2CMKA

Cytidine monophosphate kinase in complex with cytidine-di-phosphate
Total Genus 75
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
75
sequence length
221
structure length
221
Chain Sequence
AIAPVITIDGPSGAGKGTLCKAMAEALQWHLLDSGAIYRVLALAALHHHVDVASEDALVPLASHLDVRFVSTNGNLEVILEGEDVSGEIRTQEVANAASQVAAFPRVREALLRRQRAFRELPGLIADGRDMGTVVFPDAPVKIFLDASSEERAHRRMLQLQEKGFSVNFERLLAEIKERDDRDRNRAVAPLVPAADALVLDSTTLSIEQVIEKALQYARQK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords PROTEIN (CYTIDINE MONOPHOSPHATE KINASE)
publication title Structures of escherichia coli CMP kinase alone and in complex with CDP: a new fold of the nucleoside monophosphate binding domain and insights into cytosine nucleotide specificity.
pubmed doi rcsb
source organism Escherichia coli
total genus 75
structure length 221
sequence length 221
ec nomenclature ec 2.7.4.25: (d)CMP kinase.
pdb deposition date 1998-09-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02224 Cytidylate_kin Cytidylate kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 2cmkA00
1X86B 2RHDA 3KJIA 1IY0A 1E1RA 1R2QA 3HPRA 3K0AA 5K8IA 1ZD9A 3T1QA 4O2LA 3WHKA 4R7ZA 4H1VA 3PUWA 4NCIA 2DPXA 1P60A 2VP9A 1XCGB 1NLFA 5CIQA 1KGDA 5FBLB 1YHNA 2IYLD 2ZETA 3DZDA 1XTJA 1DAGA 2A7QA 4QL3A 4BZQA 1XEXB 2QRZA 2NPFA 3KL4A 3SYKA 4DCTA 5BN4A 4L5BA 4D25A 3PR1A 4PANA 3D31A 1N5LA 2HDNB 4HB2A 1II9A 2JLWA 2ZRLA 2J0UB 1KAOA 4W9MC 4ARZA 3HDTA 2H18A 5A4JA 4B3BA 4P31A 4POAA 5CDFE 2DWPA 1H8HA 1I2MA 2F1HA 3SOPA 2IYWA 1QVRA 1F60A 2EFEB 4LJ6A 5B2ZA 3SR0A 1CULC 5AR1A 1KDTA 3SFZA 1RPZA 3CIOA 2WAYA 5LPNA 4MGYR 2BOVA 3U4QA 2JLYA 3IQXA 3J81k 2ANBA 1Y3AA 4TTQA 2GCOA 2V9PA 3GLGB 1XXHE 1IN4A 1G7SA 3MJRA 5DI3B 4TMTA 3IDQA 2ZS8A 4W5JA 4DVGA 4LJ4A 1KMHA 1ODFA 2TMKA 4A4DA 4NE2A 4GRAA 3VKGA 3NVAA 2RGCA 5J4YA 2XITA 2GA8A 1M1YE 1ZC4A 2PT7A 2ZSAA 4MDFA 2DYKA 4QHTA 4BFXA 4YDSA 2WWWA 4Q1EA 1Q22A 3TLXA 3KKMA 4AD8A 4LY6A 2FSGA 4QRHA 1XJQA 4B6FA 2OG2A 5HCNA 3RLFA 1KSHA 1S2MA 4LJ7A 1YKSA 1Z0KA 4JS0A 3EZ6A 5EP3A 4OBEA 1N5IA 5G41A 1Z07A 5JJIA 2B7BA 2V7QD 5KU1A 1PLKA 2R62A 3LAWA 2QZ4A 3T34A 4ACAA 4DB2A 3QKTA 1P2SA 1RRFA 2BKEA 4HYYA 4OI4A 1GKIA 4ZIRB 2PEZA 3EC1A 1G17A 3MD0A 3UK6A 1C4OA 3EZ9A 5KHOC 2P6NA 3GQBA 4D4LA 4FMBB 1NVWQ 1KK3A 2R65A 2BMDA 2J46A 2YKGA 2X2EA 1YZGA 1L2TA 1VYUA 2YC2C 4IDOA 3V4FA 3DVLA 2ORVA 2NMVA 4TYYA 2ONJA 5FTLA 4C30A 2NIPA 5H1YA 4FN5A 3LD9A 1J7KA 3U7FB 3GJ6A 3K9HA 2H92A 5SZKB 3AEZA 4BPBA 1SVKA 4IDNA 4M1OA 1E2JA 4F93B 2O8FB 5FPTA 3EASA 4V0MA 3SFVA 4IVPA 1KI6B 4QM7A 2DFKB 2C9CA 4URVR 3LX5A 4OQXA 3EZFA 2ZTSA 2PJZA 4MA4A 1DAIA 1XTKA 3FFAA 1BS1A 1CU1A 1DAFA 2YV5A 3W5JA 2DWOA 5GJVC 5EP4A 1O3YA 4QBIA 2EYUA 3U3MA 3PENA 4MRPA 1FNMA 3D8BA 4QBHA 5AUQA 4WBSA 1YVDA 2FJUA 3CONA 4FMDB 2ZM5A 1HEIA 4EPYA 2IYQA 1MO5A 4M0LA 3P26A 2IUTA 3K0FA 2BWJA 4D6PA 2VRWA 1D8TA 1WDTA 4FMCB 1UBCA 3A1UA 3FE2A 4U02A 1KI1A 2R6DA 4ZDKA 1OFTA 2IXEA 4Q4HA 2GXAA 2AD1A 2OUKA 1XTQA 4AYTA 5BQ5A 3MSXA 1Z2CA 1IONA 1CP2A 1F2TA 3NH9A 2QQ0A 4Q4AA 5LDDC 3NG1A 3UXMA 3AM1A 1WXQA 2B8WA 2BJWA 3TH5A 5FH9A 1KTVA 4IOLA 3U44A 2RGAA 4JSYA 5M04A 1P75A 2HLDA 4PPGA 3CH5A 4YMTA 1XBTA 4KV9A 4QOSA 4Q4JA 2PBRA 2FFBA 2YHSA 1Q3HA 2ZRDA 4PC3A 1GAJA 1ZM4A 1ZIPA 2VO1A 3MUFA 3QXJA 4HAXA 2G0TA 3VR4A 4I1VA 1T8UA 4AYXA 3AF0A 3M1IA 5EZ6B 3IGFA 1KMHB 1S3GA 4HDCA 3ZVLA 2Q21A 5BXQC 1SXJE 1IJEA 1G7CA 3K9LA 5KUTA 3UG7A 4B3CA 2XSZD 2IYUA 3L0IB 3B1ZA 3W8RA 4QJ5A 1E2DA 5DH9A 2DB3A 3AVOA 4A0HA 3HU2A 1JALA 3ECCA 3BXZA 3TSOA 3U61B 2OILA 4GPTA 5JFGA 1Z83A 1D5CA 3BOSA 4X8HA 2FMXA 1BYUA 5BYKA 3WBJA 1MOZA 2WJJA 1HTWA 3ZIAA 1NVVR 3AKDA 2CLCX 1VMAA 4S2EA 5SZIA 3T5GA 3MWLA 2BIFA 2FA9A 1F6BA 4A8JC 3UMFA 4BRWA 2QUZA 1F2UA 1OXSC 3GD7A 3NBYC 1OJLA 2CLSA 2IXFA 3NTUA 3KJEA 3CZQA 1JNYA 4DC9A 3G5UA 1ZNYA 1G3UA 1RZ3A 2GXUA 3V9PA 4JYBA 2VSOA 3ZVRA 6Q21A 2UZIR 1QVAA 1ZMXA 4TYPA 4B48A 1MRSA 3P32A 5FPSA 3H86A 2WIAA 2ATXA 4AURA 4D80A 2BCJQ 1YE8A 4JZKA 3UG6A 4L9SA 3IIJA 3BB3A 4OJKA 3TKLA 5J47A 3OAAA 4TTRA 2VP0A 5LBIA 8OHMA 1GKUB 3OZXA 3EWAA 1OB5A 1SVMA 4HLCA 4BRUA 4GI7A 2H17A 2GHIA 2VHUA 4MUAA 4YMVA 5FOTA 4HDOB 1AKEA 2O0KA 1Z06A 1FMLA 1WF3A 2QE7D 4LHZA 2PT5A 1XMIA 2WICA 4QG7A 4PZYA 1PLLA 4A2QA 2ZR9A 3K0FB 1U81A 1BIFA 5C4GB 5JMTA 3A1SA 2WOJA 1L7VC 3B6EA 2J59A 3CPEA 2AFHE 4RZXA 3K70C 2YYZA 3PITA 2ZI5A 3X1YA 4HLUC 3FTQA 4A15A 3RS3A 2Q0HA 2OLJA 4NCKA 3TSWA 4LYJA 4Z1MA 4EQ6B 1W44A 4R98A 621PA 5EXPA 4EDHA 1L4YA 4XH9B 421PA 4IXNA 1OIWA 5AUNB 1TMKA 3UWOA 5C4MA 1P2TA 1R0XA 4HB4A 4PXAA 4I81A 5F98A 3H2YA 4MYUA 2GBLA 4C2UA 1DADA 5KSYA 4TYWA 2F3TA 4EPWA 2AN9A 4DT1B 1R8SA 2BKUA 2LKDA 2RGNA 2ZS9A 3PUXA 2NPIA 3IHWA 4Q03A 5BN5A 1U0JA 3P1JA 3K53A 2ERYA 4KITB 4ILEA 2CL6X 1NRJB 2VSFA 3L8ZA 5JHGB 1PJRA 2BBTA 1XTSA 1YZKA 4EPTA 4RD4A 3CNLA 2O8BA 5TXGA 3OHMA 4C3ZA 1DAEA 2HYDA 2Z43A 1II8B 3I3SR 4JJZA 4LZZA 1TQ4A 2DY1A 2OXRA 2FZ4A 5IK2D 2R9VA 4C0BA 4IEEA 4M1SA 4YXWA 1Z0FA 5EQTA 2O8EB 4IRUB 4JJKA 2VH5R 4W5HA 1JPJA 1CJKC 1KO5A 2QAGC 2HF9A 3U6BA 3NHBA 4CW7A 4D82A 1E3MA 3CRW1 3FFBA 2GXSA 4L4UA 3WP0A 2ORIA 1W4BA 4A92A 2P0EA 3RS7A 4QGAA 4AI6A 2AFIE 1VTKA 1Z47A 3K1JA 3FMPB 3P20A 4XWKA 2QTHA 3U6KA 2XNDA 5FBQB 1DG1G 