2CMPA

Crystal structure of the dna binding domain of g1p small terminase subunit from bacteriophage sf6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
b'KLSPKQERFIEEYFINDMNATKAAIAAGYSKNSASAIGAENLQKPAIRARIDARLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TERMINASE SMALL SUBUNIT
publication title The 1.58 A Resolution Structure of the DNA-Binding Domain of Bacteriophage Sf6 Small Terminase Provides New Hints on DNA Binding
pubmed doi rcsb
source organism Bacteriophage sf6
molecule tags Viral protein
total genus 19
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cmpA00
4ZC3A 3ZQQA 2CMPA
chains in the Genus database with same CATH superfamily
4IHVA 5BNGA 3WTVC 1UAAA 2M34A 4IQJA 1RI7A 3F22A 2L7MP 4Y13A 3GTMJ 1Z21A 2PI0A 1DP7P 2BOLA 2O61A 2YPRA 1YFHA 2NS0A 3RPUA 3P7NA 3OWTA 3P9IA 2HTSA 5IY5H 4PSWA 4O5VA 1D5VA 1SANA 1T98A 1XSDA 3FK6A 1SAUA 4M9SA 3QP5A 3JRHA 3BR0A 3CDLA 3ABLH 3PJRA 4NC7A 4U87A 4EV0A 4OIPF 4BQAA 1L3LA 5F64A 3TBIA 3UKGA 1MMSA 3MZ8A 1XG1A 2ECCA 3CJQB 1SFXA 4HX7A 4LG3A 4MFEA 4EJUA 2EIMH 5AIQA 2O6GE 2DOAA 4MEYF 2W1OA 4P9FA 4E7ZA 2XF6A 1TC3C 1J7KA 3HSEA 3TP0A 3OYHA 1GLNA 1UFMA 5CJ9A 2VE9A 4FETA 3GTKJ 2IS4A 2NVTJ 2IP2A 4IJAA 4ESFA 3U1KA 4AYBN 4I09A 4PJJA 3OOUA 2BVLA 3ZXSA 3FWEA 3T1BA 3J7YJ 2KLOA 1O3SA 2OTLI 3K70C 1N75A 2A6HF 2DTZA 2ZXJA 1KU9A 2R7RA 4D7NA 5A2QK 3G6EI 4LG0A 4IOAF 3FM3A 2H6BA 4IHYA 2FOWA 2JK3A 2IPQX 2Y9YA 3QPTA 1MIJA 4R8HA 4HW0A 1MBFA 3GZ6A 4MFDA 4FISA 2JVGA 4TV7A 1ZGAA 5GPAA 5KVRA 2VKDA 4RB2C 2R0QC 1XC5A 3KX2A 1XGOA 1IW7F 2DA2A 1G3YA 1RESA 2KJCA 3HEFA 5E20A 1ONVA 2DJIA 3ZQQA 5F0FA 1T95A 4KDPA 2IGOA 4I6ZA 3LQRA 2XSJC 4FT8A 2WAEA 4EJTA 2Q2EB 4HV6A 5HODA 1HKQA 2OUMA 4ZYHA 1LVKA 4M9ZA 2VJ4A 5IP7J 2F5VA 3IL2A 4EJWA 2EINH 3K4MA 3KP3A 4XLEA 3ABMH 2DYRH 2ZJRF 3ISPA 2HVQA 1LB2A 3ZQLA 3CCQI 2JTVA 4UV9A 3DU5A 2MLGA 2J5PA 4IHXA 1ZLKA 4OOIA 4HLYA 1FMVA 2PBIA 3MKLA 3WTZA 3VYRB 4M3DA 2OD5A 4AVPA 3BR6A 5KCMA 2W82A 1PYVA 1HXDA 3DEUA 3BR3A 1SMYF 3HHHA 5M3MJ 4I01A 1VZ0A 2IGNA 1JJ8C 1TWGJ 5TISC 3VWBA 5LHIA 1VQNI 3QODA 4A6EA 2HYGD 2R7SA 2JRTA 4L5EA 5ICCA 1SVMA 1VTNC 1U8BA 2KIFA 3BJOA 3DBRB 3WHBA 3SQNA 3JREA 1KU3A 2LK2A 3F3XA 4OU0A 1J9IA 4UUSB 3DF8A 3BROA 3DU6A 4UV8A 5CQGA 2DT6A 5C3EJ 2ETHA 2OA4A 2GXGA 1FP2A 2CS3A 1XX5A 3LAJA 1WQ2A 2XKOA 3MZHA 1JUSA 3SZPA 2KQRA 2UV1A 5DS9A 4Y52J 4JOMA 5EGOB 1E2XA 1I1GA 2OU2A 2KFDA 4X6AJ 3NWTA 1SVOA 1PVEA 3K69A 2HWVA 4ZYAA 3H3VK 5JR3A 1QU3A 5HLIA 1YRNB 1XMAA 4OMYA 2WV1A 3I9V2 4CH7A 1R9TJ 1TBXA 4KNYA 3M8FA 1BOBA 2Y0SA 4UUSA 5E79C 3RSNA 4CA0A 3M1CA 1J75A 4I0BA 5DD8A 4BE1A 1BN5A 2R4GA 2DPUA 4B4CA 3QOEA 5FROA 3ZOBA 3K6GA 4WXDA 2ZSHB 1QVTA 1SC7A 2NVXJ 4ZDOA 4M3FA 2MSYA 4HNTA 2JWTA 3J7AY 1Y56A 5K7ZA 3JTHA 1CQTA 1LUJB 3OS2A 2A3SA 2EILH 2WA0A 2WC2A 4MLOA 4KUMA 1VQOI 5J1YA 1YRNA 1LDKB 2Z2SB 4A0ZA 5H6QA 4MTDA 2WAQN 1Z7LA 5FLXZ 2HYJA 3ZMUA 3M7GA 2BW3B 3K1NA 2NNNA 3LSKA 1MNEA 3IUOA 5ILVA 3TO9A 3E5UA 4F7ZA 2ZO4A 4LGWA 2WWYA 2VXDA 4BHCA 2HDCA 4A93J 2VODA 1H9GA 2CYYA 4CXFA 3MZYA 3D5RC 2VJ5A 1F4KA 3RCOA 1WRJA 1P9QC 4IQ4A 4CYCB 1MDMB 4RAGA 3BG5A 1R1VA 3DQVC 1HQCA 1GV2A 5EYRA 3DTKA 1RZ4A 4A0XA 1LFPA 2EA2A 3DPUA 3H1CA 2DXIA 2VBZA 1O57A 5D5UB 2CQ7A 3ERED 3BWGA 3ASOH 4U0VA 2WAFA 1Y0UA 4I76A 3BTJA 2VBXA 3MWMA 4BY7J 3COAC 2Y31A 4HEA2 3Q0VA 4I7HA 2QQ8A 4B47A 3GLXA 2CQKA 3ZMZA 2I10A 3DKWA 2ESNA 4A3FJ 1J0RA 4WWCA 2ZXWH 4M3GA 4X0GA 2KT0A 2QGUA 3H5RA 3TW6A 4EM1A 5J4VA 5EDNA 1WJFA 1ZGJA 3CCJI 3O6BB 4XIDA 5HDNA 1W36D 4KYWA 5ILSA 5M5XJ 1MDMA 1DDNA 2ACJA 2P5VA 2GM4A 5HS9A 4BBSJ 2HOTA 3JSOA 1KONA 5KAIC 4F52A 1RIOH 4HYEA 1A36A 5CQEA 4WCGA 5GP9A 1SFOJ 3PNVA 3VSKA 4LLGF 1IN7A 3TEDA 3KIOA 2XIGA 4DBRA 2VOOA 3SEQA 2YX4A 1SFEA 4F91B 3I5UA 2JA5J 1NTCA 1VQ5I 5L3GA 5AIPA 2JJ7A 2VPLA 1OR7A 5ICGA 3CZ6A 4ZTJA 1U9NA 3DEEA 2OCEA 5K5OA 2V1DA 2O7OA 3BTCA 4CZCA 3CMAI 3BP8A 4P5OA 3MKYB 1RR8C 2R7WA 2MA3A 2FBKA 1OISA 1J5YA 3VB2A 3MCZA 4A3GJ 2R7VA 2O0YA 5JLWA 3L7WA 2R7UA 3WODF 1ORKA 5ED4A 1V5GA 4A3LJ 1ETKA 2RAEA 3RI4A 4AIKA 4ENKA 4N0BA 3EYYA 