2CMPA

Crystal structure of the dna binding domain of g1p small terminase subunit from bacteriophage sf6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
KLSPKQERFIEEYFINDMNATKAAIAAGYSKNSASAIGAENLQKPAIRARIDARLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TERMINASE SMALL SUBUNIT
publication title The 1.58 A Resolution Structure of the DNA-Binding Domain of Bacteriophage Sf6 Small Terminase Provides New Hints on DNA Binding
pubmed doi rcsb
source organism Bacteriophage sf6
molecule tags Viral protein
total genus 19
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cmpA00
2CMPA 3ZQQA 4ZC3A
chains in the Genus database with same CATH superfamily
4ANJA 3KLOA 1V5GA 2R5ZA 1J59A 5IP9J 5DYMA 3MD2A 3HB9A 1FBSA 2BZTA 4A12A 3CCYA 1VQ8I 2E60A 3BG5A 3EUAA 5FO5A 2DU9A 2DPDA 3NRVA 2ZMEC 2XB5A 3ZMTA 1TL8A 1SAXA 5GP9A 1FTTA 4WCGA 3GTPJ 4HOBA 1H88C 1H0MA 1YLFA 2XF6A 4U0YA 3BPVA 4JBAA 4E70A 1K4TA 2FU4A 3I54A 4Y3OA 1XGOA 1REPC 1O57A 3RPUA 4XORA 3WU2C 2VQCA 3K70C 3ASOH 2ZSHB 1BW6A 3I9V2 1YJNI 3T1BA 1QPMA 1ETYA 3TDZC 2JA5J 2ZSIB 4BXUA 2KL4A 3WTYC 1TBXA 2VXZA 3ROUA 1FOWA 3MWMA 4UB6C 2ME0A 3A01B 3KYCB 1FP2A 1RNLA 3K4KA 3H5AA 2E36A 5HNFA 3IWFA 5HDNA 5FFXA 3IL2A 3OYLA 4GYGA 1R1UA 4FQGA 1VTNC 2VJIA 5FKKA 2VJ4A 3TP3A 4U7DA 3OL3A 2KT0A 1HW2A 1WI3A 4R8HA 2PJPA 3VFZA 1Y39A 2KFDA 3VSLA 5IP6A 3CMYA 3I53A 2M34A 2Z9OA 2A69F 3OIQA 5A2QK 4A3FJ 2QKMB 1XCVA 2VOOA 3I64A 3KP5A 1BOBA 2CFOA 3Q0VA 3IKTA 5GAEJ 2EILH 3V8LA 3RQIA 4PZJA 3BC8A 1W4MA 1YIJI 3B6CA 4LITA 3CMEI 2ZO4A 1UHMA 1XMXA 2EBIA 2MGQA 4IEJA 1ZR4A 5IOYA 1B6AA 3DXJF 1FWZA 2DJIA 2AXLA 3BQYA 3KP7A 2BV6A 2LKXA 1BJZA 1V3FA 1Q1HA 2LFBA 5KNLA 2WY8Q 5L3DA 3T8TA 1R5HA 4A3LJ 3HOZJ 2A07F 1JT0A 3WU0A 1VNDA 3JRHA 1BI0A 2IGKA 4EM1A 1F36A 3J80Z 4BH9A 2E1CA 2E1MC 1MBFA 3HIFA 1QZZA 4E7KA 3RQ4A 5JHUA 1B72B 3FF5A 4XOPA 2XHKA 3BG9A 3A02A 1O3SA 2XPUA 4XRSA 4ENNA 3U21A 3GX4X 2ZJPF 2NVTJ 3KP4A 4A0YA 3DTKA 1PUFB 1QNTA 1QRYA 2A05A 2YS9A 5D5WB 2GOXB 2Y9YA 4IO9F 4S0HB 3ZR8X 3S93A 2H27A 4RGRA 3S14J 1ETVA 1ETQA 2M5WA 2RC4A 5L3BA 2W7NA 3RZOJ 4CICA 1YIOA 1RESA 3NEUA 3RI4A 3PIOF 4ESJA 5CQEA 4L0YB 5CVIA 1TT5B 3C18A 1BR1A 2LF8A 1KYZA 4IHTA 3L09A 1Q1VA 4G6QA 2STTA 2CQQA 4HG2A 3I4NJ 1DQUA 5L3FA 2CV0A 2D1VA 2R7FA 1CQTA 4IHXA 4MIMA 2E35A 1Y8RB 3VWBA 2BGCA 2ZXWH 3FZVA 2L5QA 1Z67A 4HRIA 1GT0C 3EUKL 3DLLF 3K4JA 3A4CA 3HOWJ 2EFPA 3QPSA 4DGWB 2RQPA 1ZREA 2FXAA 3UKGA 4O3MA 5F27A 3VSKA 2DMTA 1G3YA 3L7WA 1MDMA 2EINH 2RNJA 2VE9A 4YG2F 3CUQB 3S15J 1BR4A 4U7BA 4A6DA 3EYIA 3FIWA 2A5YB 3ZQ7A 2IA1A 1WJDA 4GGGA 1K61A 2VKEA 2YR2A 2OU2A 1R5GA 2Z3YA 1FJLA 2OF7A 1USSA 3I5UA 5ICGA 3F8MA 3FBIB 2Z99A 2DO7A 1J5YA 1MMGA 1VQMI 4BHPA 1S7OA 5H20A 4RBOA 3QPLA 1U5TC 3LFKA 3VB2A 4CDGA 5EG0A 2HOTA 1ENHA 1VI0A 3HRSA 2XGXA 2NVYJ 4PCQA 3W2VA 4DYQA 1RKWA 2J5OA 4KT6A 3FXLA 4EM2A 2EZLA 2VL8A 3F72A 2K4JA 3ECHA 3K4MA 2M8EA 2ZJRF 4O5VA 3CDHA 1YS7A 1U8BA 4B44A 1AKHB 2IVMA 2WV0A 1XSXA 1ZARA 5HS9A 3CCRI 1WSUA 4CCLA 2BY0A 5E79C 1WJAA 2IJLA 1JT6A 2VQHA 3JW4A 2PBIA 1BIBA 1HSTA 3CJQB 2V1XA 2ZNZA 2HNHA 5FGMA 1USTA 3U1DA 4ZZDA 4EV0A 2RN7A 2JN6A 3BQZA 4S05A 3P7NA 3DP7A 4UV9A 2A68F 2R5YB 4H0EA 1GV2A 4AIKA 1QQIA 2L02A 2XV4S 2YUSA 2H6BA 4L9VA 1MBJA 1BOAA 2IAIA 2JT1A 4A0ZA 2O3FA 2V1UA 2JVGA 3E1SA 2QM3A 2MABA 5J8FA 3L2VA 4A5NA 2BVLA 4EM0B 3KCCA 3QRFF 1SD4A 3K70D 2FBKA 3DKXA 1G2HA 2Y9ZA 2HVRA 3PNYA 4NB5A 3OYNA 2VPRA 4HV6A 4EJTA 2HQRA 4E7IA 1HDPA 2PQ8A 1RETA 1APLC 3ZQLA 1B4AA 2RDPA 2LVSA 1D1BA 5HNHA 2DJNA 4F55A 1PDNC 4OMYA 3R0JA 1QVUA 3MFKA 4YIIA 4PJMA 3LSMA 3RPUD 1XB4A 2EFNA 1ZG5A 3FWEA 4OMZA 1YX3A 3ZN1A 5JLWA 3O3KA 5E3MA 4C30A 1IO2A 2DBBA 3P9KA 1E0EA 5C4JJ 4X0GA 2X1DA 4UVBA 3A03A 1VQKI 1P7IA 2O5RA 4A3EJ 5B3SH 2VT2A 5FKMA 3TKYA 1NHAA 4BXFA 1UCRA 2DDAA 4LGWA 2ELJA 3W2AA 4U88A 3H1CA 3K2ZA 1K83J 1HW5A 2CFXA 3HYIA 3TP0A 2WC2A 3HOUJ 2L7MP 4QIWN 3R61A 2BY1A 2F5EA 1U6GA 5J4VA 4PGGA 2LH9A 5LHIA 1ZGWA 2LTPA 5D5XB 1H8AC 1T56A 1N75A 3QAHA 4Z2YA 1R9TJ 3OYMA 2CG4A 2UXNA 3GO5A 3W6KB 5J1YA 2HOSA 5E3OA 2Z2SB 5DD4A 2KRFA 2DK5A 3I4PA 1A6IA 2QA4I 3JRBA 2VKDA 2DI3A 2JTVA 2K27A 2DA6A 4AIDA 5ED4A 2GBYA 3WG7H 4ZDLA 1T08B 3HKZA 3RJPA 2ECBA 1Z0XA 4N0BA 5EF6A 3L2RA 3EYYA 3GTJJ 1QA6A 1O7FA 4IHVA 3B73A 4I76A 1W5SA 4P9FA 4AIJA 4ZH4F 5GADJ 2JPBA 5AIPA 1WRJA 4BQAA 1UFMA 1SEUA 4NC8A 5M5YJ 3BY6A 2M30A 5LEJA 3TBIA 3HBLA 4MEXF 5CLSA 2FOKA 4BYYA 1H9GA 5EJCA 3TMOA 1WWXA 2P6SA 2WBMA 3C7JA 1RKTA 1JGSA 4B43A 5ILVA 2DA5A 4BEHB 4DBRA 4HDUA 1BN5A 2F48A 1VQ6I 2CQXA 4I09A 2XIGA 5ERIA 5CVUA 2KIFA 3S2DJ 3BG7A 3JSOA 1QZYA 2XAUA 5IP7J 4A3GJ 2ICWG 1Z9CA 3H92A 3CESA 4HA8A 3Q0WA 2WADA 3ELKA 2PG4A 5F64A 3L2QA 1IUFA 4XKCA 3JRCA 5KCMA 3SEQA 1FSHA 2BHYA 2L01A 3LSGA 4F91B 1Z91A 3MKZA 4HQEA 3TQNA 2DMPA 2CWEA 1FSEA 3Q0UA 2L9VA 1TQPA 3FXJA 2FSWA 2A5WA 3CCEI 3FXRA 1FBQA 3KLNA 3IH3A 4B4CA 2V9PA 1WZ2A 3D5SC 1OKRA 2KIUA 5E1WA 2MD0A 4XOTA 3HGYA 4BJTA 2ZFWA 1GDTA 3G1LA 2HZTA 1F5TA 2DT7B 2R93J 4CCNA 2M2EA 4DQ2A 4ETSA 3TO6A 3DBRB 4RM3A 3RDIA 2K4BA 1YHQI 2G7HA 2B0LA 5E8IA 2QEXI 3VYUB 3A1YA 1JUMA 4OWRB 5FFZA 3ABUA 2RAEA 5KK1A 2IP2A 1K7AA 3ZPLA 2X0LA 2DN0A 1X3ZB 1WGXA 4RB0A 3OYJA 1LFPA 4BKXA 2CW7A 1FBUA 5IT9K 3OIPA 3G1MA 3HEFA 4WXCA 4PJNA 4Y4RA 3ZN0A 4G9YA 3PO2J 4BJ6C 3C1DA 1BBYA 1OCRH 4F3QA 3ASNH 4M71A 4CZZA 4FTHA 4I6ZA 2ACJA 3S1MJ 5JHFA 2X9DA 4C3JJ 3WG9A 2IA2A 2MBFA 3LSJA 2OZ6A 4DW6A 1IN4A 4BU2A 4DYRA 1VF9A 4CYCB 1SVOA 1V5EA 1QVTA 3LMMA 1T95A 4XKBA 3HTUA 2CV2A 2KQRA 1E3HA 5FLVA 4Y52J 1RIOH 1JKOC 2P7CB 1R1VA 1T98A 1X58A 1IRZA 3HHHA 2NS7A 4OIPF 2DAOA 5IY5H 2K86A 2XDVA 5GAGJ 1YI2I 4P5OA 4QTRA 4CCKA 1FYLA 2HOEA 5FKNA 4HNUA 2A6TA 5B66C 1G3WA 3MZHA 2VBZA 4B1RA 4XLEA 3F22A 4AVZA 4MGRA 5KVRA 5DDGA 2ESHA 3K4BA 4O6JA 4Y33A 3CJNA 1QBJA 3FX3A 4HQMA 4NBQA 4LIVA 3E97A 4WXDA 2Z1DA 1XSDA 2L54A 2CW0F 2ID6A 1I3QJ 1FT9A 3IH2A 4TV7A 2NAZA 3KE2A 3RYPA 3OYKA 2IS1A 2EIMH 3CF5F 5B5EC 4PK4A 2IS4A 4WXHA 4AYBA 1FMVA 1PYVA 4QLCU 1IDYA 3LSTA 3LSKA 1O3QA 2IGOA 2QENA 2E34A 1ZG1A 2D5VA 1GUUA 4EGZA 3V8KA 2XRLA 1NH3A 5ICFA 4RLQA 3JRFA 1IRFA 3QODA 3ZRGA 2LLKA 4RGSA 1LEBA 3IKVA 5LD2C 1T0FA 4BXXJ 4A3JJ 2PMZN 4RB3C 2HOAA 1BI1A 2F4MB 3C2GA 3MAJA 2KISA 1BI3A 1FMWA 3TW7A 1R71A 5D5VB 3IRRA 4CYDA 1HC8A 4ENJA 5GAHJ 4FT8A 4R1HA 4ENKA 4RB1A 1SFEA 3ESWB 4I99C 2DA2A 3WTVC 2GWRA 2JUCA 3AL0B 4M72A 1VQOI 1N25A 4HLXA 1ZAOA 4BY1J 1T0FC 4KA4A 4I98B 1MBGA 2XROA 3GTLJ 2RREA 9ANTA 3S1RJ 3L2UA 1R00A 2R7ZJ 2WV1A 3OYBA 1U8RA 1QZEA 4KN4X 2BE5F 1R22A 2QKLB 4XLHA 4DOZA 2E1OA 1RZ4A 2QF7A 2R7DA 1N78A 4F93B 3CO6C 2M7AA 4A3KJ 1OMIA 2NRAC 1JHHA 3HHGA 1DUXC 2XAHA 3GEZA 2X6WA 1TWGJ 1D3YA 3JRIA 5J3LA 4DZJA 4L18B 1X1DA 2I10A 3V8JA 1T39A 2LR8A 1SVLA 5GTHC 2DDBA 4A3CJ 1ZK8A 4N9IA 5DCMB 5D5UB 1UG0A 1LDDA 4YRVA 3ABLH 3O8GA 3WHBA 4M3EA 4KIFA 4C2UA 1VFCA 2EA2A 4ESFA 4D7MA 2HEOA 1XGNA 5LGNA 2Q2EB 1ZKGA 1W1WE 2VOPA 1P4AA 3H9GA 1YJ9I 5JVGF 2WAQA 3FK6A 3ZQQA 4A0XA 5CKTA 2XVCA 1FZPB 3HTSB 4KIBA 3PIPF 3BR2A 3DF8A 3PQJA 3CC2I 5D8KB 1CF7B 1FOKA 1HW1A 1Z3XA 3RSNA 2M0CA 1IC8A 4BUPA 1YQAA 4WK8F 4P96A 2E5NA 3PNTA 3H35A 3S2WA 3GTOJ 1ETKA 4L5JA 3Q9SA 2M7BA 3HOSA 2JRTA 1LVAA 2E5ZA 3D0SA 3DV8A 4NQWB 3HL2A 5M3FJ 3DPLC 2LK2A 2MSYA 2RKHA 2L7KA 5FKLA 3ONQA 3F21A 4WF2A 1ZR2A 4A3MJ 5HVQC 3FXMA 1YJWI 4XNFA 4YIRX 1YRNB 4CCMA 2BVMA 4LG0A 1G4DA 5J8CA 2WWYA 1NK2P 2MFZA 1XS9A 3HPGA 3OSGA 2DW4A 3WU1B 3SDBA 4G7ZF 3QP5A 3LQRA 3HUGA 3FM3A 3J7AY 3J81Z 3DU6A 5D6EA 2DA4A 3ZQHA 1JHFA 4E7HA 2Q0OA 1FEXA 2QQBA 4M9SA 3VYRB 1HKTA 2K9MA 5IOZA 1R49A 