2RHMA 4XVQA 1U8AA 1E79D 2YOFA 1EWRA 3ZZUA 1F2UB 3N2IA 5FPYA 2OZEA 2VP5A 4AIIA 2Y8EA 5CITA 3TVTA 1XD2B 5FBRB 1VPLA 3C15C 2AXNA 2IC5A 3QI2A 3I5XA 3CF2A 4QGHA 4KXFB 2QQEA 4LJAA 1W5SA 5L3QA 3UMSA 1J8YF 4RY2A 2C2HA 4ZCIA 2GAOA 1TQDA 3GP8A 3BFKA 1ZNWA 1WBBA 2V1UA 3JVVA 4DB4A 2ZJ2A 1CR2A 1VIAA 2WZQA 1N0VC 3TW8B 3W3ZB 4B2IA 4BFUA 3WNDA 2G88A 2ZI4A 2ZU0C 3DL0A 4DCSA 1IHUA 4US2R 3ZZ0A 3ZVMA 1E1QA 1R0WA 4TMZA 4PC2A 1EWQA 1XTRA 4CEJB 4D4JA 2XGJA 1SKQA 1U8YA 4GL2A 2FE4A 3PUYA 1Z0AA 2XEXA 2CLDX 3EWSA 4UQOA 3FYHA 3UIEA 1X8KA 4IEIA 2OEPA 3E70C 2VIIA 4Q66C 3L43A 4XWAA 4TL7A 3GLGE 2ZREA 2J7PD 2JIZD 4Q1BA 4DLXA 3W6NA 1R4AA 3Q8XB 2ZE5A 2ODEA 4ABYA 4JLNA 4G1UC 1LF5A 1FZQA 4PFSA 5DSZA 3TQCA 1AQUA 2QROA 2ZS7A 3EIQA 2BDTA 4C0HA 3VX4A 3ADDA 2CCGA 4NHOA 3CX8A 1J8MF 1JB1A 1NMZA 2FF7A 4FWIB 3KFXA 3A1WA 3IPXA 3QNUA 4A9AA 3G0HA 3VKHA 1IOZA 2FOLA 4ZCLA 5FUYA 1U98A 2Z83A 1VG1A 5KPJA 3GJ7A 2FFQA 2C77A 3ZZTA 4C2TA 2J1LA 3PXGA 1D2NA 2RB4A 1K8RA 3KZ1E 1WA5A 2XZPA 4BLQA 1JJ7A 4Z1MD 3PV0A 3KQNA 2J45A 3ADKA 2XXAB 3R7WB 4QBFA 3CR7A 1I4DD 2WV9A 2ZJBA 1E98A 3TSZA 5TVKA 1W49A 2OT3B 1AM4D 1E2NA 2BEKA 2XTZA 5JWRA 4YQFA 1UKEA 4J0QA 1VYVA 1SVLA 1S96A 1T3HA 3I4LA 1U0HC 1JBKA 1YRAA 3EG5A 5J4KA 1AGPA 1R8QA 3SDZA 2F3RA 1TEVA 2EFGA 3WYFA 1GILA 3DHWC 4IVQA 5FOVA 3HR7A 3VHXA 1GL6A 4HZUA 1KSJA 2QPTA 3F3YA 4JKYA 1OHHD 4HUQA 4OL0A 3MLEA 1NVUQ 2ZQ5A 1RJ9A 1MV5A 4F7WA 2F1JA 3A1TA 5TY0A 3UKDA 3GLFA 3JZAA 1ZJ6A 1MABB 2WJYA 2KBFA 3EIHA 1NN1A 3K09C 1XZPA 1A1VA 1E9SA 4ZI2A 3BFXA 3K0CA 3AF2A 4YMUA 3U5ZB 2FFHA 2ZE7A 4YXWD 1KI3A 1N6PA 2XB2A 3I72A 4DRZA 2EFCB 5CK5A 3WYGA 1P62B 2QSZA 1UBFA 2OBMA 1EFHA 1R6BX 2Z0MA 4OHYA 2ZI3A 3NHAA 1KNQA 4C0AC 2JLQA 2FZLA 2FN4A 1NBMD 2NZJA 2IW3A 4RCYA 1UAAA 1SHKA 2A78A 1OIVA 2DCUA 4PC7A 3IQWA 4OHZA 1VIYA 4K81B 1SULA 2GVDC 2B92A 2GCPA 5L8VA 1DELA 4F91B 4B34A 5DN6D 1G19A 2CK3D 3ND8A 1E96A 1PZNA 4LHXA 3DMNA 5LD2C 2CVHA 3OEEA 2GTPA 2CL7X 4XTCS 4V0KA 4B2LA 1UKYA 3SHWA 4IOMA 1M6NA 2CJWB 1ZD1A 1Z3IX 2MSDB 5E3HA 3EZ7A 3U3JA 1DEKA 4WXRA 3ZVNA 3PEYA 1HH4A 4IDQA 1CTQA 1E2FA 3NKVA 3VFDA 4B76A 3W9YA 3SHFA 3I62A 2JA1A 1PLJA 2HF8A 2GNOA 3I5YA 4MDEA 2GK7A 2DWQA 4DCNA 1UPTA 3D7MA 4ZDWA 1MRNA 4NYIR 1NG1A 1SXJC 1IN5A 1U0LA 4KU4A 5CK4A 1N0UA 1I4LD 3GEHA 1D2MA 1IBRA 1OIXA 3TMKA 4DSOA 3CM0A 2GEVA 2V7QA 4C7OA 2ZI6A 2ZJ8A 5FUVA 3C4JA 4JBYA 2FH5B 5FTNA 3MJHA 3ICEA 4DZZA 4MKHA 4KYUA 2ZE6A 3RYTC 4F38A 3ZD7A 4KFTA 4EKDA 2G1KA 4HUTA 1S1MA 3NDBB 1XF9A 4F4IA 5L3SB 1CR0A 5LB4A 4B75A 2RH5A 1G3IA 3T1TA 1D2EA 3REFA 2GZDA 3QVUA 3A4MA 1W36C 2OHFA 2A30A 1IN8A 5FUWA 5HE8A 2X1VA 4FXPA 4HB0A 4TMKA 3AF1A 4DSUA 2OSBA 2ZE8A 4ASUA 2FDCA 5DGXA 3BGWA 1DAMA 2FU5C 2IS4A 2JJ1D 3NEJA 2OV2A 4HAWA 4PAQA 3ZYCA 1GSIA 3VMFA 1RJ9B 1KNXA 4PO8A 1FL9A 2FPKA 3RANA 1W7AA 2W00A 2DHRA 1EXMA 1VG9B 3C8UA 3L0OA 2ZSEA 5BWMA 1E4YA 2I4IA 3THWA 1UEIA 2IWHA 1EK0A 3BE4A 1Q1EA 2J0SA 1DPFA 3GFOA 5CLLA 1G41A 1E2HA 2QU8A 4QJ4A 1Q44A 5EP1A 2RKOA 1RVDA 1KK0A 2O8DB 1Z29A 4OQMA 4YLGA 4QHSA 3C14C 3K0EA 1JR3D 5H8WA 3QF4A 4NYMQ 4HB3A 3QPVA 1T0JB 3SJCA 1WP9A 3QKRA 1GITA 4NTZA 1BH2A 4LV5B 3VU9B 5JRZA 5HZKA 3EPJA 3ND9A 3WYAA 4LWZA 3WY9A 1Z08A 4ZPXA 3DOEA 1NN5A 2WOOA 3LDAA 1SVSA 3PCRB 4O0MA 4MH0R 2O8CA 3CUEF 1SQ5A 2E87A 4LYFA 3T61A 1UJ2A 3U3RA 2QAJA 3Q5EA 1ZYUA 1WRBA 5J4VA 1KO1A 3W5IA 3BS4A 2RCNA 3AGQA 2VLIA 2QA5A 1N6IA 3W3AA 2CXXA 4OQLA 1G5RA 4P4TA 4ERNA 4JVMA 4PHHA 4LCBA 2HJGA 4IFBA 4MYHA 2QTVB 2PZFA 4B71A 4PSKA 4BASA 2X8AA 3KQHA 1T5IA 1VCIA 4G5QA 2RAPA 5FBVB 1V43A 1OYYA 2Q3MA 3L0PA 4TMWA 3THYA 1YRBA 2PMKA 5B57C 1RRPA 4RKFA 4S35A 5J40A 4UNSA 4BZPA 1JXOA 1OH8A 2N42A 1TPZA 1CJTC 3OEED 2XSZA 5GJCA 1XU4A 3LBNA 4B47A 5TV2A 4NZYA 3MAAC 1UKVY 2QMUA 1GP2A 4HSEA 1AK2A 1IQPA 3L2OB 4YC7A 5JHHB 3AKEA 3PQCA 5AJWA 4CF7A 1AS2A 2WPDA 1EFUA 3AUXA 4QHYA 1E2GA 1F5NA 3EC2A 1E2EA 3THOA 4NKRA 3TJZA 2JGNA 4BEJA 1EFCA 1SKYB 4RD2A 1O87A 4L8GA 4XSGA 1UEJA 5FFMA 1LS1A 2AK2A 3IHLA 1P61B 2O5VA 4IOJA 4CIDA 1WCV1 4DLRA 3BD9A 3H4MA 4EFLA 4A2WA 4P3YA 2PMDA 4DLWA 4MRVA 1US8B 2CNWD 2YWGA 3LBIA 4LJYA 1II0A 3SC3A 1NI3A 4EJSB 1XEFA 2GAAA 1HYQA 1TL7C 4US1R 1ZM7A 2C99A 3GJ3A 4BWYA 2VPPA 5JS7A 3IO3A 2CCKA 2JAQA 3H1TA 1IN7A 1UFQA 3X1WA 2CHGA 4E09A 3WP1B 4FW9A 2WWYA 3I32A 5DIFA 3NH6A 2ATVA 3WMFA 4XSHA 2GZAA 2JLVA 2BMFA 2GZHA 1HT2E 3DOFA 4H9GA 5B30A 4HLUA 2R2AA 1K6MA 2VP4A 2NZ8A 2Q3HA 2IL1A 2PCJA 5P21A 1Z0DA 1QBKC 1G8GA 1XJ0A 5HPYB 4JLVA 1MT0A 3QG5A 1FW6A 4WZBE 2QP3A 4IFEA 4GZLA 2WWIA 2YNMA 4P33A 1TEXA 1T9HA 4Q7LA 1DARA 1N6LA 5KNCA 2OFXA 2J3EA 1ZM3A 4DLVA 1AN0A 4WA7A 1X6VA 5FTJA 2UKDA 2QE7A 4M9ZA 1CS4C 1RYHA 5EE5B 4ASUD 1I2DA 4JYCA 4F4CA 1G4UR 4GMDA 1NKTA 1OXVA 4RD6A 3ZGXA 1DG3A 4II7A 1OH6A 2KBEA 4KCGA 1E2PA 1FP6A 2QBYA 1CRQA 1ZU4A 4Y0VA 5KSZA 3KQUA 3SYNA 1TF5A 2ZSFA 4A6XA 3AVTA 2BJVA 4FINA 2C5LA 3K0AB 2DBYA 4PHTA 3QKSA 2YVUA 3QKRB 4A1FA 2WJVA 4B33A 1YR6A 1RC8A 4YMSA 1BYIA 2J0VA 1E0SA 1E2KA 2QAGA 2Z5FA 2G6BA 4GOKA 1WB9A 1ZIOA 2O8CB 2PZEA 2PX3A 3AVVA 1HUQA 2ZSBA 5IDVA 1AKYA 1W0KD 2OCPA 2PX0A 3KQKA 2H16A 1Q1BA 3OIYA 3A37A 4X8LA 1UKZA 4MITA 4CEIA 3IKJA 4JLPA 1G3MA 4ARZB 4BLRA 3FWYA 4KLNA 2ZSDA 1LS6A 2VEDA 1JXMA 2J41A 2ZRGA 3NC1C 4D4KA 4JLJA 4JT4A 2Q9AA 