2CMKA

Cytidine monophosphate kinase in complex with cytidine-di-phosphate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
b'AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
publication title Structures of escherichia coli CMP kinase alone and in complex with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 1998-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cmkA00
2Q3HA 3L0PA 4MGKR 1J99A 2D2FA 2QAGB 4DLUA 5J47A 1CEEA 2HF9A 2BWJA 5DYGA 3T1OA 1MO4A 2NO0A 3I32A 3EZ9A 2BEJA 2HUPA 3O8DA 1JALA 4YMUA 5JJLA 5KDDA 4RJLA 5SZHB 2GEUA 4EKDA 3VR2A 2JJ8A 3NKVA 2F1RA 3R8FA 3H2YA 1E2IA 3AUXA 4IRUB 2FFHA 1QDEA 2ZVQX 1N6LA 3SJZA 1GNPA 5HE9A 4BFWA 4EPRA 2IS2A 1L2TA 1TMKA 3LQRA 1RRFA 4JSTA 2C9OA 4TMZA 3GP8A 5DNYB 1UBGA 2WWXA 2GK6A 4PPFA 1TUEA 4CEJA 3IHWA 2BVNA 1GNQA 4MRPA 3EG5A 4GOXA 3S1AB 4HATA 3HYTA 5SZIA 4PAQA 2XZOA 1TADA 2ZU0C 3F8TA 4C0AC 2X2FA 3QG1A 2ZRMA 2ZJ5A 1ZNXA 1P4SA 2G0TA 5CLLA 1AGRA 2IBMA 1OH8A 2WHXA 3GLHE 1E9AA 3CNOA 5JWOA 2C78A 4PTLA 4QBGB 4DCSA 3L8ZA 3GLFB 1DADA 1OH6A 2NTYC 1US8B 3DM5A 4XWAA 2DFLA 4MRVA 3U3OA 4L9SA 3KDSE 5KO2A 3A8TA 4C0KA 2GESA 2B8TA 3M0EA 4MKHA 4NCHA 4TLCA 3IPXA 1EK0A 2FU5C 1XTIA 2ZSEA 3HYRA 2H16A 2ZSFA 1IM2A 3DKPA 4MITA 4LHZA 4TSFA 2ZE8A 4YMSA 3M1IA 3RSOA 3SFVA 4US1R 3TUIC 2BOVA 1U94A 1QHHA 3GFPA 1U9IA 3WY9A 2CVHA 2R6CA 4I81A 3L8YA 2G88A 4BFXA 1HE1C 4TYQA 4BUJA 1QHYA 2WJVA 3B13B 4M1OA 1S3SA 2B6HA 1G291 2QORA 3W8RA 3GJ8A 2XX3A 3FHTA 2UZIR 2Q21A 2GHIA 3FB4A 4BLPA 3TH5A 2AK2A 3NWJA 4YMVA 4P32A 4PFSA 3IBGA 2OBMA 4QGGA 1RPZA 1DG3A 5IHPA 5CK4A 1DBSA 4CEHB 4Q03A 3KL4A 1S9HA 1G1MA 1T3HA 4R2HA 3CRRA 1D2NA 4Q9HA 1SXJC 2XOKA 5DIFA 2VO1A 2J87A 5G53C 2IA5A 2FJUA 3B78A 2CBZA 5BYKA 2IYUA 1GNRA 3IHLA 1W0JD 5GJCA 2BBWA 1J2JA 1JECA 3O8BA 4LV6A 2GA8A 5DI3A 2HCBA 4PC2A 1R0YA 1NMYA 2ZTSA 1X8LA 1KSJA 1Z83A 4B35A 1IY2A 2XAUA 3QE0A 4DKXA 4AD8A 4UXJA 5DLQC 3AF0A 4EPVA 1BIFA 1P6XA 3SYLA 2YVUA 3U3RA 2WWHA 3GMTA 3NTUA 2ZRHA 5KNBA 3LXRA 1R8QA 5SZJA 2HLDD 2IYXA 5TV2A 3GJ3A 2AWNA 4DB4A 4NKRA 4B33A 4LDJA 2WM9B 1YJ5A 5G40A 1NBMA 2ORWA 2ZAMA 3E1SA 3ZVLA 5HCNA 4KFSA 4TYNA 4AYWA 2NO6A 3NDBB 4Q4HA 4F7WA 4G0NA 2QN6A 4D0LB 4NMMA 5CM9C 1L4UA 5CM8B 1CKEA 2F9MA 4LHYA 4ZIRB 4U5XA 3FMPB 4KYIB 1TTTA 3EIEA 1KSHA 3GLFA 4LYAA 4MRRA 4C0JA 2MMGA 3ZJYA 2NZJA 4URXR 1NG1A 2ZPTX 3QBVA 2Z4RA 1Y63A 5TDHA 4LBWA 3GJ6A 1TQ2A 4R9UC 5TMPA 3I5XA 1MR3F 1N6KA 2ZU6A 4GMDA 4TYYA 3FHOA 3ZH9B 3MRSA 5SZKB 3DDCA 4FD2A 3OIYA 3IGFA 3O47A 1NN0A 1CRQA 3OHMA 4MKFA 1XXHB 2WWIA 1T3LA 1JJVA 3WHKA 5AUOB 1Z5ZA 1AJEA 3TR0A 1QHNA 4O0MA 3ASYA 4Q01A 2WPDD 4D6PA 3B82A 2WV9A 4JLKA 1G7TA 1G3MA 2XJ4A 1LNZA 3Q85A 1IJFA 3KZ1E 3VKWA 4GI7A 5TB5A 2O8CB 2AFHE 2PEZA 5A0FA 2IS1A 1X1RA 4CEHA 3UATA 4XOIA 5C4GB 2JLXA 1W48A 2VEDA 3RC3A 4FN5A 3LVQE 3RAPR 4GP7A 2C95A 2ZRFA 4B48A 3RDPA 3FGNA 5JBQA 2QTVB 5A4JA 1NF3A 2JEOA 1XCPA 3QPWA 1F2UB 1ZC4A 521PA 2PL3A 3NBXX 1R5NA 1M2OB 4LRWA 3FHCB 1N6HA 4DCNA 1E6CA 1W5TA 1TEXA 4EQ6B 3GLHB 1CR0A 4MKIA 2QGZA 4JJKA 4UXHA 3QKTA 4AKEA 1KMHA 4V03A 2JIZD 2JASA 1GOTA 2A7QA 3SC3A 4BFSA 5K8UA 2V6IA 3RRMA 4A92A 1GKUB 3KUCA 3ZIAA 4YMWA 3MWJA 5E7IA 4POAA 4U00A 1Z6AA 2AK3A 4JSYA 2W00A 4D4KA 1UBFA 4GZLA 1MT0A 2GBLC 2Q9BA 1JJ7A 2W58A 3PEVA 3A4NA 1FX0A 1ZM3A 2QL6A 1GL9B 1OW3B 3CPEA 3AH8A 4IEEA 4NZYA 3FMFA 3A1UA 1CS4C 3U7GA 2FPLA 2W6ID 1VG1A 1KI4A 3AKCA 4M22A 2DFNA 5EXTA 2F1JA 2C9CA 5JEDA 5FOVA 3OF5A 4B6FA 3GLIE 2J1LA 4MQBA 4HYYA 5DN6A 4BWYA 5K8TA 3MD0A 4PO8A 5D3MA 1KIMA 2G1KA 4TTQA 5H8WA 4GDFA 4BLSA 2PX3A 3VX4A 4Z51A 1QHSA 2Z0MA 3ZVNA 5M04A 1XU4A 2QQ0A 4LJ7A 2KBEA 4ACBA 2KWIA 2KBFA 4Q47A 1M6NA 3IPYA 3IBYA 1E9FA 1CJVC 3PEYA 4D0GA 5J4YA 2NO1A 1V43A 3DO6A 1CU1A 1J8YF 2RGCA 3R20A 1XTSA 3HU3A 4ZPXA 4TTPA 2WAYA 4FCWA 2WTUA 1GAJA 3I62A 3FKQA 1II8B 1W0KA 3PENA 4KVGA 2ZYWX 2D06A 4QKQA 4QNMA 1FQJA 4LV8B 1KDPA 3K0CA 2OBLA 2GRJA 2Y8EA 4PAOA 2IS4A 3G5UA 3OEEA 1D5CA 2R6FA 2HXYA 2REOA 1PLKA 1YE8A 2IYYA 4WA7A 2HT6A 3B2EA 3HPRA 3EZFA 3T5GA 3W5IA 5JWRA 5HR5A 3OFNA 2OCYC 2J0VA 5GJWC 2V55B 1XJ0A 3PEWA 1SVKA 2YHSA 3TQFA 4WAUA 3K70C 2B7BA 4NTZA 4MYUA 2P6RA 5CIWA 3HU1A 3AF1A 3TNFA 2AXPA 1KI7A 1RIFA 2XZPA 4QJ5A 5FTMA 2P5SA 1E2KA 4M4SA 3TKLA 1EX6A 3FTQA 1HQCA 3ND9A 5FL3A 4TZ0A 4LK2A 4DT1B 5KSYA 2JA1A 4HDCA 3Q5EA 3PXGA 1HQYE 5CITA 2PJRA 3LVRE 3BIFA 2WZQA 5FOTA 2ZITA 3AKEA 2OE2A 1Z22A 4DLWA 1W4CA 4NBSA 3AP1A 1DE0A 3P32A 2PX0A 4QGHA 1SVLA 4X8HA 3VU9B 2DWQA 2OESA 1XFAA 5H68A 1RRPA 4DB2A 4KFRA 2JDID 5EE1A 3Q7PA 1XPOA 1ZM9A 3X1DA 2H5EA 1GRQA 1UKYA 5FUXA 4US2R 2VSXA 3LX5A 3AVXA 1N6OA 4Q1CA 1NJGA 2V3CC 2QPAA 5HKKD 2IYZA 3KQKA 4MGYR 3OIWA 2ZJ2A 1E2GA 3VHLB 2QP4A 2GWHA 2GJAA 2PLFA 3NXSA 5DISB 4NU0A 5EE0A 5B30A 2B8WA 1WQ1R 2DFTA 2PBRA 4Q00A 3WMFA 3QENA 4IVQA 2Z5FA 1FP7A 1TPZA 1GWNA 3LO5A 1R7RA 4ZKEA 2ZSBA 4RZUA 1G5RA 3OAAA 4PC6A 4C7OA 2KE5A 4RZ3A 1OIVA 3MJRA 1COWA 4CIDA 4Y0VA 4A6XA 3Q8XB 4XVQA 1HEIA 1WB9A 4GZMA 1WP9A 1CF4A 2OT3B 4DLRA 2E87A 2PT7A 4DIEA 5B57C 5BN3A 2GCOA 1V5WA 1X3SA 3CONA 2QSZA 1XJCA 3FKSA 4KAXA 4KITB 1VDZA 1II8A 1XP8A 1P3JA 3L0OA 1F5NA 1VYTA 4PXAA 3BK7A 3SHWA 4N0EA 3U60B 