2HVQA 2LSOA 1ON1A 3QYBA 5IYBJ 3KYLA 2XPWA 1I6HJ 4B47A 4LFUA 2ELHA 4EVIA 1BL0A 2W57A 4AD9A 3V7SA 4HF2A 4JOMA 1V54H 3J7AO 3ZGKA 2M9HA 3BDDA 2E1NA 1NTCA 3LSHA 3GTQJ 4I02A 2ECCA 4OINF 3DEUA 3F8FA 1I50J 3OMYA 2W85A 4CZCA 2CSOA 3KEOA 4Y15A 4BGDA 2Y31A 1WH5A 2DYRH 3C2BA 4Z6YA 1ZH5A 1Z6RA 2W00A 1OR7C 1EH7A 4OIRF 2HWVA 1B8IA 2Y0SN 4RS8A 3BR1A 1SFUA 1ZLJA 2UV1A 4MQVA 1HKSA 3WTUC 2KKOA 1TNSA 2MD5A 3I71A 4D5CA 4KMUX 3G2BA 4DIQA 2XGDA 2JUGA 2UUZA 4EJOA 1MD0A 2LY9A 3E6CC 3QOPA 3DTIA 4KISA 3IV5A 1MJ9A 4AUXA 2BBYA 2GLOA 3UR3C 2HXOA 4KDPA 1Y8QB 3OV8A 2I5UA 5HLHA 3I0TA 5E17F 1JJ6C 1P4WA 1L0OC 3H3ZA 3I59B 4LB6B 2O8KA 3MQ0A 5F1RA 3R0AA 4HNTA 4WX9A 1GXPA 3V42A 1TQIA 4XRMA 1SMYF 2QWWA 1A04A 1QO0D 3E5QA 3CF2A 4ON0A 4U87A 3JAMZ 1K6YA 2K3PA 3HSFA 3FISA 3FDYA 4HDVA 1WPKA 3ABKH 4BY7J 1SAUA 3LWFA 1S9HA 2WB1A 1BIAA 1YW7A 1TWAJ 2M8GX 2VC0A 4C3IJ 1A6QA 3S3NA 2FQ4A 3MKYB 4ESBA 2FBIA 2L9RA 3F3XA 4RAYA 1KU9A 2ID3A 2X1EA 2DOEA 2IXSA 5D4RA 1FIPA 3QU6A 3HG9A 3A01A 2LRDA 4XLNF 1A35A 4XLPF 1W7PB 4DNCA 4A5MA 4ZYAA 5K5OA 4JK1X 1JJ8C 2RQQA 2R4GA 3AG2H 5E1ZB 4RDUA 1IXCA 2W84A 2ZJQF 3N97A 5K7FA 1UG2A 1XD7A 4G8XA 5DV5A 2XSJC 4OOIA 1KU3A 2F5DA 5FROA 4KUMA 5BS6A 2R7WA 1A31A 1OLTA 3DPUA 2EFWA 2EK5A 1DGRM 5H2FC 1MJAA 3KYDB 4KT5C 4BHBA 3CP2A 2FF4A 1IGNA 4Y17A 1U5TA 1W36C 1X4OA 3P5JA 3OYCA 4C2TA 2O03A 1PJRA 4UUSB 3L9FA 2CO5A 2V1NA 3GCMA 1TLHB 2F6CA 3BZKA 3AAFA 4ASNA 2DOFA 1Z21A 5F0CA 3CC7I 3GBGA 5FRNA 5FLXZ 1ETXA 1EA3A 1FIAA 5DD8A 3F8CA 1DU6A 3FM5A 3B6AA 2GXAA 3LAJA 4RMNA 2MYSA 1XPXA 3P9IA 2HDWA 3CP8A 2YPRA 1RRJA 3AG3H 3SJMA 2W82A 5DCFA 3SFIA 4BQQA 1U3EM 1TW3A 2XAGA 2L4MA 2ME6A 2P6TA 3BP8A 1SFXA 1U0JA 2ZXHA 2WAFA 1HOMA 4CSWA 4IPAA 1LPQA 1B72A 2R7UA 3G73A 2ZXIA 2LC2A 1XN7A 5FD6A 4ZYHA 1PUFA 5F6FA 2PN6A 1K79A 2COMA 4XMYA 2E71A 4II2A 5L3EA 1VQ4I 1IV8A 2X6XA 3OR1C 5BPDA 1XG1A 4JP0A 1W5TA 3K6GA 3PNVA 3QWLA 4A3DJ 2MH2A 4LB5A 4AC0A 4NC7A 4BHCA 5JFRA 1VQPI 1YYVA 1W0TA 4UB8C 3KP3A 2KP6A 1BM9A 1JKPC 1SANA 1Y6IA 4B48A 1JKRC 3WE2A 3WTZA 2GXGA 2RVCA 3R4KA 3BR3A 1P92A 5DM7F 4MTDA 4M6YA 4CCOA 2VLAA 2D45A 1D1AA 1KQ9A 4S04A 1UHSA 2VUMJ 2IW5A 1FOXA 1J9IA 2DA7A 1XC5A 3RKYA 2OTJI 1XGSA 4B09A 2VBYA 4UV8A 5EGOB 4XM3A 1Z7LA 3JTGA 3K2AA 2OC6A 1H9TA 3OWTA 4L9NA 2B7EA 1XTAA 5JI6A 2QBYB 2A61A 3Q9VA 3IUOA 1ZGJA 5H6RA 1D8KA 2JK3A 4IRIA 3W6VA 1WCMJ 3KP2A 1MSEC 4PSXA 4V2FA 2L9SA 4BAYA 2K9NA 4ZYEA 1K78B 2F5FA 2RV8A 4L5IA 2HZDA 1FP1D 3BR0A 3JCUC 3DEEA 3CUQA 4U0VA 2CUZA 5CQGA 4CO8A 1Z6TA 2K9QA 4XKVA 2J5PA 1WJ5A 4EATA 1ODDA 2O6GE 1R1TA 3OY9A 3CJTB 5KAFC 3RKQA 4XSXF 2D2WA 2JMWA 3LOCA 2CUJA 3FKJA 2E2IJ 3ZQFA 1E17A 3VPRA 3DKWA 2FBHA 4I0BA 4LK1F 3CUQC 1DPUA 3A0HC 4ZDPA 2ELKA 2LD5A 3H3VK 5TISC 2EFQA 4FASD 5HLTA 2OTLI 4RLFA 1R58A 3NARA 1AKHA 3S16J 2QQ8A 2COBA 3RKXA 1ZYRF 3HOVJ 1BC7C 5CVRA 2KJBA 4GCVA 2P81A 5A2QZ 1R23A 3PJRA 2L3DA 4IQJA 4IOAF 1Z05A 3H36A 1EF4A 1PP8F 1IN8A 4IRGA 5HDKA 2K9LA 1PP7U 3OYDA 1XDUA 4FHTA 2LKSA 3PUFA 3ZQIA 3IAS2 4RGUA 4MQ9F 4EJUA 2HTSA 2VT3A 4HX4A 1MIJA 4RB2C 2X6YA 3IRQA 2JSCA 4F7ZA 2R5YA 3JSPA 1O4XA 4IJAA 1VZ0A 2EZHA 1ZG3A 3OR2C 2BXZA 4RM2A 2NVXJ 1HCRA 2EZIA 5GPCA 5HS7A 4GO1A 1X1CA 2HTJA 2E2JJ 1T8IA 4LIUA 2ZBKA 3KIOA 3KP6A 4HSRA 2XUBA 5FJ8J 3TO7A 2O9LA 2LP0A 2XAQA 1SMTA 5LGUA 2VQGA 3SZPA 4XLCA 2P8TA 3G4SI 3OS0A 2DA3A 3MCZA 2NNYA 3PO3J 1FNNA 3BOQA 2IBDA 4QSHA 1U9OA 4HBLA 4WWCA 1LDJA 3QQAA 2XB0X 2HYFA 4IOCF 2Y69H 1KQ0A 5FB2A 2GQQA 1ZRCA 4QWQA 2Y75A 2ZXJA 2DTZA 3K4LA 3VODA 3UNGC 2V4JC 2XF7A 1IXRC 2DFFA 2R7QA 2WTEA 2NS8A 2QQ9A 1LDKB 4XLFA 4E7JA 3M4OJ 4KFCA 1D5VA 4LLGF 3OYAA 2XC7A 5ILSA 1W36D 1HA8A 2L4AA 1FOYA 4YEJA 2RNGA 2DK8A 2DPUA 1OQYA 1FTZA 5EEGA 2WA0A 4W1UA 3ABTA 1TC3C 1EJ9A 2MC4A 4N9HA 1EV7A 1QHHD 3M8JA 3WODF 1BW5A 2CJJA 2VE8A 1X2NA 3ZCOA 3KETA 1RI7A 1VQ9I 4HX7A 5KHDA 5J4YA 3J81K 1IRGA 1WI9A 2OJED 5ICCA 1UMQA 2R7OA 1QU3A 4AU7A 1V55H 3DEWA 3HC7A 4LLLA 2IPQX 2ISZA 4FISA 1ZTRA 1FYMA 2ZNYA 5TJJA 3BJOA 4MNUA 3TGNA 1X1PA 5M3MJ 3K1PA 2NS0A 3H3UA 5LBQA 2JZYA 2OCEA 3CD6I 1SC7A 1UB9A 3RYRA 3VDXA 2PJRB 5LRSA 3PUBA 4OIOF 2XF5A 4EGYA 2R92J 1S7AA 2OCCH 1ACIA 1JXSA 3V7CA 3CDIA 1T38A 2OA4A 3OYEA 4BDZA 3LNQA 4ENMA 1T6SA 2GZWA 5J40A 4XRSG 1IW7F 2K02A 1OYYA 3JREA 4BL0B 1UHWA 2DA1A 2FMLA 4ZZLA 3K0LA 3K4NA 1WVRA 3BZ6A 3H5RA 4BEHA 2GOMA 1IN7A 4FX0A 2Q8KA 4HW0A 3RZDJ 1W0UA 2JQ7A 5E8GA 2EV6A 1V5FA 5JLXA 3J80K 1HDDC 3MMYB 2MA3A 2DQLA 1Y56A 3DBHB 2YU9J 3GYHX 2VXDA 1TWHJ 2V26A 4QPOA 3F23A 1VQNI 3GTGJ 1Y0UA 3U2RA 2EB7A 2MG4A 2LBFB 2R7VA 2H6CA 3OS1A 3DWLE 1LE8A 4YELA 1QGPA 3BR6A 2LDUA 2HPMA 1D5YA 3BTIA 2KJCA 4KNYA 2HQNA 4JX5A 4E4HA 4V2GA 1G6NA 3HRTA 2FJ1A 1BA5A 2DOAA 2AS5F 1ONVA 2VBWA 2ZMEB 3ERED 1VQ5I 3TDUC 2XASA 2FA5A 1YW9A 5LHGA 1S29A 2EWNA 3S1NJ 1SVMA 4CUGA 4FX4A 1B9MA 2IGNA 1O3RA 1FY7A 2QYOA 1HXDA 2M87A 4BQOA 4E7SA 5B1AH 5B1BH 2R5ZB 3P9CA 1EH8A 2HYGD 1B9NA 1RPWA 5JVTA 3L00A 4J00A 4PSWA 1DU0A 1MBHA 3MZ8A 2V6CA 3BG6A 3K1MA 3KEQA 3CCJI 2PLYA 4E7LA 2KMUA 4M9ZA 1A36A 3CCSI 4XQFA 1DPRA 1STZA 4XN3A 5J1UA 3RIRA 4ZYDA 2GAUA 2O8XA 2AO9A 3GFLA 2B9SA 1HQCA 2VC1A 2B63J 2W4SA 3GLLA 2NOJB 4MFEA 2L2OA 4ZTFA 2VODA 1MMAA 3FHZA 3F0CA 1Y1VJ 2K3FA 3HDDA 2X48A 1IDZA 3O8HA 4M3DA 1T33A 3O6BB 4M6XA 2QVOA 2V9KA 1TT0A 4G6DA 2BW3A 1TW2A 4DZPA 1UELB 5CVVA 3I3LA 2DTRA 4U0WA 3OYHA 5TGTA 2OBPA 4PGHA 4P1WA 1ZHFA 1R36A 3FMQA 3WTWC 2GM4A 1LQ1A 2ADUA 2HDCA 1R5ID 2L0KA 4MO7A 2E2HJ 2STWA 1RUNA 2DLLA 3QP6A 4PJLA 2A3SA 3GVAA 4ABZA 3CLQA 1EH6A 4UVAA 3TEDA 2VN2A 4KMFA 1JE8A 3VYTB 2M3AA 4KITB 4BACA 1MMSA 3LA3A 2EIJH 4IVNA 2HKXA 1V4RA 4XICA 5M5WJ 4KYWA 2VIXA 3FHNA 3M07A 2E1MB 3ML6A 1G8XA 5M5XJ 5BPIA 3OSFA 2ZJ2A 3IAM2 3HSEA 2X4HA 1F4KA 1X2MA 2E7WA 3T5XA 1BI2A 1S3JA 3DFGA 2H8WA 4UHTA 4NDLA 4LD5A 4A93J 4IKFA 2VASA 2DT6A 3REOA 4Y13A 1IAWA 1IJWC 3QPHA 3D5LA 1OISA 3J7YJ 2HFHA 1D1CA 3HSRA 1MGTA 3CCUI 1TQMA 2QQAA 4V19K 1B59A 3OYGA 1WJBA 2WAEA 3SZTA 3EDPA 3BLYA 3H0GJ 4K2EA 5F0FA 4E7ZA 3CCQI 3S1QJ 5IYCJ 2LOOA 3W2WA 1D0XA 2K40A 2A6EF 2KPMA 2DXIA 2G7UA 4RAGA 1RR8C 1X4PA 4MFDA 4G6TB 4Q4ZF 3PM1A 4CXFA 1WQ2A 3E6DA 2CQKA 3LL7A 4N4NB 4BE2A 4IF4A 4NC6A 3SYTA 2BEOA 2UZKA 4A3BJ 1XX5A 1OPCA 1FLIA 5D8LB 2EIKH 5IYDJ 1UJ8A 5K5QA 2DCEA 2FUG2 4HYEA 2A6HF 3S17J 2M4KA 4LK0F 2VONA 1B1BA 2KZGA 2UWMA 4BBSJ 1OR7A 4PJ0C 4A69C 3E6MA 3AL0C 1XCBA 5BMZA 2XGEA 3F8NA 2OQRA 1W5CC 2VJJA 3BTCA 1QHGA 4Q47A 2DQRA 2P7VB 4XN0A 1XSVA 1IV6A 2OUMA 1MJBA 2CRGA 2RGVA 3DTEA 4H4KC 2BY3A 3DKYA 2QCOA 1YTYA 5CJ9A 1HBXG 4BDYA 3MEXA 1GV5A 5K7HA 1F9NA 5IT9Z 5DCMA 2R7XA 3M8EA 1LNWA 3CO7C 1YS6A 1MDMB 2V1DA 1U5TB 3C2HA 2O61A 1TTYA 3TOAA 2HS5A 1OYWA 2LKPA 3WHCA 3H0DA 1VQLI 1I5ZA 2LMDA 2W25A 2Q2EA 2KIMA 3L1PA 3G1OA 1OCTC 2EPFA 2EZKA 2ZC2A 4KICA 1ZQ3P 3K1NA 4ZJZA 1K4SA 1IG7A 2EJRA 2DFIA 5D4SA 2V7FA 3LSIA 2NVUB 4HV5A 1YFHA 1G59A 2NXNB 1BR2A 2FX0A 3K10A 3CMAI 5TRDA 1CF7A 3J7ZI 4X6AJ 5EG0B 2X51A 1IN5A 4PFPA 2BOLA 1HLVA 2LREA 2QZ8A 5E18F 4BE0A 1T2KA 2CMPA 3JRDA 2H8RA 1XMAA 1JTXA 4A2UA 1QPIA 2ISYA 4DJAA 3CZ6A 4JX4A 4NQWA 4I0AA 1ORKA 2IEKA 3FBNB 1FPQA 2Z16A 2LY1A 4XONA 1J7KA 3HJEA 2FMYA 3N4MA 4NHJA 2PMUA 2HDDA 4XIDA 1IZ1A 1YRNA 3EUHA 2OAZA 5HODA 3ZMZA 1R6RA 1FC3A 2F2EA 2PMZA 3BPXA 3E5XA 2F4OB 3E7LA 3GFMA 3KZYA 4N4OB 5F04A 5EZHA 3HKZN 2XGCA 5EEAA 4HSTA 1IF1A 1XGMA 2D1HA 2IT0A 4ZTJA 3C3WA 3S2HJ 3JRAA 2KLOA 4B3XA 1DP7P 3OS2A 1YG2A 3F8BA 2JWTA 5DTDA 1J2XA 3BTLA 2KZVA 1ULYA 1DDNA 4LJZF 4G7OF 1SD5A 5BNGA 3TW6A 3EUHC 1ETWA 3S3OA 1KYWA 2Z5UA 3A2KA 3I58A 2CUEA 1MH3A 3K69A 4L5EA 2QLZA 4EEFG 2OV7A 4BE1A 2F5VA 4OAYA 