1NF3A 1NKSA 3GJ4A 2P6RA 3TAHA 3THYB 5EUMA 4GDFA 3UANA 4JMPA 2A9KA 2MSEB 2C98A 1W4AA 3N5CA 2ONKA 5IK2A 2CVFA 4N0DA 1NG9A 3U4QB 1UBGA 4GOXA 4MYCA 2V4ZA 2YWHA 2ZAMA 4HLQB 1NN3A 2HV8A 2GCOB 4GMXA 2JLSA 1IXSB 1NMYA 2IA5A 3EA5A 1FQJA 5G3ZA 3B60A 4YONB 5JI3E 1EG7A 4MGKR 2HT6A 1DAHA 4DIEA 1AZTA 2ZVPX 1GOTA 2GILA 4LX0A 3FKSA 1LB1B 4LC0A 3X1ZA 4GP6A 2B7CA 3A58B 1P3JA 1E79A 5CDFA 2R6FA 3AF3A 2CCJA 4DDTA 3W90A 3CLVA 1UADA 5FR2A 3WRYC 1ZUIA 1IY2A 4AG6A 2WPDD 1KI9A 1XCPA 2IYTA 1G3RA 3DO6A 3KFVA 4BQSA 2C04A 3GFTA 4ZCMA 3KTAA 4Q21A 2C9YA 4I99A 1XP8A 1U90A 1YR8A 2VP2A 4GNKA 1GRQA 5EE1A 1CJVC 1T4GA 4KVAA 1GNPA 4GP7A 1Z2AA 3ZLJA 1E9EA 4DDWA 2J87A 3QBVA 1DO2A 1QF9A 4CDGA 4JL8A 2JLXA 1OB2A 2IS6A 1C9KA 3IPYA 3ADBA 5JJLA 4HAZA 1T5LA 1Z0JA 4MQBA 1TTTA 2IK8A 1Z0IA 1FTSA 2KB0A 2HYIC 4A82A 1QHSA 4PZZA 1J99A 3LRPA 1G291 2P3SA 3LBHA 5EE9A 2W2VA 5HTKA 2I1QA 4PQRA 4BFWA 5GADl 2XJ4A 3LVQE 2G9NA 2YOHA 3AVUA 2D7CA 2W83A 1OKKA 3A4LA 1E9DA 3AF4A 4AKHA 3VR5A 3W6OA 3K70D 1QZXA 3OIWA 2WJIA 3QXCA 3LQRA 1XPUA 2R6AA 3MWYW 1FUKA 4TZ0A 1E99A 4BUJA 2J7PA 2JIZA 4D4MA 3DDCA 2XZOA 1YZNA 3CPHA 3KJHA 1NNEA 4MGIR 3A4NA 1BKDR 5JRJA 5G40A 2ZRAA 2NG1A 1CIPA 1G8FA 1Q20A 2WJHA 4Q1CA 3K9NA 2ZXUA 3RNLA 2IS1A 4F4JA 1CKEA 4PTLA 3KQLA 3SNHA 1AJEA 5AJXA 1LV7A 1EFRA 1SGWA 1TUIA 2QEQA 2W58A 3M4YA 3WRXC 121PA 1KJWA 2WMNB 1L8QA 2QN6A 3PVSA 2P67A 3QUSA 4EAQA 2HT1A 1W0JA 5KSPA 3AKYA 4Q4HB 2GJSA 4AKGA 3PEWA 4GZMA 1G8PA 3KB1A 4CEIB 2GEDA 1F2TB 4Q4AB 3H0KA 4RVCA 2Z4RA 3K09A 1SHZA 1R0ZA 4E5UA 3AVQA 2WTUA 2PLFA 3TGPA 4LRWA 2R44A 5F2EA 3RRZA 3U44B 3LA6A 2JATA 2WHXA 5FOSA 4DWJA 2OESA 3E1SA 1T91A 2YJTD 1IXRC 2AHOA 1CRPA 5FOUA 4W5WA 2RGBA 4Q4JB 4L9WA 2OXCA 2D74A 2VQSA 1U9IC 4OYHA 1KO8A 1OHHA 4DLUA 4MRRA 5H70A 4US0R 1XDBA 4UNRA 1ZINA 3TNFA 4QJ3A 3EIEA 3QJYA 3QY0A 4JL6A 1E0JA 1UBEA 3GJ8A 4C0KA 3U3OA 1DS6A 1N6NA 3C41J 1QG4A 1KI4A 1CJMA 1VHTA 2BBOA 4M1YA 3KUDA 5JS8A 1KDPA 1IJFA 3DM5A 4G5SA 1YZQA 4G5GA 4TLBA 1JAHA 1GL9B 2BMJA 4UNNA 3QQ5A 1CEEA 1ZU5A 2MMCA 3GMTA 2VL7A 4IJMA 2GJKA 2ZYUX 4PHFA 3AUYA 1GRNA 1G21E 1GL7A 5E7IA 2NO0A 4DKXA 2IF2A 1NBMA 1GVNB 3PFIA 2WSSD 1ZNZA 2ZRIA 1CJUC 1G9XA 1KZGB 2ZRFA 3FKSD 3JZMA 5C1BA 3CX6A 2C8VA 1OV4A 3R20A 4TQUS 5CM8B 4YDHB 1WE2A 3S1AA 4LJ9A 4B43A 3BJIC 2W0SA 3AGPA 4JLMA 4C0JA 2XZLA 2ZVQX 4CRWB 4Q9LA 3CRVA 3F8TA 5DN6A 5EZ5A 3BH7A 2LCFA 1D9XA 2CK3A 4I1SA 1CBUA 1N0WA 1NSTA 2ZI9A 3P4XA 4OI0A 3VHLB 4P4SA 2JDID 4HDQB 2J7KA 5TB5A 2D7DA 5KDDA 4QNMA 4URWR 2N1BA 4Q7MB 1Q21A 3B78A 5KDOA 5JWOA 1QDEA 3LNCA 4LJ5A 5JCZA 2XTMA 4U00A 5GVRA 2QP4A 3LQQA 1GUAA 4LV8B 2FSFA 3BWDD 3GFPA 3WBKA 4BLOA 4TQ9A 4MRSA 1P9WA 2B6HA 5CYOA 5KNBA 2HCBA 1ZCAA 5EE0A 4LJ8A 5F9FA 2IXGA 3D3QA 2CE7A 3OFND 5J5CA 1OKKD 4PC6A 1AGRA 2J5XA 5EXXA 4DXAA 4DUGD 4MUBA 2R6CA 4NU0A 2D06A 3IEVA 2F43A 1D9ZA 4C9BA 3QPUA 3VNUA 1Q1ZA 2PCLA 4ITRC 4LHVA 3FHCB 3SEAA 4L16A 2EU8A 2GDJA 3U60B 3B1XA 1OSNA 4HAUA 1TNDA 3U7GA 1SKYE 1W2HA 1OFUX 1XZQA 4QNRA 3FHTA 4WZAE 2OCYC 3TAUA 4B2PA 3IO5A 2BCGY 3QKUA 1GTVA 2HXYA 3HYRA 3RC3A 2RMKA 1EFRD 2AR7A 4QKQA 2JCSA 3CPJB 3RRYA 3CF0A 1E6CA 4ZO4A 1WQ1R 2ZRJA 2P5TB 3LW8A 1E9BA 2WIBA 3D6TB 3I8XA 5FPHA 4FMCF 1YQTA 2R6GA 3VR6A 4LDJA 1W0JD 2FGJA 3ASZA 4LV6A 1R0YA 4DDVA 4KVGA 1XWIA 3MMPA 4JLBA 3BH6A 3SU8A 4BFVA 2JJ1A 5FR1A 4A6PA 1NIJA 4V0LA 1S3SA 2B21A 1KJZA 2FPMA 1KYIA 2W2XA 4B44A 4DSTA 1G1MA 1U8ZA 3GCGA 3QXXA 1UDXA 3L82B 4ZV4A 1UF9A 1E32A 1QHYA 3EXAA 1G3QA 2PL3A 2ZEJA 2G3YA 3CH4B 4NPHA 3UATA 2O8BB 1GDDA 1Z6YA 1ZVQA 2V6JA 4I1OA 4TL9A 5KO2A 4LC1A 3H84A 3LW7A 2IUUA 5C46F 1QG2A 4TYQA 2EYQA 1P6XA 2F7SA 3O8BA 2E1RA 3HPQA 2BM1A 1E2MA 2WBLC 4GSYA 2HCJB 1OPXA 2VTKA 3LH5A 4JL5A 4Q5IA 4RZ2A 2J0QA 3QOFA 4KHZA 1A7JA 2EW1A 5AJYA 1G18A 1TU3A 4Z54A 4OQNA 1JR3A 2OLKA 4RD0A 2HEIA 4BLTA 4TYNA 3NBXX 4KO8A 4RSGA 4O3MA 4JVNA 4IDPA 2N46A 1EX6A 1ZCBA 2BBWA 2OM2A 3S1AB 4BEBA 2F9LA 3FVQA 4BECA 2CHVA 3ADCA 2WJGA 3B1WA 2FSHA 1R5NA 3B9PA 4QFMA 1P4SA 4PX9A 3NXSA 4PSVA 1LF0A 4Q9IA 1M7BA 3GJ0A 1SZPA 3O8CA 2H7VA 4RZ3A 5JECA 4OJQA 3FPAA 1PUIA 3OF5A 3GLIA 2HUPA 5ANRB 1DE0A 4DDUA 2ZRNA 3WNBA 3NDPA 5L3QB 5DI9A 821PA 3EW9A 3KKQA 4KBFA 4G01B 4JBWA 4Q7KA 1RE0A 2PLRA 4EFNA 2DFNA 4K46A 2OFWA 2OAP1 1P5ZB 2FEMA 4V0NA 5F9HA 1OF1A 2Q3FA 3VNVA 1N6OA 3VR2A 1GZSA 2UZ3A 4BFZA 1ZUNB 2ZR7A 2R8RA 4C0SA 1M34E 1N6HA 2O0JA 2BM0A 1J2JA 4RCZA 2JLZA 1SXJD 3DKVA 4JSTA 2A5YB 1XD9A 1Z6XA 1MO3A 2FEOA 1KI2A 2NQ2C 5EP2A 1Q3TA 1G7RA 2OCAA 4AKEA 1Q12A 1S8FA 2GVZC 5BW8A 2V1XA 4XVRA 2GJ9A 1HQCA 3IEUA 4O2RA 3TE6A 2BV3A 5IT5A 3IBYA 4TLAA 1DO0A 2KSQA 1XJCA 1NJFA 1QHNA 1XEXA 3DM9B 2VF8A 1X1RA 1VG8A 3GEIA 2AX4A 5EUQB 4R9UC 2J0UA 4Q01A 4E07A 1Q57A 3V4RA 1W36D 1TU4A 2CNWA 1OT3A 1A2KC 1XB2A 1IM2A 1KOFA 1IN6A 3U7HB 4KI0A 3T12A 3CWQA 4NONA 4UXJA 2EWVA 2P5SA 5JEEA 4HATA 3ONWA 4WIAA 2Q6TA 3PG5A 1XRJA 4E22A 2MMGA 5AK0A 4TZ6A 1W2GA 1YR9A 2A5DA 3EAQA 3AVXA 2IWRA 1C1YA 2VA8A 3VX3A 2NGRA 3RAPR 1NP6A 3BERA 5K8UA 1YZTA 2GESA 4URYR 3W8NA 1GFIA 3BBPA 3GLGA 2XTNA 5DI3A 1E2LA 2J9RA 3B8HA 1E2QA 2ZJZA 4PO9A 1CXZA 2CL0X 2PH1A 2QI9C 1RYFA 1G8YA 3L0SA 2XX3A 3Q9LA 4OHVA 4Q9KA 521PA 4NBSA 2WWXA 4JLOA 1NN0A 1UM8A 2D3WA 2IYXA 3AP3A 4HZUB 2WKQA 1OYWA 1A4RA 3TR5A 4HUQB 4CVNA 