1IRZA 1BI1A 1NH3A 3WGGA 3LSIA 2R7TA 2P6SA 5E17F 1MGTA 2STTA 3S1MJ 5HNHA 1G8XA 1U2WA 2NOJB 3MQ0A 1WWXA 3F21A 2QENA 1LNWA 1OMIA 1WI9A 3KFWX 4W1UA 1JKPC 3DFGA 4XLNF 2K86A 2D5VA 4HSRA 2MG4A 2MH2A 2ISZA 4CHUA 3PNTA 2M0CA 2MABA 1K7AA 3SXYA 3P9CA 1USSA 4AM3A 3RKYA 3JTGA 5LRRA 3M3YJ 4QLCU 4MQVA 3ZMVA 3H5AA 2CRGA 3FXMA 3E3VA 4BL0B 2CV2A 4FHTA 3JAMZ 3K4CA 4LIUA 2DMUA 5J8CA 4B1RA 1HOMA 1PP8F 2XAHA 3O3KA 1IXCA 1ZELA 3DPTA 3E6DA 3I58A 3AAFA 4IX7A 2XV4S 1RR7A 4F92B 4NDLA 4GYGA 1XDSA 1GVDA 4UHTA 3ZCOA 2R7FA 3QPHA 4KJZA 1FBQA 1HSTA 1YIOA 4E70A 2L02A 1U9OA 4A2UA 4AD9A 4C2MJ 5H20A 2XGXA 3FXKA 2HR3A 5DD4A 5CVUA 1BJZA 1ZAOA 1WVRA 4C30A 2E2JJ 1SD6A 4AWXB 4C3HJ 4HSTA 2Q1ZB 2DQLA 2MLKA 2KJBA 3G1OA 3K70D 4DW6A 5CKTA 2BY1A 2CJJA 1IN8A 1MH3A 3CJNA 1FZPB 2ZBKA 1MD0A 2JUGA 3E6MA 5JVGF 1IXSB 2EFPA 2FEZA 2N8GA 3TOAA 4ZYGA 4ZYEA 1FTZA 3RDIA 2X0LA 1YIJI 1X1BA 1TQIA 4BH9A 5L3EA 3L2UA 4P96A 3H0DA 1B1BA 1ZQ3P 4BE2A 3SZGA 2KZVA 2XHKA 4LFUA 1YW9A 5DYMA 1IXRC 3SHFA 5LEJA 1AKHB 3E7LA 3CDHA 3L09A 4J00A 1G4DA 5FKNA 5JHFA 1O3RA 1GVJA 1Y1VJ 1IG7A 4XLPF 1FEXA 1D8KA 1BI0A 2FF4A 3FHNA 2HS5A 4NNJA 2E19A 3OOPA 3F8NA 4FASD 4OMZA 3H9JA 5IOZA 1Z05A 4G6DA 3PIPF 1MSFC 3A1YA 2QVOA 5HLHA 1QHGA 3CCVI 2XASA 2L9RA 3FMSA 5FD5A 2M87A 3DP7A 2JMWA 5LHHA 3LFUA 4P1WA 4G6TB 1Z9CA 2OC6A 4GGGA 1XCBA 1AKHA 3RTRA 3RZDJ 3S2WA 2OPTA 3RPQA 4PGGA 1B6AA 2DK8A 2YX7A 3WTYC 1FOKA 2M4KA 1WJDA 1AA7A 2L4MA 3ABTA 2X1DA 3HPHA 4UVAA 1NK2P 4KICA 2CMPA 5IYDJ 4MTEA 4D7MA 3S3NA 4II2A 2B0LA 4DYRA 2DA6A 1IC8A 4FE7A 2X4HA 3PM1A 1ERDA 2NXNB 3I53A 4CCMA 3QRFF 3ERMA 2GXBA 3ZR8X 2IRFG 2VN2A 2JN6A 2DOFA 3BR1A 2IA1A 1FOXA 1R4NB 2QBYA 1V5EA 4EGYA 1QBJA 3RZOJ 4A3BJ 3CJRB 4YELA 5J40A 3WU0A 1D3YA 2OF7A 1FOWA 1D0XA 4B43A 3CMEI 3WG9A 4A3MJ 1PUEE 3G1MA 4NBQA 4B8XA 1P4WA 1YX3A 4A12A 2JPBA 5GTIC 3CD6I 4A3IJ 3HTUA 4NC6A 3BTLA 1IAWA 1JE8A 2JPCA 4H0EA 4BJ6C 1K78A 3W2VA 1IO2A 3ECOA 4M74A 3IWZA 2ECBA 3OYKA 2E7WA 1FPQA 2CGPA 3FKJA 1F5TA 2UXXA 1S7EA 3HGGA 1WI3A 2LD5A 4D0PA 4GFBA 2M4GA 1I39A 4JQFA 1D5YA 1E0EA 1HBXG 1X4PA 3TW7A 3Q9SA 4Y7NJ 3I59B 3K0LA 3WGIA 3N05A 2CQQA 4JX6A 1IUFA 2W84A 3OYNA 5JHUA 3GZ5A 1OCTC 3CUQB 4M6XA 1KU2A 3H36A 4Q5SF 3KP6A 3CCSI 2KRHA 3V7SA 1BW6A 1U78A 2ME6A 4BHBA 1FNNA 2NNYA 1B72B 2M7AA 1WH5A 2F4MB 2P4WA 4BACA 4IPAA 3IWFA 1AWCA 3HUGB 1XSVA 5FKLA 1FOYA 3ZRGA 2K3PA 2ZC2A 4XR6A 2EFWA 2DPDA 1E3HA 2KPMA 2WB1A 3ZP5A 2DFFA 3PNYA 2W57A 3ZN0A 6PAXA 2VIXA 1W5CC 5FKOA 3EUKL 3L2QA 2QSFX 1BI2A 5HDGA 2R5YB 1O4XA 2WY8Q 1UMQA 2V1XA 4RB0A 2L9SA 2VI6A 3CUQA 4XNFA 1ZRFA 4P9UA 1IV8A 2COBA 5EG0B 4JYKA 3OYFA 3KZZA 3FHZA 4D5FA 3IV5A 4AIHA 1RKTA 5FLXK 3HGYA 4HF0A 2M5WA 3LSMA 2L54A 2JA6J 4QPOA 2Z16A 3WHCA 3HUGA 3QOPA 1BR2A 4EM0B 2EBIA 4JX4A 3BPXA 3F6VA 1ZG1A 3VYUB 3LAPA 3ZQCA 4GYIA 2XAFA 3LSPA 4UB6C 4ENJA 1K6YA 4BBRJ 2EWNA 2VONA 2BXZA 2DMTA 4DOZA 2BHYA 4EQQA 5K5QA 3OYJA 3OSGA 1SFUA 3HG9A 4M3BA 2JSCA 3P5JA 4OIRF 2DT5A 3ZQGA 3HL2A 2R5YA 4BE0A 2LY1A 5F6FA 3HOTA 4IXAA 3RKXA 2Z9OA 2V9KA 1FBUA 2X6WA 3E1SA 4NHJA 5IYCJ 3LSJA 1CF7A 3WU1B 3HPGA 2B9SA 1ETWA 1X2NA 2FE3A 1SVLA 4DQ2A 1HLVA 2OZUA 5FFZA 3CF2A 2PMZA 3S1QJ 1ETVA 3H9GA 1R1UA 3ZQFA 1YQAA 2IXSA 2RVCA 2GQQA 5K7FA 2MBFA 1K61A 3K1PA 2IW5A 1D1BA 1PUFB 2L7KA 4PFOA 3K2AA 1H9TA 4BXFA 3PIOF 1MMDA 3HC7A 4HQMA 4PCQA 2H6CA 4BGDA 2MYSA 3OS0A 4MQ9F 1P2FA 1W1WE 2WADA 3OYLA 1W0UA 1ACIA 3HOVJ 1MNDA 3BTIA 4EJVA 3I56I 1YX5A 5LGTA 3S1RJ 5K7HA 4ZDPA 4DJAA 3KEQA 4WF2A 2ZMEC 4XICA 4XSZF 1G3TA 2MC4A 3HRMA 2BXYA 2KL4A 5J1UA 2Y48A 3D1NI 1ON2A 1SFKA 1YHQI 3JRFA 1T08B 1BBYA 4KN4X 1VQPI 5GTHC 2DT7B 3M8JA 2PJPA 1OCPA 4B3XA 2R7XA 2X1CA 3C2GA 2PN6A 1PUFA 2CO5A 4GO1A 5FLVA 3R61A 4II3A 1ZN2A 4Z6YA 4S04A 1LEAA 2EFQA 3KPHA 4KIGA 3CCEI 3TDUC 4HAMA 3U9GA 4F55A 1X3WB 3PO3J 5JVTA 2H1LA 2AQFA 3KYDB 1HKSA 3FBNB 2JQ7A 3HRUA 2K7LA 3HOXJ 4E4HA 2W00A 3L9FA 2LBFB 4LB6B 3DCFA 5GAGJ 1FWZA 5HS8A 3K7AJ 3AG3H 4UXNA 1S9HA 1TW3A 5CVVA 4BS9A 5B3SH 2J5OA 3Q0UA 2ZCWA 3FIWA 4PDKA 1HDPA 2DLLA 2G7HA 2F5FA 2VLAA 3N4MA 3SZTA 3CP2A 3V7CA 3IC7A 2DA1A 2AXTC 