1EGAA 2XSZA 4BLTA 4OBEA 3ND8A 1GAJA 3FMOB 4MDFA 1KI6B 3I8XA 3LBNA 2NO7A 5DO9A 1QHHB 1NVVR 4HEJA 4B44A 4KODA 5IRCD 2QBYA 4LJ5A 2NMVA 4LI0A 4XIGS 3THOA 1S8FA 2GZAA 1PUIA 2Z4RA 3K0CA 4B3BA 4NCNA 3NG1A 3FMPB 3R9IA 4TMVA 2ZE7A 3QKTA 3K0FA 3C4JA 1WB9A 1EK0A 4TMXA 1IONA 1RE0A 2HF9A 3ONWA 1S9DA 1UADA 1OFTA 1ZM4A 5TXGA 5DLQC 1YZGA 3MFYA 3WHKA 1II9A 2E1RA 3W8RA 1B23P 1GSIA 1XMJA 2NIPA 1P5ZB 1TU3A 4M4SA 3RC3A 3GLGE 4Q1FA 1Q44A 1WQ1R 2VP0A 1GNQA 3EZ2A 4OQMA 3B8HA 2DPXA 2RCNA 1W4BA 3DL0A 3ETLA 3BGWA 3FWYA 1IJFA 2H8KA 4NH0A 1W5SA 4F4JA 4X8OA 3A4LA 5FR1A 3AB3A 1G4UR 1WCV1 1Z0JA 2IK8A 5SZIA 2ZSBA 2YINC 1ZD1A 2RGAA 1DAFA 2ONJA 3LLUA 4D0GA 1FNMA 3GLIA 1F2UB 3KZ1E 4ERNA 4PPFA 1OYYA 1RFLA 4GP7A 3VQTA 1OKKA 1P9WA 1E9FA 3OZXA 1E98A 2VO1A 3RRYA 2CL0X 2YYZA 4GFDA 2FE4A 2ZRHA 3AVUA 5KPDA 8OHMA 4GI7A 1QVRA 2WKRA 1V5WA 4AD8A 3PEYA 3EG5A 1VG8A 4QL3A 2NO1A 3L0OA 4CDGA 3R20A 4UKDA 4KYIB 1II0A 1NN3A 3RANA 2GRJA 4D26A 2ORIA 2CNWA 3Q9LA 2AX4A 1II8A 2ZR9A 1I4LD 3QE0A 1Q1EA 4CF7A 3OF5A 4U5XA 1WRBA 4RJLA 2H16A 5HPYB 1HUQA 1CP2A 5IDVA 4PO8A 1S1MA 3IPXA 1MV5A 3AVPA 3B1ZA 3P32A 3B9QA 1OIWA 4DSUA 1E1QA 1E2DA 1S0UA 4G5RA 4C9BA 3K70B 2B6HA 2ZUDA 4C4PA 3KKPA 3AH8A 2XJ9A 4RFVA 2F3TA 2CL7X 3VKWA 3V4FA 4DLUA 3LO5A 1X8LA 3QEJA 4LC1A 2VP5A 3UMSA 1R0XA 1XXHA 4U7DA 2P5TB 4PC2A 3FOZA 2VHJA 1EFCA 5C1BA 3U5ZB 3GFOA 4LYJA 5H1YA 1A5TA 2EVWX 4G1UC 1GRNA 4V02A 3RSLA 1TTTA 5P21A 4KFTA 4YDSA 3GEEA 2VP4A 4GRAA 5KNCA 1KMQA 4RKEA 3AF4A 2CCJA 3ZH9B 4D81A 5HZHA 1P60A 1ZUIA 2QSZA 4B48A 2HXYA 1HE1C 4BGDA 2CHQA 4HB2A 5FH9A 1LNZA 5FUVA 4TL8A 4PHGA 1UJ2A 1JAIA 4I81A 2F1IA 3JVUA 4I4LA 4M9XA 3TVTA 2W0MA 3K70C 3E5HA 4MGZR 2FF7A 3SE0A 1W48A 3SJBA 2RGEA 1G5PA 3NC0C 4NYJQ 2BHRA 5CDFE 4UQOA 3W34A 1KY3A 2YOGA 4M9ZA 4TTPA 621PA 5L3QA 1R4AA 4RD6A 2VA8A 2GNOA 1BMFD 4LHVA 3WY9A 2HXSA 1FUKA 1Z6GA 2JA1A 2WAYA 5G40A 3S1AA 3SC3A 3VFDA 4Q9JA 5B2ZA 2LWIA 1N6KA 5G53C 1Q0UA 1BO6A 1JBKA 4WIAA 1LB1B 4TQAA 2QMUA 3KKNA 1KI4A 2QL6A 2Z5FA 6Q21A 2ATXA 1SULA 1G9XA 2O8FB 1JXMA 1JEDA 1VDZA 3GFTA 4EPVA 5JS7A 2QTHA 2FFBA 4BECA 4C0AC 3W8NA 3I92A 1XEXA 3FHTA 2IUSA 4CVNA 1DAEA 2LKDA 3HU2A 2XAUA 2GJSA 1Z0IA 3HR7A 4EPTA 4GSYA 1BIFA 4Q4JB 1UKVY 1KO4A 2KBEA 1E2LA 1KI9A 4N3NA 5GJCA 1YR7A 2IBMA 1W36C 2ZU6A 2J46A 5AUQA 1R6BX 1ODFA 2FGKA 2P3SA 3LBIA 3TIFA 1NLFA 3QQ5A 2BBTA 1R5BA 1S96A 2OEPA 4BFSA 4DBLC 1W0JD 3B1WA 1P9RA 1P6XA 2Z43A 3EPKA 4YLGA 3LWNA 1N6NA 1GNPA 1G8FA 2QN6A 1YZLA 1DTSA 3BB4A 2KI5A 4Q02A 4AKIA 2WWHA 2V9PA 3REGA 1K5GA 1H8ED 1N5JA 2J0VA 3NEJA 2QPAA 4JJZA 5E7JA 4D2IA 1VCNA 4LHYA 1UBGA 2ZI3A 4V0MA 2Q3MA 3PXGA 5DIFA 1S2MA 4S35A 1IBRA 2FZLA 3ASYA 3F5FA 1E2IA 1G20E 3MJRA 4L16A 1KZGB 3HU3A 1KNXA 1ZM3A 3K9NA 4LHWA 1DO0A 1WMSA 3L0SA 1OXVA 4QBGB 2OM2A 4TSFA 5G41A 4LDJA 4AYWA 5F98A 4F91B 5FI1B 3GLIE 2IF0A 1X86B 4GPTA 1E9CA 1E1QD 