2WMOB 5FOWA 2CMKA 3X1XA 5EJEA 2G0NA 4V0ME 5FOXA 3GLFB 3ICQB 3ZQ6A 1TADA 2F1RA 1OXXK 4ESVA 1LTQA 3RS0A 2YZ2A 2IT1A 4ZIRA 3RDPA 5B64A 4MGZR 3ASYA 3T35A 1Z6AA 3R9IA 4HLDA 2C96A 4M2LA 3AP2A 3SYLA 4FCWA 2W6IA 4LOAA 1W0KA 4M22A 4DSNA 3GLIB 1VG0B 4LSGA 2Z4SA 3BB1A 2X2FA 2GEUA 3OEHD 2V54A 1HY3A 1TQ6A 1VCMA 2BEJA 1AS3A 3U3KA 2ZU6A 1HE8B 3TUJC 1VCNA 1AS0A 2ZIAA 3GLHA 5BN3A 1X3SA 1DVRA 2O8FA 1KI6A 4M4SA 3OE7D 1OXTA 4TT3D 4M53A 4P32A 1P9RA 2KE5A 4WZ6A 1K5DA 3M0EA 3THXA 2HXSA 2OBNA 1G5PA 2E9SA 2AL7A 3PEVA 1A82A 4IVRA 3KDSE 5G53C 3PUZA 5HCIA 3T1VA 1G4AE 4DLZA 4KFSA 5SZJA 4A8JA 3F5FA 5JBQA 2A5GA 5KDLA 4CT5A 3U7EB 1N3BA 3AVPA 3K0SA 1E0KA 1PUJA 4Q48A 1OXUA 1YR7A 2A5FA 4B3GA 4D0NA 2PJRA 4CZ2A 3A6PC 3KJGA 3HWSA 4V03A 4CYMA 4XWOA 5FL7D 5KYKA 3CKLA 5DHFA 5FTKA 4NYJQ 4KBGA 3V00A 2VSXA 3VR1A 4B32A 4EUNA 1FPMA 4ZI3A 2OBLA 1V5WA 3FB4A 4MKFA 5L3VA 2MSCB 1Z28A 2WAXA 1ETUA 4EFMA 3BK7A 4WXPA 1T0HB 3RS5A 2OE2A 4C7OB 2QORA 2FG5A 1N6RA 3Q7PA 4H1UA 3K0CC 4OK6A 2I3BA 3LXRA 5KTYA 2XJ9A 2CBZA 4K8OA 1W46A 2BMEA 4LHWA 3FKQA 2CDNA 5IHPA 3K9GA 5AJVB 5GVSA 4UKDA 4NYIQ 4V0OA 3RWMB 1XEWX 1S1CA 4JKIA 5CJPA 1G5TA 1JQLB 4DLSA 2X19A 4PHGA 2GXQA 4Q00A 1EFTA 4IXMA 2JJ2A 4PC1A 4WW0A 3SE0A 5CJ2A 2GJ8A 4FI3C 3C5CA 1Z6GA 1ZP6A 4MYTA 2IUSA 4PAMA 4BE7B 1F48A 3IILA 3PUVA 1ZRHA 2FV8A 4Q9JA 3X2SA 3W34A 1XNJA 1GKYA 2D2FA 4MKGA 1IXZA 3O8RA 4QC2A 1B23P 4DEYA 4RKEA 5JLJA 3SQWA 1ZBDA 4WVFA 2GETA 4FWTA 3THWB 1QHGA 2YOGA 2ZJAA 3E5HA 1R5OA 3IIKA 1FP7A 4HEJA 1U9IA 2QT1A 3CZPA 1KK2A 3O8DA 4DEXA 2AKAB 3Q72A 2IYRA 2FGKA 2NO9A 2QPAA 3QG1A 1KI8A 4IOKA 3KXKA 1OH5A 1A5TA 1KO4A 1MO4A 2QMOA 4QXAA 4KSCA 3QF4B 3I61A 3MWJA 2FX3A 3SS8A 3AQ4A 4NP6A 2C03A 2QL6A 2F55A 4LBZA 1S9DA 4IW3B 4KODA 2ZAOA 1JPNA 3AH8A 2Z6VA 4ZKDA 3GLHB 1HV8A 4MKIA 4GT1A 3C5HA 1XMSA 3L8YA 1VYTA 3QE0A 1U99A 1HT1E 3BH0A 2W6ID 3MWKA 3TR0A 2NOAA 1RRGA 1JI0A 2WKRA 1IAQA 1YZLA 2G77B 3CWZA 4PSAA 3THXB 5E95A 4Q7JB 4M1TA 4DBLC 1J90A 2PEYA 3TQFA 4EJSC 3RHFA 3NWJA 3KXIA 4A8JB 1LVGA 2VBCA 2ZPTX 3ETLA 4KLZA 4M1MA 1E4VA 3RSOA 5FPKA 4M1KA 2SHKA 3HU1A 1NY5A 1OFHA 1ZNXA 4NCNA 4B3XA 3LO5A 1DBSA 4RFSA 5IRCD 1VHLA 4Q1DA 1XCMA 1XEWY 3BORA 3MG9A 4Q1FA 1JAIA 4EQ6A 2XOKA 1E1RD 2QTFA 1N2CE 1E9RA 1F3OA 4M9SA 2D2EA 1G6HA 2QP9X 2AK3A 1NVXQ 1RIFA 1YJ5A 4TN1A 1QHXA 4JT2A 5H68A 3CW2A 2VP6A 3LFUA 4FD2A 4CT4B 2WSSA 1TUEA 4TLCA 5EXTA 4UXIA 4X8OA 3GPLA 1G6OA 1T6NA 4DT1A 2D62A 4LYHA 1NBME 3QBTA 4LBVA 4RFVA 1W4CA 1E0AA 3PEUA 1SVWA 3SJBA 3QXHA 1JEEA 1FOEB 1E2IA 4RD3A 3B9QA 4KJZA 5FL3A 1H8HD 221PA 2ODWA 3DKPA 2JDIA 3FGNA 3SBEA 2ZRCA 3KUCA 2Q9CA 4UJ5A 2H1LA 3DEFA 5DE3A 5FBWB 4DIDA 3HR8A 5AJZA 1ZW6A 3FOZA 3MFYA 1II8A 1Q1QA 1XTIA 3QVVA 4WAUA 3ZS8A 4TTPA 2F9MA 3K70B 3QPWA 4DJTA 1XXHA 2O8EA 2WWFA 5CB8A 4D2IA 4WOPA 3ZS9A 4CEHA 3PJRA 5C18A 3REGA 4PQFA 3U2QA 1KSGA 4Q19A 4OK3A 2IEYA 2ZRMA 2QSYA 5LB2A 3SI7A 3MGCA 4M9QA 3CRMA 4Q9HA 5KOYA 4AYWA 2ANCA 4JLDA 2GKSA 5CB6A 4E03A 1P9NA 4LK2A 1RFLA 3OFNA 4XJXA 2JJ2D 1N6KA 2ZRBA 1N5KA 4DUGA 3C7KA 2QPOA 3BB4A 3BIFA 4FCTA 2JEOA 2K5UA 2GCNA 2IF0A 3I73A 2ZYVX 3WMEA 2VHJA 3WXMA 1U2RA 2H57A 1NLZA 3I92A 3NBZC 1KZ7B 4OKSA 4BGDA 2IBMA 2EFHB 2QNRA 1Q0UA 4TQAA 1XD2A 2LWIA 2QBYB 1LFDB 2NO6A 3KB2A 4NDZA 1MO6A 3RC8A 4PR0A 1EX7A 5FTMA 4JBXA 2DFTA 1D6JA 4RJLA 5JEDA 1Z63A 4URXR 5DYIA 2REBA 3LX8A 3MRSA 3OESA 2ZUBA 3QKSB 3KKNA 4MRNA 1XMVA 1NMXA 4PZLA 1DOAA 1TX4B 4PPQA 3SN6A 3B2EA 4KFRA 3QSYA 3GEEA 4DLTA 2IYSA 2QRNA 2QAGB 3IUYA 4QGFA 1GWNA 2XNSA 4C4PA 5JWHA 4DCVA 2WWGA 1W1WA 5DLQC 4OI1A 3VQTA 4B73A 5B58C 1P73A 2ZYWX 4NMMA 4TMVA 4CEJA 4TWZA 4EPXA 4AKIA 1RKBA 1RW4A 1KSFX 3TUZC 2VHCA 3TIFA 2OO7A 3UWKA 5J4LA 721PA 2KJQA 3WHLA 4OHXA 4TLEA 2ZRPA 1G20E 4PPNA 3BFVA 1OFIA 2EFDB 3LLUA 3Q7QA 1FX0A 4JLAA 3SJAA 3C16C 4RD1A 4EIWA 3P4YA 1YU9A 1T8TA 4M21A 1E9AA 2B8TA 4RFSB 4XVUA 1ZUHA 4A0GA 5ELXA 3DMDA 4P0TA 4RZUA 3TK1A 2QG6A 1FQKA 1XD8A 3CO5A 3WMGA 2ORWA 3R8FA 5TARA 2OAQ1 4QBGB 1FTNA 4Q47A 3WNCA 4FCVA 5FI1B 1UDWA 2AKYA 2OCBA 3HP1A 3HU3A 3ZJYA 1OH7A 2RGXA 4JIMA 1XX6A 4D0GA 3K8YA 3GLFE 3UPUA 1JR6A 2QT0A 5L3RA 1KY3A 4DLYA 4W7SA 1JR3E 2RGDA 1E9FA 2HJVA 3QXSA 4M9XA 4Q1AA 1BO6A 1ESMA 3QEJA 4JVLA 3T15A 2ECKA 2XOKD 4M8NE 1TAGA 1G16A 4ZDIA 2JJ8A 3R7WA 2XXAA 3P27A 3NBFA 3KTAB 5D3MA 2Q9BA 2QMHA 4KAXA 1VECA 4PQYA 1JQJC 3CX7A 2HLDD 3Q85A 2DR3A 3N2EA 4A0FA 4LPKA 4LYAA 4IDHA 1KAGA 1M7GA 3GLIE 1P2UA 1R7RA 4B6EA 1E94E 1BMFA 2ASEA 2IHYA 2ZJOA 2FSIA 4EPVA 1XXHB 1ZAKA 2QM8A 3VAAA 4CEHB 4UXHA 5CIWA 1Y63A 5IF9A 2WVJA 3KX2A 4GFDA 1VCOA 3FMIA 1ZM9A 1XFAA 2IEZA 1VKJA 2QM7A 4UJ3A 2C9OA 1LW7A 3NIBA 1S0UA 1SXJA 2ZITA 4U7DA 1SVOA 3FDIA 1W48A 2I1VB 1MABA 5DNYB 2NO7A 1NVVQ 3AVYA 5J4HA 2VF7A 4NCHA 4C0LA 5DISB 4TL8A 3I1FA 4BLSA 5JI2E 3KKPA 2JLUA 5K8LA 2XB4A 4I4LA 2YWFA 4G5RA 1XPRA 2UVQA 3FMFA 1CR1A 3UMRA 3FMOB 2KWIA 4HZIA 4URZR 4YMWA 4B3FX 1BOFA 3SJZA 1XPOA 1TF2A 3MCAA 1KDOA 2IYVA 4D81A 1G7TA 1R10A 3PIRA 1G8HA 1NJGA 3VR3A 1S4QA 4JLKA 4XTRA 3TRFA 2CEAA 3ZIAD 1DTSA 4LHYA 4OK5A 4X8MA 1X8JA 1KI7A 4ON9A 1ZD8A 3B13B 2O0HA 2ZUCA 1M74A 1QRAA 1P72A 5HE9A 3KKOA 3G82C 1KJYA 1FNNA 1Z22A 2A5JA 3CF6R 2BHRA 1LNZA 1CLUA 5KNDA 1KHTA 2P2LA 5CYPA 2ZR0A 1N5JA 1R5BA 2H8KA 2ERXA 2RGGA 2IS2A 