3ZMTA 3HOWJ 2COMA 3H5NA 2EV6A 2XDVA 2IGMA 1HW1A 4JX5A 3JAMK 1YE9A 1A6IA 1S7AA 2VQCA 2FNPA 2FSWA 4KIFA 2FX0A 1YS7A 3RYRA 1Y8QB 2H27A 2V6EA 2W85A 1SEUA 2F6CA 5FRNA 1UELB 5DCMB 5CPRB 4A5MA 5B1AH 3BDDA 3QP6A 1DPUA 1BM9A 3RYPA 3RIRA 1P7JA 2QEXI 2HQNA 3R6SA 2HDWA 1A5JA 1YW7A 4UUTA 4N9HA 1FJLA 2FOKA 4HOBA 1S3JA 3DEWA 3MMYB 4NUBA 3HOYJ 3CC2I 2LVSA 4EGZA 1YYVA 3FMQA 5ILUA 2VPRA 2QQAA 3Q9VA 5GAEJ 4Y4RA 4C2UA 2R92J 1T8IA 2JA8J 2Q2EA 1MJBA 2DA7A 4KT5C 3A01B 2L7ZA 2IA2A 2W7NA 2Y9ZA 2X85A 1T0FC 1BA5A 3IKVA 1STZA 1IDZA 5E1XA 3FXQA 4RLQA 3S8PA 1ZH5A 3BR5A 2HYFA 3FX3A 1B8IB 1XGNA 2KIMA 1WJBA 2F5DA 2E71A 2GIZA 3DWLE 1QQIA 4XBFA 2FQ3A 4PK4A 1J09A 2E36A 2VT2A 4KIBA 2RNJA 1QZEA 1U0JA 4HF2A 1G2HA 3CO6C 2QUFA 1IUYA 2DYSH 3HSRA 3W2AA 2LH9A 2IS1A 4IEJA 3J81Z 4B44A 5FGMA 2P0WA 1ZYRF 5JI6A 4UB8C 1XB4A 2A6EF 4XN3A 4CYDA 2A61A 3A01A 1OCOH 2PMHA 3ABUA 3BQYA 3GO5A 2FUG2 5J8FA 1MKMA 2PJRB 2XPUA 1QZYA 1YTYA 1JHHA 3S3OA 1B8IA 4CGZA 1FSEA 3FXUA 2QF7A 1J2XA 2DDAA 2VB6A 2NVUB 2EIKH 3GCMA 1LFBA 3TDZC 3GFIA 2Q8KA 2BEOA 1UHWA 5FB2A 3FXJA 3HYIA 1N78A 5DV5A 3BG6A 3QU6A 1CGPA 1LE8B 2FQ4A 3PL8A 4MIMA 4ZTFA 5L3CA 4BHPA 2ZMEB 4KMUX 2L7FP 4D1QA 3S93A 2M1BA 2V9VA 4Y17A 5EGOA 3AKZA 4ON0A 3FXRA 1N77A 3FXOA 2R7QA 2WTEA 3BQZA 4CCJA 4L5JA 2KDZA 2PJRA 2V9PA 1VI0A 4Q48A 5E3NA 2CU7A 3BC8A 4Y15A 2R7ZJ 2F48A 3R60A 2XPVA 3S1NJ 3BCBA 2MGQA 1GUUA 1DQUA 1UZCA 1JUPA 1IJWC 3S32A 2X6YA 3QU3A 1P4XA 3T8RA 4ZYDA 3BLYA 1V5FA 3CO7C 2HVRA 3MD2A 4BU2A 5E3MA 1LE8A 5LFAA 2XAGA 2ZJPF 4IO9F 1KU7A 3H3ZA 3ESWB 1Z91A 2ZMEA 3C2HA 4Z2YA 3O2PE 3OYBA 2YSRA 1WFXA 1P6RA 3V42A 2STWA 2LLKA 3W2WA 1IN6A 2IVMA 4ZJZA 3K4LA 1B9MA 1T2KA 4MEXF 1WZ2A 4DBQA 1G3SA 2HI3A 2EB7A 2XF7A 2Z3YA 4XMYA 4XKBA 3BT9A 4LMYA 1YITI 3U2RA 2PX9A 4XKCA 4S05A 2FMLA 3CMYA 4RA2A 2BW3A 2K9SA 2HZDA 2JVHA 2E1CA 1VQ8I 1TT0A 2LMDA 1TWAJ 3V4GA 3CDIA 3F0CA 4W97A 1E3OC 1W5SA 4ANJA 2HXIA 1YO5C 4F3QA 4RGXA 2JA7J 4WXHA 4KN7X 1WJAA 2GA1A 3PFYA 5HDKA 5D4RA 5C4XJ 3BY6A 4PJMA 2LYCA 2X48A 4NQWB 4RAYA 5D6EA 1ZRCA 4CYCA 1HC8A 1YG2A 3DLLF 2LR8A 2VOPA 2V4JC 2QLZA 3OR2C 2OZ6A 2P6TA 2VT3A 3EUHC 1XSXA 2HNHA 3JR9A 3IHUA 5L3FA 2LP0A 3VFZA 1JGGA 5EF6A 1RKWA 2L5QA 1XDUA 4BY1J 3VPRA 4LITA 1Z67A 3IRQA 3B6CA 5HLGA 2LY2A 2HQRA 2X6XA 4OINF 3L2CA 1MJAA 2CG4A 1ETQA 5TJJA 2F2EA 2IEKA 4UUVA 4ENMA 3W6JB 2Y0SN 4NQWA 4E7SA 1O7FA 3VDXA 2H1KA 4IRIA 4DYQA 2NAZA 3LWFA 4HX8A 2A6TA 1AHDP 2Y0MA 1FP1D 5GAHJ 2P7CB 1FLIA 5HS7A 2YUSA 1SAXA 5IT9Z 2VKVA 1R7JA 1TW2A 3VOEA 4M9XA 1YS6A 2CWEA 3ZN1A 4LD5A 4RM3A 4IHTA 2CFXA 3GLLA 1LFUP 1BC7C 1S8NA 3DBLB 1MSEC 5LGNA 1WJCA 1JT0A 1ZLJA 3PSFA 1B59A 3I71A 2QSGX 2K4BA 2RKHA 3KYLA 3PFIA 3A0HC 2H09A 1XGMA 3V8LA 2ME0A 2PFBA 2L4AA 1W7PB 2FRHA 2QQ9A 5E3LA 2HOEA 2VE8A 1BR4A 2E1NA 1ZR4A 2O03A 4M73A 1DU6A 3K4KA 4RGSA 4EEFG 4GXOA 1KYZA 5ERIA 2DFEA 4EM2A 2YS9A 1E3PA 4U0YA 3G4SI 3LA3A 1MW7A 4H4KC 3W3CA 2L01A 2GOXB 5EZGA 2I8DA 3HDDA 2C6YA 2CQXA 4QWQA 3SFIA 3HHGA 2LC2A 1LEBA 2CW0F 4BYYA 3MAJA 3ZQ7A 4M6VA 2FU4A 4FQGA 1VQ6I 2P5KA 5D6FA 2A68F 3FISA 1FYLA 4I98B 1OPCA 1XPXA 1LDDA 1R58A 1I27A 1H0MA 4IVNA 1W7PA 1X19A 1ZK8A 4XONA 1TNSA 2XAUA 4ZC3A 1SD4A 3C3WA 1OJLA 4R79A 1OFCX 2QSHX 2XVCA 3I0TA 4CCKA 1R4MB 3H0GJ 1MBGA 2V1UA 3K4BA 4YIIA 2KIUA 2GOMA 2JA2A 1O7LA 2Y30A 3K9TA 2IGKA 3F8BA 2O8KA 3GTOJ 2RQQA 4LIVA 4EATA 2GIVA 4YG2F 4HX4A 1Y6IA 2UUZA 1SMTA 3I3LA 3A03A 2ZFUA 3EDPA 3WE2A 1P7IA 4A5NA 2RNGA 3JRCA 4L0ZB 3SDGA 3GX4X 3OV8A 4L5IA 1TL8A 3M4OJ 4CCNA 3WTUC 2DCEA 4ESJA 3KZIC 3D5LA 2LG4A 1TQPA 3KLNA 2KRFA 2GZWA 4ZZLA 3D5SC 2CFOA 1OCZH 3UNGC 1Y1WJ 1FIPA 2AQEA 4BNCA 4HNVA 1UG2A 2UXNA 3VYTB 1QVUA 2M9HA 3WTSC 2Y69H 5LHGA 1AOYA 3CC4I 3VODA 3EQLF 3M8EA 4UY8I 3ZMSA 2EA4A 2KISA 2CQNA 4PGHA 2NS8A 1S7OA 4G6QA 2DAOA 3EUAA 3JSPA 3I55I 3I64A 3ZMDA 5M5WJ 2OTJI 3H3UA 3PUFA 3HM5A 1ZREA 3F8MA 2P7VB 3BJ6A 4I02A 2DMQA 2ZNZA 1LQ1A 3CQZJ 2MC3A 2GWRA 2XB5A 3AG1H 3SDBA 2LKPA 1ZTRA 2LFBA 2PEXA 2M45A 3O8GA 4GDFA 3TOBA 3EPZA 2JSPA 2K02A 3M1EA 4G7HF 2E2IJ 2ZFWA 3L00A 3NEUA 2EZLA 2FD5A 4A3CJ 1VQMI 1QO0D 2HU9A 4N9IA 