5FTJA 3NVAA 1QG4A 1E79A 2ZR0A 2IYLD 3NBYC 4HAXA 3KUDA 4JSYA 5DI3A 4Z54A 3U2QA 1MH1A 3EPLA 4LHZA 1K5DA 3TSWA 1OHHD 3B1YA 2PEYA 5AJYA 4US2R 2FSFA 1TQ6A 3I4LA 3QXHA 3MJHA 5HKKD 4W9MC 2VQSA 1HE8B 1CULC 2ZE5A 2ZI6A 1XU4A 2XZOA 1NI3A 4Q1BA 1CR0A 3EXAA 2I4IA 3T1VA 3HYRA 2DB3A 4DLZA 5SZHB 1ESNA 4TMKA 1LW7A 2H1LA 1TQ4A 3LX5A 4L5BA 2Q9AA 1E9AA 1FQJA 1KI1A 2QU8A 1T8TA 2QRZA 2CCKA 2GBLC 4LJ4A 4LWZA 4O0MA 2ZAMA 2IWHA 2F9LA 3ZLJA 4A0HA 2MMCA 4G01B 1KJYA 3RS5A 1HH4A 2FU5C 4V0LA 5EP4A 1X1SA 1S3SA 2WKQA 1Z5ZA 2ZRDA 4IDHA 4ESVA 1WBDA 2MMGA 1E0SA 3W5JA 2Q9CA 4DSNA 4JSTA 2ATVA 3ZVMA 4MGYR 5JSZA 1T4GA 2Z4SA 3AKYA 1CJTC 4XOIA 2XTNA 2IXFA 4W5WA 4B2IA 4EJSB 2IXGA 1BYUA 3GP8A 2P5SA 2GETA 4JLBA 4WXPA 3BWDD 4O25A 1XTIA 4ON9A 4DIEA 1AQYA 1QDEA 4BLPA 1P2VA 3SOPA 1HV8A 1TF2A 2G88A 3NIBA 5IT5A 1PLJA 5BQ5A 2VHCA 2HUPA 3BIFA 2NZ8A 4JLDA 4FD2A 4FW9A 1W0KA 2GXQA 1KTVA 5AJXA 3X1WA 4BFWA 2YOFA 2PCJA 3NDBB 5EP2A 1D2MA 1SXJA 2J7PD 3SU8A 3U7EB 3RS2A 4RD2A 2WBLC 4N0DA 4PPGA 4A2PA 4BFVA 1Z0AA 3A37A 2BIFA 4IOJA 4NONA 3TNFA 3CKLA 1VYVA 1JI0A 3NXSA 4URWR 1GITA 3GFPA 4M1KA 3CX6A 1G291 5AJVB 3E1SA 5JJLA 5C4MA 4BUJA 2GJ8A 4H9GA 3D31A 4NYIR 5DHFA 4RD4A 4AIIA 1SVMA 3KQKA 3TW8B 5EE5B 2ZRLA 2VSXA 3QNUA 2FA9A 3IGFA 1M2OB 5AUNB 3AM1A 5GADl 2GZDA 4IHQA 4Q21A 2J5XA 2C2HA 4TSFD 2GJAA 3TVDA 2JLUA 1OFHA 5CK4A 5J4KA 1YKSA 3REFA 4CEHB 1QBKC 5CB8A 2CK3A 2AN9A 3GLIB 4XVRA 3L82B 4NDZA 3X1YA 1G1MA 1K6MA 1P75A 1NBMA 1TADA 5EJEA 1Z6TA 4C0SA 4DLTA 3K8YA 1H8HA 1DAKA 4BLQA 1OH7A 2PT7A 2D7CA 3QXXA 1XNJA 3U7FB 4BFTA 3IBYA 1Z2CA 1FUUA 4HUTA 5HR5A 5KYKA 3GJ5A 1BH2A 2ZANA 421PA 1KO8A 4ZDWA 2FEMA 1MT0A 1NVXQ 2IYWA 2W6IA 2VP9A 2OLKA 3KKOA 1K8RA 2HJVA 4R2IA 3ZZUA 1SZPA 2H57A 5IF9A 3KQUA 1JAHA 3E70C 1OFIA 3K1JA 4DT1B 1AN0A 1G19A 5GJBA 1E0KA 2GZHA 3LQQA 3OEHD 5DI3B 5FTMA 3SQWA 1SVWA 4LK2A 2IYSA 1FNNA 2EFCB 4LJ6A 4PC6A 2RHMA 4PZYA 1M74A 2EFHB 4DLWA 5E7MA 3B1VA
chains in the Genus database with same CATH superfamily
4ZVSA 2TECE 2WD7A 4O4LF 4QAJA 4XX0A 3BFXA 3GRAA 3ICCA 4LCJA 4Q9AA 3ZLJA 1QFSA 1KGDA 1SOWA 3R3WA 4AS3A 1E18A 3O2SB 3LC1O 3AP3A 2BHTA 3AUTA 4QATA 2PUWA 4CETA 4RTJA 3DAYA 3M34A 1NOKA 1RHUA 3JVIA 3DQZA 3P94A 1ISHA 4MIKA 3VO1A 2VWHA 3H9QA 1YB6A 4MA5A 4AWAA 1DQZA 1QTIA 3SNHA 5KWIA 1HORA 4WESA 1NM5C 4G25A 3OQNA 4BUZA 1BDMA 3DTYA 4KWCA 4Z51A 5ITVA 3FKJA 4IXDA 4FP9A 1KFKB 1IIRA 4C7OA 4HBGA 5IK2D 1Y3IA 1PP4A 1SJ9A 2JH3A 4DV1B 3VR1A 1KAGA 2NVBA 4R6WA 2Q5JA 3HM2A 1EG2A 3RR2A 4U2EA 2VHVA 2VNIA 3G8DA 4QLAA 3CUWA 1Y6JA 4ZJPA 2VQ6A 1AF7A 4KLCA 1I6KA 1TM5E 4YNBA 1EZ4A 4FE4A 5EG5A 3OU7A 5G0SA 1C7IA 4II2A 2AKAB 3ELWA 4F5WA 1N2IA 2JJ2D 2ECOA 4R83A 5CDTA 1DQPA 3LLVA 4D41A 3KOOA 4R7TA 2OK7A 1X7XA 1U0RA 4DCGA 4CIAA 3QITA 2WV9A 4JUCA 2V7VA 1WL8A 1OZAA 5HM6A 4NEQA 2X5JO 3CRRA 3R9XA 3GBSA 4HG2A 3Q2KA 5TPWA 1YZUA 2C8KA 