1GIAA 1TF7A 4TSFA 3ZQJA 1RRCA 4KSBA 2W6JA 3NEYA 4PO1A 3CNOA 2QGZA 3AB3A 2L0XA 2ZANA 2CJWA 2ZI7A 5UKDA 2QGNA 3AVWA 1VDZA 2GF9A 2WWHA 3A8TA 4FMDF 4HAVA 1T3LA 3AV0B 3OAAD 3CRRA 2VHTA 1XMJA 2YC4C 2ZRKA 2ZROA 3DZ8A 3N70A 4B3DA 1FX0B 4L15A 1ONBA 2JASA 1YZUA 1WBDA 4N1AA 1H8EA 2ZRHA 3AP1A 5DYGA 3TUIC 1JEDA 2ZYTX 4TMXA 5CM9C 4URUR 5GJWC 1ZM2A 4KYIB 2QMEA 5SZHB 4UNPA 3LV8A 3X1DA 4BFSA 2ODBA 1TQ2A 4A2PA 5E7MA 4BLPA 2GRJA 1M7HA 5AWFC 2QY9A 1Z5ZA 5LD2B 2V55B 3RS2A 5HKKA 1HA3A 2LKCA 3LWNA 4PPFA 2QENA 3LVRE 2C78A 3BAFA 4BFYA 4LGMA 4N3NA 1QHHA 1N25A 4LBWA 2YWEA 2PZGA 3AKCA 4TLDA 4TL6A 5FUXA 4ACBA 4XOIA 1EESA 3E2IA 4JVSB 2CHQA 3T5DA 5L3SA 5D3MB 2EWWA 4NL4H 3SBDA 1IY1A 3EPHA 1KIMA 4XD7A 2IYZA 3OEHA 3EARA 2BVNA 5JSZA 2G83A 5TMPA 1ELOA 4F92B 4D26A 1AZSC 1COWA 5G3YA 2F6RA 1W5TA 3EPLA 4Q02A 1P2VA 1X1SA 2GJAA 2RGEA 2VYFA 3SQXA 3OIVA 3LXXA 3OE7A 1G64A 4TT3A 4AY2A 2FPLA 3GLHE 1SXJB 4B74A 2IYYA 4P4SB 4IKEA 5F3WB 1OE0A 2V8OA 4NYMR 4Z8YA 1MR3F 3B1VA 3B7GA 2FWRA 3RSLA 1A2BA 3TBKA 3JVUA 1E69A 1BMFD 3CRQA 4I1UA 4HAYA 1QHIA 4R2IA 3BC1A 2WM9B 4IHQA 2YINC 2OFOA 3RWOA 3IBGA 3EX7C 1JECA 1KKMA 1GRRA 1ANKA 2O8DA 1KO7A 1Z6TA 2GBLC 3EA0A 5A5GA 5AUOB 3IIMA 5FL7A 1SVIA 2RGNC 2W0MA 5E4FA 3Q3JB 3RS4A 1NIPA 3ZDQA 1FUUA 3LLMA 2A3RA 1W36B 2REXB 2XNDD 3DPUA 4UNQA 4Z51A 3VU9A 1KDRA 2DFLA 4PAOA 5GJBA 1AIPA 1B0UA 1M8PA 2P6UA 3SZRA 1AQYA 3T1OA 2F43B 1GNRA 1J70A 1S9HA 4B35A 5AUPB 5JCPA 2O52A 4D0LB 3M6AA 2FFAA 3CB4A 2BC9A 4R71A 2CE2X 3FHOA 3I8SA 1GG2A 1W47A 3TW4A 2C95A 1OW3B 2H5EA 4AK9A 1M2OB 5DHAA 1GNQA 5K8TA 5C2JB 1P7CA 5HR5A 2WKPA 4V02A 4NYJR 3RVBA 3B82A 1KMQA 5E7JA 2NO1A 1KK1A 2AD5A 2JLRA 3CNNA 2AWOA 1W4RA 2BBSA 2REOA 4Q18A 4QGGA 4A36A 2AWNA 1KKLA 1X8LA 4KFUA 1E9CA 1MH1A 4OI2A 3R8CA 5D3QA 4LBYA 4A0RA 1WMSA 5DO9A 3RRMA 1E1QD 2D4HA 3B5JA 4TSFD 4QM6A 3Q5DA 1NLYA 2WSMA 4CGZA 3NC0C 2W6JD 3LY5A 3CBQA 2X77A 3GJ5A 2KI5A 1NSFA 3OIUA 3KXLA 4GOJA 5KPDA 3ZD6A 4XIGS 3B1YA 2G1JA 3GJXC 1CR4A 2XAUA 1GM5A 2W2TA 2IX3A 4C0QC 2NTYC 3RRNA 3EZ2A 5KSOA 2ODNA 4O25A 4M1WA 2GWHA 4P4UA 3TVDA 1AA9A 2P65A 3O47A 1H8ED 1FFHA 3RABA 1US8A 1PVOA 4EJSA 4G0NA 4Y0AA 3VKWA 1OLOA 1QHHB 1PV4A 1HURA 3EPKA 1EGAA 4N0EA 1Z8FA 2F1IA 2ZUDA 3A1VA 1JJVA 4LPSA 5JZVA 3QIAA 4R2HA 4BFTA 4ESHA 2FNAA 4Q4LA 4NH0A 5EE3A 3R9XA 2A2ZA 1LY1A 1H65A 2EVWX 3B85A 1KY2A 1DAKA 2ZJ5A 4GBMA 4DCUA 1ZC3A 5JSZB 1U94A 5FI0B 4AWXA 2V3CC 3A36A 5HKKD 4AG5A 5JJKA 1FMJA 4G3XA 4ZKEA 3T06B 4G5OA 4FIDA 2EQBA 4LUCA 2ZJYA 1NY6A 4AC9A 1MKYA 1T3SA 4NCJA 4DHEA 4BZXA 1NL3A 3HJNA 4EPRA 3QEOA 4XD7D 1L4UA 3F0TA 2AXPA 5HZHA 2V6IA 2GF0A 3R9WA 3BRWD 5A0FA 5BYJA 3ZH9B 3VTKA 2GK6A 4OHWA 3W6PA 1COWD 5EXSA 1ESNA 4ZDJA 5CLQA 1HE1C 1HQYE 4Z8XA 4OQFA 3CR8A 2VHQA 3HYTA 4HI0E 4LI0A 1K5GA 3QENA 2IHBA 3QF7A 4U5XA 5TDHA 1I4TD 1CF4A
chains in the Genus database with same CATH superfamily
3LZ6A 2MYUA 4MUJA 2W6OA 2WFLB 3KJIA 4OYYA 1E1RA 5K8IA 1OTHA 1SBQA 1WMBA 3T1QA 1V8PA 3T99A 5ITZB 1HFWA 1GUDA 1TW3A 2VP9A 1JH8A 5BMVA 5ELMA 3PQ5A 5I7AA 5EIBD 1GT6A 2HSWA 1TFUA 2IYLD 2V5UA 3FR8A 4O4IF 1QX3A 5CAEB 4CGYA 2ZETA 5ALIA 1FYWA 3GRYA 5JU6A 4U7TB 1HKHA 2QRZA 5BN4A 4DCTA 3CVUA 1KS2A 1JN0A 1O95D 3PR1A 1NRIA 1R6UA 2HDNB 1C50A 1L5HB 3CLTC 2ZRLA 5A6VA 4N76A 4L78A 4IICA 4DIKA 5EWMB 3N28A 4W9MC 3BMXA 2NSLA 5CBKA 4B3BA 3DWFA 4KRGA 4YAFA 3LS2A 5CDFE 4OQQA 2F1HA 3SOPA 4ZAYA 4LJ6A 1QVRA 2UYYA 4MQMA 4Y2VA 2VDUE 2XQJA 3X0DA 4L4YA 5ILOA 1HX7A 2C2ZA 4WBNA 3TMAA 1AQIA 3P9CA 3ZNOA 5HMMA 3K32A 3HY3A 3QFTA 4JX9A 5DHSA 2O05A 4MVJD 3SAJA 1UBRS 3HJCA 3SSMA 5AVRA 3O94A 1QOQB 3MGKA 4MGYR 2BHSA 4HQOA 3UHAA 4BV9A 3J81k 2JLYA 4WN3A 5DLEA 3AW8A 4MVJH 5EIBC 1PVVA 2GCOA 4A16A 5CJPA 5G4KA 4IHJF 3WJ2A 4GECA 3GLGB 4OJMX 2E4YA 3K5HA 4YS6A 3ISTA 3IDQA 4DVGA 2JCGA 4LJ4A 1RQRA 2BYTA 2TMKA 1ZK4A 3FPBA 3LC7O 3NVAA 4BKRA 1B7GO 1ZDMA 1NAHA 3RB8A 1R6TA 2P9JA 3F9CA 1PS9A 4LN1A 1KC1A 3MTGA 4ZYXA 5LWQA 4KQ6A 1Z7GA 1M1YE 2YHIB 4CMIB 1HDGO 4R1SA 2DYKA 5KYGA 2R0QC 4UCWA 1EE2A 4YDSA 1RKUA 2NUTA 4O5OA 3FRHA 4Q1EA 4LY6A 2CF6A 1U1IA 2P2CA 5EQFA 3K9WA 3KVOA 4P3KA 4UASA 3NATA 2EIHA 5LLSA 3ST7A 4Z53A 5IJ0A 3MBOA 3A4YA 4QYMA 3RLFA 2ES4A 4NOLA 3ZLUA 3RODA 1Z0KA 4MMYB 2EDCA 3EZ6A 3GK3A 3UCFA 3C8DA 3SJUA 4RANA 3A6KA 3DL4A 3GEPA 3C7AA 5TPZA 1DNPA 3MWEA 1PLKA 3F1KA 2PY6A 3T34A 3T7JA 2HJSA 4IX9A 1RRFA 4QOIA 3OCUA 1WZIA 1AOXA 1P31A 4YCCA 3QWAA 2PR7A 4EA9A 2OPBA 1QG0A 3H05A 3UMGA 1S5PA 1GFZA 2VPZA 2XH8A 4FMBB 3QSGA 4B7XA 1KK3A 3N6XA 3BSYA 5JD3A 2BMDA 1XDGA 4PPYA 4P5EA 4IDOA 1WP4A 3C6YA 1YFLA 2AN4A 3MJTA 5EG5A 1GEEA 4BQFA 2Q4OA 2NMVA 2B4KA 2ONJA 4C30A 3PWKA 4AJ2A 5FTLA 3Q3VA 3RSFA 4FN5A 2NUAA 3PQDA 3DLHA 5BV1A 1Y3FE 1QQ7A 2TYSB 1RM3A 1E3SA 5SZKB 3IMEA 2Z98A 4IDNA 4M1OA 4XRGA 2G9UA 1M8JA 2O7QA 4G07A 4F93B 4G81A 4V0MA 1Q11A 1KI6B 3PQ2A 2UVDA 4PLFA 4BMPB 3Q10A 3GCWA 3LX5A 3PLRA 1IAVA 1WLYA 1O4VA 3EZFA 4OJTA 3IEIA 3L4JA 2PSJA 2YMMA 4DPLA 3CKMA 3G23A 4LMPA 4ZI7F 4G0VA 4QGBA 1DIBA 1UINA 1O3YA 4QBIA 2EYUA 2CFRA 2Y1CA 2JRLA 3D8BA 1XOIA 2CDRA 2Q29A 1DV1A 1YVDA 4FMDB 1ZGZA 1HEIA 1DQNA 3QLVC 3K0FA 2BWJA 4M1EA 4PE5B 3A28A 4YLEA 5EA2A 1D8TA 4Z9BA 3ZKWB 3BHMA 3FE2A 4E2WA 3QVXA 3E9NA 4CXMA 3ZJVA 1NYLA 4DMRA 4YT2A 1UC4B 2QM0A 1ODLA 