2UWMA 2QZ8A 2GBYA 1K83J 3CC7I 5BQTA 3S14J 1YLFA 2DQRA 3PO2J 4ZH4F 4XRFA 2CH0A 1FBSA 3BG9A 1R49A 2KHMA 2WV0A 1MBEA 3FXLA 1WHUA 2MFZA 4B48A 5E1ZB 4YRVA 1H89C 1SD7A 1FIAA 2CW7A 1PJRA 1R1TA 3EUHA 3IAM2 4MO7A 4A6DA 4HA8A 1JGSA 3KZYA 1D1CA 4LK1F 3OIQA 3WG7H 2DODA 1ZHFA 3J81K 3CCRI 2LSOA 1EV7A 2EZKA 2XGCA 3OIOA 5DM7F 1DU0A 3ZPLA 3OL4A 1W7PD 2OCCH 2YU9J 2KRCA 2JRMA 4XN0A 4L0YB 1VQLI 1F36A 1TP4A 2R3SA 4PSXA 2B7EA 3DXJF 3CCYA 3U1DA 4E7IA 2B63J 3R4KA 4BAYA 3BG7A 4QPQA 1I3QJ 2BHZA 1R5ID 3AG4H 4C3JJ 5LLQA 3QAHA 3IAS2 3C7JA 3HXLA 2E5NA 1EH8A 3G2BA 3P9KA 3ROUA 4XRSG 4D9JA 2ICWG 3RKWA 4YFKF 1I3AA 4QTRA 3OYMA 3CCMI 1HCRA 4IZZA 2UZKA 1IDYA 1NG7A 3LQQA 2VQHA 4XSXF 3HOSA 1KQ8A 3FZVA 2NOGA 1LDJA 5H6RA 3KYCB 4DNCA 5DM6F 3I59A 2YR2A 4AYBA 2GA2A 2R93J 2H94A 3CP8A 3LL7A 2YU3A 3T8TA 2R5ZB 2CW8A 2DK5A 3R0JA 3VYSB 5GADJ 3KEOA 2H8RA 3V8KA 2KDOA 1JT6A 2O5RA 3CLOA 4IHSA 3IH2A 4RMNA 3OYAA 1X4OA 1B72A 5IP6A 1HF0A 4Q4ZF 2X51A 4L9NA 1MBJA 1IRFA 3NWSA 4AIDA 5IP9J 3IP4B 3T0YA 1EA3A 1KZHA 1Y39A 2M8EA 1ZKGA 2HGCA 4M72A 1TQMA 3L1PA 5DCFA 2BV6A 4Y33A 5F0HA 1VQ7I 1HA8A 2OV7A 2K5CA 4LOCA 3RKQA 4E7JA 2G7UA 5CYVA 5EG0A 3NQOA 4CZZA 2O9LA 4E7HA 2DTRA 3BCAA 1YW8A 4A3EJ 3Q0WA 5C4JJ 4FX4A 4HRIA 1Z6TA 1ZARA 3GEZA 3OIPA 1JTXA 3G3ZA 2FA5A 5F1RA 3GMEA 3E0JB 1T33A 5EEHA 3F6OA 3BR2A 2F4IA 2HVSA 3T5XA 3I54A 4ZZDA 1KQ9A 1DPRA 1X1CA 3KEYA 4PJLA 1Z3YA 2XSDC 5EEGA 3TP3A 3R0AA 1WSUA 1XGSA 3I4MJ 3K1MA 2ELHA 2LF8A 4HZFA 2HQAA 2XRNA 4JBAA 1YI2I 1GXQA 4XLFA 4ENNA 3EETA 3GFJA 2HOAA 1ETOA 2CSOA 2LDUA 2O3FA 3OMYA 2XKPA 4QSHA 3QQAA 4XOPA 3H9QA 3QYEA 2VJJA 1T6SA 2RC4A 3TQNA 2EJRA 1B4AA 1W4MA 1MMNA 4BKXA 2XGDA 2LKXA 3LSGA 5BMZA 2PLYA 3LA7A 4CUGA 2EFOA 2FMYA 4LG0B 3LSTA 2M30A 2M3AA 4RS8A 1GV5A 3F8FA 2K9QA 3DPLC 1IRXA 4MHGA 2DI3A 3OL3A 1REPC 1X1AA 1ZG3A 1JI8A 1VQKI 1MBHA 3QPSA 2IBDA 2ISYA 2EPFA 3OYEA 1VQ9I 1XCVA 2WB1N 3ECHA 5IT9K 1L0OC 4K2EA 1FT9A 2ZXIA 4WK8F 2IS2A 1R00A 1FSHA 3HIFA 4HBLA 1HSJA 3K2ZA 1D0YA 1TLHB 4G8XA 3Q3SA 1MBKA 2OQGA 3KP4A 1TTYA 1Z6RA 3FBIB 1S5LC 1YOVB 3KETA 2Y75A 1IV6A 1Z0XA 2E34A 3SJMA 2K27A 1W5TA 1X2MA 5D8KB 5FLMJ 3CUOA 4QIWN 3KP5A 3IH3A 3I4NJ 2BY2A 3F72A 2QWWA 1T39A 1OCRH 2OAZA 3JRBA 1KYWA 1MH4A 4DIQA 4IHWA 1IN4A 2RV8A 2I5UA 2EQRA 4XRSA 2X9DA 4HPQA 3FKIJ 3GTJJ 3PUBA 3GFMA 3GTLJ 5BPIA 2LBFA 2L3DA 2XPWA 5C44J 3BOQA 1NK3P 1OR7C 3BZKA 2L2OA 1JTYA 2WAQA 4BXXJ 2OBPA 5J6XA 4IF4A 2AO9A 3GYHX 1G6NA 5DTDA 3J7AO 3S17J 3S2HJ 2BYVE 1ZGWA 3CTAA 2DA4A 3QWLA 2XB0X 3X2QH 4IOCF 2PMZN 2WBMA 3HSFA 4L9VA 2XAJA 5F1JA 4DZJA 1EJ9A 5F08A 5LGUA 3NAUA 2DDBA 1PP7U 5J1RA 5DEQA 1MJ9A 4A3KJ 2XGEA 3PQKA 1LPQA 4KISA 2CUJA 1R71A 2IJLA 3QYBA 1D0ZA 5DCMA 2XROA 3OSFA 1HDDC 4XL9A 1GXPA 5E1WA 1DP3A 1FMWA 1JKQC 1ODDA 2ZSIB 3H92A 4IKFA 1BJAA 3AFHA 1X58A 3JCUC 2VQGA 4S0HB 5CVRA 3JRIA 3DKXA 2MD5A 4GRIA 1U8RA 1KGSA 2W24A 1RRJA 4JP0A 3FM5A 3Q5FA 4HDVA 2ADUA 4BQNA 3ELKA 5D8LB 4KFCA 1HKTA 1K79A 5DDGA 1ETYA 4OIOF 2EZHA 3RPUD 2V1NA 4HNUA 1MZBA 3VSLA 2X1EA 3GTPJ 1ON1A 5FO5A 1R36A 1NG6A 2KZGA 5FJ8J 3KP7A 1JKOC 4CCLA 4AUXA 4CICA 2VASA 1JKRC 2M2EA 2DA3A 2ZNYA 1YJNI 1R6RA 1ETXA 2VC0A 1GHCA 4M6YA 2DMPA 2RQPA 1JUMA 2V26A 1ENHA 2E7XA 4O6JA 1QPMA 3BJAA 1K6OA 1X1DA 5J4YA 4L9JA 3F23A 3M9AA 3OY9A 4N4OB 3GUDA 2RREA 1LVAA 5D5XB 2D1VA 1OCCH 2ZJ2A 9ANTA 2VL8A 3CF5F 2XF5A 3DBHB 2DU9A 2A07F 3BPVA 4CCOA 3MKWB 3ZQHA 1TWCJ 5EZHA 3ULQB 5IYBJ 1B9NA 2ELKA 4AIJA 4PUSA 2IS6A 1BI3A 3U21A 4PZJA 1G3WA 3A4CA 1BC8C 4E6KG 2GLOA 4I2OA 4UVBA 3L2WA 1A31A 1A6QA 4XQFA 1PDNC 5E18F 4FCYA 3GTQJ 1FYMA 1Q1HA 3FK7A 4G9YA 2V7FA 3S15J 2L0KA 1S29A 2VUMJ 4RAZA 2DBBA 2BY3A 2L9VA 5F27A 2A5WA 1G59A 2CV0A 3REOA 2LRDA 2K9NA 3HZJA 2A69F 4YFNF 3CLQA 1V55H 4RM2A 2FXAA 2P8TA 4DYCA 5D5WB 3KP2A 5IPAA 1VQ4I 4L18B 4V19K 4IRGA 2RDPA 3J80Z 1EH7A 3LSHA 2HXOA 3E5QA 4U0WA 4C9YA 2BVMA 1QPIA 3IH4A 1JJ6C 3B6AA 2E35A 1U6GA 3QYFA 2DO7A 4XLHA 1J59A 2K9LA 1FX7A 3TO6A 4XM3A 5KAFC 3SEZA 2HDDA 2HPIA 2PQ8A 3RQ4A 5CVJA 2VKHA 5B1BH 2QCOA 4AC0A 1P92A 1UHMA 3MKZA 2L9NA 2W48A 5TRDA 1ULYA 4UNOA 3G73A 2BBYA 