1XD2A 2HEIA 2FEMA 3M6AA 1GKIA 4BEBA 1W4RA 2ZRAA 1GITA 2ZRKA 3BFXA 1JQLB 3W3ZB 2RGEA 2O8BB 3CF6R 2LKDA 4MA4A 3SFZA 5DE3A 1RC8A 3MJHA 4LUCA 4UKDA 1PVOA 4JMPA 1JBKA 2FV8A 3BORA 1YZQA 2R6GA 4OK6A 5D3QA 3FOZA 2ODWA 2O8DB 4HSEA 1PLJA 3A6PC 4LPKA 2AXNA 2ZQ5A 2CHQA 4OK5A 4M1KA 2GXQA 4DXAA 3U7HB 1KJYA 3CH5A 2O5VA 4AI6A 1XPRA 2GAAA 3QNUA 4P4TA 1II0A 3NEYA 4B71A 1MO5A 5DYIA 1F2TB 1FL9A 3CB4A 2ECKA 1TQ4A 3QEJA 1SHZA 4P4UA 4PQRA 4QOSA 4Q9JA 4QBHA 3U3MA 3FFBA 3GLIB 4EDHA 1OB2A 4TWZA 4EFNA 5JEEA 2HLDA 3D3QA 3LNCA 4P0TA 4N0DA 2QP3A 1L7VC 4KBGA 4ZDWA 2BBOA 2F1HA 2JLVA 4DDTA 5IK2D 3C5CA 5BXQC 1XTQA 1IOZA 1M8PA 2QI9C 2QRZA 3I8SA 4YC7A 4GL2A 4BLRA 2ZYVX 2I4IA 3HPQA 5F2EA 4I1OA 2BJWA 3LAWA 2Q9CA 3PUYA 1G8FA 1M7HA 5KDLA 1S4QA 1S8FA 4HLUA 1OHHA 5KSZA 2H17A 4I1VA 1HY3A 2V8OA 1U0HC 3D8BA 4JLVA 2YWFA 4DLTA 1D2MA 3P1JA 4B44A 2N1BA 2OXCA 3QF4B 2R9VA 3KQNA 2XGJA 1KZ7B 1MKYA 3TQCA 4GRAA 4HAZA 4PR0A 3U5ZB 2FSGA 1N6NA 3T1TA 1RJ9B 4OHZA 4K8OA 5FTJA 2F1IA 2QBYB 1LS1A 2WSSA 5E3HA 4NONA 4B3XA 1D2EA 5EP4A 1NI3A 1P2UA 1YZGA 2WPDA 3K1JA 2UZ3A 1S1MA 1UBEA 4M1YA 4PO9A 2FPMA 4DLYA 5FUYA 2FWRA 2ZUBA 3T06B 1R5BA 4OI0A 3CRW1 1FOEB 4LJ6A 4ZCMA 5LDDC 2RMKA 3A4LA 3MWYW 5JFGA 5J4HA 2O0JA 3TR5A 2O0KA 1GZSA 4MRSA 1OIWA 1ZNYA 1KJWA 4RFSB 4RKEA 3KXKA 2GF0A 1G7SA 3TMKA 5CDFE 2C04A 1VIAA 2REBA 3CUEF 4DCVA 3K9HA 1JEDA 2BBTA 2J7PA 4O2LA 1BYUA 3ZQJA 4R7ZA 5JECA 2OZEA 2ZRLA 1DARA 2Z4SA 4IHQA 1JXMA 2IXFA 2W0SA 3PIRA 4NYMQ 4TL6A 4UJ5A 5FTKA 5JZVA 1E9BA 4E22A 1KY3A 2O0HA 3AVPA 1PJRA 3K0FB 3RANA 5C18A 2F9LA 1OKKD 3H4MA 3QKSA 2VHUA 1XEWX 3GJXC 3AF4A 3BB3A 3SJCA 1RE0A 1RRGA 4Q9LA 2A5DA 2GXUA 2QMUA 4NCNA 4NYJQ 3T35A 1KY2A 4C0SA 3SN6A 1W7AA 2ZAOA 1ESNA 4AYXA 1BMFD 3I4LA 3A1SA 1QHIA 3GLGE 3B5JA 4XSGA 5ANRB 1EXMA 2CCJA 5CB6A 1KJZA 3TRFA 1Z2AA 1FP6A 5E7MA 3EARA 2ZS9A 4LJYA 3LA6A 3ZZUA 4B2LA 4MYTA 5B2ZA 2ONJA 2MSCB 3RYTC 4PPNA 4B2IA 3NEJA 2BMJA 4QXAA 5EJEA 4G5OA 2V7QD 4IFBA 1G16A 4QHSA 5E4FA 3B6EA 4AKHA 3DOFA 2WMOB 1TU3A 1P2TA 1MABA 3R9XA 3SQXA 3MWKA 1ZNZA 3IIKA 2C96A 3L82B 1XXHE 1Z8FA 421PA 3Q7QA 4XD7A 1H8EA 1UPTA 1RJ9A 4PPGA 2FSFA 2ZYUX 5BQ5A 3KFXA 1G6OA 1P9RA 3W9YA 4E09A 1KO4A 2ZI5A 4LJ9A 4F92B 1ZUNB 2IUUA 5CK5A 1UKEA 4ZCLA 4HDOB 4HUQA 4Q66C 1SVOA 1IHUA 2RCNA 4JIMA 1ZW6A 1W36C 5C2JB 3PEUA 4DUGD 4KHZA 1AZSC 2A3RA 2VP2A 4YXWA 3X1YA 1C1YA 1ELOA 1SHKA 1EFCA 1SVWA 2IC5A 1JPNA 1G8PA 2ZUDA 3A4MA 3NH6A 2D7CA 4D4MA 1XZQA 4YONB 5FBWB 4HLQB 5AJZA 1LV7A 3W6OA 2GXSA 3H0KA 4NCJA 2IWRA 1KI9A 1E0SA 2ZR9A 5FUVA 3VHXA 4V0NA 1DAEA 1RVDA 1U81A 1T3SA 4I4LA 2OFWA 4OI4A 5DHFA 3A1WA 5AJVB 1GL6A 3BB1A 3MFYA 1R4AA 1AQYA 3AKYA 1U9IC 2ZXUA 3CNLA 3FE2A 5JCPA 5LD2C 4HB2A 1YVDA 3N70A 4HEJA 3T15A 4CT4B 3IILA 1X86B 4LV5B 1BOFA 2HDNB 3RS5A 4DWJA 3L2OB 5TXGA 3B1YA 3X1WA 1DAKA 2AN9A 2WJGA 3QUSA 2ZI4A 2JLRA 5FL7D 2R65A 1EFRA 2QP9X 1XCMA 2ZROA 2Q3MA 5JSZB 3W5JA 1P61B 3B1ZA 5FOSA 4A0GA 4K81B 3WNCA 1G19A 1IONA 4QHYA 2IEZA 2OCBA 3K0SA 3AVTA 4H1UA 2BC9A 1Z28A 4UNQA 2QAGC 4BLQA 5EXSA 4B43A 4L9WA 2QG6A 4JLNA 4HDQB 4URVR 4OHWA 4LHXA 4FI3C 1YQTA 2E9SA 3WYGA 3UWOA 2CDNA 3TAUA 4PC1A 4F38A 2FA9A 2PZGA 4ZDKA 1CIPA 3PJRA 1P62B 3ZD6A 4BGDA 4LC1A 3DZDA 2OUKA 3ASZA 4C3ZA 3KKNA 2J0SA 2OG2A 2ZJYA 1UADA 5EXXA 3JVVA 5FI1B 5J4VA 1NNEA 3ND8A 4G5RA 2I1QA 2EWWA 3RABA 1K8RA 1ZM4A 2RGXA 3HR8A 1QG4A 5TARA 4PSAA 3ZS8A 3B9QA 1XMSA 4F4IA 2FPKA 2P3SA 1SVIA 2QAGA 3IO3A 4IDQA 1I2MA 4E03A 3L43A 1M7GA 4OKSA 1TNDA 3JVUA 4PO1A 2D2EA 1WF3A 2F6RA 4RVCA 3WRXC 2XJ9A 1AKEA 1RKBA 2RGAA 2PCLA 1OFTA 4QHTA 1KKMA 3CX6A 4BRUA 1NSFA 4KSBA 4DDWA 2J46A 1FNNA 1ZC3A 1G20E 4Q7LA 5FOWA 1ZAKA 1S1CA 1E32A 1O3YA 3EC2A 4KU4A 2QEQA 1E1RA 4TQAA 2PZEA 3SE0A 2KI5A 3W90A 3B1XA 4TQUS 2OSBA 1OSNA 4XH9B 3SZRA 1GTVA 1S3GA 2GILA 1LY1A 2WJIA 3SBEA 4DSTA 4HLDA 2ZI6A 1M1YE 4ABYA 5L3QB 2J9RA 3CX7A 2G9NA 4CZ2A 1P9NA 3S1AA 4X8LA 2F43B 5C1BA 3RS2A 4RZXA 4BFZA 4U7DA 1AS0A 4RD4A 1KI8A 1XEXB 4BFTA 4ESVA 2JLSA 4Q4LA 2B92A 4IDOA 4RFVA 2DCUA 2DWOA 2JLWA 2V1XA 3EA5A 3N2EA 3GLGB 2FGJA 1WA5A 1DG1G 3U6BA 5F3WB 3ICEA 1F3OA 2WKQA 4A6PA 2GNOA 3G82C 1ONBA 2IW3A 3RWOA 4EUNA 1R0ZA 1US8A 1KNXA 4LBVA 5JHGB 3NC0C 1S96A 4LYHA 5JSZA 4WZ6A 4RD2A 1LFDB 4KYUA 5FUWA 2WJHA 2YINC 4IOLA 4MGZR 4JLPA 4G5GA 1XB2A 5AUPB 3MSXA 5KUTA 2W83A 4TL9A 2MSEB 4OQNA 1IN5A 1KDRA 1TAGA 1OJLA 2J41A 2V4ZA 4URZR 3K0AB 4DRZA 3ECCA 2VTKA 3O8CA 4LBZA 2PJZA 1B23P 4LJ4A 1DAFA 4IOMA 2ZJOA 5AUQA 3QSYA 2I3BA 1YHNA 3KKMA 5IK2A 2ZRBA 1CJMA 2OILA 5DO9A 2JLYA 2BKEA 2YC2C 4LHWA 4M8NE 5BW8A 4Z1MD 2ATXA 4M9QA 4IVPA 3B1VA 4EPYA 3BB4A 1ZCAA 3NG1A 3ZQ6A 3GFTA 4NCIA 3BBPA 4OBEA 1N25A 4EPXA 2ODBA 3U44B 3ADBA 4G5SA 4KBFA 3VR4A 4II7A 5G3ZA 1DAMA 1W5SA 2DFKB 1H8HA 3K9GA 1YZTA 3LW7A 5EE5B 4D4LA 2B21A 4V02A 1KZGB 1W46A 2G83A 2HCJB 4DCUA 1Q44A 3BS4A 5FBQB 3W8NA 2A9KA 2X77A 4PSKA 4HAUA 1NKTA 1ZBDA 5CDFA 1XTRA 2ZRGA 3UG7A 4OJKA 3KJGA 1VG8A 1NP6A 1NL3A 3WNDA 4Q9KA 1QF9A 1ZNWA 1A4RA 4A9AA 3V9PA 3THWB 1HA3A 1T8UA 1T4GA 1YR6A 2WVJA 2DY1A 2HYDA 4DZZA 1Q22A 3HP1A 3DM9B 1MO6A 4JKIA 1KTVA 5TVKA 1U90A 4JLBA 4DCTA 1E69A 5FOUA 2NPIA 5EZ6B 5HTKA 3A1TA 4B3BA 1E3MA 2LKCA 3NBYC 