3OMXA 2IXEA 4OFXA 4RZQA 2H3EA 2GN2A 4AYTA 1ISPA 5KS2A 1BXRB 2BGGA 1HORA 1EAMA 4FGLA 1KYWA 4FR5A 4X24A 3ANSA 3NG1A 5HZGA 4NNPA 3UXMA 1OT5A 4YQZA 3ZJTA 3BE6A 3BMCB 2V7UA 2H31A 3THSA 5CW2A 3USES 5FH9A 5DNVA 2FQQA 4E15A 3U44A 5AVVA 3DV9A 4HHEA 5REQB 4Z99A 1P75A 4RJIA 3KV1A 2HLDA 3KYIB 4PPGA 4WBNB 7AT1A 3ZBQA 3HCBA 1XNRB 3B1KA 3JR7A 4MV0A 1RRVA 1ZJYA 4QOSA 2EERA 3BFJA 4U6SA 2FFBA 2J3QA 5A9TA 3RC9A 1Q3HA 2ZRDA 4PC3A 4XGIA 2O0MA 1ZM4A 5JCJD 3FIUA 2VO1A 4K0RA 2HK9A 1KE2A 3A1DA 2Q4TA 4HAXA 1Y6JA 2FZVA 4CMEA 4I1VA 4PHCA 3M1IA 2XRFA 1UDRA 4ISCA 4RK7A 5DYYA 1ZH0A 4QAQA 1IHYA 1H69A 3DR5A 4QVGA 5B3AA 3RBAA 5EJ4A 2V7VA 3ZVLA 5CXXA 2Q21A 4TM8A 5BXQC 3L49A 3QMWA 2ZUVA 3OLQA 2NO4A 3INTA 1IJEA 3RHTA 5KUTA 2FOIA 2XSZD 3H5VA 3M3DA 3L0IB 3QWHA 4RYLA 2ORED 3DCJA 3W8RA 4QJ5A 1E2DA 4Z3KA 3AVOA 3O73A 1RXUA 5WRFA 4I7EA 1V3VA 3ROPA 4RIGA 1W4ZA 1AMOA 1OA0A 3U61B 3N1UA 5FOQA 1IZ8A 5IJ0B 1O08A 3BOSA 3QVKA 4BJ1A 2WHYA 1BYUA 4EX6A 3KT6A 3TEJA 1H0RA 1MOZA 2WHRA 3ECAA 2WJJA 3EIXA 3K6KA 2HI0A 4HQKA 4FFDA 1YCGA 3C6ZA 1W6RA 3E5NA 3M6WA 2CLCX 1VMAA 3MWEB 3G6KA 4KKXB 3R3JA 1EX9A 1T0IA 1ULAA 2F3PA 3ESYA 3MWLA 3QOYA 2DBQA 3D81A 5AVQA 2QUZA 4K05A 4G4SO 4U63A 5FBZA 1MHTA 1OLUA 1YJCA 5AI8A 4C1BA 2A94A 2CLSA 2IYOA 3NTUA 3IT2A 3KJEA 2YRFA 5AICA 3JALA 2I7VA 1WXHA 3N8IA 3OH8A 4P93A 3RWBA 2ECPA 1GTZA 3DNPA 1T2AA 4QPJC 3NETA 3D3EA 5AIAA 1SB9A 2DUUA 3V9PA 2XBLA 4GOOD 2HHAA 1EDBA 3KIPA 3SLRA 3ZGYA 5L7WA 1QVAA 2XWSA 4TYPA 2FTKE 3HEMA 5FPSA 3F9RA 1CZUA 5CLHA 1FDUA 5KBYA 4X6XA 1V11A 5GTDA 2QZSA 5GM2A 5AFSA 4O4IA 1LJUA 1UFKA 5IG2A 4OJKA 5FUBA 2XKKA 5DMHA 2WYHA 2VP0A 4TTRA 3TW8A 4R8VA 2R6R1 3G2PA 2PNJA 1ZIDA 3JARA 5DLYA 3GX1A 1ND6A 2GN6A 3A6FA 3D2CA 4HLCA 4C88A 3HVJA 4NDNE 1PW5A 4PZ0A 4YWHA 5KNCD 2H5JA 1E4EB 3K94A 4MA5A 4H4CA 2MHCA 5DNAA 5IAEA 2CGEA 1KH3A 1YAJA 1UJBA 4CLXA 4CV1A 5HS4A 4G63A 5T3YA 4R0VA 5KNCH 1O1YA 2AJBA 4XJVA 3SSNA 5AVSA 3GI1A 1NUHA 2WICA 4G4JA 4RZSA 1WNFA 4PZYA 4G0MA 3V4LA 4JEIA 5AQ1A 3K0FB 4IQ4A 2OXTA 1BROA 2Y4OA 3L7IA 1GZHB 1XEAA 4KQIA 2J5BA 4ND4A 3V5NA 2OD2A 3CPEA 4AJLA 3JTMA 5HBGA 1AQ6A 2K2WA 3PITA 4QO8A 4HLUC 3FTQA 1JQ5A 4A15A 1W9MA 4BBJA 4Z4CA 3D3JA 4LYJA 4XIYA 2NYRA 3QI7A 2XWQA 2QSUA 3LCMA 5EXPA 1ODJA 5CDSA 1A27A 1EU1A 4XDHA 3WA7A 1JLKA 2W6QA 1OIWA 3CYFA 1GGKA 1KQ3A 2JKYA 5SYAA 3UWOA 2YNMC 1NONA 1P2TA 2JCXA 1RYEA 2J6IA 4H60A 3T52A 2FMTA 3HKDB 5ALSA 4BVGA 2NYUA 1I4EB 2F3TA 3EXFB 2HMSA 1RPJA 2AN9A 1W9HA 2I4RA 5G1PA 4A10A 1R8SA 2F48A 2LKDA 3R44A 4QYSA 1X7ZB 3BIXA 5BQFA 2P9TA 1FXUA 2VDJA 2IE0A 3EGXA 1NATA 1RBZA 4MV9A 4Q03A 4EUKA 4G0UA 5E6RB 3OSUA 1B3BA 4WE3A 2ERYA 4KRFA 4KITB 1X3LA 2VSFA 1GYPA 3FYDA 2BBTA 3VDNB 1DKNA 1F14A 2B35A 3BJEA 5ECWA 5TXGA 3RCBA 5LLDA 5JNLA 1M6WA 2Z43A 1LU9A 4ZA2A 1J23A 4G0YA 1DBQA 4IJ5A 1H0KA 4N9WA 5E8JA 5M5BA 4LZZA 3EXHB 4DR6B 4DCMA 3IR7A 1KP3A 2R9VA 2WU1A 1M2VB 2FQWA 1Z0FA 4M1SA 4CR8A 4IRUB 1FSPA 3RKRA 4BNVA 1LNQA 5JQWA 3TD6A 1RMYA 4B4VA 1QO0D 1WDMA 2QAGC 4LDRA 2BI4A 2PGXA 4MV6A 3NHBA 3TTYA 4CW7A 1JDBC 3CRW1 1QDUA 1C3OB 1QF7A 4IRMA 5E6UA 4L4UA 2ORIA 5H81A 3ZNQA 4OQZA 1ODTC 1V9LA 4AI6A 1WUTA 4GEKA 4CMBA 1BDIA 1VTKA 5FULA 3O4JA 3QUAA 2FP3A 4IS3A 4L57A 1WJGA 4QDUA 3P9IA 4XWKA 3D4LA 1DG1G 4PRKA 1P3DA 3STTA 5I4BA 3R7NA 5HP4A 1K6XA 1HL3A 3FTNA 4WXYB 4EF4A 4OHRA 1EWRA 1UDCA 5CFZA 5ENZA 1C7RA 2OZEA 3AIKA 2Y8EA 5CITA 3IALA 4MXDA 5FBRB 1A76A 4ZVLA 1U7XA 2ZJ3A 3TG2A 1ICEA 1P1RA 4ZI7A 7REQA 2PUEA 1A8UA 5JV5A 5EVCA 4WK2B 2QQEA 1W5SA 4OLJA 5KQLA 4Q4DA 2W6PA 5IASA 5C51B 1VJ0A 2NLOA 1E1NA 1DWUA 4KQFA 1AB6A 1TQDA 4EBBA 2EJTA 5GZ6A 3OCVA 4O4IB 5F9MA 1QKKA 3WLPA 4JUDX 4S0ZA 4WZBB 4J1TC 4WY8A 3D6MA 3RYFB 3FNQA 3JVVA 4BO9A 1SOWA 1CR2A 1LC0A 1VIAA 1X13A 2WZQA 3EXG1 3KPUA 3TW8B 5GAJA 4B2IA 1M6HA 4NAVA 3JARB 3LF1A 2YV4A 4DDHA 1KWGA 5LMZA 1N3YA 3ZZ0A 1Z9BA 3B3QA 3BWXA 2O2YA 5C8DA 2YY7A 3YASA 2I6QA 4GVLA 1U8YA 1X0VA 2XGJA 3RO7A 5J58A 2C9MA 4KWHA 4WJLA 2ZPAA 4HDMA 5EINA 3PUYA 5BRNA 3WLLA 5ABPA 2D0PB 3R23A 4M0FA 3QWFA 4ZRDA 3ZD9A 5K2MA 4ZOLF 1B8UA 1AUVA 3ZE0B 4Q66C 4YFYA 5B1IA 3L43A 4G9GA 3ZY6A 4FS3A 1KYYA 4OJYA 2JIZD 3GLGE 3EOZA 1USVA 2RARA 2EAUA 1W59A 3SXUA 4E32A 3W6NA 2GBIA 2IY9A 3Q8XB 1JT9A 2IZ6A 2ODEA 2ZE5A 2FF5A 4KRYA 4ABYA 4BHTA 4EECA 2HK7A 4PFSA 4AJJA 4OOEA 2A9RA 2R5WA 3EIQA 4NS1A 3INNA 5EZSA 2E5LB 4YAGA 4IHJB 3N8DA 1ISJA 1RWWA 4BP3A 4FSHA 3MTIA 1J8MF 4NAHA 1N2SA 1NMZA 3C3BA 5EIOA 1QV7A 3EVAA 2GQ0A 3IB6A 3AONB 3QNUA 4FGZA 2ECQA 3S2IA 3VKHA 4X1YA 4ZCLA 4FJ0A 1I6MA 3A2MA 4MJXA 4Y6QA 5KPJA 2XQVA 3GJ7A 4KQJA 3ZZTA 4ZVNA 2QX4A 4DV2B 3A32A 2VZ9A 4JYPA 3PXGA 4BNDA 3CC8A 2V4UA 3KZ1E 5JNTA 3JD1A 3PFWO 4ZCRA 2LP4Y 1Z2DA 1Z4KA 2G4VA 4Z1MD 4Z49A 1ZSNA 5A3VA 2J45A 3WWDA 3ADKA 4INZA 1NQXA 3F6RA 3NR2A 1S2LA 4HGOA 2ZJBA 1E98A 3U40A 1W49A 3QOXA 1NZDA 3E48A 3AEQB 3GGSA 3NTOA 1KEKA 5JWRA 2P1DA 1W75A 2R00C 3DW1X 3EFHA 3T4UA 3DDNA 1VYVA 5TT0A 2CWDA 3I2KA 3N7AA 2VTBA 2AN3A 3IOYA 1P0FA 3BRWA 4CN8A 2LGJA 1Z73A 1CWUA 3UAZA 2GYYA 4I4NA 3EG5A 3VPDA 2TECE 1WF6A 3AFNA 5DSTA 4LXXA 4KO1S 2ZAGA 4M3NA 3DHWC 3FIJA 3FAZA 4IVQA 2HBRA 1GL6A 4HZUA 4RK1A 2C2YA 4JKYA 3K1AB 1OHHD 3F8SA 1XYGA 4G0ZA 3TL6A 2AG1A 1U3UA 2Q5CA 2ZSJA 4WNIA 4CL8A 4YV0A 5E6UB 3A1TA 4P80A 