3QU3A 1ITYA 3OYFA 1LFBA 1ZGAA 2R7TA 2M4GA 2HU9A 5IT3A 3WTTC 4D1QA 2LNBA 1D0ZA 3KPHA 4PFOA 4UUVA 5LGTA 3WGIA 1KU7A 1OJLA 1MBEA 2DT5A 3F9KA 3PSIA 3RCOA 2MLKA 2F5CA 1Y0NA 4FETA 3L2CA 2NVQJ 3SZGA 3MKLA 2DMQA 4XRFA 2VKHA 3WTSC 4D9JA 5DUKA 5CYVA 1P9QC 5E3LA 3LAPA 3HXLA 3CCLI 4HAMA 4QPQA 1S6LA 1U2WA 4GYIA 3E6BA 1ZRDA 1MW7A 5HS8A 1YW8A 5F08A 2MW8A 3OOPA 4FE7A 1AU7A 2NYXA 2DODA 2L7ZA 2VQLA 1Z77A 3HZJA 4AM3A 5BQTA 5F1JA 4PDKA 1KA8A 5DS9A 1J0RA 1DP3A 2O7OA 2L7FP 3ERMA 5FD5A 4YIFA 3FKIJ 5H6QA 1SFOJ 3GZNB 3BROA 3I59A 4M3GA 2OD5A 4XBFA 4YFKF 2XSDC 2ZKZA 3FXOA 2VI6A 4EJVA 4P9UA 2QGUA 2XKOA 4F92B 3BCAA 2MH9A 2W24A 4UXNA 1KQ8A 1YOVB 2W1OA 3SHFA 5HOOA 1VQ7I 3FXKA 3VOEA 2CU7A 4ITVA 4GRIA 1E2XA 2VB6A 4FCYA 2EA4A 1NK3P 3COAC 2EH3A 5F0HA 1IN6A 5J6XA 3FK7A 1Z1DA 1WJCA 3OL4A 3CUOA 3QYEA 5AIQA 1BC8C 1WH7A 2PEXA 1MZBA 2UXXA 1EKEA 1N77A 3GF2A 4Q5SF 1OCCH 3HOXJ 4LG3A 4Y7NJ 2JA6J 1GVDA 4M9XA 1JUPA 2AQEA 3OOUA 2LF7A 2OQGA 1W7PA 2ZFUA 1SD7A 4XKWA 5KAIC 3M3YJ 1JI8A 2HQ5A 1Z3YA 3WGGA 2FD5A 2FOWA 3CC4I 5E1XA 4A6EA 4LLNA 3GXOA 3G6EI 4M74A 2C6YA 3K9TA 4HZFA 3HPHA 1U78A 4CHUA 2NOGA 2HYJA 2FE3A 3I55I 3TO9A 2O0YA 2TRTA 5DM6F 3NWTA 1F1ZA 1POGA 5D6FA 3WTXC 3K4CA 4X1EA 3B02A 1A5JA 2PX9A 3GTKJ 2HI3A 3HGGA 1Y1WJ 2IGMA 2K5CA 2CW8A 1YITI 5BOXA 4GDFA 3BT9A 3ZMSA 4UUSA 4J19A 3FMRA 1I39A 2FNAA 1TZLA 3SQNA 3R60A 4IRHA 1OYIA 4IHWA 2Z33A 3SXYA 4HX8A 3AG4H 3PL8A 3BWGA 3CCVI 2VJ5A 1R7JA 2LG4A 2Q1ZB 4IHSA 1X1BA 2JA8J 3S8PA 1YO5C 4B3AA 2QSGX 3DU5A 2PMHA 2JA7J 3F6OA 3KX2A 4UUTA 2CV1A 2P5LC 1LVKA 2AHQA 3M1CA 1MKMA 2Y0SA 3JR9A 3FXUA 3H5NA 1U9NA 1XMKA 2K85A 2ETHA 3OIOA 1BJAA 4EJWA 4AYBN 3M7GA 3NAUA 5EYRA 2KDZA 2JSPA 1OCOH 4OAZA 3MN2A 3GZ5A 3QYFA 4CA0A 5LLQA 1I6XA 1WJFA 1G3SA 2QSFX 3U9GA 2QUFA 1P4XA 1D8JA 4UVCA 3LA7A 3ABMH 3E3VA 1MSFC 3IH4A 2DMUA 2CQNA 2H09A 1S8NA 3VEPA 4A3IJ 1KONA 3KZZA 4L9TA 4GXOA 4R79A 2OPTA 3LFUA 3WGHA 3HRUA 4GFBA 1FX7A 5C44J 2FEZA 3T0YA 3H9JA 2DYSH 2E7XA 4XK4A 5LFAA 1TNTA 3KEYA 1MNEA 4FE4A 4IZZA 2XPVA 3EETA 4KN7X 3BJAA 3NQOA 5GPAA 1X3WB 4CCJA 3BTJA 4EQQA 1AA7A 1X1AA 5K1YA 2ZB9A 3CJRB 1IUYA 1OCZH 2HQAA 3SEZA 2HR3A 3V7RA 4C2MJ 3S3MA 1JGGA 6PAXA 5EGOA 4BQNA 4CH7A 3FMSA 1KU2A 2GA1A 1HF0A 1JTYA 1HKQA 2M45A 3PQKA 4E6KG 4RAZA 2M0MA 2QBYA 4HF0A 1WKMA 4F52A 1S72I 5E20A 1AOYA 5CVJA 3BJ6A 2HGCA 3W6JB 3H9QA 3EPZA 1K78A 2DFHA 5K7ZA 1O7LA 3Q5FA 1I1GA 1MH4A 1O3TA 5C4XJ 2G0EA 4MEYF 3CDLA 1LFUP 1F43A 3BG3A 1NG7A 2R0QC 1J09A 2LYCA 2H94A 2CGPA 1RUOA 1I27A 4IXAA 1P6RA 1J75A 2Y30A 1TWCJ 2Y2ZA 3JRGA 3ZQCA 2HKOA 1MNDA 3DBLB 3WE3A 2EV0A 5C3EJ 4J01A 2ESNA 4BNCA 3GZ6A 2FQ3A 2IS2A 1WHUA 2WAQN 1UZCA 3ISPA 3I56I 1LE8B 2I8DA 3N05A 3S32A 2BXYA 4B8XA 2X1CA 1C0WA 1K6OA 2MLGA 4XL9A 1GXQA 1GVJA 1SD6A 3X2QH 2KIQA 3RTRA 4IX7A 2K7LA 4Q48A 5FKOA 2V9VA 3IHUA 1HSJA 2NNNA 4LOCA 3M1EA 1LB2A 4JX6A 4NNJA 1X3UA 2L9NA 4CGZA 5LHHA 2JVHA 2R3SA 3GW2A 2E19A 5ICEA 4RGXA 1DGWY 3ECOA 3Q3SA 4D7NA 3GLXA 4KJZA 1AWCA 1ON2A 1I1SA 3PSFA 4P55A 5J47A 5CPRB 2G9WA 4M6VA 3IWZA 3FXQA 3MZYA 3QPTA 4L0ZB 1R4NB 2F4IA 1MNMC 1G3TA 1TP4A 1AHDP 5FRMA 3PFYA 3IP4B 4NUBA 4LMYA 4HEA2 3DQVC 2IS6A 1PVEA 2P4WA 1LEAA 5AONA 2M1BA 3DCFA 1L3LA 2XAFA 1YX5A 4C3HJ 3V4GA 2GXBA 2EFOA 2KRHA 2H1LA 2Y48A 2YX7A 3W3CA 4BBRJ 1ZLKA 2TCTA 3GMEA 3SDGA 3SFZA 5LEKA 2KHMA 2EV5A 1P7JA 3DLAA 3ZMVA 1Z7UA 3OYIA 3ZMUA 3KFWX 2AQFA 2CUFA 3TOBA 1SFKA 3HM5A 2XAJA 2P5VA 1TWFJ 3D5RC 3I4MJ 4OU0A 1ZN2A 2KDOA 4HF1A 4MLOA 5E3NA 4XSZF 4IHYA 1MMDA 3ZOBA 2BW3B 4D5FA 1RR7A 2FRHA 2V6EA 3AKZA 2CH0A 3D1NI 3CQZJ 1JKQC 2GIZA 2YSRA 5DEQA 5K5RA 2HXIA 1IRXA 4D0PA 1ERDA 1D0YA 5IPAA 2FNPA 3JAMK 4RA2A 1LJ9A 2BHZA 3KZIC 2CS3A 4UY8I 1ETOA 2CQ7A 4M3BA 4M73A 3L2WA 2XKPA 1E3OC 1WJEA 2DMNA 5HLGA 2CYYA 3F6VA 3ZQGA 1H89C 3HRMA 1W7PD 3U1KA 2H1KA 4OIQF 2P0WA 4YFXF 1KGSA 1ZELA 4BS9A 2K9SA 3LA2A 2BYVE 5L3CA 3CMMA 5LRRA 2X6OA 2GIVA 2Y0MA 2WY7Q 3BR5A 2GA2A 5DUIA 4UNOA 4ZDOA 1RC9A 4II3A 4RAFA 2XRNA 5J1RA 1OCPA 1S5LC 2QSHX 1YE9A 2BY2A 3E5UA 1GHCA 4I7HA 2OZUA 2TDXA 2HVSA 3VYSB 2PFBA 2AXTC 4IL6C 2ZCWA 4YFNF 2R7RA 2R7SA 3NWSA 4G7HF 2N8GA 5GTIC 4AVPA 4HLYA 2V79A 5HDGA 3PFIA 4ZYGA 2X85A 3CCMI 1R4MB 4HNVA 1E3PA 1UAAA 1OFCX 1KZHA 3ZMDA 2VKVA 5EZGA 3RKWA 3ZXSA 3GWZA 2VBXA 3CLOA 4MTEA 3G71I 4XR6A 2JJ7A 1P2FA 3BZCA 3JTHA 3LQQA 2YU3A 2WB1N 4MHGA 2JRMA 1IXSB 2LY2A 4DYCA 3ULQB 1FYKA 1MMNA 4LG0B 3HOTA 4KIGA 2PJRA 1GLNA 3A0BC 3K7AJ 4HPQA 5FLXK 5HLIA 5L3GA 1LUJB 4CYCA 3HUGB 5EDNA 3G3ZA 3GUDA 4G12A 3AG1H 2MC3A 4PJJA 2DFEA 4ZC3A 1CGPA 2P5KA 4JYKA 4IQ4A 4XLAA 4C9YA 1WFXA 3GFJA 3LSRA 3QOEA 3ZP5A 3IC7A 2HPIA 3MKWB 2IA0A 3LSPA 2PI0A 3DPTA 2EQRA 5ILUA 4PUSA 3AFHA 4L9JA 4G94A 5FLMJ 2JPCA 1M1EB 2KRCA 3E0JB 3T8RA 2LBFA 3HOYJ 3M9AA 4AWXB 4M3FA 3GFIA 2VPLA 4BJ5C 3BCBA 4I2OA 3TL4X 3R6SA 1XDSA 4W97A 1X19A 3RPQA 1MBKA 2W48A 4JQFA 4AIHA 5JR3A 4I01A 1JUSA 1NG6A 4EMSA 1B8IB 3CTAA 3MVPA 3GTMJ 2JA2A 1PUEE 2ZMEA 5EEHA 3O2PE 4DBQA 2IRFG 3M8FA 2YX4A 1ZRFA 1I3AA 1S7EA 1LKXA 3EQLF
chains in the Genus database with same CATH topology
4RLFA 4ANJA 2KQRA 2OV7A 2CV2A 1V5GA 4BE1A 2F5VA 4OAYA 3MD2A 3OYFA 2R7TA 2E60A 2HU9A 2M4GA 3EUAA 4D1QA 1D0ZA 4PFOA 3PJRA 4IQJA 2XDVA 3F9KA 3PSIA 3RCOA 4P5OA 4CCKA 4FETA 3SZGA 4HNUA 2K9LA 2A6TA 2XF6A 2VKHA 3OYDA 4D9JA 3IAS2 1P9QC 4XLEA 4AVZA 4Y3OA 2X6YA 3HXLA 4XORA 3K4BA 2VQCA 3K70C 4QPQA 1VZ0A 2ZSHB 3OR2C 4Y33A 4RM2A 3I9V2 1X1CA 1MW7A 2ZSIB 2KL4A 4LIUA 4LIVA 2VXZA 4HSRA 2Z1DA 2VQLA 3OYKA 2IS1A 3K4KA 3H5AA 2VQGA 5HNFA 4PK4A 4XLCA 2IS4A 1DP3A 4AYBA 1FMVA 1PYVA 3OS0A 3OYLA 2VJIA 3LSKA 2VJ4A 2IGOA 3OL3A 4F92B 3BCAA 3VSLA 4RLQA 3ZRGA 3QODA 2W1OA 5HOOA 5LD2C 4ITVA 4GRIA 3OIQA 2QKMB 2VB6A 3K4LA 3UNGC 1BOBA 2V4JC 2XF7A 2CFOA 2R7QA 3C2GA 1WJCA 1LDKB 4XLFA 1FMWA 4E7JA 3OL4A 3BC8A 3QYEA 3OYAA 2XC7A 4LITA 1W36D 1HA8A 1N77A 4LG3A 4YEJA 2RNGA 3AL0B 2DJIA 2WA0A 2AQEA 3OOUA 1T0FC 2ZFUA 4XKWA 1JI8A 2RREA 5KNLA 2WY8Q 1Z3YA 2MC4A 3L2UA 1QHHD 3M8JA 3OYBA 3HPHA 3ZCOA 2QKLB 4XLHA 2IGKA 4DOZA 5KHDA 1N78A 2E1MC 4F93B 2M7AA 4E7KA 3NWTA 2R7OA 3K4CA 4AU7A 3RQ4A 1QU3A 2X6WA 4XOPA 3HC7A 3U21A 2IGMA 2K5CA 2CW8A 1X1DA 3DTKA 1TZLA 2GOXB 3ZR8X 3S93A 1UG0A 3PL8A 4YRVA 2W7NA 2VJ5A 4C2UA 2LG4A 2Q1ZB 1X1BA 3VDXA 3S8PA 2PJRB 3PUBA 2XF5A 2Q2EB 3DU5A 5CQEA 3KX2A 2CV1A 1BR1A 1LVKA 3M1CA 2Y0SA 3H9GA 3OYEA 2WAQA 3H5NA 4BDZA 3ZQQA 5CKTA 4HG2A 1DQUA 2CV0A 4BL0B 2JSPA 1Z3XA 4OAZA 3RSNA 3VWBA 3QYFA 4CA0A 3K4NA 4BUPA 2L5QA 1WJFA 3H5RA 2E5NA 3PNTA 3H35A 4BEHA 4HRIA 3EUKL 2GOMA 3K4JA 3A4CA 2M7BA 3HOSA 1V5FA 4DGWB 2E5ZA 3MMYB 4NQWB 1Y56A 3HL2A 3DPLC 3VSKA 2VXDA 2L7KA 1KONA 2V26A 4QPOA 3ONQA 4R79A 5HVQC 3LFUA 2LBFB 4XNFA 4CCMA 2R7VA 1BR4A 2BVMA 3OS1A 4U7BA 3DWLE 3H9JA 2MFZA 3HPGA 4YELA 3KEYA 1WJDA 5LFAA 1MNEA 4IZZA 3SDBA 2HPMA 4CCJA 3J7AY 1AA7A 1X1AA 3FBIB 4E4HA 1MMGA 3CJRB 2HQAA 3SEZA 3DU6A 2DOAA 3S3MA 4E7HA 3VYRB 4BQNA 4CH7A 2K9MA 2HVQA 3W2VA 4KT6A 3QYBA 3KYLA 4CUGA 2VL8A 4E6KG 4B47A 2M0MA 2IGNA 3K4MA 4E7SA 4F52A 4BQOA 4B44A 4JOMA 3ZGKA 3H9QA 3EPZA 3LSHA 4CCLA 4J00A 1WJAA 4PSWA 1NG7A 1J09A 2LYCA 3BG6A 2VQHA 3CJQB 2HNHA 3OMYA 4E7LA 4CZCA 2KMUA 4XQFA 4BGDA 4XN3A 2W00A 1MNDA 1OR7C 4J01A 2IS2A 2W4SA 4ZTFA 2NOJB 2I8DA 2L2OA 1MMAA 3N05A 3S32A 2UV1A 2JVGA 3E1SA 3L2VA 2MABA 2X1CA 2BVLA 3G2BA 4XL9A 4DIQA 2JUGA 3K70D 2UUZA 2V9KA 1TT0A 3DKXA 3RTRA 4IX7A 3DTIA 2BW3A 3PNYA 3OYNA 2HVRA 4KISA 5HLTA 4E7IA 1UELB 4NNJA 3I3LA 3UR3C 3OYHA 2L9NA 1D1BA 5HNHA 2JVHA 5TGTA 4F55A 4HNTA 4P1WA 3V42A 4PJMA 1DGWY 3LSMA 3CF2A 4U87A 1K6YA 3RPUD 2K3PA 4KJZA 3FDYA 1YX3A 3PSFA 4PJLA 