4M2LA 4XVRA 1GM5A 3VR1A 5IDVA 4WVFA 1XTJA 3EZ2A 2F43A 4TLBA 4RD1A 1FUKA 2ZSAA 2FFBA 3IIJA 5EXPA 4FMCB 5CLQA 4M9ZA 4BPBA 2XNDA 2QA5A 4BLOA 2ZJ8A 3KXIA 3AB3A 1VYUA 2NPFA 4JL6A 1D9XA 1DVRA 1JQJC 3LFUA 2JJ1D 4FMDF 3IUYA 3GLGA 3LDAA 2SHKA 3AV0B 1KAOA 1IAQA 2CCGA 4ZIRA 2O52A 2EW1A 5FH9A 2G3YA 1IN4A 5K8IA 4ASUD 3KB1A 2WOOA 3MUFA 4L15A 4FXPA 2IYVA 2IUSA 2P5TB 4M1MA 1F48A 3RS3A 4OL0A 3KTAB 4OI1A 3SYNA 4TL7A 1XTKA 3NBFA 3MGCA 2JGNA 1E2PA 2REXB 1E79A 3AKDA 4B75A 4AK9A 3UWKA 4O2RA 1T91A 1ZIPA 4D4JA 2X19A 4JBYA 3EIQA 3F3YA 2WIBA 1G5TA 4RCZA 1XXHA 5IF9A 4P4SB 5J4LA 4GSYA 3K0CC 1HUQA 3BE4A 3THXB 5KYKA 1E0KA 2PEYA 2ZI9A 3PITA 4MRNA 5BN5A 3LQQA 2A5FA 1ZD1A 1W4BA 2P0EA 4JLAA 4BFVA 2VHJA 4QJ3A 1JEEA 1UEIA 4C2UA 1JR3D 2W6JA 2O8CA 1N2CE 3NHBA 1OT3A 4UXIA 4JJZA 4L4UA 3I8XA 2H92A 1JNYA 1OV4A 2GCPA 2C8VA 3AVQA 4E07A 3B7GA 4BECA 1ZP6A 1VYVA 1GSIA 2MMCA 1CJTC 2VP0A 4DVGA 1YR8A 5EP1A 2XSZD 2QZ4A 3OEHD 4MYCA 1D6JA 1T5LA 3VR6A 3RC8A 1LVGA 3RLFA 1G18A 1Z2CA 221PA 2G1JA 2IXGA 2EU8A 5KTYA 2ZJBA 4PZLA 1F2UA 2J45A 3DVLA 5B64A 1X8KA 3THWA 2RH5A 4EJSB 2NOAA 2FGKA 3C4JA 1K6MA 2BCJQ 4MUAA 4DBLC 1T6NA 3SQWA 3TVTA 2DR3A 2ORIA 4TTRA 3RSLA 1Z0AA 4A8JB 1CR1A 1XEWY 2HXSA 1ZD9A 3GLHA 5FBLB 1KYIA 4EQ6A 1SKYE 4NE2A 4P3YA 4PC3A 4DLSA 1JR3E 2QQEA 1LTQA 3B9PA 1FW6A 2J0QA 1Z07A 1Y3AA 2ODEA 4C0HA 2GKSA 2W2VA 3LWNA 5FR2A 1WCV1 2FSIA 2AHOA 3QY0A 4JVMA 2HJVA 4PHFA 4ESHA 1HURA 5F98A 1KGDA 1Z0FA 2O8FB 1VCIA 4B76A 2I1VB 2WBLC 2V54A 1N5LA 1VG0B 4P31A 4JVNA 3TIFA 3VNVA 3B60A 4OHVA 2ODNA 4MYHA 4DLVA 2HT1A 4AG5A 2YWEA 4CF7A 2VHCA 1OIXA 1TUIA 5H70A 1W2GA 5E7JA 1N0VC 2QY9A 4LYJA 5FTNA 4D82A 2XZLA 4BASA 1EX7A 1GFIA 1I4LD 4LJ5A 5ELXA 2IS6A 2N42A 1KOFA 3PVSA 4PHHA 2W2XA 2DHRA 2QUZA 4F91B 1G64A 5J4KA 2QRNA 4XTCS 1KK0A 2A78A 2YOHA 1DPFA 2GXAA 2E1RA 1PZNA 4RCYA 1CTQA 4TSFD 1VG9B 1R0XA 2D74A 3LBHA 3IQXA 3LLMA 1NIJA 3QEOA 2MSDB 2CVFA 2XTMA 1OH5A 1KNQA 5DH9A 3QXCA 4BFYA 1W49A 3CZPA 4QM7A 3BXZA 1XDBA 4P4SA 4Q1FA 4BFUA 2XEXA 1UJ2A 5JI2E 3FMIA 1HV8A 4CGZA 2QSYA 3TUZC 5AJWA 3ZVRA 3X2SA 3UG6A 4BZPA 2BKUA 3EZ6A 3NC1C 4EJSC 3U6KA 4LBYA 3UANA 4XWOA 2HV8A 2C03A 4NPHA 4A0RA 4JLMA 4CW7A 3KQLA 1JR6A 1LF5A 4IEIA 4NYIR 3LH5A 4HZUB 1OXTA 4IDPA 4B34A 5JWHA 1UKVY 2WSMA 4YDHB 3T1VA 5C46F 3AVYA 1RYHA 2XOKD 1Q0UA 2ZETA 4QGFA 4O25A 4OQLA 2XB2A 1XMVA 1G3UA 3PV0A 3LY5A 4OHXA 2CJWB 1A5TA 1G6HA 3CNNA 4FMBB 2Z83A 4LZZA 3VFDA 4V0OA 5K8LA 4URWR 4B3CA 4QJ4A 4AKGA 2GJ9A 1DTSA 1E2EA 4PC7A 4EJSA 5CYOA 4W7SA 2ZRNA 1OYYA 4HAXA 1P73A 1XD8A 1Z0DA 4KLZA 2VF8A 2P65A 3CR7A 2XB4A 1H65A 2GDJA 2H8KA 1GIAA 1IN6A 4A1FA 2IYQA 3WXMA 1N0UA 1XRJA 1AN0A 3TK1A 1SXJD 1W0JA 3CRMA 4OQFA 2R44A 4Q19A 1Z29A 4DT1A 4EPWA 4X8OA 2HYIC 4DLXA 1N3BA 2FZ4A 1VECA 1NJFA 1ZM2A 3CLVA 3RS7A 2G0NA 3SU8A 5P21A 3C5HA 2O8FA 2OHFA 2GVDC 1RYFA 3CF0A 2K5UA 1IBRA 2DPXA 3H86A 1L8QA 4Z54A 1N5JA 3CX8A 4HLUC 5DGXA 3CR8A 3ZDQA 3KUDA 1G4UR 2BMEA 3VU9A 4RSGA 4LCBA 2P67A 3O8RA 1G3RA 4D26A 5FOXA 5G41A 1R0WA 3U4QB 3ADDA 3QVUA 1N5KA 1YR9A 2J3EA 1P9WA 1BKDR 1KO1A 4H1VA 2PMKA 2OAQ1 2ZANA 3R9WA 4BZXA 1G21E 2AD1A 1E2FA 2IHYA 4KFUA 1RZ3A 2EYQA 2YJTD 1SZPA 4LSGA 3TSZA 4QGAA 5EE9A 2JLZA 1VCOA 2NG1A 4AURA 1EG7A 1SXJE 1Z0JA 1XMJA 2IYRA 3N2IA 1UAAA 4ZDJA 1ZCBA 3CZQA 3GEIA 4EFLA 1NVUQ 2WIAA 1NY6A 1Z6XA 3VTKA 1ZU5A 1ZYUA 4M1WA 4QC2A 4DLZA 5IRCD 3EAQA 4M21A 1N5IA 1QVAA 3GJ5A 3UMSA 1AIPA 3TSWA 1D8TA 3LD9A 2ZEJA 1ZU4A 3RS0A 1M74A 2AL7A 4FCTA 4LJAA 3DMNA 3IEVA 2J0UB 3CH4B 3IDQA 4A2PA 4V0KA 3N5CA 3AGPA 3AVUA 1AM4D 2H18A 4HZUA 4RKFA 2XTNA 1R10A 2JLUA 5B58C 1AZTA 1NN3A 3DL0A 1PUJA 1E2QA 1TF7A 1P5ZB 2EYUA 4TT3D 2VBCA 3U2QA 1VHLA 1SKYB 1U2RA 1NVWQ 4PZYA 5EE3A 5JS7A 2RHMA 5F9HA 3GEHA 2CJWA 4PHGA 4TQ9A 3PUWA 3SYKA 5FPHA 3TW8B 4D0NA 4EAQA 2WOJA 2ZS8A 2IYTA 3MLEA 3Q72A 2O8BA 2R6AA 4W5WA 2H57A 1R2QA 5EQTA 1QVRA 3NBZC 2FMXA 4TYWA 1VPLA 2ZI3A 1E9EA 2WKPA 2UVQA 5AK0A 3QKRB 1IQPA 2O8DA 2X8AA 2Q0HA 3SHFA 2WMNB 2CK3D 3F0TA 1KMQA 2BCGY 2FZLA 1XX6A 3TE6A 1II9A 4GMXA 1IY0A 3I1FA 5KOYA 5AUNB 4M1SA 4KI0A 2RKOA 2CMKA 3IKJA 4LC0A 3ZIAD 5C4MA 1A1VA 3ZS9A 3KXLA 2C98A 3P20A 4Q1EA 4C30A 1R5OA 3THOA 1UEJA 4UNSA 1F2TA 3LXXA 5LBIA 2IYWA 4Z8YA 2JIZA 1UF9A 3GLIA 2CLDX 1CBUA 4KLNA 3P4YA 4CYMA 2QPOA 5FTLA 2X2EA 3Q3JB 4QM6A 5AWFC 1MO3A 2ZUCA 3DZ8A 3EASA 3QXHA 2BBSA 3CIOA 1XBTA 5HPYB 1A82A 5BN4A 4TN1A 4EIWA 1OFHA 1DAIA 1D9ZA 1Z47A 3GJ7A 3MAAC 3OIUA 4HLCA 2JJ1A 3ZVMA 1YU9A 3Q5DA 4CVNA 1KHTA 1Q57A 4I1SA 4IXMA 5E95A 3THYB 2XNSA 2GETA 5DN6D 4ASUA 3CRVA 3EA0A 2GZAA 1DO2A 2EWVA 4A0FA 2W6IA 2FG5A 2ZRPA 4Q02A 2WJJA 1DAHA 4JT2A 1HYQA 4GPTA 2CHGA 3F5FA 3BOSA 3QF4A 3PUXA 3ADCA 2N46A 1MRSA 1E1QD 1E9DA 4Q4AB 2WKRA 4K46A 4WZAE 4CEIB 3PG5A 1F60A 1S9DA 2VP6A 3VQTA 3B8HA 5CB8A 3W6PA 1J90A 4DSUA 1OYWA 4JYCA 5JCZA 2QBYA 5EUQB 3K09C 2RGNC 4FWTA 4EPTA 1W0KD 1GUAA 1CJKC 1WBDA 1G8YA 3C14C 1Q3HA 4KO8A 4C2TA 1KDTA 4JVLA 3CPHA 3HJNA 3TGPA 3OEED 3QI2A 4I99A 1E0JA 1JR3A 4DDVA 1T5IA 2EFEB 2AX4A 1KK1A 3GEEA 4OYHA 2QNRA 1MV5A 1FMLA 4XJXA 1N6PA 1XMIA 2RGDA 4BLTA 3OFND 2ZRJA 3C41J 5CYPA 5JMTA 4RFSA 3PR1A 4HUTA 4TMTA 1GKYA 1VCMA 4TMWA 2OLKA 4BQSA 