5DLDA 5TY0A 2GKGA 3UKDA 3K9FC 2W37A 4MJ7A 2PLNA 3PC8C 4EG7A 1JSRA 4L7QA 1E8NA 3K3PA 4MR8A 3EIHA 1NN1A 5CNJA 1A1VA 1UL1X 1UMCB 4DUYB 3U5ZB 2Q3JA 1L3CA 2FFHA 3BXOA 4N5DA 1P1KA 1JTFA 3R41A 3WGLA 1Y5IA 4OGFA 4YAWA 2CKMA 3MYYA 4JCCA 4KWIA 3W04A 4KFCA 4DABA 2YWBA 2G4LA 4WFQA 5GMOA 4RETA 2HA0A 4OHYA 1R12A 2MYTA 4GX5A 3PFCA 4AULA 4ZI7B 1KNQA 4MQ6A 2JLQA 4RF3A 3SVLA 1P7VA 1OGYA 2A78A 4RVNA 2QNIA 3H75A 1NM5C 3W5CA 2ZIFA 3PDIB 4OHZA 1VIYA 4K81B 4CL2A 1PI3A 4CLDA 1RI3A 2B92A 1XK6A 1VI5A 4MSUA 3X43A 5L8VA 1XVTA 1WULS 5DN6D 1SG0A 3EDQA 2GPTA 3LGAA 1YVPA 3MA0A 1E96A 1SB8A 1Z35A 3E05A 3MTBA 5HNKA 3BF8A 1WOMA 3DMNA 5LD2C 2CVHA 3A6EA 3OEEA 3HXQA 4WNAA 4WKBA 4E6EA 1JHYA 2CL7X 1NI4A 3GMSA 3H5NA 2F64A 2QVYX 1PNVA 4HDMB 1SC4A 3C4QA 3STUA 4B2LA 4MP6A 1KZHA 4IOMA 3W77A 2OCKA 1UBTS 1YL5A 1Z3IX 2BUBA 1PWZA 5E3HA 1RHKA 1RBQA 2VPXA 3ZGVA 1WWKA 2G06A 1E63A 3FUUA 3L7AA 5JMTA 1DEKA 3EG9B 3PYLA 4QE3A 4MAMA 5D01A 4WXRA 1TAQA 2VYCA 4KVZA 2WLTA 3IAUA 1YRQA 4MVXA 3MBKA 4WA8A 1DEAA 3GT3A 4CUJA 5CVVA 4G2TA 3VFDA 4B76A 3W9YA 2YV2A 2EP8A 2QL7A 3TMYA 3WIOA 2OK7A 3V1MA 1EAYA 2I7DA 3IP3A 1IEWA 3LDGA 4G6ZA 5H83A 4MDEA 2IQ5A 1QYIA 4NYIR 4HNUA 1NG1A 2WSIA 4MZDA 4ZO6A 1MIOB 1N0UA 3OQ1A 1OIXA 1BDBA 2C97A 3TMKA 3S27A 3NHKA 4X1YB 1NX6A 2IUYA 4P34A 4C7OA 2ZI6A 2VEOA 4WZAA 2LPMA 3C4JA 2WB4A 3T4XA 1CJBA 1YC5A 1N7HA 1YFZA 1JEQA 1GSAA 4LHEA 4P9NA 3MJHA 2XV1A 3T3HA 3MWFA 4AN4A 4L75A 4DZZA 1NU6A 5G02A 1CS0B 3TTVA 4KFTA 4EKDA 4LA4A 1ONNA 2C4KA 2CC2A 4NU8X 1ONOA 3ZDCA 2G36A 3ZG6A 1VLMA 2RG1A 3ZGZA 1XF9A 1DG9A 1MLDA 2JL1A 3WK6A 4B75A 4JXXA 2RH5A 5F52A 1G3IA 4C06A 3P8ZA 2VTBB 2EWMA 1O96A 3S1LA 4ZHQF 2WJWA 3REFA 2O1WA 3A4MA 1BEUB 3N0TA 1FP2A 1QNFA 2OZLA 5HE8A 3VVMA 1SD2A 1VPDA 4ABTA 1YTUA 5ALJA 2CHFA 3TFWA 3MVEA 4REQA 1DAMA 2YY5A 4QYXA 4BATA 2PFGA 2OV2A 4LXYA 4PAQA 3DMPA 1I5RA 2WF6A 1XQWA 2R8YA 2X5OA 3IAAA 4FDAA 3RUIA 3R75A 3LY8A 4PO8A 1FL9A 5ES3A 2DR0A 2V59A 2ORYA 5HMLA 1BA2A 1JE1A 3M1YA 4P38A 1EXMA 2H08A 1PL7A 3F3SA 3OZVA 1W7AA 3THWA 1R88A 1H1TA 2QN2A 1NQWA 4AZ0A 1NOKA 4BO7A 4UDYX 3U1VA 2BGUA 1DPFA 2HDOA 3GFOA 1OWPA 5CLLA 2JGIA 1E2HA 1QR6A 1W1IA 5EP1A 2VF5X 3AY3A 4HGPA 5C8XA 4DYDA 3NYIA 3V1YA 5KTTA 2ZUFA 2AFIB 4YLGA 1TLTA 3PB3A 4Z4QA 1GG9A 4QHSA 3TLAA 5F21A 2V8BA 3QF4A 3F46A 5ICCA 3FVWA 4FDUA 4ZVUA 1ZHOA 4ZC8A 5I5GA 3SJCA 4JH0A 4ETIA 1GITA 1L7XA 1BH2A 3GFFA 4LV5B 5KVAA 3EZYA 3EPJA 3DBRA 4IG9A 4U3JA 1G2IA 1JG4A 2G17A 3M83A 3BSFA 1D4ZA 3ND9A 3DUWA 3KHUA 4ZPXA 3WY9A 4CJXA 2KLBA 1L5VA 5ALFA 1C1DB 2CNOA 2DJIA 2GPWA 2GUWA 2R7AA 1AURA 3KQOA 3I45A 3PCRB 2O54A 3NTVA 3C74A 3T61A 3JZIA 4D9FA 1WZCA 4OU4A 5J4VA 7ABPA 1Q95A 4IBOA 3W5IA 3BS4A 1SC1A 4WNAB 1YB7A 3WE7A 1NI4B 4JHLA 4MRMB 3GRAA 4I9NA 2FPWA 1LZKA 1Q7GA 4P2BA 3LU1A 2W11A 4YPOA 1UM9A 4ONEA 2Y77A 1VCIA 1SELA 2EX4A 1QWOA 4DJAA 1SCDA 1P45A 2RAPA 1GZ4A 4FVTA 4TMWA 5FT9A 1KVTA 2MINB 3DE0X 4ER7A 4GWLA 2ZYDA 4UNSA 4BZPA 1JXOA 2N9UA 4RZHA 4DRXB 3RAFC 5FPPA 1RDFA 1L8XA 4RXMA 4CMHA 4DMKA 5J3JA 1C9NA 1YRWA 5IT0A 1PSDA 1EFPB 4I3HA 1YMQA 1SKUA 1YULA 4O8CA 3R8XA 3UTCA 1GP2A 3UMYA 2RGWA 1IQPA 4CF7A 1AS2A 1E20A 1OCEA 5G2OA 1EFUA 2CLEB 4QHYA 1D1TA 3RIEA 3HVKA 2XZTA 3LSTA 2ODAA 4AN1A 2WUFA 5CYFA 1F5NA 2AE2A 5DGTA 4DRYA 1G55A 3F98A 4G09A 1EGMB 5EMMA 1K6IA 1YNOA 5EC8A 4ZQCB 4FEGA 1O87A 1FDSA 1M2FA 1W93A 2FWIA 4L8GA 4WZAB 2QRPA 2AK2A 2JFZA 4KL8S 4I36A 4LE1A 5HFAA 4CIDA 1S7CA 1RTTA 3D3WB 1Z5GA 3H4MA 2JK0A 5DWDA 4XJSA 4A5SA 3ZYZA 4MRVA 4DLWA 5FRDA 3K31A 2OVBA 1II0A 3ROTA 3WR5A 4EJSB 2GAAA 1HYQA 1TL7C 1ZM7A 3OLYA 1OLSA 2AI3A 3BBLA 3FHJA 2AMYA 4JJAA 2Z6AA 2JD1A 3C6MA 2F3SA 4P7GA 1YKGA 2RHGB 5JMWA 1Z0ZA 1JDZA 4JP3A 1IRXA 1JDNA 3WP1B 2A92A 3I30X 3P2KA 5B3KA 2UZ0A 3I32A 5E2BA 2ATVA 1KAMA 1IEXA 2OZLB 3DOFA 4TSRA 3OZEA 5B30A 1H2FA 1VC2A 2XVXA 3A1EA 4RM3A 2R79A 5CGQB 1JHAA 4N4AA 1M1ZA 4B09A 4CM4B 4Z5XA 5CDTA 3SZLA 5IVDA 2OV4A 3Q1KA 1FMFA 1AB5A 1ORHA 1E3QA 1WKCA 1JYFA 1QBKC 1G8GA 2VWHA 3OWHA 5DBGA 4JLVA 4KEAA 5HPYB 3T3NA 1U4SA 4WZBE 2FE1A 4GZLA 3AR8A 4WESB 3JD4A 2B5VA 3JQBA 3UMVA 3RVLA 1LRKA 4B7UA 3EH2A 3PSHA 4PZ9A 4R8KA 1ZM3A 1NF2A 4DUPA 4PLYA 5ALYA 3O7WA 2UZ4A 1JT2A 2HA5A 3SMQA 1BE0A 4MB2A 1J6UA 1U65A 4JYCA 4H18A 3KM0A 1YBMA 2RH8A 4EVIA 3MJCA 2DBRA 5DGHA 4BP8A 1QIDA 1EVKA 3I6BA 1L4HA 4ER6A 1FP6A 1I36A 1MP0A 3IE1A 4Y0VA 3SS9X 3N8NA 1JG7A 3SYNA 3KQUA 5IX8A 2J8ZA 2KQUA 4KOEC 4BN5A 3ACCA 5FFFA 1F8UA 4C04A 3AVTA 2PMBA 3ANLA 3BZWA 2PX2A 4V39A 2DBYA 4YECA 3NRJA 2G25A 1XE3A 3QKSA 1RLOA 3W2IA 1LLDA 4ZOLB 4YX9A 3CU5A 3EPRA 3FVTA 4ARCA 4A1FA 2WJVA 1YR6A 2BDUA 4ZQEA 1IHOA 1BYIA 1HYBA 2HIHA 1GFSA 2J0VA 4KYTA 3F5MA 4LC9A 1FMCA 3CFYA 1KMMA 2PX3A 2B0JA 2IPAB 4ZEWA 5BVGB 2PX0A 3KQKA 1X0XA 1Q1BA 3LPAA 2QHXA 3O8QA 1VIMA 1OXBB 3C45A 2LDXA 4JJEA 4LKRA 1PDWA 3HWX1 2J08A 3B2QA 3PU6A 2CHUA 3F7NA 4JLPA 1SVUA 4ARZB 4NJEB 2GSWA 3S5UA 4E94A 1VHJA 2J41A 2XCQA 2ZRGA 5YASA 4INPA 4ZZ1A 2I6UA 1NTOA 3RE1A 4R7TA 1CK4A 2Q9AA 1NKSA 3GJ4A 2P6RA 1RKVA 2NAFA 3TAHA 4PLTA 4FDLA 2WG1A 3EZNA 2H51A 2YUIA 3N5CA 3RAGA 5AOBA 5FKJA 1FDWA 3P5SA 2RDMA 3AM4A 1X8XA 2Z8XA 4L76A 1NG9A 1QVWA 2IEAA 1HBJA 4QWMA 5D5HA 3W3AD 4R05A 4M1QA 4CKZA 2ZAMA 4GLFA 4EGFA 4E1BA 1OFGA 4GMXA 1BX3A 1IXSB 