4C30A 5CPRB 1SAUA 1E0EA 1S9HA 2F4IA 2WB1A 3VYTB 4X0GA 2X1DA 2M3AA 4KITB 4BACA 5FRMA 3PFYA 3S3NA 3IP4B 2O5RA 4NUBA 3MKYB 4HEA2 3DQVC 2IS6A 4BXFA 2VIXA 3FHNA 2X1EA 2E1MB 1YX5A 1G8XA 2ELJA 2IXSA 3W2AA 3HG9A 2LRDA 2KRHA 3IAM2 3W3CA 4ZYAA 2RQQA 2R4GA 2LH9A 2KHMA 3DLAA 3OYIA 4IKFA 2VASA 2XSJC 2DT6A 2AQFA 1SFKA 3D5RC 1N75A 5FROA 2R7WA 2KDOA 3D5LA 3OYMA 1OLTA 4MLOA 3DPUA 1DGRM 1MMDA 2BW3B 1D1CA 3CP2A 2V6EA 3AKZA 2CH0A 1X4OA 2Z2SB 1W36C 3OYCA 4C2TA 3OYGA 1WJBA 2WAEA 1IRXA 3BLYA 1PJRA 1ERDA 1D0YA 4E7ZA 2V1NA 2F6CA 2VKDA 2LOOA 1Z21A 2CS3A 3W2WA 3L2WA 1D0XA 2KPMA 3GBGA 2DXIA 1WJEA 5FRNA 1X4PA 4ZDLA 4G6TB 1EA3A 3HKZA 3L2RA 2P0WA 1ZELA 3LL7A 4BS9A 4N4NB 4BE2A 4RMNA 2MYSA 3SYTA 2HDWA 3CP8A 3CMMA 2WY7Q 4ZDOA 2DCEA 2FUG2 4NC8A 2W82A 4II3A 3TBIA 2M4KA 4BQQA 1YE9A 2UWMA 3TMOA 2HVSA 3VYSB 1U0JA 2ZXHA 2WAFA 2WBMA 2R7SA 3AL0C 4CSWA 2R7RA 2VJJA 3NWSA 2R7UA 1QHGA 4B43A 2ZXIA 4XN0A 4BEHB 4DBRA 2X85A 2OUMA 3DTEA 2LC2A 4H4KC 1UAAA 3DKYA 4BDYA 3BG7A 4XMYA 3ZXSA 4II2A 2XAUA 2X6XA 4XR6A 3OR1C 2R7XA 3CESA 2WADA 3K6GA 3PNVA 3L2QA 3C2HA 2LY2A 4XKCA 5KCMA 3SEQA 1MMNA 3H0DA 4NC7A 3HOTA 2PJRA 3LSGA 4F91B 1GLNA 3MKZA 4HPQA 2KP6A 1Y6IA 4B48A 4ZJZA 3HUGB 2VLAA 4CCOA 1D1AA 2V7FA 3LSIA 2A5WA 1G59A 4PJJA 3K10A 1BR2A 3D5SC 4ZC3A 4BJTA 2MD0A 4XOTA 1Z7LA 2X51A 4XM3A 2OC6A 4PFPA 2BOLA 3OWTA 2LREA 2DT7B 4BE0A 4IQ4A 2CMPA 4XLAA 1WFXA 4C9YA 4CCNA 3QOEA 4DJAA 2HPIA 3MKWB 3DPTA 3IUOA 4RM3A 3CZ6A 4PUSA 3AFHA 3FBNB 4PSXA 2Z16A 2L9SA 2LY1A 3VYUB 4XONA 3A1YA 2HZDA 4OWRB 2KRCA 3E0JB 2LBFA 3DEEA 2CUZA 5CQGA 3OYJA 1R6RA 2PMZA 1LFPA 4XKVA 2CW7A 4N4OB 2VPLA 4BJ5C 1WJ5A 3OIPA 4EATA 3BCBA 4HSTA 3TL4X 4Y4RA 4PJNA 3OY9A 4ZTJA 1X19A 4JQFA 2KLOA 4B3XA 4BJ6C 3OS2A 1NG6A 2CUJA 3FKJA 4F3QA 2KZVA 2JA2A 5JHFA 4DBQA 3EUHC 4ZDPA 3S3OA 4BU2A 3A2KA 1V5EA 3LMMA 1T95A 4XKBA 4FASD 1LKXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CMP A;  3ZQQ A;  4ZC3 A; 
#chains in the Genus database with same CATH topology
 4ANJ A;  3KLO A;  1V5G A;  2R5Z A;  1J59 A;  5IP9 J;  5DYM A;  3MD2 A;  3HB9 A;  1FBS A;  2BZT A;  4A12 A;  3CCY A;  1VQ8 I;  2E60 A;  3BG5 A;  3EUA A;  5FO5 A;  2DU9 A;  2DPD A;  3NRV A;  2ZME C;  2XB5 A;  3ZMT A;  1TL8 A;  1SAX A;  5GP9 A;  1FTT A;  4WCG A;  3GTP J;  4HOB A;  1H88 C;  1H0M A;  1YLF A;  2XF6 A;  4U0Y A;  3BPV A;  4JBA A;  4E70 A;  1K4T A;  2FU4 A;  3I54 A;  4Y3O A;  1XGO A;  1REP C;  1O57 A;  3RPU A;  4XOR A;  3WU2 C;  2VQC A;  3K70 C;  3ASO H;  2ZSH B;  1BW6 A;  3I9V 2;  1YJN I;  3T1B A;  1QPM A;  1ETY A;  3TDZ C;  2JA5 J;  2ZSI B;  4BXU A;  2KL4 A;  3WTY C;  1TBX A;  2VXZ A;  3ROU A;  1FOW A;  3MWM A;  4UB6 C;  2ME0 A;  3A01 B;  3KYC B;  1FP2 A;  1RNL A;  3K4K A;  3H5A A;  2E36 A;  5HNF A;  3IWF A;  5HDN A;  5FFX A;  3IL2 A;  3OYL A;  4GYG A;  1R1U A;  4FQG A;  1VTN C;  2VJI A;  5FKK A;  2VJ4 A;  3TP3 A;  4U7D A;  3OL3 A;  2KT0 A;  1HW2 A;  1WI3 A;  4R8H A;  2PJP A;  3VFZ A;  1Y39 A;  2KFD A;  3VSL A;  5IP6 A;  3CMY A;  3I53 A;  2M34 A;  2Z9O A;  2A69 F;  3OIQ A;  5A2Q K;  4A3F J;  2QKM B;  1XCV A;  2VOO A;  3I64 A;  3KP5 A;  1BOB A;  2CFO A;  3Q0V A;  3IKT A;  5GAE J;  2EIL H;  3V8L A;  3RQI A;  4PZJ A;  3BC8 A;  1W4M A;  1YIJ I;  3B6C A;  4LIT A;  3CME I;  2ZO4 A;  1UHM A;  1XMX A;  2EBI A;  2MGQ A;  4IEJ A;  1ZR4 A;  5IOY A;  1B6A A;  3DXJ F;  1FWZ A;  2DJI A;  2AXL A;  3BQY A;  3KP7 A;  2BV6 A;  2LKX A;  1BJZ A;  1V3F A;  1Q1H A;  2LFB A;  5KNL A;  2WY8 Q;  5L3D A;  3T8T A;  1R5H A;  4A3L J;  3HOZ J;  2A07 F;  1JT0 A;  3WU0 A;  1VND A;  3JRH A;  1BI0 A;  2IGK A;  4EM1 A;  1F36 A;  3J80 Z;  4BH9 A;  2E1C A;  2E1M C;  1MBF A;  3HIF A;  1QZZ A;  4E7K A;  3RQ4 A;  5JHU A;  1B72 B;  3FF5 A;  4XOP A;  2XHK A;  3BG9 A;  3A02 A;  1O3S A;  2XPU A;  4XRS A;  4ENN A;  3U21 A;  3GX4 X;  2ZJP F;  2NVT J;  3KP4 A;  4A0Y A;  3DTK A;  1PUF B;  1QNT A;  1QRY A;  2A05 A;  2YS9 A;  5D5W B;  2GOX B;  2Y9Y A;  4IO9 F;  4S0H B;  3ZR8 X;  3S93 A;  2H27 A;  4RGR A;  3S14 J;  1ETV A;  1ETQ A;  2M5W A;  2RC4 A;  5L3B A;  2W7N A;  3RZO J;  4CIC A;  1YIO A;  1RES A;  3NEU A;  3RI4 A;  3PIO F;  4ESJ A;  5CQE A;  4L0Y B;  5CVI A;  1TT5 B;  3C18 A;  1BR1 A;  2LF8 A;  1KYZ A;  4IHT A;  3L09 A;  1Q1V A;  4G6Q A;  2STT A;  2CQQ A;  4HG2 A;  3I4N J;  1DQU A;  5L3F A;  2CV0 A;  2D1V A;  2R7F A;  1CQT A;  4IHX A;  4MIM A;  2E35 A;  1Y8R B;  3VWB A;  2BGC A;  2ZXW H;  3FZV A;  2L5Q A;  1Z67 A;  4HRI A;  1GT0 C;  3EUK L;  3DLL F;  3K4J A;  3A4C A;  3HOW J;  2EFP A;  3QPS A;  4DGW B;  2RQP A;  1ZRE A;  2FXA A;  3UKG A;  4O3M A;  5F27 A;  3VSK A;  2DMT A;  1G3Y A;  3L7W A;  1MDM A;  2EIN H;  2RNJ A;  2VE9 A;  4YG2 F;  3CUQ B;  3S15 J;  1BR4 A;  4U7B A;  4A6D A;  3EYI A;  3FIW A;  2A5Y B;  3ZQ7 A;  2IA1 A;  1WJD A;  4GGG A;  1K61 A;  2VKE A;  2YR2 A;  2OU2 A;  1R5G A;  2Z3Y A;  1FJL A;  2OF7 A;  1USS A;  3I5U A;  5ICG A;  3F8M A;  3FBI B;  2Z99 A;  2DO7 A;  1J5Y A;  1MMG A;  1VQM I;  4BHP A;  1S7O A;  5H20 A;  4RBO A;  3QPL A;  1U5T C;  3LFK A;  3VB2 A;  4CDG A;  5EG0 A;  2HOT A;  1ENH A;  1VI0 A;  3HRS A;  2XGX A;  2NVY J;  4PCQ A;  3W2V A;  4DYQ A;  1RKW A;  2J5O A;  4KT6 A;  3FXL A;  4EM2 A;  2EZL A;  2VL8 A;  3F72 A;  2K4J A;  3ECH A;  3K4M A;  2M8E A;  2ZJR F;  4O5V A;  3CDH A;  1YS7 A;  1U8B A;  4B44 A;  1AKH B;  2IVM A;  2WV0 A;  1XSX A;  1ZAR A;  5HS9 A;  3CCR I;  1WSU A;  4CCL A;  2BY0 A;  5E79 C;  1WJA A;  2IJL A;  1JT6 A;  2VQH A;  3JW4 A;  2PBI A;  1BIB A;  1HST A;  3CJQ B;  2V1X A;  2ZNZ A;  2HNH A;  5FGM A;  1UST A;  3U1D A;  4ZZD A;  4EV0 A;  2RN7 A;  2JN6 A;  3BQZ A;  4S05 A;  3P7N A;  3DP7 A;  4UV9 A;  2A68 F;  2R5Y B;  4H0E A;  1GV2 A;  4AIK A;  1QQI A;  2L02 A;  2XV4 S;  2YUS A;  2H6B A;  4L9V A;  1MBJ A;  1BOA A;  2IAI A;  2JT1 A;  4A0Z A;  2O3F A;  2V1U A;  2JVG A;  3E1S A;  2QM3 A;  2MAB A;  5J8F A;  3L2V A;  4A5N A;  2BVL A;  4EM0 B;  3KCC A;  3QRF F;  1SD4 A;  3K70 D;  2FBK A;  3DKX A;  1G2H A;  2Y9Z A;  2HVR A;  3PNY A;  4NB5 A;  3OYN A;  2VPR A;  4HV6 A;  4EJT A;  2HQR A;  4E7I A;  1HDP A;  2PQ8 A;  1RET A;  1APL C;  3ZQL A;  1B4A A;  2RDP A;  2LVS A;  1D1B A;  5HNH A;  2DJN A;  4F55 A;  1PDN C;  4OMY A;  3R0J A;  1QVU A;  3MFK A;  4YII A;  4PJM A;  3LSM A;  3RPU D;  1XB4 A;  2EFN A;  1ZG5 A;  3FWE A;  4OMZ A;  1YX3 A;  3ZN1 A;  5JLW A;  3O3K A;  5E3M A;  4C30 A;  1IO2 A;  2DBB A;  3P9K A;  1E0E A;  5C4J J;  4X0G A;  2X1D A;  4UVB A;  3A03 A;  1VQK I;  1P7I A;  2O5R A;  4A3E J;  5B3S H;  2VT2 A;  5FKM A;  3TKY A;  1NHA A;  4BXF A;  1UCR A;  2DDA A;  4LGW A;  2ELJ A;  3W2A A;  4U88 A;  3H1C A;  3K2Z A;  1K83 J;  1HW5 A;  2CFX A;  3HYI A;  3TP0 A;  2WC2 A;  3HOU J;  2L7M P;  4QIW N;  3R61 A;  2BY1 A;  2F5E A;  1U6G A;  5J4V A;  4PGG A;  2LH9 A;  5LHI A;  1ZGW A;  2LTP A;  5D5X B;  1H8A C;  1T56 A;  1N75 A;  3QAH A;  4Z2Y A;  1R9T J;  3OYM A;  2CG4 A;  2UXN A;  3GO5 A;  3W6K B;  5J1Y A;  2HOS A;  5E3O A;  2Z2S B;  5DD4 A;  2KRF A;  2DK5 A;  3I4P A;  1A6I A;  2QA4 I;  3JRB A;  2VKD A;  2DI3 A;  2JTV A;  2K27 A;  2DA6 A;  4AID A;  5ED4 A;  2GBY A;  3WG7 H;  4ZDL A;  1T08 B;  3HKZ A;  3RJP A;  2ECB A;  1Z0X A;  4N0B A;  5EF6 A;  3L2R A;  3EYY A;  3GTJ J;  1QA6 A;  1O7F A;  4IHV A;  3B73 A;  4I76 A;  1W5S A;  4P9F A;  4AIJ A;  4ZH4 F;  5GAD J;  2JPB A;  5AIP A;  1WRJ A;  4BQA A;  1UFM A;  1SEU A;  4NC8 A;  5M5Y J;  3BY6 A;  2M30 A;  5LEJ A;  3TBI A;  3HBL A;  4MEX