3QYJA 4FR5A 1RPNA 3RYTC 5IWCA 2RG1A 1U8XX 1WY7A 2WZDA 3W5IA 4D9IA 5HJ5A 3UXHA 4FWIB 3E9DA 3ZG6A 1TK2A 5JADA 5HM8A 1HRKA 4KRFA 4I9NA 5LMZA 1KBZA 4JX9A 1A4XA 3PB3A 5ALIA 3ZHVA 1R9GA 4G0QA 4OD0A 3MZ0A 3AUJB 3PG5A 4GYYA 1GQSA 1PR9A 4ZKDA 1K5HA 4N8DA 3C8DA 4OHVA 4A0FA 1ZHOA 1LSSA 3WZMA 4I9HA 3SEQA 2QLMA 3A2LA 4C1BA 4DF3A 2XEDA 1KRWA 2PRYA 1K86A 1K98A 3B7WA 3FLBA 3EZ9A 3TEFA 4S1NA 3I1JA 3OPQA 5J4LA 4HDKB 3TQTA 1XF1A 2QN1A 2OXRA 1RQGA 1T1EA 3ZIAD 3I5AA 4AN1A 1PTKA 2VHYA 1X94A 4LBWA 2C7OA 2DETA 3ZJTA 3H42B 4GZ5A 1CE8A 1W4ZA 1ANKA 2UXDB 3M6AA 1YDFA 4YYEA 4I1PA 3JPWA 1K6EA 1LPPA 3IJEB 4HTAA 1N1GA 1Z15A 4UBIA 1NNEA 2RHCA 5IDXA 2PGDA 4Q9IA 5HIJA 2C83A 1TW3A 2O2XA 1E4VA 2JFGA 3IDAA 2X3UA 4B47A 3GK3A 4OXNA 3BXFA 1G42A 2CYCA 3KFLA 2QUJA 1EB8A 1W49A 3CT4A 4A5OA 3ZHZA 4CR6A 1NQUA 3C6ZA 1V8BA 4PLZA 1VFNA 2E7ZA 3FBWA 5IJ9A 1QAMA 4QNRA 2XKBA 4G41A 3BOSA 3NAGA 3A8TA 5B3JC 5K8VA 1NBME 4PCAA 4A6XA 5JNTA 4CUJA 1SKYE 2PVPA 5J2TB 1WSAA 4MKRA 5C2JB 1CVLA 1SCUA 2TMYA 3I05A 1CKEA 1EFHA 1YQEA 3WHPA 5E1DA 4EG7A 5EWJB 3UKDA 1JEYB 3L77A 4EA8A 4DVGA 5LSAA 3CZMA 4RS3A 4IJWA 4HEA1 1DO8A 4C4AA 4HQOA 2NSDA 4R6XA 5K3FA 3VISA 3PNOA 2P2CA 2YWHA 3LRXA 2ZJZA 2O0MA 2XA9A 1DZIA 1FRFS 2CE7A 3CLRC 3I2FA 5ESWA 3VMMA 2B4TO 5E4JA 3M9LA 2XQIA 4Y0AA 1RKUA 4M83A 2XZDA 5BOSA 2HRDA 2NQTA 1Y89A 4BWYA 2C5GA 4LJ9A 4OYRA 1P1KA 1WLYA 1U3VA 2C78A 2WWIA 3LCMA 4Q9LA 4Z0HO 4L8YA 2JAXA 4DIBA 1QWOA 2OYSA 2QVGA 1EFRA 3KVVA 3TDKA 4CI9A 1H2RS 3ANMA 2D62A 3DCIA 3RKSA 3T06B 1B1CA 2GZ1A 5AJUA 4NCHA 2ZBDA 1Q91A 1GWNA 4IWXA 1H2FA 4B0OA 2GHQA 5K0EA 3VUEA 1SBTA 2CUKA 2WAXA 4IUDS 4DCSA 1F8XA 4UUMA 1J5EB 3ILYA 5ADHA 5EHNA 5A6SB 2PL3A 2G09A 4H6PA 4PYRA 3M4XA 4HQRA 3VV2A 3GH1A 4D9JA 2B4AA 4P86A 1DG9A 1ZJ5A 1WBJB 3JZMA 4JU8A 5JYDA 2RGYA 4Y67A 3KK0A 3TLYA 2JVJA 1GEEA 3NUGA 1JQLB 2AJ8A 1XTZA 3PQ7A 4O4JA 3A1DA 5AW7A 3G0GA 4JL5A 1FRVA 1C4XA 3NIDB 4UUPA 3EFEA 2D00A 3BKXA 3LKBA 4I2VA 3ZKAA 3RVDA 5K9ZA 1P62B 3Q8XB 3REQB 4ZVRA 1U81A 1JJ7A 1AKTA 1YSCA 2Z9DA 4KN5A 4MKXA 4XQ9A 4IOLA 5ER6A 4UU7A 3GLFA 1NFFA 2O57A 4EVRA 4KQXA 4DM7A 1Y0BA 1FLAA 5CYOA 3JYLA 1MVNA 2BFPA 3NBKA 3BDIA 3CTMA 4I1RA 3FNFA 2FR8C 1ZN9A 3E2MA 1M7BA 3M1IA 4TWIA 2PX3A 2JFHA 3RVMA 2QQEA 4MA0A 4AJEA 3GT0A 3NTUA 1PG5A 5LZ7A 3N59A 1U6JA 2RAPA 3EVAA 4IAOA 3A1WA 3CEAA 4KL8S 1LRJA 4POOA 3TTVA 3G2PA 1UBHS 2C2YA 1Z0DA 3CSSA 4UASA 4D4HA 3FKQA 2Q50A 3ECAA 4FVTA 2YY7A 3M4JA 1X7YB 2GPSA 1JDBB 3ILHA 4FT2A 4KLZA 1O3YA 1T3LA 4R8VA 2NPFA 2ZIWB 1NASA 1NURA 2IXBA 4B3CA 1O95C 4ZYUA 1IXYA 1DTWB 4J4BA 1TVCA 4RANA 3WRYC 4I8IA 1V4VA 5EWMB 4YUVA 2OOKA 4CDRA 4Q05A 1QZTA 2P0AA 4L6IA 1UMBB 5L3SB 1JEJA 3CX8A 3WMXA 2GEUA 2B21A 4Y18A 3CZPA 3Q9SA 1P7YA 1BCSB 5EJ4A 2A5FA 3U3OA 4PTZA 5H80A 2G0NA 2JI7A 2YXLA 4YP5A 1I36A 1UJ5A 2Q2OA 1PNOA 4NPHA 4R4JA 1X3LA 2AJCA 3RFUA 1GDTA 5JCJD 4L3OA 