3PFIA 2XSZA 4RD0A 3OEHA 2YC4C 2P6UA 4MUBA 5G3YA 3R7WB 3QKRA 3OE7D 3K09A 4LJ8A 2RGNA 4RY2A 2ZS7A 4DEXA 2QENA 4D80A 4A15A 3BH6A 2CXXA 5EUMA 1UBCA 2EVWX 5DI3B 2H7VA 4GBMA 4ERNA 4DEYA 3JZAA 1P2VA 3DKVA 2ZE6A 3K0FA 1GDDA 3NHAA 4IKEA 4TLDA 1U8AA 3REGA 4R71A 4D81A 3U61B 1AK2A 4NL4H 3ETLA 2AKAB 1SXJB 2OCAA 2ZI7A 1ODFA 3X1ZA 3K70D 1DO0A 3EPKA 2QROA 4GNKA 3TW4A 2A2ZA 1PV4A 1KO8A 2A5GA 3QKUA 5GADl 3WHLA 4DJTA 1A7JA 2BMDA 1RW4A 3K0EA 1UM8A 2VRWA 3GD7A 1SVSA 1LB1B 2C9YA 2CL0X 2J5XA 2OAP1 2QAJA 3EWAA 4MGIR 4Q4HB 1Q1BA 3P26A 4GT1A 4LPSA 4LWZA 1MOZA 1NKSA 5TY0A 5JS8A 4NP6A 4RZ2A 2NO9A 3THYA 3ZZTA 2JDIA 2FFQA 3E70C 1PUIA 3SBDA 5KHOC 1XEFA 1GRNA 1W1WA 1E2NA 5FBVB 1NY5A 3UXMA 4B73A 4M1TA 3KKQA 2C5LA 3K9LA 2DWPA 3QJYA 4IVRA 4M53A 4FWIB 3OAAD 2BMFA 5HKKA 4YQFA 1GILA 4L5BA 1P7CA 3TSOA 5KNCA 4Q7JB 1AQUA 1COWD 1OPXA 5HZHA 1E4YA 1EFTA 2ZREA 4Q4AA 5IT5A 1Z6TA 4C4PA 2QE7D 1G3IA 3KFVA 4CEIA 4A0HA 3BH0A 3FKSD 3UIEA 2YV5A 4B3DA 2QMHA 1HTWA 2VQSA 4ITRC 5LB2A 4M0LA 1BO6A 1FUUA 1QRAA 1RFLA 3BH7A 3QBTA 1ZIOA 1RRCA 4NHOA 1ZM7A 5BWMA 1IJEA 1JAIA 1QHGA 1WRBA 1I4TD 3CKLA 2CNWD 2CE7A 2AKYA 3AVOA 1OB5A 4ZKDA 1K5GA 1IXZA 2IX3A 2YYZA 3PQCA 2IF0A 3LV8A 4WXPA 1FQKA 1GRRA 1KSFX 4AYTA 1BH2A 4FIDA 4M9XA 2BIFA 1T0JB 4B74A 1M7BA 2VF7A 2GJSA 1XNJA 3C7KA 4G01B 5DSZA 3BD9A 2ZRIA 4JLOA 1G5PA 2ZVPX 2GVZC 4IXNA 4XIGS 1U8YA 3R7WA 1GL7A 1NMZA 3TLXA 1JPJA 5HCIA 3FMOB 1N6RA 4HAYA 1E96A 2GEDA 2JJ2D 4YDSA 4AWXA 2QTFA 2NZ8A 3EXAA 4W9MC 1FZQA 1OFUX 2P2LA 1LS6A 1FTSA 2RAPA 1VTKA 4MH0R 1W2HA 2OLJA 2ANCA 2GF9A 4PX9A 2QMOA 1KMHB 4V0ME 2BJVA 1SXJA 1FPMA 1TF2A 3MCAA 5J5CA 3QXJA 3WMEA 1E99A 4ARZB 2A30A 3CPJB 2OO7A 3NVAA 1Z06A 5A5GA 2BHRA 3LW8A 2XTZA 3T5DA 1AS2A 1C4OA 4Q1DA 4A36A 4A4DA 3I72A 4CDGA 3KQUA 5JRJA 1ZD8A 1Z3IX 1JAHA 1YRAA 2Z43A 4OI2A 3QVVA 3RHFA 2Q3FA 2GZDA 4LGMA 1G17A 3H84A 2QM7A 2IL1A 1FX0B 3MMPA 1W44A 3CF2A 1P2SA 3CWQA 4B6EA 1T0HB 4HB3A 2YKGA 3RVBA 4G3XA 2FX3A 4PQYA 2AWOA 4KODA 1OHHD 1KI3A 2GEVA 121PA 1HT1E 3I73A 5JI3E 3SJBA 4ZDIA 2R8RA 1A2KC 2ZE7A 1AKYA 3EC1A 1QHXA 2OFXA 5AR1A 1DOAA 1TX4B 1VKJA 2V6JA 2ASEA 4JL8A 4TZ6A 1O87A 2V9PA 2X1VA 3GJ0A 5HZKA 1U98A 5D3MB 2YOFA 4V0LA 3U7FB 3BAFA 3T1QA 2W2TA 3SJAA 4TMKA 1DELA 1M34E 1NVVR 2WSSD 4IDNA 4AC9A 3VNUA 1NSTA 5FPSA 3CM0A 3RRNA 5FPKA 4LI0A 4XWKA 2NO7A 4A2WA 1E9RA 1VIYA 1UDWA 5KPJA 4Q7MB 2ZYTX 1Q1ZA 1ZUIA 2JLQA 4UNNA 4ILEA 4QRHA 3NIBA 3AM1A 4WBSA 1Q20A 4HAVA 2ZRDA 1S2MA 1NVXQ 2WICA 3KQHA 1PLLA 1SULA 3DPUA 1NVVQ 3OIVA 4FW9A 3V4FA 5JLJA 2FDCA 1EFUA 4B32A 4TLAA 4B3FX 1WE2A 4TT3A 1S0UA 4Y0AA 1EFHA 1NLZA 2WAXA 2WJYA 1K5DA 3AF3A 4JYBA 4TLEA 5L3QA 1OLOA 2L0XA 1YZUA 5EP3A 2O8EB 1XCGB 3J81k 2J7PD 4JKYA 5DHAA 4O3MA 3IEUA 1MH1A 2VYFA 2F7SA 1XEXA 2LCFA 3PCRB 3U7EB 4US0R 4C9BA 2R62A 1E94E 1MRNA 2RGBA 1AGPA 4Q1AA 1FTNA 5CJ2A 2V1UA 2FFAA 4G5QA 5JHHB 2OBNA 2KJQA 4IOKA 3W6NA 3KJHA 1IN7A 2CK3A 2QGNA 2CL7X 2IUTA 3LBIA 4ZI3A 3U3JA 821PA 2G77B 3CRQA 4ARZA 2C99A 2FF7A 4Q4JB 1BYIA 3GPLA 1CRPA 5KSPA 1F6BA 4X8MA 2ZE5A 4PZZA 4HB0A 5F9FA 2J7KA 1OKKA 1Z0KA 2WWFA 2XITA 3KJIA 3QOFA 2KSQA 3BJIC 3EPLA 8OHMA 2XXAB 2RGGA 1G8HA 4UNRA 3K70B 3C16C 3K0AA 4Q7KA 3LX8A 3AGQA 4TMVA 2GAOA 2HJGA 2IWHA 1XD9A 3LLUA 2ORVA 1ZVQA 3SNHA 1BMFA 4R2IA 3ZGXA 3T61A 5KU1A 4LY6A 2AR7A 1KK3A 1QZXA 1E9CA 1U0LA 5KDOA 3MG9A 4ZCIA 4S2EA 1ZJ6A 1OE0A 2GTPA 2FE4A 4F4JA 3U44A 4IW3B 3L0SA 4KXFB 5FI0B 4XD7D 1HE8B 1H8ED 6Q21A 4LOAA 1VHTA 2V7QA 3I3SR 1KK2A 2GBLA 1KO5A 1QG2A 3BWDD 1YR7A 3WMGA 3V00A 2NIPA 4C7OB 3TAHA 1IN8A 3KKOA 3E2IA 4MDEA 4Q18A 5AJXA 4KCGA 4C0LA 1E1QA 2JATA 2VIIA 3A36A 3UKDA 1DEKA 4DC9A 2ATVA 2GCOB 1KDOA 4OQMA 4GP6A 3ICQB 3VR5A 3GFOA 2IF2A 4W5HA 1CXZA 2C77A 4AG6A 4YXWD 1J7KA 3HDTA 3VKGA 5AJYA 3KKPA 3QIAA 2QU8A 3AF2A 1SGWA 3TUJC 4IJMA 2DYKA 4GOKA 4YMTA 1I2DA 5JJKA 3TBKA 3L0IB 4QFMA 1LF0A 2VP9A 1OXXK 1Z08A 3AEZA 3DEFA 3GQBA 2QTHA 1XD2B 4DUGA 4AKIA 3WBJA 2GJKA 1VMAA 5L8VA 3ZD7A 3CW2A 1AS3A 3R8CA 1WMSA 2O8EA 4IOJA 4BZQA 4DSOA 2JCSA 4Q5IA 3FFAA 2IT1A 4TMXA 1GP2A 3FWYA 1W36D 1KSGA 4OHYA 4U02A 2EFGA 3T34A 1CLUA 1E2JA 4BRWA 4Q21A 4URYR 2CEAA 1SVMA 4JT4A 3WNBA 2VA8A 4EFMA 2FH5B 1FMJA 1U0JA 4JBXA 4UQOA 3OE7A 1OXSC 2ZSDA 3REFA 3BRWD 2EFCB 4DDUA 4WXRA 1EFRD 1XPUA 3UMFA 3IO5A 4Q4JA 2D62A 1G7RA 3K9NA 4OK3A 4QNRA 3EIHA 4Q48A 1P75A 2D3WA 2QT1A 3CBQA 3P4XA 3BFKA 1A2BA 3KTAA 1E2LA 1N6IA 2QT0A 4E5UA 5CJPA 3V4RA 3OESA 3ZZ0A 1IXRC 1SQ5A 3EWSA 4NDZA 2GZHA 4PHTA 1KAGA 1OH7A 2XXAA 4OQXA 5FL7A 4M9SA 3ZYCA 1XWIA 2YWHA 3TJZA 4J0QA 3IQWA 5L3VA 4OJQA 2ERYA 3THXA 3QPUA 2QPTA 1UDXA 3K8YA 5GVSA 1KI1A 1DAGA 3AVVA 1ZMXA 3R9IA 1SKQA 3EPHA 1FNMA 2FEOA 4D2IA 3HU2A 3SDZA 721PA 2WWWA 2J59A 4IFEA 4KSCA 1JB1A 2CCKA 1TQDA 3LBNA 2YWGA 3FYHA 1R6BX 4PSVA 1KI6B 3AP2A 4A8JC 5KSOA 5GJBA 3HWSA 5FFMA 2HF8A 3EX7C 4PPQA 1KKLA 1EWQA 4PANA 3LRPA 1TEVA 4KVAA 1ETUA 1GVNB 1NRJB 2DB3A 1X1SA 1U8ZA 1VCNA 2VP5A 3WRYC 1T9HA 4HI0E 3X1XA 4XVUA 2LWIA 2QE7A 1CR4A 4ZI2A 3D31A 4NYIQ 1E1RD 5L3SB 1HT2E 4G1UC 4F4CA 2VHQA 1NN1A 1J70A 4UNPA 2H1LA 1Z6YA 3WYAA 5GVRA 5H1YA 1ZRHA 2OV2A 1CJUC 3H1TA 4JL5A 4BE7B 4A8JA 1AA9A 1X6VA 2RB4A 3WBKA 2ZJAA 4JLJA 