5E8GA 3E5XA 3HBLA 4BDYA 2XRLA 2E1MC 3I4PA 3GF2A 1FYKA 2DOEA 5LRSA 3A02A 2NRAC 2H8WA 5BOXA 2LF7A 4UVCA 3BZCA 4RB3C 4C2TA 3KCCA 2QQBA 2F5CA 1XMXA 5ICEA 3GW2A 5H2FC 2HEOA 1GDTA 3OYDA 1WGXA 3GWZA 1EKEA 2JUCA 4XLCA 3DKYA 2EV0A 3TKYA 5D4SA 4Q47A 2XC7A 1D1AA 1RETA 1OKRA 5DUIA 1WKMA 4ABZA 2IAIA 4EMSA 4IL6C 4YIFA 3CCLI 1UJ8A 4BDZA 2LTPA 3C1DA 1WH7A 1X3ZB 2KIQA 1M1EB 3GTGJ 2G0EA 5IT3A 5JFRA 4OIQF 4N4NB 1BIAA 4YIRX 1UHSA 1OQYA 4XKWA 1X1PA 1FY7A 2ZXHA 2TCTA 3LFKA 1OYIA 1MNMC 3EYIA 3JRAA 4PJNA 4G7ZF 3FDYA 4J19A 3IKTA 4O3MA 2KP6A 2TRTA 3LMMA 4JK1X 5K5RA 3L2VA 4FTHA 2KMUA 4AU7A 4A69C 3CJTB 4B09A 2D1HA 2VBYA 5FKKA 1IN5A 3JW4A 1TWFJ 1I1SA 2E1OA 2XAQA 1U5TC 2HOSA 3GXOA 1I50J 3OS1A 1SD5A 1T0FA 1RUOA 5A2QZ 3MEXA 1Z3XA 1K4TA 3E6BA 2HPMA 2QKMB 4U88A 2DMNA 4BJ5C 2HTJA 3E97A 2F4OB 3ML6A 4CDGA 5HOOA 1YJWI 1USTA 3M07A 3NARA 3IRRA 1RNLA 4R1HA 4WX9A 2BZTA 1QA6A 4M3EA 2ID6A 1V3FA 2G9WA 4LK0F 5GPCA 4EVIA 1A35A 5HLTA 1H88C 3CUQC 4YFXF 1HW5A 3S2DJ 4NC8A 1XS9A 3QPLA 1I6HJ 1ZG5A 3NRVA 1F1ZA 1KQ0A 3OYCA 3D0SA 4CSWA 1TZLA 4WXCA 5CVIA 3S16J 4RGUA 2HZTA 3K10A 2AXLA 5J47A 5M3FJ 3OR1C 5HVQC 1Z7UA 4HG2A 2RGVA 3MVPA 3UR3C 1BL0A 3WE3A 1NHAA 3HKZA 1D8JA 4MGRA 4FE4A 3W6VA 5JLXA 3WTXC 4YEJA 2X6OA 4B3AA 4ETSA 3DV8A 2CUFA 2EK5A 4HF1A 1A04A 1BR1A 2EFNA 2HFHA 2Z5UA 3HRSA 4LJZF 2ID3A 2ESHA 4BUPA 1GT0C 2IT0A 3KE2A 3DTEA 4KITB 4RBOA 1X3UA 4G12A 4A0YA 1DGRM 1QRYA 1R5GA 2LREA 5B66C 1O3QA 2EH3A 1Z1DA 1WJEA 2M7BA 4RDUA 4M71A 1DUXC 2MD0A 5LD2C 2Z99A 1ZRDA 5L3BA 1WPKA 5ICFA 4XLAA 2E60A 3WGHA 3ASNH 4KA4A 2Q0OA 1V4RA 2V79A 2OQRA 1F9NA 5EJCA 1ZR2A 3AL0C 5LBQA 3F8CA 2JT1A 2QKLB 4F93B 4IRHA 1OYWA 3HB9A 2M8GX 1S72I 3WTWC 3C2BA 3OYIA 4EJOA 2FBIA 2MH9A 2LKSA 5K1YA 4BQQA 2HKOA 2VKEA 4XRMA 3K4JA 2LOOA 2R7OA 1R23A 1ITYA 3KLOA 1VFCA 1IZ1A 2BE5F 3FMRA 3V8JA 3AG2H 1P4AA 4HQEA 2VC1A 1TWHJ 4KMFA 2TDXA 5FD6A 3BZ6A 2AS5F 2QBYB 2E1MB 4G94A 1QGPA 2KKOA 4P55A 2CUZA 2A05A 2O8XA 3CCUI 2Z33A 1OYYA 2ZJQF 2PMUA 4XOTA 2DW4A 2BGCA 1U3EM 5D5VB 3OYGA 4PJ0C 3LNQA 2P5LC 1WJ5A 4J01A 4OAZA 5J3LA 3DLAA 2K85A 4XORA 1FTTA 5FFXA 3TL4X 3TMOA 4NB5A 4HLXA 3B73A 4BEHB 4D5CA 3G71I 3HTSB 4MNUA 2DA5A 1XD7A 4U7DA 2CUEA 1K78B 2JZYA 5HNFA 1XN7A 2EV5A 4LLNA 5BPDA 1EH6A 1TT5B 1QNTA 1C0WA 3SYTA 4XK4A 3MFKA 1QZZA 4XKVA 2CV1A 1W0TA 4I99C 3GBGA 2DFIA 2VBWA 2A5YB 2WY7Q 2FJ1A 1HW2A 3LSRA 1MMAA 2QM3A 2VJIA 3L2RA 3A2KA 4RB1A 3J7ZI 1EF4A 2FNAA 4E7KA 2BY0A 5F04A 5TGTA 4L9TA 3ZQIA 2P81A 4LB5A 3HRTA 3CESA 1LJ9A 1QHHD 1IRGA 2DJNA 2DFHA 3F9KA 2NVQJ 1T38A 3HOUJ 4PFPA 3GZNB 3N97A 4BEHA 1VF9A 3RQIA 2M0MA 1U5TB 2K3FA 4A3DJ 3HKZN 3TGNA 4G7OF 4DZPA 2R7DA 4U7BA 4RGRA 3WU2C 3H35A 2Y2ZA 3O8HA 2LNBA 1Z77A 3GVAA 2RN7A 4ASNA 2DN0A 5E3OA 5M5YJ 1E17A 1WCMJ 5AONA 1N25A 1IF1A 3HOZJ 3TO7A 1BOAA 1Q1VA 1XMKA 1T56A 4I0AA 4RLFA 2EZIA 1H8AC 5FRMA 5KK1A 3DTIA 4C3IJ 1BIBA 1KA8A 5BS6A 1R22A 4V2GA 1RUNA 2F5EA 1UCRA 5KHDA 2VQLA 5FKMA 2K4JA 1Y8RB 4LLLA 2ELJA 2XUBA 5CLSA 2GAUA 1APLC 1F43A 1YJ9I 5KNLA 3E6CC 1U5TA 3SFZA 1I6XA 5IOYA 3A0BC 1DGWY 2D2WA 3C18A 1OLTA 3V7RA 3JRGA 4FX0A 1TNTA 2V6CA 3VEPA 3HJEA 4E7LA 5L3DA 2Z1DA 4ESBA 1O3TA 3GFLA 1W36C 1LKXA 2W25A 1R5HA 2NYXA 4ZDLA 2AHQA 5B5EC 2E5ZA 1I5ZA 2ZB9A 1XTAA 3K4NA 2HQ5A 2HKXA 4OAYA 4OWRB 4CO8A 2E2HJ 1Y0NA 2W4SA 3ONQA 4HDUA 1CF7B 3ZGKA 2D45A 5F0CA 3ABKH 1V54H 2QYOA 5DUKA 1UB9A 4RAFA 2PG4A 2QA4I 1AU7A 2VXZA 1S6LA 4BJTA 1MMGA 2R5ZA 1JXSA 1FC3A 3FF5A 5LEKA 3J80K 1RPWA 1BW5A 4AVZA 2EIJH 1RC9A 3BG3A 1JHFA 3LOCA 2MW8A 4A3JJ 2GXAA 3S3MA 3RJPA 3W6KB 3JRDA 4DGWB 5EEAA 3AL0B 2LY9A 2NVYJ 4HV5A 4V2FA 3PQJA 1VNDA 4BXUA 3WTTC 1POGA 2OJED 1UG0A 3PSIA 3LA2A 4KT6A 4X1EA 1K4SA 4ITVA 3MN2A 5E8IA 2K9MA 2IA0A 2FBHA 2K40A 1IGNA 4BQOA 3G1LA 2NS7A 3CMMA 4GCVA 4Y3OA 2ZKZA 3B02A
chains in the Genus database with same CATH topology