1CTQA 4EG5A 1FNDA 4RU1A 4F8EA 3L79A 3K53A 1JBEA 4FOLA 4KV9A 2WUDA 2RGUA 3RVKA 4EFMA 4DDVA 1EFLA 4R2XA 3PUKA 1YR6A 5J43A 3PVSA 2TSYB 1QFMA 1EE2A 2PZJA 3IXQA 1XCGB 1BG6A 1HMYA 5L3ZA 1EIZA 3I64A 4F04A 3QEKA 2WHRA 4PCVA 2HO4A 4BFUA 5JBIA 3Q5DA 1M6WA 1KSHA 5K51A 4LECA 3MWYW 2HCRA 4E2ZA 3LIIA 1R9JA 3ESBA 2GD1O 4MQEA 4LTNA 3LQRA 1L1FA 3VTKA 1E7MA 1A8HA 1J20A 4FGWA 3D81A 1U8AA 5ALOA 4LFCB 5BV2P 5IZCA 4NG4A 3GLFE 4F3KA 2IE8A 2XBMA 1UFKA 2Y2VA 2Z83A 3X1DA 4UDXX 5HS6A 3ZYCA 1CP3A 3MJVA 4CPDA 3DD1A 3GDHA 2V7PA 2H5JA 2ERCA 3RRMA 5LZ4A 5JD4A 3ROQA 1R8SA 1Q3HA 1I6MA 5EUMA 3AB8A 5A3VA 2C84A 5CB4F 2J4CA 3OZUA 4FMPA 5EMNA 5F52A 4F3CA 1BGXT 1ONOA 1T6YA 1C1DA 2EW1A 3O8BA 4OI4A 1LNSA 1RQLA 4PZ9A 3PF9A 5DTEA 2F1OA 1Y63A 3O3OB 2CXUA 2DCUA 1I51A 1UXHA 3D6AA 2QW8A 3GOHA 1ODLA 1H6CA 4KBGA 3DHYA 4FXPA 3MMZA 3PLNA 5CUQA 5FJJA 3LU1A 1LBQA 1OREA 3EPJA 3GVIA 4H15A 2BMEA 4HZUB 1REQB 4IDFA 1EHCA 1Q77A 4MV4A 1CUWA 4P80A 3N5CA 1BCRA 1ENZA 4BMVA 1ZQ9A 4DCVA 4MI9A 2V3VA 3FPJA 3GUYA 1CZNA 3HKEA 4HGRA 2UZIR 1BEUB 3DOHA 1I13A 2G80A 2HEGA 4DKXA 1AF4A 2BP7B 4QDXA 1P19A 1V5IA 2ZRAA 3DO5A 1T9GS 721PA 4TS4A 2VLIA 1PR2A 3E1GA 4YUZA 3CO5A 4K28A 1HGXA 3SBDA 4EGCB 5CD9A 1I33A 4IIBA 1W93A 4PONA 3KZCA 4F0JA 1MEOA 3GV0A 5DTIA 2BLNA 3C3PA 1A9OA 4EUKA 2QT0A 3KZMA 1HTWA 1KR2A 1NN5A 4EYSA 1XHFA 1DDIA 2HHLA 4KLRA 3TW8A 3T6KA 1KHTA 5BR7A 3UOAB 4KSYA 1ULTA 3G9UA 3G0HA 2XZTA 4YRDA 3GJYA 4EUHA 4YJ2A 2YZGA 1FFYA 1V16A 2Y2UA 4QBIA 3IJPA 1LLQA 4FMDB 3R5JA 2DQ4A 4ZVQA 2E6KA 1LEHA 4HZGA 3SSOA 5LLDA 3QTLA 1LUAA 5LA6F 2YC4C 3P2OA 2IHBA 4V3CA 5JZSA 3H3JA 4ZYVA 1B6GA 1NU6A 2OCAA 3QKRA 4MWZA 1UF9A 3PX3A 4N6GA 2QRHA 3ONNA 4MKHA 2OKGA 5THQA 1VIMA 1YZFA 3HKCA 4ZQIA 3SHOA 5K8UA 3GT7A 3MUNA 3IBGA 4UQLA 3K31A 3L1VA 4WY8A 4I4TF 4W5JA 2JLWA 3LL7A 4P4LA 5HSGA 2WD8A 3OIDA 2RSLA 4KQ2A 3FYDA 2A0FA 1Y8CA 4N5HX 4YA6A 3HDGA 3L4EA 4A0QA 3AY6A 3FCXA 3HEMA 3KWJA 4J0JA 3IUMA 4JJ7A 4N9QA 2NZUG 1A69A 3DCNA 5CG1A 4NNJA 1OI4A 2AQ8A 5G0UA 2WYVA 4OYLA 2H8GA 2UV8A 1IIBA 4EFDA 2O54A 4M1EA 4DB2A 4Z4EA 3JD2A 4BV8A 2RJOA 4IXNA 5BNTA 5BNZA 5KNBD 3U4IA 4C0QC 4CU2A 4F3RA 4CEHB 2XRMA 2JAWA 3F46A 2GCPA 2UYYA 4E22A 1J56A 1LJ8A 2CXRA 3DE1X 5T57A 2VT2A 3DBOB 3FWKA 4B4DA 4B0PA 4MGKR 3KFVA 2Q5EA 4FFNA 4JLJA 2E87A 5EKUA 4RLSA 3GRUA 1FVFA 1EPUA 3BICA 1FFXB 1RMYA 3CURA 2OWEA 3P0IA 5ISMA 2VPWA 4PHFA 1QX3A 4M7RA 1WW3A 1RVV1 1VL6A 2QTMA 3SYLA 5FA6A 1N5RA 3FYUB 1WS6A 3PCXA 3CW2A 1T6ZA 5CURA 4S3MA 5HKLA 3T41A 1C50A 1VHJA 5KU7A 2GEBA 3L8GA 1XV5A 3DVQX 4I1IA 1AMOA 5IBPA 4H08A 2C20A 3SG0A 1ZNWA 2GCOA 2BFBB 4QPDA 5LQKA 2COKA 3HBAA 1QE0A 2VAWA 5JAQA 4HPJB 2BF4A 4TXLA 4MIOA 1SXJE 1M75A 2FR8A 3E5MA 1EGVB 3B1XA 4P84A 3SWWA 1TGYA 1QYDA 2UUBB 2P91A 5JS1A 1LS6A 4X8HA 2B20A 2WDZA 3EFOA 4DCJA 4X61A 1EUQA 1PQWA 4DUGA 2JLYA 2G72A 3O8DA 1XN1A 3M3HA 2X7HA 