F;  5CLS A;  2FOK A;  4BYY A;  1H9G A;  5EJC A;  3TMO A;  1WWX A;  2P6S A;  2WBM A;  3C7J A;  1RKT A;  1JGS A;  4B43 A;  5ILV A;  2DA5 A;  4BEH B;  4DBR A;  4HDU A;  1BN5 A;  2F48 A;  1VQ6 I;  2CQX A;  4I09 A;  2XIG A;  5ERI A;  5CVU A;  2KIF A;  3S2D J;  3BG7 A;  3JSO A;  1QZY A;  2XAU A;  5IP7 J;  4A3G J;  2ICW G;  1Z9C A;  3H92 A;  3CES A;  4HA8 A;  3Q0W A;  2WAD A;  3ELK A;  2PG4 A;  5F64 A;  3L2Q A;  1IUF A;  4XKC A;  3JRC A;  5KCM A;  3SEQ A;  1FSH A;  2BHY A;  2L01 A;  3LSG A;  4F91 B;  1Z91 A;  3MKZ A;  4HQE A;  3TQN A;  2DMP A;  2CWE A;  1FSE A;  3Q0U A;  2L9V A;  1TQP A;  3FXJ A;  2FSW A;  2A5W A;  3CCE I;  3FXR A;  1FBQ A;  3KLN A;  3IH3 A;  4B4C A;  2V9P A;  1WZ2 A;  3D5S C;  1OKR A;  2KIU A;  5E1W A;  2MD0 A;  4XOT A;  3HGY A;  4BJT A;  2ZFW A;  1GDT A;  3G1L A;  2HZT A;  1F5T A;  2DT7 B;  2R93 J;  4CCN A;  2M2E A;  4DQ2 A;  4ETS A;  3TO6 A;  3DBR B;  4RM3 A;  3RDI A;  2K4B A;  1YHQ I;  2G7H A;  2B0L A;  5E8I A;  2QEX I;  3VYU B;  3A1Y A;  1JUM A;  4OWR B;  5FFZ A;  3ABU A;  2RAE A;  5KK1 A;  2IP2 A;  1K7A A;  3ZPL A;  2X0L A;  2DN0 A;  1X3Z B;  1WGX A;  4RB0 A;  3OYJ A;  1LFP A;  4BKX A;  2CW7 A;  1FBU A;  5IT9 K;  3OIP A;  3G1M A;  3HEF A;  4WXC A;  4PJN A;  4Y4R A;  3ZN0 A;  4G9Y A;  3PO2 J;  4BJ6 C;  3C1D A;  1BBY A;  1OCR H;  4F3Q A;  3ASN H;  4M71 A;  4CZZ A;  4FTH A;  4I6Z A;  2ACJ A;  3S1M J;  5JHF A;  2X9D A;  4C3J J;  3WG9 A;  2IA2 A;  2MBF A;  3LSJ A;  2OZ6 A;  4DW6 A;  1IN4 A;  4BU2 A;  4DYR A;  1VF9 A;  4CYC B;  1SVO A;  1V5E A;  1QVT A;  3LMM A;  1T95 A;  4XKB A;  3HTU A;  2CV2 A;  2KQR A;  1E3H A;  5FLV A;  4Y52 J;  1RIO H;  1JKO C;  2P7C B;  1R1V A;  1T98 A;  1X58 A;  1IRZ A;  3HHH A;  2NS7 A;  4OIP F;  2DAO A;  5IY5 H;  2K86 A;  2XDV A;  5GAG J;  1YI2 I;  4P5O A;  4QTR A;  4CCK A;  1FYL A;  2HOE A;  5FKN A;  4HNU A;  2A6T A;  5B66 C;  1G3W A;  3MZH A;  2VBZ A;  4B1R A;  4XLE A;  3F22 A;  4AVZ A;  4MGR A;  5KVR A;  5DDG A;  2ESH A;  3K4B A;  4O6J A;  4Y33 A;  3CJN A;  1QBJ A;  3FX3 A;  4HQM A;  4NBQ A;  4LIV A;  3E97 A;  4WXD A;  2Z1D A;  1XSD A;  2L54 A;  2CW0 F;  2ID6 A;  1I3Q J;  1FT9 A;  3IH2 A;  4TV7 A;  2NAZ A;  3KE2 A;  3RYP A;  3OYK A;  2IS1 A;  2EIM H;  3CF5 F;  5B5E C;  4PK4 A;  2IS4 A;  4WXH A;  4AYB A;  1FMV A;  1PYV A;  4QLC U;  1IDY A;  3LST A;  3LSK A;  1O3Q A;  2IGO A;  2QEN A;  2E34 A;  1ZG1 A;  2D5V A;  1GUU A;  4EGZ A;  3V8K A;  2XRL A;  1NH3 A;  5ICF A;  4RLQ A;  3JRF A;  1IRF A;  3QOD A;  3ZRG A;  2LLK A;  4RGS A;  1LEB A;  3IKV A;  5LD2 C;  1T0F A;  4BXX J;  4A3J J;  2PMZ N;  4RB3 C;  2HOA A;  1BI1 A;  2F4M B;  3C2G A;  3MAJ A;  2KIS A;  1BI3 A;  1FMW A;  3TW7 A;  1R71 A;  5D5V B;  3IRR A;  4CYD A;  1HC8 A;  4ENJ A;  5GAH J;  4FT8 A;  4R1H A;  4ENK A;  4RB1 A;  1SFE A;  3ESW B;  4I99 C;  2DA2 A;  3WTV C;  2GWR A;  2JUC A;  3AL0 B;  4M72 A;  1VQO I;  1N25 A;  4HLX A;  1ZAO A;  4BY1 J;  1T0F C;  4KA4 A;  4I98 B;  1MBG A;  2XRO A;  3GTL J;  2RRE A;  9ANT A;  3S1R J;  3L2U A;  1R00 A;  2R7Z J;  2WV1 A;  3OYB A;  1U8R A;  1QZE A;  4KN4 X;  2BE5 F;  1R22 A;  2QKL B;  4XLH A;  4DOZ A;  2E1O A;  1RZ4 A;  2QF7 A;  2R7D A;  1N78 A;  4F93 B;  3CO6 C;  2M7A A;  4A3K J;  1OMI A;  2NRA C;  1JHH A;  3HHG A;  1DUX C;  2XAH A;  3GEZ A;  2X6W A;  1TWG J;  1D3Y A;  3JRI A;  5J3L A;  4DZJ A;  4L18 B;  1X1D A;  2I10 A;  3V8J A;  1T39 A;  2LR8 A;  1SVL A;  5GTH C;  2DDB A;  4A3C J;  1ZK8 A;  4N9I A;  5DCM B;  5D5U B;  1UG0 A;  1LDD A;  4YRV A;  3ABL H;  3O8G A;  3WHB A;  4M3E A;  4KIF A;  4C2U A;  1VFC A;  2EA2 A;  4ESF A;  4D7M A;  2HEO A;  1XGN A;  5LGN A;  2Q2E B;  1ZKG A;  1W1W E;  2VOP A;  1P4A A;  3H9G A;  1YJ9 I;  5JVG F;  2WAQ A;  3FK6 A;  3ZQQ A;  4A0X A;  5CKT A;  2XVC A;  1FZP B;  3HTS B;  4KIB A;  3PIP F;  3BR2 A;  3DF8 A;  3PQJ A;  3CC2 I;  5D8K B;  1CF7 B;  1FOK A;  1HW1 A;  1Z3X A;  3RSN A;  2M0C A;  1IC8 A;  4BUP A;  1YQA A;  4WK8 F;  4P96 A;  2E5N A;  3PNT A;  3H35 A;  3S2W A;  3GTO J;  1ETK A;  4L5J A;  3Q9S A;  2M7B A;  3HOS A;  2JRT A;  1LVA A;  2E5Z A;  3D0S A;  3DV8 A;  4NQW B;  3HL2 A;  5M3F J;  3DPL C;  2LK2 A;  2MSY A;  2RKH A;  2L7K A;  5FKL A;  3ONQ A;  3F21 A;  4WF2 A;  1ZR2 A;  4A3M J;  5HVQ C;  3FXM A;  1YJW I;  4XNF A;  4YIR X;  1YRN B;  4CCM A;  2BVM A;  4LG0 A;  1G4D A;  5J8C A;  2WWY A;  1NK2 P;  2MFZ A;  1XS9 A;  3HPG A;  3OSG A;  2DW4 A;  3WU1 B;  3SDB A;  4G7Z F;  3QP5 A;  3LQR A;  3HUG A;  3FM3 A;  3J7A Y;  3J81 Z;  3DU6 A;  5D6E A;  2DA4 A;  3ZQH A;  1JHF A;  4E7H A;  2Q0O A;  1FEX A;  2QQB A;  4M9S A;  3VYR B;  1HKT A;  2K9M A;  5IOZ A;  1R49 A;  2HVQ A;  2LSO A;  1ON1 A;  3QYB A;  5IYB J;  3KYL A;  2XPW A;  1I6H J;  4B47 A;  4LFU A;  2ELH A;  4EVI A;  1BL0 A;  2W57 A;  4AD9 A;  3V7S A;  4HF2 A;  4JOM A;  1V54 H;  3J7A O;  3ZGK A;  2M9H A;  3BDD A;  2E1N A;  1NTC A;  3LSH A;  3GTQ J;  4I02 A;  2ECC A;  4OIN F;  3DEU A;  3F8F A;  1I50 J;  3OMY A;  2W85 A;  4CZC A;  2CSO A;  3KEO A;  4Y15 A;  4BGD A;  2Y31 A;  1WH5 A;  2DYR H;  3C2B A;  4Z6Y A;  1ZH5 A;  1Z6R A;  2W00 A;  1OR7 C;  1EH7 A;  4OIR F;  2HWV A;  1B8I A;  2Y0S N;  4RS8 A;  3BR1 A;  1SFU A;  1ZLJ A;  2UV1 A;  4MQV A;  1HKS A;  3WTU C;  2KKO A;  1TNS A;  2MD5 A;  3I71 A;  4D5C A;  4KMU X;  3G2B A;  4DIQ A;  2XGD A;  2JUG A;  2UUZ A;  4EJO A;  1MD0 A;  2LY9 A;  3E6C C;  3QOP A;  3DTI A;  4KIS A;  3IV5 A;  1MJ9 A;  4AUX A;  2BBY A;  2GLO A;  3UR3 C;  2HXO A;  4KDP A;  1Y8Q B;  3OV8 A;  2I5U A;  5HLH A;  3I0T A;  5E17 F;  1JJ6 C;  1P4W A;  1L0O C;  3H3Z A;  3I59 B;  4LB6 B;  2O8K A;  3MQ0 A;  5F1R A;  3R0A A;  4HNT A;  4WX9 A;  1GXP A;  3V42 A;  1TQI A;  4XRM A;  1SMY F;  2QWW A;  1A04 A;  1QO0 D;  3E5Q A;  3CF2 A;  4ON0 A;  4U87 A;  3JAM Z;  1K6Y A;  2K3P A;  3HSF A;  3FIS A;  3FDY A;  4HDV A;  1WPK A;  3ABK H;  4BY7 J;  1SAU A;  3LWF A;  1S9H A;  2WB1 A;  1BIA A;  1YW7 A;  1TWA J;  2M8G X;  2VC0 A;  4C3I J;  1A6Q A;  3S3N A;  2FQ4 A;  3MKY B;  4ESB A;  2FBI A;  2L9R A;  3F3X A;  4RAY A;  1KU9 A;  2ID3 A;  2X1E A;  2DOE A;  2IXS A;  5D4R A;  1FIP A;  3QU6 A;  3HG9 A;  3A01 A;  2LRD A;  4XLN F;  1A35 A;  4XLP F;  1W7P B;  4DNC A;  4A5M A;  4ZYA A;  5K5O A;  4JK1 X;  1JJ8 C;  2RQQ A;  2R4G A;  3AG2 H;  5E1Z B;  4RDU A;  1IXC A;  2W84 A;  2ZJQ F;  3N97 A;  5K7F A;  1UG2 A;  1XD7 A;  4G8X A;  5DV5 A;  2XSJ C;  4OOI A;  1KU3 A;  2F5D A;  5FRO A;  4KUM A;  5BS6 A;  2R7W A;  1A31 A;  1OLT A;  3DPU A;  2EFW A;  2EK5 A;  1DGR M;  5H2F C;  1MJA A;  3KYD B;  4KT5 C;  4BHB A;  3CP2 A;  2FF4 A;  1IGN A;  4Y17 A;  1U5T A;  1W36 C;  1X4O A;  3P5J A;  3OYC A;  4C2T A;  2O03 A;  1PJR A;  4UUS B;  3L9F A;  2CO5 A;  2V1N A;  3GCM A;  1TLH B;  2F6C A;  3BZK A;  3AAF A;  4ASN A;  2DOF A;  1Z21 A;  5F0C A;  3CC7 I;  3GBG A;  5FRN A;  5FLX Z;  1ETX A;  1EA3 A;  1FIA A;  5DD8 A;  3F8C A;  1DU6 A;  3FM5 A;  3B6A A;  2GXA A;  3LAJ A;  4RMN A;  2MYS A;  1XPX A;  3P9I A;  2HDW A;  3CP8 A;  2YPR A;  1RRJ A;  3AG3 H;  3SJM A;  2W82 A;  5DCF A;  3SFI A;  4BQQ A;  1U3E M;  1TW3 A;  2XAG A;  2L4M A;  2ME6 A;  2P6T A;  3BP8 A;  1SFX A;  1U0J A;  2ZXH A;  2WAF A;  1HOM A;  4CSW A;  4IPA A;  1LPQ A;  1B72 A;  2R7U A;  3G73 A;  2ZXI A;  2LC2 A;  1XN7 A;  5FD6 A;  4ZYH A;  1PUF A;  5F6F A;  2PN6 A;  1K79 A;  2COM A;  4XMY A;  2E71 A;  4II2 A;  5L3E A;  1VQ4 I;  1IV8 A;  2X6X A;  3OR1 C;  5BPD A;  1XG1 A;  4JP0 A;  1W5T