1ERDA 4CCMA 2VASA 1UAAA 3ZR8X 4IQJA 1R6RA 2V26A 1Z21A 1V5EA 2BOLA 1X1DA 3CJRB 4YELA 4RM3A 3OY9A 4N4OB 1D0XA 3OWTA 4B43A 2RREA 4PSWA 3PJRA 1SAUA 1YX3A 4NC7A 4U87A 2VL8A 1WJCA 3TBIA 3PSFA 2XF5A 3CJQB 4LG3A 4CCOA 3KYLA 4BJ6C 2DOAA 2W1OA 3MKWB 3W2VA 4E7ZA 2XF6A 3OYKA 4PUSA 3FKJA 2IS6A 3OYHA 1GLNA 1BR4A 3U21A 4FETA 3K4KA 2IS4A 3A4CA 4E6KG 2M4GA 4JQFA 3L2WA 1E0EA 4PJJA 4XQFA 3OOUA 2BVLA 1X4PA 3ZXSA 2KLOA 3K70C 1MW7A 3N05A 4H4KC 2V7FA 3W3CA 1N75A 2GOXB 3OYNA 2I8DA 2R7RA 2KRHA 2LC2A 2A5WA 1G59A 2CV0A 2LRDA 2M7AA 2JVGA 4BACA 2VKDA 3HUGB 1X19A 4RM2A 3KX2A 4XONA 3ZRGA 2K3PA 2XAUA 4ZC3A 4XR6A 4R79A 3LSHA 4C9YA 2BVMA 4CCKA 2KPMA 2WB1A 2DJIA 3K4BA 3ZQQA 1T95A 2IGOA 2GOMA 2JA2A 2XSJC 2IGKA 2WAEA 3PNYA 3QYFA 2Q2EB 4XLHA 2RQQA 4LIVA 2VIXA 4EATA 2K9LA 2OUMA 3EUKL 3L2QA 1LVKA 2WY8Q 4XM3A 2VJ4A 2L9SA 1Y6IA 2UUZA 3SEZA 3I3LA 4XNFA 2ZFUA 2F5VA 2HPIA 2RNGA 3K4MA 3OYFA 3RQ4A 2VKHA 4CCNA 4XLEA 2DCEA 2HVQA 3D5LA 2LG4A 2L9NA 3MKZA 3LSMA 4QPOA 2Z16A 3DU5A 3D5SC 2CFOA 1BR2A 3UNGC 2AQEA 3VYUB 4BDYA 1FMVA 2E1MC 3VYTB 3VYRB 1K6YA 5KCMA 4DOZA 2W82A 1PYVA 3OYJA 4C2TA 3HG9A 1VZ0A 2IGNA 3HL2A 3EUAA 3VWBA 4BE0A 2LY1A 3QODA 3HOTA 3OYDA 2R7SA 2V9KA 4XLCA 2X6WA 3DKYA 3E1SA 3HPGA 1D1AA 2XC7A 3CF2A 2PMZA 4BDZA 3H9GA 3SDBA 2IXSA 3DU6A 5CQGA 2DT6A 1D1BA 4N4NB 2L7KA 4PFOA 4BXFA 4XKWA 3EPZA 1MMDA 3HC7A 2CS3A 4BGDA 3OS0A 2ZXHA 2MYSA 2JSPA 3OYLA 2WADA 4PJNA 3FDYA 1MNDA 2KP6A 3L2VA 3LMMA 2KQRA 2UV1A 1YX5A 4JOMA 2KMUA 4ZDPA 4AU7A 4DJAA 2HU9A 2UWMA 3NWTA 2MC4A 4ZYAA 3OS1A 2KL4A 2CH0A 1QU3A 2KHMA 4B48A 1SFKA 2MFZA 1Z3XA 3I9V2 4CH7A 4YRVA 2HPMA 2QKMB 4BJ5C 2CW7A 1PJRA 2DT7B 5HOOA 3M8JA 1BOBA 2Y0SA 4B3XA 3IAM2 3RSNA 2R7XA 2X1CA 4CA0A 3M1CA 3C2GA 4BE1A 1D1CA 2R4GA 3OIQA 3QOEA 4II3A 5FROA 3OL4A 3K6GA 2ZSHB 2KRCA 4ZDOA 4XN0A 5HLTA 4NC8A 4HNTA 3J7AY 4F55A 4PSXA 1Y56A 4E7IA 3OS2A 2WA0A 3OYCA 2AQFA 4MLOA 3FBNB 3BG7A 4CSWA 4QPQA 1TZLA 1LDKB 2Z2SB 4E4HA 3IAS2 3K10A 2W00A 3OR1C 3HXLA 2E5NA 2LBFB 5HVQC 1Z7LA 4HG2A 1S9HA 3G2BA 2BW3B 3LSKA 3UR3C 4BS9A 4D9JA 1MNEA 3IUOA 3OYMA 3HKZA 4IZZA 2VXDA 2VLAA 1NG7A 2VQHA 3HOSA 3CP2A 4YEJA 3D5RC 2VJ5A 3RCOA 3H5NA 2XDVA 1BR1A 1P9QC 2IGMA 4IQ4A 4AYBA 4BUPA 3CP8A 3LL7A 1YE9A 2VQCA 3DTEA 4KITB 2CW8A 3DQVC 1DGRM 3VYSB 2LREA 2V6EA 2KDOA 2F6CA 3DTKA 5FRNA 1UELB 1WJEA 2M7BA 5CPRB 1LFPA 3DPUA 2O5RA 2DXIA 4RMNA 2MD0A 3OYAA 5LD2C 1X4OA 4XLAA 2HDWA 2E60A 2WAFA 2X51A 3MMYB 3NWSA 4HEA2 4NUBA 3IP4B 4B47A 3AL0C 1EA3A 2QKLB 4F93B 4X0GA 3H5RA 1W36D 1WJFA 4Y4RA 4C2UA 3OYIA 4Y33A 1HA8A 2OV7A 4BQQA 2W7NA 3K4JA 2K5CA 2LOOA 2X85A 1KONA 1T0FC 2R7OA 4E7JA 4F52A 4RLQA 3S8PA 5CQEA 4E7HA 3PNVA 3VSKA 3BCAA 1WJBA 4DBRA 3SEQA 2E1MB 4HRIA 3DWLE 4F91B 2CUZA 3OIPA 4PK4A 1J09A 4XOTA 2VPLA 1U0JA 3OYGA 1WJ5A 3E0JB 4J01A 3CZ6A 4OAZA 4ZTJA 2F4IA 3DLAA 3DEEA 2LH9A 3W2AA 4XORA 2IS1A 2HVSA 4B44A 3TL4X 3TMOA 4CZCA 2P0WA 1X1CA 4P5OA 4BEHB 3MKYB 2R7WA 3KEYA 4PJLA 1Z3YA 4XN3A 2R7VA 5HNFA 2R7UA 2FUG2 2PJRB 1V5GA 3SYTA 2HQAA 4XKVA 2CV1A 3GBGA 3S3OA 2WY7Q 4XLFA 2VB6A 3OMYA 1MMAA 2VJIA 3L2RA 3A2KA 3LSIA 4XOPA 3H9QA 3QYEA 2VJJA 2R7TA 1N78A 4E7KA 1MMNA 3BG6A 5HNHA 5TGTA 1G8XA 2NOJB 3CESA 3LSGA 1QHHD 3PL8A 4CUGA 4ZTFA 3F9KA 2M3AA 4PFPA 4HSRA 4D1QA 4BEHA 3DPLC 1IRXA 3S93A 2M0MA 2MABA 3OL3A 3PNTA 3AKZA 1X1AA 1JI8A 1N77A 2R7QA 3H5AA 4CCJA 4U7BA 4BL0B 3H35A 2CV2A 3OYEA 2PJRA 3K4CA 4LIUA 3BC8A 2ZXIA 2IS2A 3BCBA 1ZELA 3DPTA 4IX7A 4F92B 1DQUA 1D0YA 3S32A 2X6YA 3ZCOA 3BLYA 3FBIB 4KJZA 1V5FA 2HVRA 4RLFA 3MD2A 5FRMA 4BU2A 3DTIA 5LFAA 5KHDA 2VQLA 2ELJA 4C30A 3C2HA 3OYBA 4HSTA 1WFXA 2Q1ZB 5KNLA 3V42A 3W2WA 1DGWY 4ZJZA 3K70D 3K4LA 1OLTA 5CKTA 4DIQA 4DBQA 2JUGA 4HPQA 2XF7A 3PUBA 4XMYA 4XKBA 4E7LA 2Z1DA 2LBFA 1W36C 1LKXA 1X1BA 4XKCA 4ZDLA 1OR7C 3L2UA 3H0DA 2BW3A 2L2OA 2HZDA 2JVHA 4BE2A 2WAQA 2E5ZA 2KZVA 3SZGA 1TT0A 3K4NA 4J00A 4OAYA 4OWRB 4ANJA 5JHFA 4F3QA 2W4SA 1WJAA 3ONQA 3PFYA 3ZGKA 2WBMA 4PJMA 3FHNA 2LYCA 4NQWB 4NNJA 2VXZA 4BJTA 4FASD 3H9JA 1MMGA 2V4JC 4KISA 3A1YA 3OR2C 2CUJA 4AVZA 3QYBA 1D0ZA 1QHGA 3EUHC 4XL9A 2HNHA 1DP3A 1FMWA 2ZSIB 4IKFA 3AFHA 3S3MA 2L5QA 2VQGA 4DGWB 3AL0B 3LFUA 4P1WA 4G6TB 3DKXA 2OC6A 4LITA 3RTRA 4GRIA 2LY2A 2X6XA 1UG0A 3PSIA 4KT6A 4BQNA 4ITVA 2M4KA 1WJDA 1AA7A 3HPHA 2K9MA 2V1NA 2X1DA 3RPUD 4HNUA 3VSLA 2X1EA 4E7SA 2CMPA 3VDXA 4BQOA 3S3NA 1NG6A 4II2A 3CMMA 4Y3OA 4CCLA 2A6TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZC3 A;  3ZQQ A;  2CMP A; 