3B7GA 2VAPA 1Q7CA 4JT2A 3CRZA 4EO9A 3D3QA 3A31A 4JL8A 5BYBA 3Q5GA 4WT7A 5AKIA 4B3RB 1XCOA 1ZIPA 4JN6B 4IV0A 2IP1A 3MCVA 4TYPA 4DCNA 5BURA 5IVPA 3U7HB 5COBA 4ID3A 1T3SA 1ID1A 3GCGA 4ZOBA 3JPYA 2VSOA 2KHZA 4BFXA 1JDUA 4YUXA 2BFFA 3SD7A 2ETXA 4D74A 1YQDA 2IGTA 3F4BA 3A3NA 4HN2A 2J5QA 5JNSA 3M6WA 1T4CA 3EXIB 4CEHA 2YJZA 5EGSA 1NXTA 2HRCA 2GM5A 3FPFA 4AY2A 2H0AA 5LCXA 4HBZA 4E5YA 1DP4A 1XDWA 1QYRA 1LK7A 3EG9B 3AR7A 4MP8A 4OSOA 4AJJA 1OW3B 1JR3A 1UJBA 4XIFA 5HE8A 2QVCA 2Y1LA 1USGA 3AKCA 3WFIA 1L8LA 1I0ZA 1VJ1A 3E3LA 2G04A 3VR5A 3R77A 3HVRA 2V7QA 2H5IA 1RI2A 2Y1XA 5TQVA 4I4TB 1RHJA 4LI3X 2VPZA 2ZT5A 4XR9A 5LQDA 1JFTA 2VCEA 3OE1A 1L7MA 4BKRA 1E1YA 1U5AA 1S2GA 2N0SA 1NLYA 2R1UA 4UDNA 4WY5A 3WADA 5BNIA 2XGSA 2FZ4A 1I2MA 4JDUA 5DYGA 3UUFA 4UDYX 4PGMA 1JSCA 4I46A 5E6RB 1L6RA 3K72B 5KJFA 5JAIA 2E4XA 3NM5A 4GNRA 5CMLA 4RMJA 4BRWA 3MJEA 4YQFA 2WFAA 2WSMA 1WB6A 2AQHA 1E3MA 4M1OA 5EIFA 2JGAA 3BCSA 3I09A 1EUZA 1CETA 2IHUA 2W11A 3DOFA 3Q12A 2VYFA 3QXGA 2QAGA 2QMEA 3EH1A 3KDPA 4QGBA 1TM4E 2ZRKA 4GOOD 4XQGA 5E2IA 1IWOA 1EDOA 1ONBA 3UW1A 3U0BA 4L8LA 2C2MA 3OTGA 4G97A 4ND1A 4QNMA 4L74A 4Z9BA 2I9KA 4R9RA 1GKKA 2CLLB 1NW7A 3R3ZA 4FILA 2NSHA 2Q6OA 2X5NA 4YMUA 3WRVA 5F64A 2QJTA 2GEVA 3DGEC 3PFCA 3WOVA 4X3PA 4WBNA 3WGQA 2JB9A 2OC4A 2ZB2A 1UWLA 1KNQA 1ZU5A 4GQIA 5DGIA 2ZPAA 3L6CA 4QTYA 2ZJAA 3JYQA 2J4DA 1ZGJA 1U7HA 2WAMA 3FAZA 4XDGA 3NC4A 5LP6A 5HMMA 3ZWVA 1X1DA 5DWVA 2EERA 1PI3A 1SQGA 4OP3A 1TC2A 1SUPA 2XKAA 5EQJB 3U1BA 5CD1A 2H11A 3M4NA 1EWKA 3GEGA 2IIPA 2Q6TA 1H5QA 4YB8A 3T3PB 1PUJA 4Y0NA 5LB2A 3DWFA 1QZZA 1YDWA 1L4GA 2Z2ZA 3LSYA 7YASA 1OWPA 4WN3A 4D3YA 2Q3BA 3O9ZA 1RRCA 3GLQA 3BVPA 3I39X 3PE3A 4OXRA 2ZREA 2VDLB 3PWZA 3C7CB 4TMTA 2JLUA 4ACBA 4UVDA 2BAGA 1BW9B 2PK3A 4LKOA 5TE9A 3WDKA 1GNRA 2Q3FA 3ITDA 1RYEA 3JQAB 4Y2RA 5B37A 3WZLA 4J7UA 4IFEA 5MGNA 4NESA 2WIGA 3BX1A 3TTSA 3L0BA 1XTBA 1K5PA 4PBTA 4CKZA 3ZNPA 1H8HD 1O89A 2ZU0C 3L4BC 5KTYA 5EJMA 4L2IA 1PCXA 1TMOA 5IVHA 4DJJA 2XEXA 3HCOA 1G66A 1GP2A 3L4SO 2NO4A 4HUJA 3DMYA 1O7JA 1M34E 2AHOA 1QANA 2JCSA 2ZM6B 1CHDA 1C29B 2OZLB 2EDAA 4AYTA 1MC4A 4FQ8A 1P2TA 2DKFA 4E13A 1I3LA 1NYTA 3MTGA 2A67A 2J3EA 2QW1A 3LWDA 1V8PA 4E5NA 1X7HA 3KUKA 1ZD8A 2PD3A 3VZQA 5CDHA 1QWSA 2CSUA 4IZHA 4FS8A 3EEOA 1FTQA 1XEFA 4DE5A 3R7DA 4G23A 4R7GA 3CF6R 3HJCA 4P32A 4KQWA 5K0BA 4Q3EA 3DLIA 5GIOE 3W5SA 2DFKB 4FEGA 5HILA 5TF0A 3STXA 5E0OA 3AM5A 2P6NA 5AHXA 3RIYA 4DGQA 4QULA 4D02A 1NG9A 1DGQA 2JJ2A 1C9YA 2GARA 2C95A 1JFSA 4A23A 2I5PO 3K0AA 1HKHA 2DTEA 2VNJA 3M89A 5CBPA 1J8MF 2PLRA 3C1UA 1NC3A 1Q22A 5FAKA 3VDNB 3DMPA 3KEOA 2VJCA 4QODA 3IAUA 1Q7EA 4RUKA 4WXMA 3TQHA 2JLCA 4B3JA 4YN3A 2VUUA 5J9FA 3NHPA 3SE7A 1XYVA 2C3UA 4K0RA 2CNOA 2JGJA 3A1SA 1GZ7A 1AHNA 3D4OA 4UUQA 3SVLA 1RMQA 1T8WA 1DU4A 5HGXA 2WNHA 3R6LA 3RG8A 1WY5A 2I4RA 3C1AA 3IHWA 5D01A 