A;  3K6G A;  3PNV A;  3QWL A;  4A3D J;  2MH2 A;  4LB5 A;  4AC0 A;  4NC7 A;  4BHC A;  5JFR A;  1VQP I;  1YYV A;  1W0T A;  4UB8 C;  3KP3 A;  2KP6 A;  1BM9 A;  1JKP C;  1SAN A;  1Y6I A;  4B48 A;  1JKR C;  3WE2 A;  3WTZ A;  2GXG A;  2RVC A;  3R4K A;  3BR3 A;  1P92 A;  5DM7 F;  4MTD A;  4M6Y A;  4CCO A;  2VLA A;  2D45 A;  1D1A A;  1KQ9 A;  4S04 A;  1UHS A;  2VUM J;  2IW5 A;  1FOX A;  1J9I A;  2DA7 A;  1XC5 A;  3RKY A;  2OTJ I;  1XGS A;  4B09 A;  2VBY A;  4UV8 A;  5EGO B;  4XM3 A;  1Z7L A;  3JTG A;  3K2A A;  2OC6 A;  1H9T A;  3OWT A;  4L9N A;  2B7E A;  1XTA A;  5JI6 A;  2QBY B;  2A61 A;  3Q9V A;  3IUO A;  1ZGJ A;  5H6R A;  1D8K A;  2JK3 A;  4IRI A;  3W6V A;  1WCM J;  3KP2 A;  1MSE C;  4PSX A;  4V2F A;  2L9S A;  4BAY A;  2K9N A;  4ZYE A;  1K78 B;  2F5F A;  2RV8 A;  4L5I A;  2HZD A;  1FP1 D;  3BR0 A;  3JCU C;  3DEE A;  3CUQ A;  4U0V A;  2CUZ A;  5CQG A;  4CO8 A;  1Z6T A;  2K9Q A;  4XKV A;  2J5P A;  1WJ5 A;  4EAT A;  1ODD A;  2O6G E;  1R1T A;  3OY9 A;  3CJT B;  5KAF C;  3RKQ A;  4XSX F;  2D2W A;  2JMW A;  3LOC A;  2CUJ A;  3FKJ A;  2E2I J;  3ZQF A;  1E17 A;  3VPR A;  3DKW A;  2FBH A;  4I0B A;  4LK1 F;  3CUQ C;  1DPU A;  3A0H C;  4ZDP A;  2ELK A;  2LD5 A;  3H3V K;  5TIS C;  2EFQ A;  4FAS D;  5HLT A;  2OTL I;  4RLF A;  1R58 A;  3NAR A;  1AKH A;  3S16 J;  2QQ8 A;  2COB A;  3RKX A;  1ZYR F;  3HOV J;  1BC7 C;  5CVR A;  2KJB A;  4GCV A;  2P81 A;  5A2Q Z;  1R23 A;  3PJR A;  2L3D A;  4IQJ A;  4IOA F;  1Z05 A;  3H36 A;  1EF4 A;  1PP8 F;  1IN8 A;  4IRG A;  5HDK A;  2K9L A;  1PP7 U;  3OYD A;  1XDU A;  4FHT A;  2LKS A;  3PUF A;  3ZQI A;  3IAS 2;  4RGU A;  4MQ9 F;  4EJU A;  2HTS A;  2VT3 A;  4HX4 A;  1MIJ A;  4RB2 C;  2X6Y A;  3IRQ A;  2JSC A;  4F7Z A;  2R5Y A;  3JSP A;  1O4X A;  4IJA A;  1VZ0 A;  2EZH A;  1ZG3 A;  3OR2 C;  2BXZ A;  4RM2 A;  2NVX J;  1HCR A;  2EZI A;  5GPC A;  5HS7 A;  4GO1 A;  1X1C A;  2HTJ A;  2E2J J;  1T8I A;  4LIU A;  2ZBK A;  3KIO A;  3KP6 A;  4HSR A;  2XUB A;  5FJ8 J;  3TO7 A;  2O9L A;  2LP0 A;  2XAQ A;  1SMT A;  5LGU A;  2VQG A;  3SZP A;  4XLC A;  2P8T A;  3G4S I;  3OS0 A;  2DA3 A;  3MCZ A;  2NNY A;  3PO3 J;  1FNN A;  3BOQ A;  2IBD A;  4QSH A;  1U9O A;  4HBL A;  4WWC A;  1LDJ A;  3QQA A;  2XB0 X;  2HYF A;  4IOC F;  2Y69 H;  1KQ0 A;  5FB2 A;  2GQQ A;  1ZRC A;  4QWQ A;  2Y75 A;  2ZXJ A;  2DTZ A;  3K4L A;  3VOD A;  3UNG C;  2V4J C;  2XF7 A;  1IXR C;  2DFF A;  2R7Q A;  2WTE A;  2NS8 A;  2QQ9 A;  1LDK B;  4XLF A;  4E7J A;  3M4O J;  4KFC A;  1D5V A;  4LLG F;  3OYA A;  2XC7 A;  5ILS A;  1W36 D;  1HA8 A;  2L4A A;  1FOY A;  4YEJ A;  2RNG A;  2DK8 A;  2DPU A;  1OQY A;  1FTZ A;  5EEG A;  2WA0 A;  4W1U A;  3ABT A;  1TC3 C;  1EJ9 A;  2MC4 A;  4N9H A;  1EV7 A;  1QHH D;  3M8J A;  3WOD F;  1BW5 A;  2CJJ A;  2VE8 A;  1X2N A;  3ZCO A;  3KET A;  1RI7 A;  1VQ9 I;  4HX7 A;  5KHD A;  5J4Y A;  3J81 K;  1IRG A;  1WI9 A;  2OJE D;  5ICC A;  1UMQ A;  2R7O A;  1QU3 A;  4AU7 A;  1V55 H;  3DEW A;  3HC7 A;  4LLL A;  2IPQ X;  2ISZ A;  4FIS A;  1ZTR A;  1FYM A;  2ZNY A;  5TJJ A;  3BJO A;  4MNU A;  3TGN A;  1X1P A;  5M3M J;  3K1P A;  2NS0 A;  3H3U A;  5LBQ A;  2JZY A;  2OCE A;  3CD6 I;  1SC7 A;  1UB9 A;  3RYR A;  3VDX A;  2PJR B;  5LRS A;  3PUB A;  4OIO F;  2XF5 A;  4EGY A;  2R92 J;  1S7A A;  2OCC H;  1ACI A;  1JXS A;  3V7C A;  3CDI A;  1T38 A;  2OA4 A;  3OYE A;  4BDZ A;  3LNQ A;  4ENM A;  1T6S A;  2GZW A;  5J40 A;  4XRS G;  1IW7 F;  2K02 A;  1OYY A;  3JRE A;  4BL0 B;  1UHW A;  2DA1 A;  2FML A;  4ZZL A;  3K0L A;  3K4N A;  1WVR A;  3BZ6 A;  3H5R A;  4BEH A;  2GOM A;  1IN7 A;  4FX0 A;  2Q8K A;  4HW0 A;  3RZD J;  1W0U A;  2JQ7 A;  5E8G A;  2EV6 A;  1V5F A;  5JLX A;  3J80 K;  1HDD C;  3MMY B;  2MA3 A;  2DQL A;  1Y56 A;  3DBH B;  2YU9 J;  3GYH X;  2VXD A;  1TWH J;  2V26 A;  4QPO A;  3F23 A;  1VQN I;  3GTG J;  1Y0U A;  3U2R A;  2EB7 A;  2MG4 A;  2LBF B;  2R7V A;  2H6C A;  3OS1 A;  3DWL E;  1LE8 A;  4YEL A;  1QGP A;  3BR6 A;  2LDU A;  2HPM A;  1D5Y A;  3BTI A;  2KJC A;  4KNY A;  2HQN A;  4JX5 A;  4E4H A;  4V2G A;  1G6N A;  3HRT A;  2FJ1 A;  1BA5 A;  2DOA A;  2AS5 F;  1ONV A;  2VBW A;  2ZME B;  3ERE D;  1VQ5 I;  3TDU C;  2XAS A;  2FA5 A;  1YW9 A;  5LHG A;  1S29 A;  2EWN A;  3S1N J;  1SVM A;  4CUG A;  4FX4 A;  1B9M A;  2IGN A;  1O3R A;  1FY7 A;  2QYO A;  1HXD A;  2M87 A;  4BQO A;  4E7S A;  5B1A H;  5B1B H;  2R5Z B;  3P9C A;  1EH8 A;  2HYG D;  1B9N A;  1RPW A;  5JVT A;  3L00 A;  4J00 A;  4PSW A;  1DU0 A;  1MBH A;  3MZ8 A;  2V6C A;  3BG6 A;  3K1M A;  3KEQ A;  3CCJ I;  2PLY A;  4E7L A;  2KMU A;  4M9Z A;  1A36 A;  3CCS I;  4XQF A;  1DPR A;  1STZ A;  4XN3 A;  5J1U A;  3RIR A;  4ZYD A;  2GAU A;  2O8X A;  2AO9 A;  3GFL A;  2B9S A;  1HQC A;  2VC1 A;  2B63 J;  2W4S A;  3GLL A;  2NOJ B;  4MFE A;  2L2O A;  4ZTF A;  2VOD A;  1MMA A;  3FHZ A;  3F0C A;  1Y1V J;  2K3F A;  3HDD A;  2X48 A;  1IDZ A;  3O8H A;  4M3D A;  1T33 A;  3O6B B;  4M6X A;  2QVO A;  2V9K A;  1TT0 A;  4G6D A;  2BW3 A;  1TW2 A;  4DZP A;  1UEL B;  5CVV A;  3I3L A;  2DTR A;  4U0W A;  3OYH A;  5TGT A;  2OBP A;  4PGH A;  4P1W A;  1ZHF A;  1R36 A;  3FMQ A;  3WTW C;  2GM4 A;  1LQ1 A;  2ADU A;  2HDC A;  1R5I D;  2L0K A;  4MO7 A;  2E2H J;  2STW A;  1RUN A;  2DLL A;  3QP6 A;  4PJL A;  2A3S A;  3GVA A;  4ABZ A;  3CLQ A;  1EH6 A;  4UVA A;  3TED A;  2VN2 A;  4KMF A;  1JE8 A;  3VYT B;  2M3A A;  4KIT B;  4BAC A;  1MMS A;  3LA3 A;  2EIJ H;  4IVN A;  2HKX A;  1V4R A;  4XIC A;  5M5W J;  4KYW A;  2VIX A;  3FHN A;  3M07 A;  2E1M B;  3ML6 A;  1G8X A;  5M5X J;  5BPI A;  3OSF A;  2ZJ2 A;  3IAM 2;  3HSE A;  2X4H A;  1F4K A;  1X2M A;  2E7W A;  3T5X A;  1BI2 A;  1S3J A;  3DFG A;  2H8W A;  4UHT A;  4NDL A;  4LD5 A;  4A93 J;  4IKF A;  2VAS A;  2DT6 A;  3REO A;  4Y13 A;  1IAW A;  1IJW C;  3QPH A;  3D5L A;  1OIS A;  3J7Y J;  2HFH A;  1D1C A;  3HSR A;  1MGT A;  3CCU I;  1TQM A;  2QQA A;  4V19 K;  1B59 A;  3OYG A;  1WJB A;  2WAE A;  3SZT A;  3EDP A;  3BLY A;  3H0G J;  4K2E A;  5F0F A;  4E7Z A;  3CCQ I;  3S1Q J;  5IYC J;  2LOO A;  3W2W A;  1D0X A;  2K40 A;  2A6E F;  2KPM A;  2DXI A;  2G7U A;  4RAG A;  1RR8 C;  1X4P A;  4MFD A;  4G6T B;  4Q4Z F;  3PM1 A;  4CXF A;  1WQ2 A;  3E6D A;  2CQK A;  3LL7 A;  4N4N B;  4BE2 A;  4IF4 A;  4NC6 A;  3SYT A;  2BEO A;  2UZK A;  4A3B J;  1XX5 A;  1OPC A;  1FLI A;  5D8L B;  2EIK H;  5IYD J;  1UJ8 A;  5K5Q A;  2DCE A;  2FUG 2;  4HYE A;  2A6H F;  3S17 J;  2M4K A;  4LK0 F;  2VON A;  1B1B A;  2KZG A;  2UWM A;  4BBS J;  1OR7 A;  4PJ0 C;  4A69 C;  3E6M A;  3AL0 C;  1XCB A;  5BMZ A;  2XGE A;  3F8N A;  2OQR A;  1W5C C;  2VJJ A;  3BTC A;  1QHG A;  4Q47 A;  2DQR A;  2P7V B;  4XN0 A;  1XSV A;  1IV6 A;  2OUM A;  1MJB A;  2CRG A;  2RGV A;  3DTE A;  4H4K C;  2BY3 A;  3DKY A;  2QCO A;  1YTY A;  5CJ9 A;  1HBX G;  4BDY A;  3MEX A;  1GV5 A;  5K7H A;  1F9N A;  5IT9 Z;  5DCM A;  2R7X A;  3M8E A;  1LNW A;  3CO7 C;  1YS6 A;  1MDM B;  2V1D A;  1U5T B;  3C2H A;  2O61 A;  1TTY A;  3TOA A;  2HS5 A;  1OYW A;  2LKP A;  3WHC A;  3H0D A;  1VQL I;  1I5Z A;  2LMD A;  2W25 A;  2Q2E A;  2KIM A;  3L1P A;  3G1O A;  1OCT C;  2EPF A;  2EZK A;  2ZC2 A;  4KIC A;  1ZQ3 P;  3K1N A;  4ZJZ A;  1K4S A;  1IG7 A;  2EJR A;  2DFI A;  5D4S A;  2V7F A;  3LSI A;  2NVU B;  4HV5 A;  1YFH A;  1G59 A;  2NXN B;  1BR2 A;  2FX0 A;  3K10 A;  3CMA I;  5TRD A;  1CF7 A;  3J7Z I;  4X6A J;  5EG0 B;  2X51 A;  1IN5 A;  4PFP A;  2BOL A;  1HLV A;  2LRE A;  