1HETA 4RPLA 3TCNA 4EG5A 1MQAA 4FU0A 1FQJA 1EPUA 3NBQA 1AU9A 3AUFA 4YONB 5G3ZA 3T3MB 2R6JA 3JD2A 2V45A 4J4TA 2X8JA 1EG7A 3IQHX 5DTJA 3T7KA 4F7DA 4ZHQA 2QAIA 1F06A 3SKVA 1XYYA 2CXRA 3A6HA 1T1RA 3CKKA 1GZ3A 4LDQA 2W6CX 5F64A 2GILA 3IPLA 1ACLA 2PA3A 1CUGA 4KDRA 3PT5A 2B7CA 3A58B 1P3JA 4PX5A 5EKSA 1G0NA 2R6FA 1JX6A 1L3BA 3CLHA 2ZB2A 4BNMA 1TRKA 4BS9A 4DDTA 1JVNA 1PJQA 1Q2XA 1QYWA 3PTLA 3ELWA 4FFNA 3WRYC 1R37A 3KFVA 5DHTA 1G3RA 1OLXA 2DQZA 2ZB4A 2EBHX 3C4VA 3GFTA 3QH4A 1Y3BE 2O2JA 1NFFA 4H3KB 2CLOB 4ZCMA 4WJKB 5FQNA 1HT0A 4I99A 1XP8A 4YUWA 2R7LA 4TXJA 3RGWS 3INRA 4MQUA 1JR2A 4MLDA 5KYWB 1T4GA 1XQ6A 4PGGA 4XLLA 1M66A 1EDZA 2J87A 2JLXA 1SA0A 1PQYA 1QF9A 3AEUA 1KJIA 3ILXA 4JL8A 5LP6C 4KPFC 1DJNA 1GT91 1VBNA 3CQ9A 3INYA 1T5LA 2RI1A 2ZBGA 1Z0JA 3IPYA 4HAZA 3ZD8A 4UBJA 1Z0IA 1FTSA 1P7ZA 4ZCTA 1DC8A 5JR3A 1J99A 2JFNA 4YBZA 3T9DA 1G291 3LBHA 3NASA 4PBSA 4QG3A 2J6BA 5HTKA 2B8JA 2CT8A 2I1QA 3SDBA 5GADl 1WTAA 2VAXA 1MAUA 1IVYA 4LVUA 4JN6B 3AVUA 4M8SA 4OLAA 1D4OA 3IHKA 1IHDA 4R1MA 2RHJA 3VR5A 2FEKA 3TDKA 3W6OA 4RBNA 4R2WA 4F6LA 1G2OA 2R7KA 2VOEA 3EVEA 3QXCA 1T25A 1VGRA 2O9JA 4NNOA 4I1PA 2YMLA 3R77A 2D1RA 3SIRA 1BH6A 5DBHX 4Y7DA 2J7PA 4N9QA 3WRWA 4B0OA 2Q5EA 3KKLA 4CF4A 5K6TA 5AJHA 3CPHA 5ESXA 1Q15A 3BK1A 4MGIR 3WWYA 5KJFA 1YIAA 4AWAA 2JCBA 4B5KA 2NG1A 1CIPA 1L7QA 3AYXB 4O4JF 5HFJA 5HILA 5BY2A 3RNLA 1L5YA 1SUFA 4PTLA 3ZU4A 2FG6C 2IEDA 3HCFA 3EUAA 3HXKA 3EIWA 2HY7A 2QEQA 1NTRA 3C3XA 1MVLA 4H7PA 4C2BA 1RE1A 3SGLA 4GWGA 2PQ6A 5J2UF 2HU7A 1DKLA 4CF3A 1ZCJA 121PA 1KJWA 1T2FA 3T5BA 3RUEA 2CXNA 1L8QA 1QHEA 2JI6A 4MCJA 4RM2A 3G0BA 3C0KA 5KSPA 2A9FA 4KTVE 1E1CB 4Q4HB 3L02A 1YBVA 3ON5A 3O8QB 3HXLA 4DNQA 1EB9A 3HDYA 5AKJA 2Z9CA 4JEUA 4CEIB 2GEDA 3O1HB 1F2TB 1XV5A 3CUKA 3H0KA 2Z4RA 3K09A 4Q4AB 4RW0A 5ED0A 1MDFA 3WOVA 4DW8A 3H9EO 2IU3A 1Y34E 4TVKA 3QELA 1AQJA 3HC7A 3D02A 3RRZA 4LOLA 1E9VA 3HCDA 3LA6A 4X44A 5ENDA 5JSFA 2JATA 4U7GA 5IKEA 1LFAA 2WHXA 4EUFA 1ZVVA 1EB8A 1IXRC 3A26A 2AHOA 1SD5A 2PL9A 3DG9A 1UOEA 4W8GA 3QU9A 5FOUA 5JCOC 4LF8B 4W5WA 1MD9A 1XWWA 5BVHB 3KBOA 2XF2A 1O94D 4PSUA 3C3AA 3E22A 1QH1B 1IMOA 2D74A 2VQSA 2ZWAA 3E82A 4OBXA 3C85A 1U9IC 4OYHA 3PWSA 2FZKA 4DQVA 1KO8A 1PWXA 1O4WA 3D43A 4KBYA 2D6FA 5H70A 5IN5A 2WKWA 4ZK2A 1JE0A 1YOBA 2Z2KA 4K7JA 1ZINA 4DAOA 1KC3A 1NYTA 1TECE 1P2GA 4FKBA 4CFZA 4EOGA 4R01A 1E0JA 1UBEA 4P8RA 3PI7A 3VO1A 3DVAB 1EJ0A 2A9VA 3ZK8A 4IGEA 1R00A 3DTVD 4FYXA 3NBKA 4ZHQB 1C9DB 8ATCA 2Z5VA 5I9NA 3HVUA 4DADA 1QO9A 2IELA 3FJOA 3P9ZA 2ZULA 4O1IA 2BBOA 4UU1A 2JH9A 5EN4A 4M1YA 2Y0BA 3KUDA 4KN9S 4Q6BA 1Z2PX 3VRHA 2EATA 1LA2A 4BVEA 1IJFA 1BQEA 3IVRA 5DSXA 5JCXA 2V7PA 1WHTA 1GL9B 3ENNA 3K30A 2AZMA 3QQ5A 4TLBA 1L7AA 1ZU5A 2MMCA 1D07A 3GMTA 1B76A 5IH3A 3FWZA 3WQRA 4NJMA 1GRNA 2D1QA 3WLEA 4H17A 5E7IA 2X8WA 1PJZA 1V3QE 1F6WA 2X1HA 3PFIA 1ZNZA 2ZRIA 4P84A 3NDJA 5BSWA 1KZGB 3S8MA 2Q1UA 2OD7A 3AEUB 1KZ9A 4F12A 2WRZA 4YDHB 4NBRA 3B51X 1PV1A 3PX2A 4LJ9A 1N7GA 2GZ2A 5KI6A 1LBIA 2W0SA 2C92A 4JLMA 4C0JA 4BVAA 1TK2A 2ZVQX 3DKIA 4CRWB 3CRVA 3F8TA 3NUZA 5L6LB 2LCFA 2CK3A 3DMFA 3K0BA 4GI1A 1BVHA 4NZMA 3K1YA 2I54A 3L07A 3NLLA 3P4XA 3Q7RA 2UZ1A 5TQ0B 3BDVA 3VI4B 3UK1A 4RK5A 4R3WA 2W90A 1KEPA 4BNIA 4RQAA 4EJ2A 2N1BA 3NHSA 3B78A 5KDOA 3BRQA 5JWOA 5BWCA 4EDFA 3D54D 4LVCA 1QDEA 2NXNA 1E6UA 3UQZA 5K3OA 1T29A 2CFCA 4JI5B 2QP4A 1EUDB 3LQQA 3H0CA 4LV8B 2FSFA 4CWAA 1LC3A 4LF7B 1GGHA 5E6SB 2XMQA 2WFZA 1JA9A 4TQ9A 5TEWA 1P9WA 2B6HA 2DFVA 3ELDA 3GRCA 3EGCA 2X4LA 3Q2OA 1J8FA 2IP1A 4FYYA 2IHTA 3PEEA 3RARA 2O20A 3AR2A 2LZ0A 1A7KA 1XHLA 1N77A 1NT4A 1Y8RA 1G5IA 3RRBA 3AM3A 4B3JA 4DUGD 2QTZA 1YQDA 2D06A 4TMYA 1ECCA 1KFEB 3RTAA 3RU3A 3U0VA 3BTVA 4M46A 4ITRC 2QM3A 3JAKB 2PT6A 4LHVA 2JGLA 5CCEA 3NHUA 1SU8A 1HK7A 1XN4A 3W7VA 4KN8A 5ALUA 3NVDA 2VXCA 3B1XA 3QUCA 4R83A 4RHXA 3ND7A 5T4BA 5JAUA 4BMZA 1RLUA 4Y2YA 4YREA 1TNDA 1A5BB 5AM4A 4KACA 3OJOA 4U4AA 4QNRA 4CG3A 4WZAE 2OCYC 4PRYA 4AMBA 1U7OA 2X3FA 3F7OA 3S6JA 1OVMA 5BV2P 3PSAA 1PT8A 1JVSA 1S2OA 3KOZA 4KO4S 3IAEA 4F1WA 1UBOS 3QELB 3RW9A 4XCXA 4UZEA 2CFTA 1RADA 3GQVA 5KCMA 3RRYA 2GAIA 4HS4A 3FPFA 3WB1A 1F0NA 1DQSA 4DXHA 2BJHA 4RMGA 1E9BA 3D6TB 3ZTYA 4WKCA 2YYYA 4WLNA 1YQTA 3ZUGA 1YCDA 1U8TA 1BGXT 3IPAA 1R0YA 2IEIA 1O6CA 3GG2A 4DDVA 1S8NA 4KVGA 2NV2B 3WSWA 4F60A 5F4BA 4BB0A 2YMQA 3BH6A 3ZU3A 2KMLA 3VO9A 1UH5A 1L4KA 1TZBA 1YL6A 4R6WA 2W2XA 1KJZA 4DSTA 1MRZA 1XTBA 1YV9A 4B0PA 4FKZA 1WEHA 3I9JA 3J7TA 1UDXA 3QXXA 5HJ2A 4AKTA 4UOZA 3T7SA 5AW7A 1P4AA 2QYOA 2X4IA 3D5EA 3LJKA 4XYEA 5FI3A 1G3QA 4AZTA 4E5NA 1IXYA 5I7OA 4GBGA 3L1JA 3HYCA 2XDAA 3VV2A 2HA4A 1GDDA 4I1OA 3VBCA 4AICA 3IVXA 2O7VA 4CL0A 1Y4DE 1QG2A 1WBJB 4KP7A 1D1SA 4NWIA 3RH0A 2F7SA 1BGVA 2JIDA 3OUUA 1EP3B 2E1RA 3DFIA 4L8VA 3HPQA 3MF4A 3WIBA 5G0VA 5I9MA 3ENQA 4F9GA 2H9AA 4L4SA 2FSVC 4MPRA 2HCJB 1RLTA 1WHTB 2W2KB 3LHFA 4XYGA 4PLCA 2HSZA 4Z7NB 3F6CA 3O8LA 3TIVA 3F6YA 1E77A 4Z54A 4J6FA 1V47A 5LXTB 2OP1A 4OQNA 2RD2A 4C4RA 4RD0A 1J0CA 3OBBA 3IESA 4Y6GB 3N2NA 1GN8A 4KO8A 4GX0A 4WSOA 3BIWA 4IDPA 1ZD5A 1ZCBA 3WKEA 4FNMA 4E0BA 3VA7A 4UDXX 4UQLA 3ADCA 1OYOA 4UUQA 1JILA 3KS9A 2QD4A 5E4JA 1WIWA 2VNKA 4QFMA 3Q2KA 4E13A 4PX9A 1NYQA 1U5BA 2DF8A 5F4ZA 5J59A 2H1CA