4IGFA 2A3RA 4FS3A 3CUYA 1QDLB 4W7IA 1UPAA 4Z4FA 2OV3A 1ADFA 2AKYA 3VPSA 4PLVA 4DCOA 5IPFA 4YCJA 1NF8A 1NZJA 3RJZA 3UG6A 1ZJ6A 4A6DA 1U9IC 2IIVA 5BUQA 4M9SA 2LTAA 3IL2A 1AA9A 3FI9A 2Q45A 4NJEA 2HNBA 1UK7A 4FKBA 8MHTA 1TJ4A 4BAZA 3OLVA 4ZZ3A 4EF6A 4O08A 2WUWE 1IU9A 5IAKA 5GINE 1R6TA 2B7CA 5FV4A 1E3QA 1HLFA 1OBOA 2GZ3A 3K4PA 2FMIA 4I2NA 3SC2B 1XVUA 2C7GA 2O0KA 2PWYA 5AM0A 3SM3A 2XMBA 3DDSA 2EKDA 1AGRA 1TUEA 5TF4A 1H42A 1J7JA 4NYMR 4Q18A 4H3KB 3QHQA 5HCUA 4BX9A 3R7WA 1A2BA 5ARDA 4LXYA 1ADJA 1P73A 4CW7A 4C30A 1N0UA 5LZ5A 4EPRA 3L6UA 4P1ZA 3H4IA 1QLJA 4S1PA 3IMEA 4OJNA 1Q3TA 1CY4A 1U1CA 1WCWA 3K9QO 5F5NA 5JI2E 2YN2A 3PVCA 1KRXA 3BL6A 3ZZNA 4A1FA 1GDHA 1HMPA 2JC3A 2OGZA 2WJGA 2X6QA 4MR7B 8ATCA 5JH7A 1E8DA 2VH2A 3F67A 1IQ0A 1U0BB 3WXBA 2PZBA 1NKSA 1QVZA 3P9KA 1OLUB 2I54A 3ORQA 2Q9BA 1W29A 1POXA 5I4KA 2AB0A 3O1LA 2HWWA 2W6PA 1TAGA 3D5EA 3DNPA 2MSCB 2C07A 2SECE 3ZC3A 1GN8A 4ISBA 4BB6A 3TQCA 1YOVB 1Z38A 3QELB 2PZMA 3QX8A 3OPYA 1KSFX 4ZAFA 4Z4CA 4CI0B 2XXJA 3U7RA 4BWFB 2CBGA 4V2UA 1DWUA 1KYZA 1EWYA 1K6IA 2ZSIA 3EDMA 4UM5A 5JLJA 2HREA 1YZNA 2VC2B 4G5HA 1PL8A 3ZDXB 3U62A 1V43A 3N53A 4IO0A 1L4NA 1E63A 3V3TA 1KMCA 1LXCA 1ZU4A 2D8AA 3O4GA 4MTCA 2JF0A 3S29A 1Z4JA 3ESZA 1DADA 2A5LA 4WNAA 1MQ8B 1CLEA 3OY7A 5T4FA 4DMKA 1IY2A 3MIIA 1RWXA 5CBKA 4BNWA 4RLHA 1C9MA 4ZOQI 2PVSA 2BGMA 1TQDA 1L4UA 5T3UA 3B89A 3EVEA 3QUCA 1UWKA 3UMRA 4TKVB 2QPOA 4X7MA 2Q5HA 3S2GA 5B30A 5FUYA 1Y7TA 1BMDA 3PJFA 2PJUA 4JENA 3C6QA 4TLAA 5FBVB 3SIXA 5KMGA 3QVXA 5D7NA 4C2BA 1QE5A 1BD3A 5BV0A 5CXSA 3DUFB 3B12A 1O1YA 1UDCA 4D4KA 4DJ5X 1DRJA 1TTPB 1DQRA 4IEIA 1WHSA 2W22A 5C52B 4DPMA 1D9ZA 3TL2A 3SN6A 1A3CA 3CHYA 1Z2NX 5F76A 4K6CA 4AZTA 3H0KA 1JEQB 4CDMA 1W1WA 2O3JA 2VJDA 4L5CA 4PYMA 4YJ3A 5ESDA 5BOVA 4Y2XA 1NRWA 1T2FA 2HMAA 2N1MA 2P4HX 1SD5A 1W34A 1ORHA 2IPMA 2YBEA 1QV7A 3GRYA 1JHOA 2MIIA 2Z2XA 3WHIA 4AKSA 1G6KA 5AJTA 4I1VA 3FETA 2P2ZA 1XQ6A 3TI7A 4J4TA 1KMMA 3CS3A 1WMAA 3IE2A 1CUAA 1RWQA 1Z45A 2WA1A 4JQSA 1E9BA 4P7FA 4TUYA 1SC3A 5L4LA 1O58A 1I7LA 3NDJA 2ZSEA 1CLUA 1VYTA 4ECEA 2MINA 2FLVA 4DAEA 4TTRA 4GDFA 4X97A 3GLRA 5B57C 4LZJA 4JXKA 1QU2A 1GGKA 2ILVA 2BEVB 4I4NA 4REQA 5ARBA 3SJZA 2V6FA 3STYA 2D13A 3OA0A 4LV8B 1QCCA 2XE8A 3AB7A 3O75A 4U6NA 4G63A 1YHYA 3EWNA 1B00A 5CHEA 1MAWA 3ORHA 2A92A 3JQRA 3EIWA 4PC3A 3AJDA 1NUTA 2WUGA 3MHPA 1M6VB 4K46A 4FMCB 3T61A 5IJ0A 2WUVA 4CLHA 3AW8A 1G6HA 3O38A 5TS3A 4EKGA 4D7AA 2CHEA 5BPFA 2VBGA 1SRRA 3QVVA 3TXAA 1ZN2A 3ILSA 5AKXA 2A9RA 1DCKA 4O59O 4OQLA 1FLVA 2HBRA 3WRXA 2P0EA 1QIEA 1THZA 3UWDA 1U9CA 2JLZA 2PGIA 1N8NA 4GOJA 2RGGA 1IXRC 1XC7A 4FFWA 4EB8A 2I2CA 2EQAA 2EW2A 2FWAA 2YHIB 1UPFA 1LA2A 1UC8A 1V11A 2FCRA 3DV0B 3ZE7A 3UK2A 1CX9B 3AEYA 3RBVA 4AU1A 4P0QB 2B5WA 2OM6A 2QG6A 4QRHA 3SYRA 2B8WA 3PLAE 1E96A 4LJRA 3WBBA 2DHRA 3Q88A 3B7PA 3SXUB 4C4SA 