4DSNA 2C2HA 4D25A 3GCGA 2NGRA 3A58B 2IEYA 1EGAA 5GJVC 4KV9A 5BYJA 2CNWA 4V0MA 2TMKA 4A2QA 2OM2A 3I92A 2VL7A 5CIQA 3CO5A 3OZXA 1NBMD 1IY1A 3SEAA 2R2AA 3VAAA 2BV3A 3WP1B 3CWZA 2GCNA 5EP2A 4H9GA 2GK7A 2F3TA 4LHVA 5L3RA 4ACAA 3DOEA 3EPJA 2PH1A 3B85A 3BERA 3E5HA 1WDTA 2VH5R 1UKZA 2FN4A 2RHDA 4YLGA 4PQFA 1C9KA 3SR0A 4URUR 1J8MF 3UK6A 2ANBA 1W47A 4DIDA 2CLCX 2JJ2A 3I61A 4RD3A 2OXRA 1N0WA 2A5JA 1IXSB 3BGWA 4JLDA 1TF5A 1Z6GA 1TL7C 2B7CA 2JAQA 1E9SA 3QPVA 1G9XA 1E0AA 3QKSB 4QBFA 2AFIE 1P72A 3A1VA 1DS6A 2D7DA 1U99A 3M4YA 4JBWA 4PAMA 3FDIA 3RWMB 1NN5A 2KB0A 3NH9A 4Z8XA 3ADKA 1NBME 2R6DA 3FVQA 4WZBE 1CULC 2CE2X 4KJZA 4IDHA 5JRZA 1E4VA 4JS0A 1G3QA 1G8GA 1NMXA 2CHVA 3AP3A 2BDTA 1E2HA 1Q1QA 2D4HA 3D6TB 3EW9A 2QM8A 3UMRA 5FPYA 1GG2A 2YOGA 4L8GA 5HE8A 1Z63A 3GLFE 2WWYA 4TYPA 4CT5A 2ERXA 3WYFA 1OFIA 2BM0A 3BC1A 4QG7A 4S35A 1Q12A 1G41A 3RNLA 4B3GA 4Q9IA 1EWRA 1FFHA 1YKSA 2PCJA 3D7MA 4GOJA 1H8HD 1OF1A 2OCPA 4N3NA 1KI6A 4MKGA 1JI0A 3VX3A 1ESMA 4W5JA 1L4YA 1XZPA 2BEKA 4HAWA 4FMDB 4Z1MA 2CLSA 2QMEA 1XF9A 4C0QC 2W0MA 4MDFA 1MABB 3QG5A 2VPPA 1TQ6A 4QBIA 4WW0A 1JXOA 1ANKA 3PUVA 3GJ4A 1YRBA 3VMFA 4WIAA 3MWLA 3RRZA 1G7CA 2PZFA 3K53A 5FR1A 3TVDA 2IHBA 3G0HA 2NQ2C 2VLIA 5L3SA 2PMDA 5LB4A 3QQ5A 1BS1A 4I1UA 2FSHA 3C15C 2PT5A 2ZRCA 3WP0A 2VSFA 1Q1EA 3KJEA 4HUQB 3T12A 4NCKA 3EZ7A 1TU4A 3I5YA 2WWGA 3SS8A 1HH4A 1ZINA 4F93B 3QXSA 1UFQA 2FOLA 2NMVA 2VSOA 3DHWC 3AQ4A 4JVSB 4Q1BA 1CR2A 1E98A 3AUYA 4NYMR 2VHTA 3SI7A 4XSHA 1WBBA 2XNDD 4FINA 4HZIA 2CL6X 2PLRA 5KNDA 5UKDA 2BM1A 1W4AA 3KX2A 4CEJB 3C8UA 4WOPA 4AY2A 2EFDB 1NIPA 5DI9A 4GFDA 1R8SA 3Q9LA 1T8TA 1YZNA 3U4QA 3HR7A 1Z0IA 2YNMA 3KB2A 4FCVA 2UKDA 1I4DD 4R98A 4UJ3A 5J40A 1WXQA 2ONKA 2ZJZA 1W36B 1YZKA 1G4AE 1NLFA 2IYSA 1E2MA 2ZR0A 2F55A 4NYJR 3UPUA 3PUZA 1NLYA 1XJQA 3P27A 3RS4A 5FPTA 2GJ8A 4DHEA 1KI2A 4XTRA 621PA 5LPNA 1KO7A 3ZLJA 4C0BA 1E2DA 2IK8A 4AIIA 2F3RA 4P33A 1E79D 1ZUHA 2AD5A 4B47A 4BEJA 4B2PA 3QF7A 4ZV4A 2OFOA 4ZO4A 3IIMA 2G6BA 2FNAA 2Q9AA 3W3AA 3VR3A 1EESA 5EZ5A 2DBYA 1CP2A 2VP4A 4L16A 1Q3TA 2Q6TA 1OXUA 1B0UA 1YZLA 3JZMA 3DMDA 3FPAA 3RRYA 1QHHB 3ONWA 3NDPA 2P6NA 4QL3A 3U3KA 5LD2B 4N1AA 2J0UA 2OEPA 4RD6A 2EFHB 1LW7A 2W6JD 4A82A 2IYLD 3W34A 4HB4A 5FBRB 2ZM5A 4LX0A 4NH0A 3B1WA 2Z6VA 4TL8A 4CRWB 5KPDA 3VKHA 1X8JA 3AVWA 1OXVA 4KFTA 4JZKA 2ZIAA 3A37A 2EQBA 4FMCF 3QXXA 4ON9A 5JJIA 1Q21A 1P60A 3SOPA 2IXEA 4LYFA 1QBKC 2A5YB 2ZR7A 3BFVA 1NG9A 2YZ2A
chains in the Genus database with same CATH superfamily
1GAEO 4YLEA 2R1VA 1J99A 5D3KA 2Q7XA 1CEEA 3JR7A 3H19A 4GECA 4IGEA 4M54A 2QVCA 5HIMA 2HF9A 3AERA 3GYBA 4KK4A 5DYGA 2O1SA 2EWMA 3EZ9A 4YMUA 2HUPA 3GBSA 3IUJA 3CVXA 1C1XA 4OFXA 1VXOA 3TDKA 1ES9A 1U2DC 4RJLA 1I3OA 1K88A 4ICIA 2FP4A 3FZEA 2R4QA 5SZHB 1J49A 1T3TA 2F1RA 2XYVA 3H2YA 4RA6A 4CCSA 4KE7A 2OK8A 1EA5A 2Z56A 1E2IA 1GSOA 3HFRA 4MUGA 1Y89A 5EXDA 3F6CA 3BXPA 2ZVQX 2C83A 1U4SA 5BOSA 1EG2A 1UBNA 5HE9A 4JI4B 1HO3A 4BVAA 1D4FA 2G9QA 3A27A 4GR4A 2ZJ4A 1I5OA 4EPRA 3PXXA 2IS2A 3GP5A 2YIJA 2YQZA 1CZRA 4TMZA 3G89A 4G24A 1X7YB 3BIWA 4QECA 5JJ5A 1NW9B 4PE5B 3ZDRA 2HMWA 3LC7O 3DGEC 2AR9A 2NTNA 4Y2SA 1TUEA 5FNVF 2VDWA 1GNQA 2BEVA 2XIJA 3EG5A 4AJ9A 2JH3A 2D1TA 3HYTA 3OI7A 4HATA 1WY5A 4OAPA 1EWTA 4BMOB 1ID8A 1TADA 1QHEA 3CNBA 3N5KA 4C0AC 2ZRMA 2C4MA 1P4SA 1P29A 5AW3A 2C3PA 1RMQA 3FPKA 1LU9A 1QCCA 2G0TA 5CLLA 4AJ1A 4DR5B 5C53B 1AUQA 1Y3DE 1VKZA 1YUNA 1K0FA 1E9AA 4LVNA 3NOVA 2PM8A 3EQ2A 5T4EA 3T3GA 4YYEA 3ACBA 4W5OA 1EVJA 4UHEA 4DCSA 3L8ZA 1PK9A 3FI0A 1DADA 2G71A 2IVZA 1ZI9A 2WIFA 3QOYA 3X3HA 2NTYC 1US8B 3DM5A 1O1YA 2VDOB 2NYRA 3O8OB 4QGBA 4R7TA 4X93A 4EO9A 4NR0A 4URHA 1NW6A 4C0KA 4MKHA 3M3DA 4Q3DA 5D6NA 1BEUB 4LE0A 5H3CA 1EK0A 3EFOA 1FDIA 1AKQA 1QGUB 3A05A 3PRJA 3DKPA 2OHJA 3M1IA 3RSOA 3V2HA 4X0EA 1T1RA 1UQRA 1Y4UA 2BOVA 3HGMA 1MF7A 5JS1A 1RXYA 4U7PB 4XPZA 2GPAA 2CVHA 3UK1A 3ZR4B 3QEMA 1IBLB 2JZCA 1PT7A 2C88A 3DAOA 4EA6A 1RXEA 3FNFA 1NUQA 1OVGA 3FHTA 4J7AA 3OPNA 4GMKA 3OHSX 4R41A 3HUTA 5IHXA 1E7WA 1KS9A 4KR3A 4XQEA 5LQNA 4YJ2A 2GDZA 5A1TA 3W5AA 3NWJA 1G59A 1J09A 2V7VA 1WSDA 1JA0A 1T2FA 4G4SP 4PFSA 1ZD2P 1EDEA 3IQHX 4R1QA 3TW6A 1RPZA 2ZTVA 3JQBC 1DG3A 3U3ZA 1EM6A 3EZNA 3GB9A 4TZKA 1G98A 3HLKA 5CK4A 3W9SA 2ACEA 2IXAA 2VXBA 3EJWA 4R3UC 1T3HA 4YCAA 3LKBA 2FRXA 3HWWA 4OOEA 3WIOA 1BMTA 3LPDA 1NNI1 1YFZA 2IA5A 3CG4A 3LKDA 4CFYA 1QUEA 4ZVNA 5BYKA 3VDNB 2P7IA 2HBYA 4DPLA 2I29A 1MJHA 2AN4A 5D87A 4ZK2A 3E7XA 3RHZA 1XGKA 5IFLA 4INOA 1K98A 2OV6A 1OJ7A 4IUCS 4O2AF 1KRXA 1DXOA 4PC2A 1WUKS 2G4VA 4HK4A 3R3SA 4GC5A 3BMNB 1LUAA 3TX6A 2XAUA 3QE0A 5CVEA 2CFRA 1GPYA 2HWYA 4MMYB 3U39A 3VBCA 4AD8A 3NOQA 5IDWA 4NE9A 3OF3A 1IULA 3E35A 4EYQA 3RFXA 3Q11A 5JBNA 4G56A 1M33A 4IMRA 1QX4A 1YBHA 3GMTA 3QHQA 4BP8A 2WYVA 3LXRA 1PVDA 4FVTA 4KTVE 5SZJA 4BATA 1Q0QA 1WM1A 1ZH4A 4E3WA 2P9GA 2AWNA 2YVAA 3MWDA 4QQ8A 5B1YA 3ZDAA 5AKZA 4B33A 4F60A 2WM9B 3IPAA 4KGVA 3UCXA 1YJ5A 5G40A 3I28A 2ZAMA 1XRPA 1S2GA 3H1FA 4HDRA 5HCNA 3ZVLA 3OQPA 2Y67A 5LLTA 4WZBA 3ZDZB 4U1RA 3PGJA 2QN6A 4UQPA 3UA3A 4EZEA 1NTOA 2H29A 4JROA 1WKCA 4HDKB 5CM9C 2SICE 1ISGA 2WKSA 4EVSA 2F9MA 2GAFA 