2QZ8 A;  5E18 F;  4BE0 A;  1T2K A;  2CMP A;  3JRD A;  2H8R A;  1XMA A;  1JTX A;  4A2U A;  1QPI A;  2ISY A;  4DJA A;  3CZ6 A;  4JX4 A;  4NQW A;  4I0A A;  1ORK A;  2IEK A;  3FBN B;  1FPQ A;  2Z16 A;  2LY1 A;  4XON A;  1J7K A;  3HJE A;  2FMY A;  3N4M A;  4NHJ A;  2PMU A;  2HDD A;  4XID A;  1IZ1 A;  1YRN A;  3EUH A;  2OAZ A;  5HOD A;  3ZMZ A;  1R6R A;  1FC3 A;  2F2E A;  2PMZ A;  3BPX A;  3E5X A;  2F4O B;  3E7L A;  3GFM A;  3KZY A;  4N4O B;  5F04 A;  5EZH A;  3HKZ N;  2XGC A;  5EEA A;  4HST A;  1IF1 A;  1XGM A;  2D1H A;  2IT0 A;  4ZTJ A;  3C3W A;  3S2H J;  3JRA A;  2KLO A;  4B3X A;  1DP7 P;  3OS2 A;  1YG2 A;  3F8B A;  2JWT A;  5DTD A;  1J2X A;  3BTL A;  2KZV A;  1ULY A;  1DDN A;  4LJZ F;  4G7O F;  1SD5 A;  5BNG A;  3TW6 A;  3EUH C;  1ETW A;  3S3O A;  1KYW A;  2Z5U A;  3A2K A;  3I58 A;  2CUE A;  1MH3 A;  3K69 A;  4L5E A;  2QLZ A;  4EEF G;  2OV7 A;  4BE1 A;  2F5V A;  4OAY A;  3QU3 A;  1ITY A;  3OYF A;  1LFB A;  1ZGA A;  2R7T A;  2M4G A;  2HU9 A;  5IT3 A;  3WTT C;  4D1Q A;  2LNB A;  1D0Z A;  3KPH A;  4PFO A;  4UUV A;  5LGT A;  3WGI A;  1KU7 A;  1OJL A;  1MBE A;  2DT5 A;  3F9K A;  3PSI A;  3RCO A;  2MLK A;  2F5C A;  1Y0N A;  4FET A;  3L2C A;  2NVQ J;  3SZG A;  3MKL A;  2DMQ A;  4XRF A;  2VKH A;  3WTS C;  4D9J A;  5DUK A;  5CYV A;  1P9Q C;  5E3L A;  3LAP A;  3HXL A;  3CCL I;  4HAM A;  4QPQ A;  1S6L A;  1U2W A;  4GYI A;  3E6B A;  1ZRD A;  1MW7 A;  5HS8 A;  1YW8 A;  5F08 A;  2MW8 A;  3OOP A;  4FE7 A;  1AU7 A;  2NYX A;  2DOD A;  2L7Z A;  2VQL A;  1Z77 A;  3HZJ A;  4AM3 A;  5BQT A;  5F1J A;  4PDK A;  1KA8 A;  5DS9 A;  1J0R A;  1DP3 A;  2O7O A;  2L7F P;  3ERM A;  5FD5 A;  4YIF A;  3FKI J;  5H6Q A;  1SFO J;  3GZN B;  3BRO A;  3I59 A;  4M3G A;  2OD5 A;  4XBF A;  4YFK F;  2XSD C;  2ZKZ A;  3FXO A;  2VI6 A;  4EJV A;  4P9U A;  2QGU A;  2XKO A;  4F92 B;  3BCA A;  2MH9 A;  2W24 A;  4UXN A;  1KQ8 A;  1YOV B;  2W1O A;  3SHF A;  5HOO A;  1VQ7 I;  3FXK A;  3VOE A;  2CU7 A;  4ITV A;  4GRI A;  1E2X A;  2VB6 A;  4FCY A;  2EA4 A;  1NK3 P;  3COA C;  2EH3 A;  5F0H A;  1IN6 A;  5J6X A;  3FK7 A;  1Z1D A;  1WJC A;  3OL4 A;  3CUO A;  3QYE A;  5AIQ A;  1BC8 C;  1WH7 A;  2PEX A;  1MZB A;  2UXX A;  1EKE A;  1N77 A;  3GF2 A;  4Q5S F;  1OCC H;  3HOX J;  4LG3 A;  4Y7N J;  2JA6 J;  1GVD A;  4M9X A;  1JUP A;  2AQE A;  3OOU A;  2LF7 A;  2OQG A;  1W7P A;  2ZFU A;  1SD7 A;  4XKW A;  5KAI C;  3M3Y J;  1JI8 A;  2HQ5 A;  1Z3Y A;  3WGG A;  2FD5 A;  2FOW A;  3CC4 I;  5E1X A;  4A6E A;  4LLN A;  3GXO A;  3G6E I;  4M74 A;  2C6Y A;  3K9T A;  4HZF A;  3HPH A;  1U78 A;  4CHU A;  2NOG A;  2HYJ A;  2FE3 A;  3I55 I;  3TO9 A;  2O0Y A;  2TRT A;  5DM6 F;  3NWT A;  1F1Z A;  1POG A;  5D6F A;  3WTX C;  3K4C A;  4X1E A;  3B02 A;  1A5J A;  2PX9 A;  3GTK J;  2HI3 A;  3HGG A;  1Y1W J;  2IGM A;  2K5C A;  2CW8 A;  1YIT I;  5BOX A;  4GDF A;  3BT9 A;  3ZMS A;  4UUS A;  4J19 A;  3FMR A;  1I39 A;  2FNA A;  1TZL A;  3SQN A;  3R60 A;  4IRH A;  1OYI A;  4IHW A;  2Z33 A;  3SXY A;  4HX8 A;  3AG4 H;  3PL8 A;  3BWG A;  3CCV I;  2VJ5 A;  1R7J A;  2LG4 A;  2Q1Z B;  4IHS A;  1X1B A;  2JA8 J;  3S8P A;  1YO5 C;  4B3A A;  2QSG X;  3DU5 A;  2PMH A;  2JA7 J;  3F6O A;  3KX2 A;  4UUT A;  2CV1 A;  2P5L C;  1LVK A;  2AHQ A;  3M1C A;  1MKM A;  2Y0S A;  3JR9 A;  3FXU A;  3H5N A;  1U9N A;  1XMK A;  2K85 A;  2ETH A;  3OIO A;  1BJA A;  4EJW A;  4AYB N;  3M7G A;  3NAU A;  5EYR A;  2KDZ A;  2JSP A;  1OCO H;  4OAZ A;  3MN2 A;  3GZ5 A;  3QYF A;  4CA0 A;  5LLQ A;  1I6X A;  1WJF A;  1G3S A;  2QSF X;  3U9G A;  2QUF A;  1P4X A;  1D8J A;  4UVC A;  3LA7 A;  3ABM H;  3E3V A;  1MSF C;  3IH4 A;  2DMU A;  2CQN A;  2H09 A;  1S8N A;  3VEP A;  4A3I J;  1KON A;  3KZZ A;  4L9T A;  4GXO A;  4R79 A;  2OPT A;  3LFU A;  3WGH A;  3HRU A;  4GFB A;  1FX7 A;  5C44 J;  2FEZ A;  3T0Y A;  3H9J A;  2DYS H;  2E7X A;  4XK4 A;  5LFA A;  1TNT A;  3KEY A;  1MNE A;  4FE4 A;  4IZZ A;  2XPV A;  3EET A;  4KN7 X;  3BJA A;  3NQO A;  5GPA A;  1X3W B;  4CCJ A;  3BTJ A;  4EQQ A;  1AA7 A;  1X1A A;  5K1Y A;  2ZB9 A;  3CJR B;  1IUY A;  1OCZ H;  2HQA A;  3SEZ A;  2HR3 A;  3V7R A;  4C2M J;  3S3M A;  1JGG A;  6PAX A;  5EGO A;  4BQN A;  4CH7 A;  3FMS A;  1KU2 A;  2GA1 A;  1HF0 A;  1JTY A;  1HKQ A;  2M45 A;  3PQK A;  4E6K G;  4RAZ A;  2M0M A;  2QBY A;  4HF0 A;  1WKM A;  4F52 A;  1S72 I;  5E20 A;  1AOY A;  5CVJ A;  3BJ6 A;  2HGC A;  3W6J B;  3H9Q A;  3EPZ A;  1K78 A;  2DFH A;  5K7Z A;  1O7L A;  3Q5F A;  1I1G A;  1MH4 A;  1O3T A;  5C4X J;  2G0E A;  4MEY F;  3CDL A;  1LFU P;  1F43 A;  3BG3 A;  1NG7 A;  2R0Q C;  1J09 A;  2LYC A;  2H94 A;  2CGP A;  1RUO A;  1I27 A;  4IXA A;  1P6R A;  1J75 A;  2Y30 A;  1TWC J;  2Y2Z A;  3JRG A;  3ZQC A;  2HKO A;  1MND A;  3DBL B;  3WE3 A;  2EV0 A;  5C3E J;  4J01 A;  2ESN A;  4BNC A;  3GZ6 A;  2FQ3 A;  2IS2 A;  1WHU A;  2WAQ N;  1UZC A;  3ISP A;  3I56 I;  1LE8 B;  2I8D A;  3N05 A;  3S32 A;  2BXY A;  4B8X A;  2X1C A;  1C0W A;  1K6O A;  2MLG A;  4XL9 A;  1GXQ A;  1GVJ A;  1SD6 A;  3X2Q H;  2KIQ A;  3RTR A;  4IX7 A;  2K7L A;  4Q48 A;  5FKO A;  2V9V A;  3IHU A;  1HSJ A;  2NNN A;  4LOC A;  3M1E A;  1LB2 A;  4JX6 A;  4NNJ A;  1X3U A;  2L9N A;  4CGZ A;  5LHH A;  2JVH A;  2R3S A;  3GW2 A;  2E19 A;  5ICE A;  4RGX A;  1DGW Y;  3ECO A;  3Q3S A;  4D7N A;  3GLX A;  4KJZ A;  1AWC A;  1ON2 A;  1I1S A;  3PSF A;  4P55 A;  5J47 A;  5CPR B;  2G9W A;  4M6V A;  3IWZ A;  3FXQ A;  3MZY A;  3QPT A;  4L0Z B;  1R4N B;  2F4I A;  1MNM C;  1G3T A;  1TP4 A;  1AHD P;  5FRM A;  3PFY A;  3IP4 B;  4NUB A;  4LMY A;  4HEA 2;  3DQV C;  2IS6 A;  1PVE A;  2P4W A;  1LEA A;  5AON A;  2M1B A;  3DCF A;  1L3L A;  2XAF A;  1YX5 A;  4C3H J;  3V4G A;  2GXB A;  2EFO A;  2KRH A;  2H1L A;  2Y48 A;  2YX7 A;  3W3C A;  4BBR J;  1ZLK A;  2TCT A;  3GME A;  3SDG A;  3SFZ A;  5LEK A;  2KHM A;  2EV5 A;  1P7J A;  3DLA A;  3ZMV A;  1Z7U A;  3OYI A;  3ZMU A;  3KFW X;  2AQF A;  2CUF A;  3TOB A;  1SFK A;  3HM5 A;  2XAJ A;  2P5V A;  1TWF J;  3D5R C;  3I4M J;  4OU0 A;  1ZN2 A;  2KDO A;  4HF1 A;  4MLO A;  5E3N A;  4XSZ F;  4IHY A;  1MMD A;  3ZOB A;  2BW3 B;  4D5F A;  1RR7 A;  2FRH A;  2V6E A;  3AKZ A;  2CH0 A;  3D1N I;  3CQZ J;  1JKQ C;  2GIZ A;  2YSR A;  5DEQ A;  5K5R A;  2HXI A;  1IRX A;  4D0P A;  1ERD A;  1D0Y A;  5IPA A;  2FNP A;  3JAM K;  4RA2 A;  1LJ9 A;  2BHZ A;  3KZI C;  2CS3 A;  4UY8 I;  1ETO A;  2CQ7 A;  4M3B A;  4M73 A;  3L2W A;  2XKP A;  1E3O C;  1WJE A;  2DMN A;  5HLG A;  2CYY A;  3F6V A;  3ZQG A;  1H89 C;  3HRM A;  1W7P D;  3U1K A;  2H1K A;  4OIQ F;  2P0W A;  4YFX F;  1KGS A;  1ZEL A;  4BS9 A;  2K9S A;  3LA2 A;  2BYV E;  5L3C A;  3CMM A;  5LRR A;  2X6O A;  2GIV A;  2Y0M A;  2WY7 Q;  3BR5 A;  2GA2 A;  5DUI A;  4UNO A;  4ZDO A;  1RC9 A;  4II3 A;  4RAF A;  2XRN A;  5J1R A;  1OCP A;  1S5L C;  2QSH X;  1YE9 A;  2BY2 A;  3E5U A;  1GHC A;  4I7H A;  2OZU A;  2TDX A;  2HVS A;  3VYS B;  2PFB A;  2AXT C;  4IL6 C;  2ZCW A;  4YFN F;  2R7R A;  2R7S A;  3NWS A;  4G7H F;  2N8G A;  5GTI C;  4AVP A;  4HLY A;  2V79 A;  5HDG A;  3PFI A;  4ZYG A;  2X85 A;  3CCM I;  1R4M B;  4HNV A;  1E3P A;  1UAA A;  1OFC X;  1KZH A;  3ZMD A;  2VKV A;  5EZG A;  3RKW A;  3ZXS A;  3GWZ A;  2VBX A;  3CLO A;  4MTE A;  3G71 I;  4XR6 A;  2JJ7 A;  1P2F A;  3BZC A;  3JTH A;  3LQQ A;  2YU3 A;  2WB1 N;  4MHG A;  2JRM A;  1IXS B;  2LY2 A;  4DYC A;  3ULQ B;  1FYK A;  1MMN A;  4LG0 B;  3HOT A;  4KIG A;  2PJR A;  1GLN A;  3A0B C;  3K7A J;  4HPQ A;  5FLX K;  5HLI A;  5L3G A;  1LUJ B;  4CYC A;  3HUG B;  5EDN A;  3G3Z A;  3GUD A;  4G12 A;  3AG1 H;  2MC3 A;  4PJJ A;  2DFE A;  4ZC3 A;  1CGP A;  2P5K A;  4JYK A;  4IQ4 A;  4XLA A;  4C9Y A;  1WFX A;  3GFJ A;  3LSR A;  3QOE A;  3ZP5 A;  3IC7 A;  2HPI A;  3MKW B;  2IA0 A;  3LSP A;  2PI0 A;  3DPT A;  2EQR A;  5ILU A;  4PUS A;  3AFH A;  4L9J A;  4G94 A;  5FLM J;  2JPC A;  1M1E B;  2KRC A;  3E0J B;  3T8R A;  2LBF A;  3HOY J;  3M9A A;  4AWX B;  4M3F A;  3GFI A;  2VPL A;  4BJ5 C;  3BCB A;  4I2O A;  3TL4 X;  3R6S A;  1XDS A;  4W97 A;  1X19 A;  3RPQ A;  1MBK A;  2W48 A;  4JQF A;  4AIH A;  5JR3 A;  4I01 A;  1JUS A;  1NG6 A;  4EMS A;  1B8I B;  3CTA A;  3MVP A;  3GTM J;  2JA2 A;  1PUE E;  2ZME A;  5EEH A;  3O2P E;  4DBQ A;  2IRF G;  3M8F A;  2YX4 A;  1ZRF A;  1I3A A;  1S7E A;  1LKX A;  3EQL F; 