4TT8A 2R7NA 3FFAA 3LT0A 2B92A 1KVTA 4MVJE 5FPTA 3OT5A 3RVBA 1IQPA 2ECPA 5FO1A 2Q8PA 1T10A 4ND2A 4YP1A 3AFGA 1QKIA 2J0SA 1MX5A 5CYFA 1N4AA 4FCVA 4HVLA 3FPLA 4E7OA 2B2CA 2R7AA 1VMEA 1SHJA 2FJPA 1QNFA 2G36A 2PZEA 1PRYA 2R96A 2WIJA 3Q4GA 1AGXA 4KIGA 2XIJA 1DKPA 3M0EA 4HB0A 2OILA 4RQTA 4Y30A 1WM1A 1MO3A 1UBTS 1WCXA 3QYAA 4M76B 5LA6A 4N65A 3H18A 3NHRA 4XTCS 2Y27A 3PXAA 4O4LA 3TRHA 1O94C 3AOEA 3N86A 3JQGA 4QIHA 4BPRA 1BS1A 3ICVA 2CEAA 5KTTA 4ZTZB 3FTPA 1R0SA 1SWWA 3OQBA 4G1VA 5ALVA 3FWHA 2PSHA 2BJWA 1DARA 1C3OA 1ZWLA 4DT1A 2XOKD 3K30A 1L5HA 3MLEA 4KGXA 5T4BA 2J7KA 1K8XB 3QVGA 3PGLA 1V95A 3DE0X 3H11B 1AQIA 5KJ6A 2J41A 2GTIA 1N2XA 4KN9S 2E4WA 3F8TA 1DX9A 5DGXA 2C7VA 3WGMA 3THYA 2FW0A 5DPMA 5LQMA 5J2TF 1MMFB 2Z2JA 4ZAGA 2PL5A 5KOYA 3SQXA 3KAJA 1OQAA 3L7BA 3HO8A 3THRA 3M3PA 4PFQA 2D3WA 3RAGA 3IQWA 5TEVA 3S28A 5CXUA 3K8QA 4ER5A 3RS4A 2OHVA 1T6NA 5AHWA 5KDDA 3ROFA 1SBNE 1TD1A 1KAEA 2NSLA 5EMLA 1W88A 1YQXA 3TR6A 1E1RD 2VDNB 1E2BA 2IA5A 4IY1A 1FXWA 5IAOA 4Z4IA 1XZMA 2KS6A 4FXOA 2X9GA 5A04A 1SM4A 1C8LA 4HDAA 4XFDA 1ZSNA 2C4HA 3EXHB 3F3MA 4H7IA 4KDRA 1S89A 2GDJA 5AKYA 1SUFA 4JVMA 3VU8A 2XBUA 4CKWA 4RHFA 5A1JA 4J3FA 1GAWA 2A94A 3H9CA 1JKIA 2W2NA 4Q3KA 1KSGA 3UAOA 4AMGA 4X44A 1M1YE 1Z75A 3OAAD 4I9GA 4C14A 5LN1A 1C30A 1V0JA 1V37A 3KEMA 3VZPA 5AVZA 2V7XA 2WZQA 5IKMA 2YYAA 2DAPA 1R0YA 3BMQA 1GA1A 3KL4A 3LVRE 1TVKB 5L3QB 3KV3O 3E58A 3B6MA 5DULA 3WBFA 2YNMC 2FMUA 4GLOA 2XR1A 1ECFA 3DEIA 3VZCA 4Q1EA 2C2KA 2HAEA 3IB6A 1QP8A 1XDSA 4JROA 2SNIE 1U0EA 1XPRA 1UQTA 4WOPA 3VH1A 4M46A 1I32A 3UCFA 3PKIA 4KFUA 1D4OA 2P4UA 3DLBA 5C3MA 2FX2A 2N42A 2WMOB 4HDSB 3U3DA 2HDHA 1FP4B 2E18A 2X2OA 4QPJC 4KAAA 2E0IA 4CM5A 3CPHA 3FNHA 2JJ1A 2E4UA 1PKEA 1ADGA 1CNFA 1Z47A 1B0ZA 1ZA1A 2WYHA 3BAZA 4JOQA 3L7KA 3CSUA 4Q4HB 4W6ZA 4CF4A 4WJLA 1NBIA 3EDCA 4HDMB 1KFBB 4RPCA 4BQIA 3N70A 4MB2A 3SIRA 4PQYA 1UK8A 1EIWA 3CUVA 4XGIA 3TRJA 3MELA 1E2MA 1BOFA 3VH4A 3OC0A 5ERGB 4I8DA 4MRAA 4XXHA 3EVDA 5TQ0B 2QLNA 4XJXA 4UNRA 3T9DA 4NX2A 3CPSA 4RA6B 4BNZA 1U4NA 2I3GA 2QZPA 4PS1A 1VPTA 3VNBA 4BJ6A 4F9EA 4JJ6A 4UEKA 2FPKA 2LW7A 1M0WA 4L50A 5EAIA 4CF3A 1YV9A 3DEJA 1JWBB 3GCXA 3LPDA 4AUKA 4LE0A 1GGNA 1EUDB 4XD7A 3HI6A 4HAOA 2GAFA 1QVWA 1R8QA 1G7SA 5CJPA 4AX4A 1JH8A 1LTQA 4ZOLB 2Q0HA 4OHUA 1HDCA 4BO2A 1Y1SA 5CIYA 2REQB 2BBSA 3A4TA 3HB5X 4MH0R 1YL7A 4LJAA 1V39A 4E4RA 3IIIA 3OKAA 1W0JA 1WV0A 2FP4B 2RC5A 4LDNA 3NYWA 1NXVA 4DYHA 2JIZD 1NWCA 4H59A 3B9PA 5DB4A 5HFAA 1TEXA 1PGNA 5BR4A 2PBFA 2UXBB 5D8DA 1V9LA 2IOFK 1JSLA 1M66A 3ZHQA 3BQ9A 1B26A 1KI2A 2NO0A 2JD2A 2RB4A 4QUAA 3HKBA 4UEJA 2VJLA 2PXAA 1E94E 1MNQA 2IDKA 4QNNA 2HH9A 1WXWA 1W52X 4AECA 3KZOA 4INAA 3WLAA 2P27A 2H1VA 3AEKA 5GPBA 4R31A 4RJJA 2NO9A 1PD0A 2HYDA 1PD1A 2QGNA 1NQAO 1VZ2A 1ZH0A 5F51A 3UWOA 4ZI7F 1FS6A 1GKIA 1YHNA 2EJUA 4RA9B 3P71T 3P0FA 