1A7KA 2ZATA 1T36A 1YTUA 4NJEB 1E3TA 2A67A 2XUAA 3L93A 3GLFA 3HRHA 3O0DA 1E1CB 5EFOA 2EZTA 4Y30A 3WLKX 2MMGA 4C0JA 4UEQA 3C70A 1P0FA 2NZJA 3ITKA 4PLCA 5EJ2A 1IOLA 2P2YA 2OVFA 3PQ5A 4URXR 1NG1A 2HW8A 3NWEA 2Q29A 4D6XA 3AIOA 2RHCA 4I50F 2PVPA 3SG0A 3PQ7A 3ESYA 2ZBQA 4MW4A 1NYLA 3KR1A 3RJZA 4QWWA 5TMPA 4YB8A 3NVMB 3S4YA 3PC6A 4OMFG 1N6KA 1L5KA 4RY8A 1QH9A 1Z15A 3OEWA 4NNPA 1PJCA 1PR4A 3AHIA 5NULA 3DDCA 3NTLA 5JVDB 4I5EA 2PPVA 4MKFA 1XQWA 1XXHB 3AILA 2VNJA 3CMMA 5LLDA 2WWIA 1T3LA 1UXKA 3R3JA 3HJAA 1QCDA 4NOKA 2XAAA 1VLZA 1Z5ZA 1YDEA 1GVHA 3CEAA 3GFRA 5F2OA 3F67A 1F51E 2ILVA 2HI0A 1NAHA 2WV9A 1ZOPA 3B82A 3DBRB 5KNLA 2G5TA 3JY6A 4EG0A 4Q7QA 1G7TA 3UPTA 4ALKA 5CD1A 2XJ4A 3VSAA 3S28A 3WO1A 1IJFA 3KZ1E 1D2RA 4AJEA 2O8CB 3EAGA 4HGOA 1X7GA 5HW0A 2IS1A 2VZ0A 5EJGA 4ZOBA 2HR1A 1LPBB 1QS0B 4CEHA 4XOIA 3O3CA 1NVEA 3HNPA 5IG2A 3RADC 2YBEA 4R8LA 1KPGA 2VEDA 3RC3A 5CH8A 2D59A 1PFVA 3U3DA 4GP7A 5MFZA 3OIGA 1PQUA 3DCJA 1NHGA 1Y4SA 4JD5A 1OI4A 1CUJA 3HEAA 5AH0A 1GZVA 1KBQA 2JEOA 1FRFS 1MQSA 1CB0A 1XCPA 2H8GA 1F2UB 2XGOA 1NNLA 521PA 5LYJB 2PL3A 2HK7A 1A8QA 1F9EA 1U7PA 2I3ZA 1QR6A 3FGZA 1CQXA 2YWDA 2FWIA 3MUOA 4LJLA 2X9NA 4MEAA 5AESA 5FEUA 5ICSA 2XIQA 4BNGA 4DCNA 2SECE 2Y6VA 1TEXA 2B1QA 3IXQA 3D2BA 3GLHB 3SYTA 4ER5A 2QGZA 4UXHA 4P22A 4PCAA 3DL4A 3EDYA 3QKTA 3NCTA 2C7QA 2JIZD 2FPRA 1ZLXA 2WFAA 3ZCTA 4I1RA 1H3NA 5K8UA 3QFFA 5EIAA 4HDNB 4A92A 3FDZA 3KUCA 4JR0A 3LVBA 3H99A 4BC1A 2QAIA 4HS4A 4ARAA 5ESXA 5LR6A 5JNWA 1Z6AA 2ZWPA 5C8XA 1VHQA 1I32A 4JSYA 1AXRA 2Q45A 4HCJA 5BR1A 2PPLA 2YHIA 4WJKB 4YMHA 2P9JA 4X66B 3EUAA 1V1RB 2W58A 4NLLA 2HSZA 4KOAA 4X97A 3ZGNA 3TLEA 2OA0A 4DE5A 2ENWA 2ZYRA 3A1UA 3H9GA 5EIXA 4GYJA 4LOKA 3N75A 2NSDA 1H0RA 4LDZA 2OC9A 1JAXA 2Y0EA 3AKCA 3H3FA 3H9QA 5EXTA 4AROA 4S04A 2X1MA 1YIAA 2VOEA 4PVCA 4EUFA 3OF5A 5HP4A 1XQ9A 1UK8A 1V6SA 2AYZA 2J1LA 2XWBF 3ZDCA 4LOLA 4MB6A 5K8TA 3QUTA 1O8CA 8ABPA 3IKMB 2G1KA 2P7HA 1M1NA 3BL8A 4GDFA 3V8RA 1X8XA 4AX8A 4GWGA 1D0IA 1QHSA 4Q4DA 2Z0MA 4FS3A 3G85A 1A5ZA 1C30B 1V8BA 5KQSA 2ERCA 4GSLA 1ZD3A 2KBEA 2Z5VA 2KWIA 3H11A 4ACBA 1PVOA 4ND8A 3I30X 4Q47A 4RPHA 3T3MB 3MUNA 4C78A 1E9FA 1D07A 3HZHA 4Y98A 1CJCA 4UFOA 3KS9A 1MEOA 4YAFA 4BVLA 1LTHR 3A1NA 4WN9B 5AQEA 4R68A 2NO1A 4MR8B 3R20A 5J4YA 3LHDA 1O58A 1VIVA 2JFNA 5JMWA 3RSCA 1KQFA 2F8TA 1T0UA 4MV5A 5BP7A 3KZXA 3OO0A 1Y98A 3I62A 1T8WA 4TKUA 3IKLA 5I01A 5FUMA 4UEJA 3PX2A 1ZH8A 3M34A 1JDBB 2AEEA 2C61A 4KVGA 4GDMA 2ZYWX 3X1KA 4RPCA 4DNOA 1D0VA 1S2NA 4EFKA 2IBSA 5EVCA 3SICE 3P52A 3H17A 2WJWA 3K0CA 2CEKA 2W2LD 4D46A 3OEEA 3O8NA 5CA1F 2R8ZA 1TJYA 2AOWA 1XZ8A 2REOA 2W6QA 2JGEA 3HVUA 5DYNA 4F7DA 4MPDA 2IYYA 3W5IA 2B78A 3SBXA 1XIVA 2OCYC 2R7NA 2JLCA 4HTFB 1MAHA 1SVKA 2YHSA 1H0KA 5D86A 1I2BA 4WAUA 3PPWA 2QXYA 3TQFA 4BB0A 4OU4A 1F0PA 1N3YA 2CFOA 3G17A 3AF1A 1VXRA 2AXPA 4QJ5A 1W85A 1UWLA 2HY7A 3UC9A 1XCJA 4W6ZA 3GBVA 4YCDA 1IEXA 3FTQA 4TZ0A 5FL3A 3WRVA 5DHQA 4ZT4A 2BH2A 4HDCA 3QOXA 1QIJA 1WX1A 2XA1A 4O8ZA 4L5IA 2PJRA 3L6RA 2OMKA 1E3JA 1R16A 2AMFA 3SCZA 3T1NA 2OE2A 1Z22A 4E12A 5KS2A 4ND5A 5EUCA 3I2HA 4X1YA 2BTQB 4EYGA 3AP1A 4XYEA 1DE0A 1YBMA 4Z0HO 4MCIA 4BVGA 1SVLA 3VU9B 1QTRA 3R5FA 5A7HA 3TWOA 1TQ8A 5H68A 5EJ4A 3NPMA 3N8IA 1WEHA 4P4LA 3OM9A 1RHQA 2Q49A 2Y9MB 4KFRA 1B8OA 1B2RA 4DB2A 3SIRA 1XPOA 3Q7PA 2V7EA 1ZM9A 3K35A 5IN5A 1SWVA 3G0BA 3JATA 2H5EA 1U6JA 1UKYA 3NUQA 2OCXA 2VSXA 4RCVA 3WB2A 1GN9A 4CCYA 3AVXA 2XMCA 3L9WA 4XA8A 5G4KA 3DVQX 3FJYA 2RGUA 3O9VA 4Q1CA 2QPAA 3ZCVA 2IYZA 3GC6A 3OIWA 3D6FA 3N3BC 1P2GA 1TW3A 3DV9A 4J0JA 3EVDA 1XAHA 4FE4A 2PLFA 3LXMA 3NXSA 4LQLA 4OHMA 5EE0A 1Q7TA 1WQ1R 4R6WA 2PBRA 3ANTA 2ZUUA 5EAIA 1LXCA 3QENA 3WK6A 4IVQA 1L1RA 2R751 1UMCB 2Z5FA 1TPZA 3TCNA 1XVTA 2XB8A 1GWNA 1LBIA 2PSJA 3I0NA 3IP3A 2BFFA 3LO5A 4FLFA 4FBMA 4TLMB 2PKQO 2ZSBA 3I6BA 1XAJA 3M6LA 5F1KA 4EMTA 1V11A 3L0CA 3LI2A 4RHEA 3VU3A 4HQ0A 1RU3A 3OURA 2IU0A 4UMDA 2AX3A 5IF3A 4ZMRA 4Y0VA 4M7PA 4A6XA 5K6RA 3Q8XB 1HEIA 4J0HA 1CF4A 3QU9A 4DLRA 4NNJA 3TSYA 4DIEA 3DE7X 5B57C 2GCOA 2Z98A 4JNCA 1YHZA 3F90A 2QSZA 4G0UA 5DXAA 2NXNA 3E61A 1VDZA 1PL6A 1QH0A 1V8DA 3NHZA 3R6TA 2QIOA 1NOJA 3ZY3A 2FMKA 4MA0A 3JZDA 1PFUA 3L0OA 1PT8A 4QYIA 5ABPA 1D09A 4YDRA 4WGGA 3L4BA 4N0EA 4QASA 2WAMA 4UTZA 3MJFA 4HMQA 3SDBA 1J07A 1KAMA 3R0VA 2FEMA 4HXEB 1JEOA 4MQ5A 2ZRAA 2P40A 2PD3A 1GITA 3L7DA 3BREA 1JQLB 3D8SA 3QMPA 3HK2A 4NZPA 5J2UA 1TCAA 2VPQA 3SFZA 3KRTA 4RDHA 4O2BF 5SYAA 1JBKA 4EI8A 4XB1A 1YZQA 3WLFA 2DPYA 2R6GA 2PA3A 4OK6A 2EKBA 2ODWA 5EIBC 2TS1A 4NAHA 3QTLA 4LPKA 1ULBA 2AXNA 4RTMA 2ZQ5A 3T1YB 4HBGA 4OK5A 3MOSA 1VIDA 2CZCA 4M1KA 5EHGA 1PZEA 1LSOA 2VQ3A 2P4EA 1IWOA 3N39C 4LRUA 3CH5A 1DC3A 3PKJA 5J2TB 4AI6A 5E0OA 3R9KA 5D51S 1HMPA 1BN7A 4L0CA 4RXTA 2J3LA 4JJ6A 1II0A 1U7XA 1MO5A 2XCRB 4QOSA 1T2VA 2WR8A 1Q95A 1TQ4A 3ORHA 3IUNA 2I3AA 3LCJA 3ORQA 1ECGA 3QEJA 4D3DA 2UZ4A 1IN1A 1BXGA 4EDHA 2AF4C 3K73O 5ETJA 4OF4A 3VVCA 4C6SA 3AIKA 1OB2A 3QMVA 1U2QA 1KA9H 1JZQA 1J24A 2MT9A 3LNCA 4KG7A 4CG3A 2XDYA 3A06A 4KBGA 3UT5A 1U11A 2JLVA 1JEAA 3ZJ4A 4ZI7F 2WFLA 3C45A 1KH2A 4YRLA 3ZUPA 3OQIB 3WTBA 5BXQC 1IB6A 3CISA 