#chains in the Genus database with same CATH topology
 4IHV A;  5BNG A;  3WTV C;  1UAA A;  2M34 A;  4IQJ A;  1RI7 A;  3F22 A;  2L7M P;  4Y13 A;  3GTM J;  1Z21 A;  2PI0 A;  1DP7 P;  2BOL A;  2O61 A;  2YPR A;  1YFH A;  2NS0 A;  3RPU A;  3P7N A;  3OWT A;  3P9I A;  2HTS A;  5IY5 H;  4PSW A;  4O5V A;  1D5V A;  1SAN A;  1T98 A;  1XSD A;  3FK6 A;  1SAU A;  4M9S A;  3QP5 A;  3JRH A;  3BR0 A;  3CDL A;  3ABL H;  3PJR A;  4NC7 A;  4U87 A;  4EV0 A;  4OIP F;  4BQA A;  1L3L A;  5F64 A;  3TBI A;  3UKG A;  1MMS A;  3MZ8 A;  1XG1 A;  2ECC A;  3CJQ B;  1SFX A;  4HX7 A;  4LG3 A;  4MFE A;  4EJU A;  2EIM H;  5AIQ A;  2O6G E;  2DOA A;  4MEY F;  2W1O A;  4P9F A;  4E7Z A;  2XF6 A;  1TC3 C;  1J7K A;  3HSE A;  3TP0 A;  3OYH A;  1GLN A;  1UFM A;  5CJ9 A;  2VE9 A;  4FET A;  3GTK J;  2IS4 A;  2NVT J;  2IP2 A;  4IJA A;  4ESF A;  3U1K A;  4AYB N;  4I09 A;  4PJJ A;  3OOU A;  2BVL A;  3ZXS A;  3FWE A;  3T1B A;  3J7Y J;  2KLO A;  1O3S A;  2OTL I;  3K70 C;  1N75 A;  2A6H F;  2DTZ A;  2ZXJ A;  1KU9 A;  2R7R A;  4D7N A;  5A2Q K;  3G6E I;  4LG0 A;  4IOA F;  3FM3 A;  2H6B A;  4IHY A;  2FOW A;  2JK3 A;  2IPQ X;  2Y9Y A;  3QPT A;  1MIJ A;  4R8H A;  4HW0 A;  1MBF A;  3GZ6 A;  4MFD A;  4FIS A;  2JVG A;  4TV7 A;  1ZGA A;  5GPA A;  5KVR A;  2VKD A;  4RB2 C;  2R0Q C;  1XC5 A;  3KX2 A;  1XGO A;  1IW7 F;  2DA2 A;  1G3Y A;  1RES A;  2KJC A;  3HEF A;  5E20 A;  1ONV A;  2DJI A;  3ZQQ A;  5F0F A;  1T95 A;  4KDP A;  2IGO A;  4I6Z A;  3LQR A;  2XSJ C;  4FT8 A;  2WAE A;  4EJT A;  2Q2E B;  4HV6 A;  5HOD A;  1HKQ A;  2OUM A;  4ZYH A;  1LVK A;  4M9Z A;  2VJ4 A;  5IP7 J;  2F5V A;  3IL2 A;  4EJW A;  2EIN H;  3K4M A;  3KP3 A;  4XLE A;  3ABM H;  2DYR H;  2ZJR F;  3ISP A;  2HVQ A;  1LB2 A;  3ZQL A;  3CCQ I;  2JTV A;  4UV9 A;  3DU5 A;  2MLG A;  2J5P A;  4IHX A;  1ZLK A;  4OOI A;  4HLY A;  1FMV A;  2PBI A;  3MKL A;  3WTZ A;  3VYR B;  4M3D A;  2OD5 A;  4AVP A;  3BR6 A;  5KCM A;  2W82 A;  1PYV A;  1HXD A;  3DEU A;  3BR3 A;  1SMY F;  3HHH A;  5M3M J;  4I01 A;  1VZ0 A;  2IGN A;  1JJ8 C;  1TWG J;  5TIS C;  3VWB A;  5LHI A;  1VQN I;  3QOD A;  4A6E A;  2HYG D;  2R7S A;  2JRT A;  4L5E A;  5ICC A;  1SVM A;  1VTN C;  1U8B A;  2KIF A;  3BJO A;  3DBR B;  3WHB A;  3SQN A;  3JRE A;  1KU3 A;  2LK2 A;  3F3X A;  4OU0 A;  1J9I A;  4UUS B;  3DF8 A;  3BRO A;  3DU6 A;  4UV8 A;  5CQG A;  2DT6 A;  5C3E J;  2ETH A;  2OA4 A;  2GXG A;  1FP2 A;  2CS3 A;  1XX5 A;  3LAJ A;  1WQ2 A;  2XKO A;  3MZH A;  1JUS A;  3SZP A;  2KQR A;  2UV1 A;  5DS9 A;  4Y52 J;  4JOM A;  5EGO B;  1E2X A;  1I1G A;  2OU2 A;  2KFD A;  4X6A J;  3NWT A;  1SVO A;  1PVE A;  3K69 A;  2HWV A;  4ZYA A;  3H3V K;  5JR3 A;  1QU3 A;  5HLI A;  1YRN B;  1XMA A;  4OMY A;  2WV1 A;  3I9V 2;  4CH7 A;  1R9T J;  1TBX A;  4KNY A;  3M8F A;  1BOB A;  2Y0S A;  4UUS A;  5E79 C;  3RSN A;  4CA0 A;  3M1C A;  1J75 A;  4I0B A;  5DD8 A;  4BE1 A;  1BN5 A;  2R4G A;  2DPU A;  4B4C A;  3QOE A;  5FRO A;  3ZOB A;  3K6G A;  4WXD A;  2ZSH B;  1QVT A;  1SC7 A;  2NVX J;  4ZDO A;  4M3F A;  2MSY A;  4HNT A;  2JWT A;  3J7A Y;  1Y56 A;  5K7Z A;  3JTH A;  1CQT A;  1LUJ B;  3OS2 A;  2A3S A;  2EIL H;  2WA0 A;  2WC2 A;  4MLO A;  4KUM A;  1VQO I;  5J1Y A;  1YRN A;  1LDK B;  2Z2S B;  4A0Z A;  5H6Q A;  4MTD A;  2WAQ N;  1Z7L A;  5FLX Z;  2HYJ A;  3ZMU A;  3M7G A;  2BW3 B;  3K1N A;  2NNN A;  3LSK A;  1MNE A;  3IUO A;  5ILV A;  3TO9 A;  3E5U A;  4F7Z A;  2ZO4 A;  4LGW A;  2WWY A;  2VXD A;  4BHC A;  2HDC A;  4A93 J;  2VOD A;  1H9G A;  2CYY A;  4CXF A;  3MZY A;  3D5R C;  2VJ5 A;  1F4K A;  3RCO A;  1WRJ A;  1P9Q C;  4IQ4 A;  4CYC B;  1MDM B;  4RAG A;  3BG5 A;  1R1V A;  3DQV C;  1HQC A;  1GV2 A;  5EYR A;  3DTK A;  1RZ4 A;  4A0X A;  1LFP A;  2EA2 A;  3DPU A;  3H1C A;  2DXI A;  2VBZ A;  1O57 A;  5D5U B;  2CQ7 A;  3ERE D;  3BWG A;  3ASO H;  4U0V A;  2WAF A;  1Y0U A;  4I76 A;  3BTJ A;  2VBX