5I8PA 3AO0B 1ABEA 4JLAA 4GYJA 4ZAWA 4PCLA 5KJ1A 4XEHA 1MOPA 3RHSA 3QF7A 1ISIA 2GPYA 3V8RA 2OCIA 2XSZD 4Q4AB 4J9UE 4W63A 4D0RA 1INLA 4ZGGA 3E3AA 1K3UB 1KEUA 1DCTA 4C3VA 1F6WA 1H9CA 3AEKB 4FYHA 3ZX4A 5C7OO 2VS1A 5CW1A 3QOXA 1RAFA 2IUEA 4GOKA 1HT3A 5DRTA 3WK4A 5M7EA 1CIJA 2WIAA 3D8TA 1WVMA 3GQBB 1XP8A 3GA5A 4XE5A 1VP9A 3SZLA 1C9DB 2HCBA 1BX1A 1PK7A 3B3JA 3CXUA 4IX9A 4HMQA 1A77A 4QJ4A 1YL5A 1XMQB 3LRTA 4RZXA 5JD6A 3P9ZA 4HRAA 3IURA 1OIVA 3NH6A 4GGPA 3DB2A 1JZTA 1U31A 3B60A 4I4CA 3AP2A 4G5QA 2DT5A 3THSA 1NVGA 3GGJA 4F5ZA 5C4IA 5EXXA 1PGOA 1DV2A 2QMZA 2IEGA 5JMOA 3LA8A 3RGWS 2WEKA 4QJBA 1JIJA 4BDSA 3JATA 3TSZA 1Y4DE 5EWMA 4QGGA 1SK8A 1COWA 2EX4A 4IRMA 2QZJA 3D2AA 3ND9A 4PYQA 4Q39A 5EQFA 1M1YA 3RV3A 1KOJA 1P44A 2Z3ZA 3LUGA 4BE4A 2O59A 4HLUA 3MBOA 1P3DA 1IY8A 4JJFA 1EVKA 4OB6A 1Y8RB 4PLHA 5AW3A 1P2GA 4HB4A 4Y1EA 5KYGA 2OYCA 1HYQA 3I5MA 1TA4A 1W2WB 2DY0A 1K2VN 1MX9A 1TT7A 3V4LA 3RLFA 4AUMA 3FR8A 2CWWA 2P7HA 1Z6PA 1T36A 2QYTA 3HY4A 1MAAA 4UW9A 1NBWB 1UKZA 2VRWA 2R6GA 3V1YA 5JJBA 3HXMA 1RQ2A 1L7AA 2A2ZA 4ARSA 3FB1A 3P0HA 1JIIA 1AZLA 2ZR7A 1U28A 4O4JF 4YYZA 1L5SA 1SH7A 1Y1QA 3D2LA 3SC6A 3WJAA 5EXTA 3WLQA 3WA7A 3CR7A 3O03A 4AJ1A 3MTBA 3TUIC 1NF2A 5KEIA 1EXMA 2PO7A 4NICA 1G18A 1QUEA 5AJWA 5HOQA 5KU1A 2H5LA 5HQ3B 5ADVA 2J33A 1DB3A 3PNVA 2XUIA 4TUYB 3WGLA 5B1EA 4DR6B 3F6BX 3DL7A 3TBHA 3HFRA 3VYVA 5FTLA 4XVHA 3B2EA 3G7NA 4UJ5A 3LDAA 4D79A 3Q1KA 5FNZA 4Q37A 1ZVVA 3K16A 4EHKA 2IU4A 2WSBA 4JLSA 1HDEA 1YDGA 1RI4A 3ZBPA 1T4MA 2FOLA 2NGRA 2IZ6A 2C5AA 1B8OA 3GROA 2YHAA 2WMNB 4FYPA 3BD7A 2E82A 3FB4A 3SYNA 2VQ3A 4IH9A 3DVAB 3HCNA 3O1JC 2P9ZA 3O94A 4TN5A 1ZH4A 1VJGA 1P31A 1Y8QB 4HHEA 1TB4A 2H2AA 1BQEA 1F5NA 4RFSA 1UP7A 5DX1A 3WNBA 4EFLA 2BEJA 3TR0A 1PT9A 1G8GA 1G9TA 3MBKA 2I6GA 4J1NA 1G5HA 2ADOA 3K70D 4RE5A 4EUFA 1NDUA 1W5TA 2DWOA 5E3JA 5JC1A 3ZGNA 3DZKA 3ND5A 5HBGA 2P1DA 2PQMA 4WASA 5EYPA 3W8FA 4IUBS 1UP4A 5ARCA 4OBBA 4B3GA 3DMFA 4LRXA 3ITNA 4GE3A 4JP8A 4D43A 5KNLA 2J3IA 2R8ZA 5D1HA 3DF7A 2FWRA 1UKEA 3FZEA 5CHYA 4F9GA 1ATIA 3OICA 3VHQA 4HGPA 2FYTA 1CUYA 3T1OA 4C05A 4DABA 4IVRA 1CZOA 1GT91 1Q11A 4D6XA 1V8FA 4F85A 4ZC8A 3UPTA 1LVHA 4JBGA 2NUTB 3W4IA 2QM3A 1Q16A 4OOEA 2ERYA 3UWSA 2HCTA 2IX9A 2HU5A 3ICEA 4TL9A 4TS1A 2C7QA 2R6AA 5KNDD 4CM6A 2FPUA 3NXKA 3QVJA 3WBJA 1JR6A 1Q0LA 5HK9A 1NHGA 1QSGA 3VNVA 2PUCA 1SHKA 4Z4HA 1HRDA 1M34B 3WIOA 4R71A 2E37A 1YMVA 1EJBA 2V3CC 3F7TA 2P4SA 3U26A 3VXKA 1CR4A 4HLNA 2C9YA 1Y8QA 3A9WA 1PO7A 3ZWKA 4CTOA 4RXMA 2WWTA 4V1CA 2OXCA 3GVHA 2GK4A 4KQ9A 4X95A 2UXCB 5G0TA 2ATEA 5F7JA 3X1ZA 2PT6A 3C3JA 1CVRA 1T91A 1EAMA 1LTHR 2B35A 4OEHA 5AR1A 1MR3F 4OHMA 3IIJA 1SHLA 2ASEA 2YJGA 4DARA 4W1PA 4DUZB 1WMDA 3EVGA 4O1IA 3UB2A 3N9IA 1QO7A 1ODKA 4O2RA 1JPUA 2WWVD 3X2SA 5CP8A 1RCTE 2DHQA 1AC5A 1MJGA 2CLHB 2I99A 2D0IA 3TKAA 2B0JA 5JV5A 2I3DA 2WWYA