4GBED 1IOZA 1M8PA 4N8DA 3I8SA 4UEWA 4CTKA 2FW0A 3C8ZA 4V1CI 4J4BA 3HPQA 2I4IA 1NU8A 1GA1A 3O5AA 4I1OA 3G9TA 2MR6A 5FI5A 3BILA 3NI2A 4YP9A 1S4QA 1XCLA 2NXWA 2X0DA 5JPDA 1EE2A 1NR5A 4GF5A 3TJMA 1FNDA 2Y4OA 1LQ2A 2VDVE 3HKDB 2H17A 4I8IA 2PGNA 4I1VA 4RXUA 5ALFA 3U1BA 1SBIA 3D8BA 2YXBA 3HDHA 3VU8A 2JHFA 4J1TA 5D84A 5TGTA 2FOXA 3P1JA 1NQXA 2J3HA 3L0ZA 4B44A 4DLTA 4EL5A 3QKIA 4NBRA 1V8PA 3BMCB 2XGJA 3QVJA 4LRYA 3NAQA 4PQEA 2GN4A 1Y6ZA 2OFFA 2H4FA 5DNVA 4BKUA 2CLKB 3U5ZB 3KVNA 1FFWA 3RT1A 2QGFA 5KI6A 4G0QA 1STOA 2NQ8A 4DAEA 1YXMA 1RXSA 2C4TA 5ARCA 1T0PA 2OCDA 1GXSA 2JW5A 1KEUA 1G6KA 4KN9S 3UV3A 5BMVB 3O1IC 4NONA 4B3XA 1Y80A 1D2EA 2LD4A 5HA5A 4A26A 4AT1A 1YZGA 4M1YA 3K1JA 4XCQA 1S1MA 1UBEA 3EH2A 2W7TA 3G8DA 3NYQA 4RV5A 4DLYA 5FUYA 4YRZA 1PJQA 3QELB 2J3MA 1NF9A 1E5XA 2GAIA 1FOEB 1LEHA 1ZW1A 2M2IA 1TTQB 4LJ6A 3A4LA 2CVQA 3FAZA 2Q46A 4OJNA 4PLZA 4DEVA 5JFGA 5CYFA 4RA9A 3V32A 1GG5A 2PUCA 5DBIA 1GZSA 2Z5LA 1RAIA 5LZ5A 1C8KA 3KPUA 1Y1RA 1V5IA 4LISA 3WNVA 3BSYA 3VR0A 2AC7A 1YZFA 3KXKA 3SHTA 3ZY2A 3W5HA 2XB6A 3TMKA 1TK3A 1KJ8A 1Q0HA 5KOJB 1V5GA 1H6CA 4EY5A 2CHFA 4RTKA 3CUWA 4O2LA 5K5EA 3HXPA 2V98A 4QYWA 2OZEA 2PUJA 3VYWA 1NDUA 1JXMA 2W0SA 1CC1S 1C9DB 3HJGA 2IW1A 3O92A 4NYMQ 5FBKA 1FSGA 3R1IA 3B6JA 2YV1A 3DE4X 3M6IA 2BYTA 2EQ5A 4UATA 2UVPB 5FJIA 2BSXA 5AXAA 1ODCA 2GBPA 5CVUA 5EIOA 5B6IA 5C18A 4JI0B 1OKKD 1XTBA 1ZGGA 3COYA 2EJUA 3GT7A 3PJFA 5CLJA 3DBOB 4N47A 3PK0A 2CD7A 1X1EA 5IVKA 1D3AA 2QQFA 4M7RA 3AF4A 2QTZA 1MX5A 3NYIA 3RYFA 1T6BY 4HTAA 4CTNA 2GLTA 5KTRA 2A5DA 2FWJA 2GXUA 2UYYA 1KY2A 5B3JC 2WDPA 2ZAOA 3NT5A 4AYXA 1BMFD 4NATA 1GA4A 1NVDA 2OBBA 5ANRB 4E70A 3TRFA 5E7MA 2YMLA 2ZS9A 1OFVA 2HPHA 4LJYA 3ZZUA 4GVLA 4B2LA 4EY3A 3FTDA 3VSCA 4Q05A 4PG7A 2HIMA 2FB9A 5E1DA 3I04A 1CUYA 1I0LA 2HWUA 2ZBFA 5AHOA 4QYSA 3UY4A 3ZTWA 1F4PA 4AUKA 4L9RA 1K3UB 4EB6B 4BWFB 3TNDA 2IOFA 4J94A 1YD7A 1CE8A 4ZAXA 4FZJA 3C6KA 4UPEA 4W5QA 2JGJA 1TU3A 3ZVKA 2XTJA 3KKEA 4MGHA 2P9BA 5M3BA 2Y2UA 2B3TA 2FMFA 5KYGA 1DKQA 1ZNZA 3SQXA 1HEYA 3UWPA 4DLPA 3CVUA 2EAUA 3QNWA 3DONA 3L82B 3KSBC 4IX9A 1WCYA 4DKJA 3Q7QA 4XD7A 2DQSA 4JU8A 1MORA 1C3EA 2DKFA 2EL9A 3C1OA 4YFVA 1L3IA 2FRDC 5BQ5A 1DNPA 2Y99A 3L05A 3ERCA 3H75A 4EOGA 4YUAA 1P9RA 1SHTX 3ONVA 4Y2HA 5AIAA 3W9YA 2H65A 2ZI5A 4LJ9A 1RLUA 5GGYA 1RAAA 1YCGA 2OG1A 1VPVA 2YYAA 3CA8A 4HDOB 4HUQA 4K1XA 4OLHA 4Q66C 3LFTA 2RCNA 2B83A 1YRYE 1ZA1A 3U9TA 4YAWA 3GLQA 2IXTA 5IX8A 5LOVB 1W36C 2WHYA 3NWOA 4YV2A 1F0NA 3ORRA 1LVHA 1N5MA 1PK8A 1U2PA 3SC4A 1Z18A 4M0EA 4FNMA 1REQB 3X1YA 4EBBA 4G6ZA 3VHRA 1ELOA 4QDZA 3HP4A 4MVJA 4R01A 4X1IB 4ZGGA 3VVLA 1JPNA 3NH6A 5KTPA 1PDVA 4IAOA 4WKPA 2VT3A 4UBKA 3EVBA 2CHEA 4G4JA 2JANA 5FBWB 4UDNA 4CI0B 3OZUA 1X38A 2PKQP 3DMRA 3W6OA 2GXSA 4E5KA 4DQDA 1R74A 4C01A 5J43A 1I3CA 1E0SA 2GMWA 1FEZA 2XA2A 4NV3A 3DOHA 3VHXA 5IYZA 4OP1A 1RVDA 2QTLA 2XYGA 3A10A 5EIEA 2CYAA 3MIZA 4OI4A 3A1WA 4D9BA 2NXJA 5B1HA 4KXYA 3H42B 2GHQA 4LTDA 2LP4Y 1T24A 3RV4A 3CNLA 4MI3A 3RK1A 4DQXA 2PUEA 3PCXA 1OAOC 3N70A 2HBRA 1BCSB 3DR3A 3L1KA 1NW5A 3T7IA 1U7DA 2BFEB 1DTWB 4MS3B 5DSXA 2AZMA 3OFVA 3X1WA 2AN9A 1P80A 2WJGA 2AC2A 4FX2A 4HG2A 3OU6A 2GFHA 4GWKA 4O4JF 3M3HA 1LKZA 1EFRA 2QP9X 3BE8A 5FAXA 5LP1A 2ZROA 1UCFA 2DQ4A 1JE0A 5JSZB 3CLKA 3VYSB 5JSHA 4HL6A 3WNCA 1Q6YA 5IWAB 3E0QA 4X95A 3D2AA 4TRJA 2HGSA 3K0SA 4FGSA 3ZXYA 4YRNA 3WVNA 3K4HA 3ZLVA 1Z28A 1YDGA 4AUMA 1W5AA 1P1FA 2XMGA 3KZNA 3U7QB 2V45A 4XIIA 2QT9A 3FLMA 4LKRA 5JCOC 4GLBA 1DDOA 4B43A 4WJZA 4HDQB 2DETA 1B93A 3BQMB 2VQDA 2QD5A 2PO7A 1MJGA 2DPMA 2WVHA 4HGRA 4JB3A 3WP0A 1C0LA 5ITVA 4TM8A 3PJRA 2PWZA 1QP0A 3AEQB 5HSGA 2J0SA 2VPWA 4LHEA 1DLJA 1ULHA 2D5IA 3M6WA 4GBGA 5J4VA 2C57A 3ZKAA 1L0BA 3VYTB 3EZLA 3LKZA 4H0NA 4KPUA 3RABA 1FFXA 1QZ3A 4FYPA 3ZS8A 4B4UA 1XMSA 1O94D 2E18A 2QYSA 1PNOA 3ACDA 3PDWA 4K6FA 3M6VA 4X63A 4F4IA 4R54A 1YS9A 2QAGA 3GQVA 4IDQA 2P4UA 4N3GA 3AK4A 3TQOA 1M7GA 3JVIA 4XCVA 3WRXC 5M34A 2ZSJA 2E2WA 1AKEA 4FPXA 4BRZA 3O9MA 5CIYA 3IT3A 1GY8A 4FYMA 4B6PA 1SEVA 2CMDA 3OQNA 16PKA 1KKMA 3N0RA 3H4IA 2CXTA 3HKEB 4BRUA 1U3FA 4DDWA 4EGCB 3RYIB 1H3FA 1QGAA 3EFEA 3QX7A 4I14A 5C52B 2XKKA 1SNYA 4KU4A 1GUDA 4QREA 1E1RA 5E6SA 3W90A 2E3JA 4QXMA 2IDZA 3B1XA 5JY6A 2VTBB 2OP1A 1A4UA 2UDPA 4MZXA 1H5QA 1XYYA 5JSQA 3BBLA 2MSNA 2BELA 5DNEA 5ER9A 1M3SA 3A4IA 1XMPA 1MC1A 3SBOA 2BL4A 3COZA 2E82A 3KD3A 3SBEA 4Z9YA 4DSTA 3FZGA 2ZI6A 4MWBA 1KZ9A 2A4KA 2O8VA 4ND2A 3W0LB 4B31A 2AZXA 4DWJA 3NYRA 5CDTA 4DF3A 2W2KA 1ESZA 4YRBA 2J9RA 2G9NA 4J49A 3CZ4A 1WZNA 3EIUA 1JIQA 5KYTA 4EJ0A 1FLAA 4YUZA 1WB4A 4BFZA 4U7DA 2OO5A 1DHTA 3AUFA 3DHNA 2ZM6B 1AS0A 4UEOA 4WNIA 1SHLA 1F2DA 4E5NA 5BQFA 2JLWA 4W7IA 4XJTA 1RQ2A 4BNDB 4D96A 2V0GA 1BVYF 4QFCA 1KYWA 1T5DX 3L7OA 1CNEA 1A71A 2NYVA 1JLLB 1MVLA 1GFZA 3NIDB 1WOMA 1WA5A 2HNKA 2HCRA 1JFFB 4LN1A 3PPXA 1KEEA 1X7XB 4RIGA 1FNBA 4ZU1X 4NRDA 1R0ZA 1SCAA 3EXIA 1HXHA 1KNXA 1VJ5A 4LBVA 5I51A 3RVOA 4B75A 2GBFA 5COBA 1OZFA 2WQ7A 4WBNB 4WZ6A 3ID6C 1IZZA 5B3AA 3W05A 3ZOZA 2ZBDA 1QYXA 4MGZR 3TIIA 2Z4TA 4JLPA 1ULSA 2M6RA 3GJTA 3ILSA 1P0IA 1OTXA 4ZP1A 1IQ0A 2AB0A 4ID3A 5EINA 4KR6A 1OJLA 