#chains in the Genus database with same CATH homology
 4RLF A;  4ANJ A;  2KQR A;  2OV7 A;  2CV2 A;  1V5G A;  4BE1 A;  2F5V A;  4OAY A;  3MD2 A;  3OYF A;  2R7T A;  2E60 A;  2HU9 A;  2M4G A;  3EUA A;  4D1Q A;  1D0Z A;  4PFO A;  3PJR A;  4IQJ A;  2XDV A;  3F9K A;  3PSI A;  3RCO A;  4P5O A;  4CCK A;  4FET A;  3SZG A;  4HNU A;  2K9L A;  2A6T A;  2XF6 A;  2VKH A;  3OYD A;  4D9J A;  3IAS 2;  1P9Q C;  4XLE A;  4AVZ A;  4Y3O A;  2X6Y A;  3HXL A;  4XOR A;  3K4B A;  2VQC A;  3K70 C;  4QPQ A;  1VZ0 A;  2ZSH B;  3OR2 C;  4Y33 A;  4RM2 A;  3I9V 2;  1X1C A;  1MW7 A;  2ZSI B;  2KL4 A;  4LIU A;  4LIV A;  2VXZ A;  4HSR A;  2Z1D A;  2VQL A;  3OYK A;  2IS1 A;  3K4K A;  3H5A A;  2VQG A;  5HNF A;  4PK4 A;  4XLC A;  2IS4 A;  1DP3 A;  4AYB A;  1FMV A;  1PYV A;  3OS0 A;  3OYL A;  2VJI A;  3LSK A;  2VJ4 A;  2IGO A;  3OL3 A;  4F92 B;  3BCA A;  3VSL A;  4RLQ A;  3ZRG A;  3QOD A;  2W1O A;  5HOO A;  5LD2 C;  4ITV A;  4GRI A;  3OIQ A;  2QKM B;  2VB6 A;  3K4L A;  3UNG C;  1BOB A;  2V4J C;  2XF7 A;  2CFO A;  2R7Q A;  3C2G A;  1WJC A;  1LDK B;  4XLF A;  1FMW A;  4E7J A;  3OL4 A;  3BC8 A;  3QYE A;  3OYA A;  2XC7 A;  4LIT A;  1W36 D;  1HA8 A;  1N77 A;  4LG3 A;  4YEJ A;  2RNG A;  3AL0 B;  2DJI A;  2WA0 A;  2AQE A;  3OOU A;  1T0F C;  2ZFU A;  4XKW A;  1JI8 A;  2RRE A;  5KNL A;  2WY8 Q;  1Z3Y A;  2MC4 A;  3L2U A;  1QHH D;  3M8J A;  3OYB A;  3HPH A;  3ZCO A;  2QKL B;  4XLH A;  2IGK A;  4DOZ A;  5KHD A;  1N78 A;  2E1M C;  4F93 B;  2M7A A;  4E7K A;  3NWT A;  2R7O A;  3K4C A;  4AU7 A;  3RQ4 A;  1QU3 A;  2X6W A;  4XOP A;  3HC7 A;  3U21 A;  2IGM A;  2K5C A;  2CW8 A;  1X1D A;  3DTK A;  1TZL A;  2GOX B;  3ZR8 X;  3S93 A;  1UG0 A;  3PL8 A;  4YRV A;  2W7N A;  2VJ5 A;  4C2U A;  2LG4 A;  2Q1Z B;  1X1B A;  3VDX A;  3S8P A;  2PJR B;  3PUB A;  2XF5 A;  2Q2E B;  3DU5 A;  5CQE A;  3KX2 A;  2CV1 A;  1BR1 A;  1LVK A;  3M1C A;  2Y0S A;  3H9G A;  3OYE A;  2WAQ A;  3H5N A;  4BDZ A;  3ZQQ A;  5CKT A;  4HG2 A;  1DQU A;  2CV0 A;  4BL0 B;  2JSP A;  1Z3X A;  4OAZ A;  3RSN A;  3VWB A;  3QYF A;  4CA0 A;  3K4N A;  4BUP A;  2L5Q A;  1WJF A;  3H5R A;  2E5N A;  3PNT A;  3H35 A;  4BEH A;  4HRI A;  3EUK L;  2GOM A;  3K4J A;  3A4C A;  2M7B A;  3HOS A;  1V5F A;  4DGW B;  2E5Z A;  3MMY B;  4NQW B;  1Y56 A;  3HL2 A;  3DPL C;  3VSK A;  2VXD A;  2L7K A;  1KON A;  2V26 A;  4QPO A;  3ONQ A;  4R79 A;  5HVQ C;  3LFU A;  2LBF B;  4XNF A;  4CCM A;  2R7V A;  1BR4 A;  2BVM A;  3OS1 A;  4U7B A;  3DWL E;  3H9J A;  2MFZ A;  3HPG A;  4YEL A;  3KEY A;  1WJD A;  5LFA A;  1MNE A;  4IZZ A;  3SDB A;  2HPM A;  4CCJ A;  3J7A Y;  1AA7 A;  1X1A A;  3FBI B;  4E4H A;  1MMG A;  3CJR B;  2HQA A;  3SEZ A;  3DU6 A;  2DOA A;  3S3M A;  4E7H A;  3VYR B;  4BQN A;  4CH7 A;  2K9M A;  2HVQ A;  3W2V A;  4KT6 A;  3QYB A;  3KYL A;  4CUG A;  2VL8 A;  4E6K G;  4B47 A;  2M0M A;  2IGN A;  3K4M A;  4E7S A;  4F52 A;  4BQO A;  4B44 A;  4JOM A;  3ZGK A;  3H9Q A;  3EPZ A;  3LSH A;  4CCL A;  4J00 A;  1WJA A;  4PSW A;  1NG7 A;  1J09 A;  2LYC A;  3BG6 A;  2VQH A;  3CJQ B;  2HNH A;  3OMY A;  4E7L A;  4CZC A;  2KMU A;  4XQF A;  4BGD A;  4XN3 A;  2W00 A;  1MND A;  1OR7 C;  4J01 A;  2IS2 A;  2W4S A;  4ZTF A;  2NOJ B;  2I8D A;  2L2O A;  1MMA A;  3N05 A;  3S32 A;  2UV1 A;  2JVG A;  3E1S A;  3L2V A;  2MAB A;  2X1C A;  2BVL A;  3G2B A;  4XL9 A;  4DIQ A;  2JUG A;  3K70 D;  2UUZ A;  2V9K A;  1TT0 A;  3DKX A;  3RTR A;  4IX7 A;  3DTI A;  2BW3 A;  3PNY A;  3OYN A;  2HVR A;  4KIS A;  5HLT A;  4E7I A;  1UEL B;  4NNJ A;  3I3L A;  3UR3 C;  3OYH A;  2L9N A;  1D1B A;  5HNH A;  2JVH A;  5TGT A;  4F55 A;  4HNT A;  4P1W A;  3V42 A;  4PJM A;  1DGW Y;  3LSM A;  3CF2 A;  4U87 A;  1K6Y A;  3RPU D;  2K3P A;  4KJZ A;  3FDY A;  1YX3 A;  3PSF A;  4PJL A;  4C30 A;  5CPR B;  1SAU A;  1E0E A;  1S9H A;  2F4I A;  2WB1 A;  3VYT B;  4X0G A;  2X1D A;  2M3A A;  4KIT B;  4BAC A;  5FRM A;  3PFY A;  3S3N A;  3IP4 B;  2O5R A;  4NUB A;  3MKY B;  4HEA 2;  3DQV C;  2IS6 A;  4BXF A;  2VIX A;  3FHN A;  2X1E A;  2E1M B;  1YX5 A;  1G8X A;  2ELJ A;  2IXS A;  3W2A A;  3HG9 A;  2LRD A;  2KRH A;  3IAM 2;  3W3C A;  4ZYA A;  2RQQ A;  2R4G A;  2LH9 A;  2KHM A;  3DLA A;  3OYI A;  4IKF A;  2VAS A;  2XSJ C;  2DT6 A;  2AQF A;  1SFK A;  3D5R C;  1N75 A;  5FRO A;  2R7W A;  2KDO A;  3D5L A;  3OYM A;  1OLT A;  4MLO A;  3DPU A;  1DGR M;  1MMD A;  2BW3 B;  1D1C A;  3CP2 A;  2V6E A;  3AKZ A;  2CH0 A;  1X4O A;  2Z2S B;  1W36 C;  3OYC A;  4C2T A;  3OYG A;  1WJB A;  2WAE A;  1IRX A;  3BLY A;  1PJR A;  1ERD A;  1D0Y A;  4E7Z A;  2V1N A;  2F6C A;  2VKD A;  2LOO A;  1Z21 A;  2CS3 A;  3W2W A;  3L2W A;  1D0X A;  2KPM A;  3GBG A;  2DXI A;  1WJE A;  5FRN A;  1X4P A;  4ZDL A;  4G6T B;  1EA3 A;  3HKZ A;  3L2R A;  2P0W A;  1ZEL A;  3LL7 A;  4BS9 A;  4N4N B;  4BE2 A;  4RMN A;  2MYS A;  3SYT A;  2HDW A;  3CP8 A;  3CMM A;  2WY7 Q;  4ZDO A;  2DCE A;  2FUG 2;  4NC8 A;  2W82 A;  4II3 A;  3TBI A;  2M4K A;  4BQQ A;  1YE9 A;  2UWM A;  3TMO A;  2HVS A;  3VYS B;  1U0J A;  2ZXH A;  2WAF A;  2WBM A;  2R7S A;  3AL0 C;  4CSW A;  2R7R A;  2VJJ A;  3NWS A;  2R7U A;  1QHG A;  4B43 A;  2ZXI A;  4XN0 A;  4BEH B;  4DBR A;  2X85 A;  2OUM A;  3DTE A;  2LC2 A;  4H4K C;  1UAA A;  3DKY A;  4BDY A;  3BG7 A;  4XMY A;  3ZXS A;  4II2 A;  2XAU A;  2X6X A;  4XR6 A;  3OR1 C;  2R7X A;  3CES A;  2WAD A;  3K6G A;  3PNV A;  3L2Q A;  3C2H A;  2LY2 A;  4XKC A;  5KCM A;  3SEQ A;  1MMN A;  3H0D A;  4NC7 A;  3HOT A;  2PJR A;  3LSG A;  4F91 B;  1GLN A;  3MKZ A;  4HPQ A;  2KP6 A;  1Y6I A;  4B48 A;  4ZJZ A;  3HUG B;  2VLA A;  4CCO A;  1D1A A;  2V7F A;  3LSI A;  2A5W A;  1G59 A;  4PJJ A;  3K10 A;  1BR2 A;  3D5S C;  4ZC3 A;  4BJT A;  2MD0 A;  4XOT A;  1Z7L A;  2X51 A;  4XM3 A;  2OC6 A;  4PFP A;  2BOL A;  3OWT A;  2LRE A;  2DT7 B;  4BE0 A;  4IQ4 A;  2CMP A;  4XLA A;  1WFX A;  4C9Y A;  4CCN A;  3QOE A;  4DJA A;  2HPI A;  3MKW B;  3DPT A;  3IUO A;  4RM3 A;  3CZ6 A;  4PUS A;  3AFH A;  3FBN B;  4PSX A;  2Z16 A;  2L9S A;  2LY1 A;  3VYU B;  4XON A;  3A1Y A;  2HZD A;  4OWR B;  2KRC A;  3E0J B;  2LBF A;  3DEE A;  2CUZ A;  5CQG A;  3OYJ A;  1R6R A;  2PMZ A;  1LFP A;  4XKV A;  2CW7 A;  4N4O B;  2VPL A;  4BJ5 C;  1WJ5 A;  3OIP A;  4EAT A;  3BCB A;  4HST A;  3TL4 X;  4Y4R A;  4PJN A;  3OY9 A;  4ZTJ A;  1X19 A;  4JQF A;  2KLO A;  4B3X A;  4BJ6 C;  3OS2 A;  1NG6 A;  2CUJ A;  3FKJ A;  4F3Q A;  2KZV A;  2JA2 A;  5JHF A;  4DBQ A;  3EUH C;  4ZDP A;  3S3O A;  4BU2 A;  3A2K A;  1V5E A;  3LMM A;  1T95 A;  4XKB A;  4FAS D;  1LKX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...