2WV7A 3BGVA 1EM8B 4O4HA 2DSTA 1JSRA 4I4IA 2PSSA 3RJ5A 1VZ3A 2ZJ0A 1CQJB 3SD7A 4DRZA 1EAMA 2VR1A 3ECCA 2VTKA 1AO3A 1LC0A 1CQWA 4OB7A 2PZBA 4E4YA 5I4IA 1L5SA 4CETA 1FP2A 4UUOA 3KKMA 1PSWA 4WFKA 1Z4QA 1CJMA 2O0MA 4OHOA 3WO0A 1BQ3A 5BW8A 9ABPA 2J5KA 1H2BA 2BR3A 2GAJA 1Z7EA 2WIGA 1ZCAA 4TLLB 3HC7A 3OM0A 1UMBA 3WGTA 4OBEA 1PWZA 3LGSA 3LZDA 4S1WA 4NOMA 1V4BA 3UO8B 1C3OB 1E77A 1P18A 1RHJA 2HV9A 3IMGA 3M4NA 3P97A 1KBZA 5JQGB 2AQHA 4I4CA 1U0BB 1VA5A 4WECA 3K9GA 1YZTA 3AOEA 3ORFA 2B21A 2H52A 1P6QA 1T2NA 1V2GA 3PL1A 4PZ9A 5FBQB 1YOVB 4WXHA 4O1IA 4GPEA 3CSSA 4PM4A 1ZBDA 2Q27A 2ZRGA 1FRQA 4LYYA 2NADA 3OY2A 2ZQZA 3BWBA 3UG7A 6ADHA 1EGMB 3T3DA 4P92A 5CAEA 5MGNA 4NXMB 2R6ZA 5JO9A 1SURA 1Z82A 5DTJA 3FR8A 2F90A 1RI3A 3U4CA 4A9AA 2DT5A 1VOTA 2J9FA 3QK7A 1J2YA 1MJFA 1XK6A 5L6LB 4YV1A 4DZZA 2DJ5A 3B48A 1KP3A 4AU1A 4KIUA 2I9PA 5CX4A 4A8PA 3OZIA 3TZHA 2Y3IA 4PGAA 1UBOS 4JH0A 2Y0CA 3ZCSA 2JIOA 2DJIA 4FOOA 4DCTA 1E69A 5FOUA 2NPIA 5K99A 3A1TA 2LKCA 2WPNA 4J1NA 2V65A 5EJ6A 3QWIA 1C9EA 1MJNA 1P4RA 2PRIA 4M2LA 4U8HA 4ZAFA 2Q1WA 3TNYA 1Q16A 4RIFA 1JJIA 4WVFA 4FB5A 1JU9A 3GWZA 3RREA 4RD1A 2FFBA 3LHIA 1ULAA 2JLBA 3BF7A 4FNGA 4CR7A 1T5SA 4HAOA 1ODJA 3IAFA 4G5XA 3ZBPA 4LNUB 3JYPA 1NLMA 4K7JA 1AE1A 5HRUA 1M5TA 5T7BA 3KXIA 3AB3A 4FE7A 2NPFA 4ZA2A 4AJHA 1VKRA 3BWVA 4XM1A 3LFUA 3UOAB 2JJ1D 3LT5A 3PLRA 1ZN2A 2XMRA 1YB7A 2C2KA 3TPFA 2HUNA 1ORTA 2CCGA 1IAQA 2OK7A 5FH9A 2O52A 1BWQA 3Q87B 1JLHA 3NEAA 1GTZA 4LHSA 3AM3A 3Q7EA 3WICA 1ZK0A 5JALA 4E88A 1I7LA 4L15A 4MZDA 1U8XX 5BSMA 4IIFA 3JAWA 2H7XA 4M1MA 1O96A 3B1JA 4KIGA 5F3DA 3AEYA 2X40A 4XE5A 2X5OA 1NE7A 2Q5JA 2D5AA 2Y1OA 3RS8A 1BE8A 1XTKA 3G8CA 3NBFA 3MGCA 2XYRA 2JGNA 2YUTA 1EPUA 1TCVA 1KKUA 2REXB 3NQ41 3PLNA 4H6PA 4PYQA 4WZZA 3PD0A 5KAMA 3TGWA 2VWHA 2M6LA 3UWKA 4CHGA 4O63O 4L51A 2C5BA 2X19A 1R64A 5K3FB 1K89A 3EIQA 3PBKA 4JBYA 3TD6A 1EVZA 4RK4A 3TRHA 3EJ6A 1GEGA 1A9XB 5A5VA 4BVFA 5J4LA 3G23A 3OZEA 1SIWA 4GSYA 2HRZA 3BE4A 2PUBA 2E4WA 2YYSA 5KYKA 4YALA 4HGNA 1IOWA 5TJ9A 4ARVA 4ZJPA 3G0GA 5BN5A 2PGIA 3KV1A 5IW8A 1QRRA 4WNCA 1M2NA 2P0EA 2BFOA 3K3PA 3CQ9A 3WLHA 2C7OA 1SO8A 4KIWA 4KKVA 4OLJA 4ZYLA 3K4QA 1PJ4A 2WU8A 1G60A 4YQEA 3ZD8A 3LX6A 4LY9A 3DLAA 3PHHA 3C3KA 1PT5A 3SGLA 4V0RA 3KCQA 3AG5A 1WXEA 4Q93A 2QTNA 2GCPA 3FWZA 1ISMA 3V46A 1ABBA 4BECA 3SNKA 3DP9A 4TWIA 2DTEA 2HHLA 4FOLA 1IHYA 1KOJA 2MWMA 4EDFA 1YR8A 1J9GA 5EP1A 1XR3A 2Q4TA 3OEHD 5IXSA 1DWUA 1E3DA 4M8SA 1FLDA 3RLFA 1F0KA 2X86A 5LN1A 1D2CA 2AN3A 5JS6A 1IHOA 4F6LA 2RHBA 3QV1A 1X8KA 5B64A 2ZTLA 3CZ9A 2B4KA 3DFZA 1QNLA 2WB4A 2FGKA 4WDQA 3C4JA 3WL4A 4CM3A 3KEMA 4IIJA 2BCJQ 5LMNB 1RM4A 2WA2A 4N5DA 4WXYB 3EFBA 4DBLC 2ORIA 4ETIA 5B1EA 1I13A 3RSLA 1M2VB 1QKJA 1XEWY 5FBLB 1ZD9A 3CFYA 2YFYA 4HNQA 1P2DA 4LECA 1OR8A 4PC3A 4PZAA 3KT8A 2QQEA 3H8WA 4PXYA 2NVOA 2PO5A 1I1QB 3HLTA 4RH0A 4MLPA 2J0QA 5K4GA 2P35A 1XKTA 3FFTA 4IIEA 5JD4A 3V9AA 5MFPA 1WCV1 2FSIA 2XDQA 3DQQA 3E8XA 3QY0A 4GX0A 5F1YA 5K1ZA 3W2TA 4X62B 1Z0FA 4Y0NA 3PTAA 3RPEA 1XZAA 4D97A 3PFFA 3WWPA 1H4TA 1Y4AE 2WBLC 3H5AA 4XRRA 4G0YA 5CW1A 1PR6A 3SJUA 1SIBE 1DJNA 4JVNA 2QVLA 4NS4A 4D3SA 1GTG1 3FGPA 4OHVA 1QYDA 1SD5A 4X1KA 4BAZA 4DLVA 5IABA 4CT0A 4AG5A 2F2TA 1PQPA 2O3JA 1FXUA 4FR5A 4B5KA 3I64A 1TUIA 1ZK2A 1Q74A 2HA6A 2OOSA 3D3EA 1LDYA 2V7UA 1Q0RA 1IDOA 4BASA 2G82A 2G17A 4W1PA 1Z6QA 5ELXA 2IS6A 4XM2A 3PVSA 2CNKA 2NSLA 1ZQ1A 3T7CA 2DHRA 3W7AA 4WINA 3B7WA 4XIFA 2CLMB 5AW8A 3RK4A 3L0YA 1DPFA 4FI3F 2GXAA 3NP7A 3SQLA 1P0MA 3KHKA 1CTQA 3G1UA 3NIGB 1DFHA 1R0XA 2ORED 2SKEA 3NKLA 2GQ0A 3G8YA 2RBKA 4XUGB 1AVTA 1NUSA 3LLMA 1NIJA 2HQOA 3ZZ1A 4BCBA 2CVFA 1R0SA 1OROA 3IBSA 4KDCA 4RJKA 4CKXA 2JHCA 1W49A 3BM5A 3CZPA 3FCSB 1ZD5A 5LXTB 4DZTA 5HVNA 4GPD1 2XMSA 4D3ZA 4P4SA 3DLTA 1N5RA 2A14A 4D79A 5B53A 4D5EA 5PGMA 2QSYA 3WR5A 4JA2A 2QW0X 4E1BA 2D2IA 5AJWA 2YMQA 1TO1E 5K0NA 1CY6A 3PD1A 4U7WA 3UG6A 2BKVA 2PQMA 4BZPA 4HYQA 4V24A 3G2NA 5IBQA 4BN5A 1PR2A 1P31A 2C03A 4NAUA 1EFAA 3NDIA 1SU4A 4N82A 3NBUA 2YHUA 2BGUA 1PDOA 2XWPA 1DEXA 1LNSA 1P0PA 3MJEA 5ED0A 1XDUA 4WK4B 4FQ7A 4H31A 4LQCA 4YDHB 3COJA 2D0PB 3OOSA 3T1VA 2VPTA 3KSAC 5IDYA 1EFPB 2XUFA 4RSMA 5CPBA 1Q0UA 1QM5A 2O1EA 3KYIB 4I4TA 4O25A 4OQLA 1QRSA 2BFBB 1XMVA 3CLUD 3UMGA 3WK8A 3VJKA 1WPRA 4C4XA 1A5TA 4XYLA 3CNNA 4RABA 2Z83A 4LZZA 2ID7A 4LZLA 1G0NA 3ZCXA 2H2DA 5K8LA 3ZX5A 2RHRA 1L1QA 4B3CA 3AFHA 3W04A 4RVDA 4ZYVA 3PEFA 1E2EA 2Q4RA 1I7NA 1Y8CA 4EJSA 2XI4A 4HC4A 3VR4H 4C76A 1L1FA 4FNOA 1Z73A 2A1TS 4L6CA 2G80A 3GL9A 1AURA 1SU6A 2J5RA 3AJ9A 3L8DA 4ZHQA 2L2QA 4DUPA 2GDJA 5EMJA 2H8KA 3SXPA 5I8PA 3ZWCA 3SYRA 1TZBA 2VPYA 2ZPAA 3OMWA 1XRJA 1TUGA 1P1CA 2YY6A 2AJTA 1SXJD 4Q19A 3UGTA 2ZP1A 4ND7A 3WISA 3FCYA 4DT1A 4QDXA 4EPWA 5JD5A 1UPUA 4IIDA 1KARA 2Q6IA 1XQVA 2G8NA 1ABFA 2X4GA 3QWFA 3ZZMA 3RS7A 5IXJA 1NOIA 2G0NA 5P21A 1P33A 3BZUA 5I4BA 3C5HA 4K6KA 3D7SA 2O8FA 2QUKA 5AVOA 1VB3A 3CF0A 1IBRA 2DPXA 3RB8A 3AT1A 5C5CA 4HLUC 5DGXA 2LDBA 2NUPB 2POCA 3BL5A 2J4CA 3ZDQA 1G4UR 3WFIA 2R5NA 4LCBA 3O8RA 3O1LA 3B3FA 4N18A 3BWMA 2ZB3A 3A2KA 3MTIA 3VZSA 3U4QB 2G1PA 1N5KA 2EP8A 2XRYA 1Z4NA 2HCFA 2PMKA 1HPLA 1W19A