A;  3MWM A;  4BY7 J;  3COA C;  2Y31 A;  4HEA 2;  3Q0V A;  4I7H A;  2QQ8 A;  4B47 A;  3GLX A;  2CQK A;  3ZMZ A;  2I10 A;  3DKW A;  2ESN A;  4A3F J;  1J0R A;  4WWC A;  2ZXW H;  4M3G A;  4X0G A;  2KT0 A;  2QGU A;  3H5R A;  3TW6 A;  4EM1 A;  5J4V A;  5EDN A;  1WJF A;  1ZGJ A;  3CCJ I;  3O6B B;  4XID A;  5HDN A;  1W36 D;  4KYW A;  5ILS A;  5M5X J;  1MDM A;  1DDN A;  2ACJ A;  2P5V A;  2GM4 A;  5HS9 A;  4BBS J;  2HOT A;  3JSO A;  1KON A;  5KAI C;  4F52 A;  1RIO H;  4HYE A;  1A36 A;  5CQE A;  4WCG A;  5GP9 A;  1SFO J;  3PNV A;  3VSK A;  4LLG F;  1IN7 A;  3TED A;  3KIO A;  2XIG A;  4DBR A;  2VOO A;  3SEQ A;  2YX4 A;  1SFE A;  4F91 B;  3I5U A;  2JA5 J;  1NTC A;  1VQ5 I;  5L3G A;  5AIP A;  2JJ7 A;  2VPL A;  1OR7 A;  5ICG A;  3CZ6 A;  4ZTJ A;  1U9N A;  3DEE A;  2OCE A;  5K5O A;  2V1D A;  2O7O A;  3BTC A;  4CZC A;  3CMA I;  3BP8 A;  4P5O A;  3MKY B;  1RR8 C;  2R7W A;  2MA3 A;  2FBK A;  1OIS A;  1J5Y A;  3VB2 A;  3MCZ A;  4A3G J;  2R7V A;  2O0Y A;  5JLW A;  3L7W A;  2R7U A;  3WOD F;  1ORK A;  5ED4 A;  1V5G A;  4A3L J;  1ETK A;  2RAE A;  3RI4 A;  4AIK A;  4ENK A;  4N0B A;  3EYY A;  1IRZ A;  1BI1 A;  1NH3 A;  3WGG A;  3LSI A;  2R7T A;  2P6S A;  5E17 F;  1MGT A;  2STT A;  3S1M J;  5HNH A;  1G8X A;  1U2W A;  2NOJ B;  3MQ0 A;  1WWX A;  3F21 A;  2QEN A;  1LNW A;  1OMI A;  1WI9 A;  3KFW X;  4W1U A;  1JKP C;  3DFG A;  4XLN F;  2K86 A;  2D5V A;  4HSR A;  2MG4 A;  2MH2 A;  2ISZ A;  4CHU A;  3PNT A;  2M0C A;  2MAB A;  1K7A A;  3SXY A;  3P9C A;  1USS A;  4AM3 A;  3RKY A;  3JTG A;  5LRR A;  3M3Y J;  4QLC U;  4MQV A;  3ZMV A;  3H5A A;  2CRG A;  3FXM A;  3E3V A;  4BL0 B;  2CV2 A;  4FHT A;  3JAM Z;  3K4C A;  4LIU A;  2DMU A;  5J8C A;  4B1R A;  1HOM A;  1PP8 F;  2XAH A;  3O3K A;  1IXC A;  1ZEL A;  3DPT A;  3E6D A;  3I58 A;  3AAF A;  4IX7 A;  2XV4 S;  1RR7 A;  4F92 B;  4NDL A;  4GYG A;  1XDS A;  1GVD A;  4UHT A;  3ZCO A;  2R7F A;  3QPH A;  4KJZ A;  1FBQ A;  1HST A;  1YIO A;  4E70 A;  2L02 A;  1U9O A;  4A2U A;  4AD9 A;  4C2M J;  5H20 A;  2XGX A;  3FXK A;  2HR3 A;  5DD4 A;  5CVU A;  1BJZ A;  1ZAO A;  1WVR A;  4C30 A;  2E2J J;  1SD6 A;  4AWX B;  4C3H J;  4HST A;  2Q1Z B;  2DQL A;  2MLK A;  2KJB A;  3G1O A;  3K70 D;  4DW6 A;  5CKT A;  2BY1 A;  2CJJ A;  1IN8 A;  1MH3 A;  3CJN A;  1FZP B;  2ZBK A;  1MD0 A;  2JUG A;  3E6M A;  5JVG F;  1IXS B;  2EFP A;  2FEZ A;  2N8G A;  3TOA A;  4ZYG A;  4ZYE A;  1FTZ A;  3RDI A;  2X0L A;  1YIJ I;  1X1B A;  1TQI A;  4BH9 A;  5L3E A;  3L2U A;  4P96 A;  3H0D A;  1B1B A;  1ZQ3 P;  4BE2 A;  3SZG A;  2KZV A;  2XHK A;  4LFU A;  1YW9 A;  5DYM A;  1IXR C;  3SHF A;  5LEJ A;  1AKH B;  3E7L A;  3CDH A;  3L09 A;  4J00 A;  1G4D A;  5FKN A;  5JHF A;  1O3R A;  1GVJ A;  1Y1V J;  1IG7 A;  4XLP F;  1FEX A;  1D8K A;  1BI0 A;  2FF4 A;  3FHN A;  2HS5 A;  4NNJ A;  2E19 A;  3OOP A;  3F8N A;  4FAS D;  4OMZ A;  3H9J A;  5IOZ A;  1Z05 A;  4G6D A;  3PIP F;  1MSF C;  3A1Y A;  2QVO A;  5HLH A;  1QHG A;  3CCV I;  2XAS A;  2L9R A;  3FMS A;  5FD5 A;  2M87 A;  3DP7 A;  2JMW A;  5LHH A;  3LFU A;  4P1W A;  4G6T B;  1Z9C A;  2OC6 A;  4GGG A;  1XCB A;  1AKH A;  3RTR A;  3RZD J;  3S2W A;  2OPT A;  3RPQ A;  4PGG A;  1B6A A;  2DK8 A;  2YX7 A;  3WTY C;  1FOK A;  2M4K A;  1WJD A;  1AA7 A;  2L4M A;  3ABT A;  2X1D A;  3HPH A;  4UVA A;  1NK2 P;  4KIC A;  2CMP A;  5IYD J;  4MTE A;  4D7M A;  3S3N A;  4II2 A;  2B0L A;  4DYR A;  2DA6 A;  1IC8 A;  4FE7 A;  2X4H A;  3PM1 A;  1ERD A;  2NXN B;  3I53 A;  4CCM A;  3QRF F;  3ERM A;  2GXB A;  3ZR8 X;  2IRF G;  2VN2 A;  2JN6 A;  2DOF A;  3BR1 A;  2IA1 A;  1FOX A;  1R4N B;  2QBY A;  1V5E A;  4EGY A;  1QBJ A;  3RZO J;  4A3B J;  3CJR B;  4YEL A;  5J40 A;  3WU0 A;  1D3Y A;  2OF7 A;  1FOW A;  1D0X A;  4B43 A;  3CME I;  3WG9 A;  4A3M J;  1PUE E;  3G1M A;  4NBQ A;  4B8X A;  1P4W A;  1YX3 A;  4A12 A;  2JPB A;  5GTI C;  3CD6 I;  4A3I J;  3HTU A;  4NC6 A;  3BTL A;  1IAW A;  1JE8 A;  2JPC A;  4H0E A;  4BJ6 C;  1K78 A;  3W2V A;  1IO2 A;  3ECO A;  4M74 A;  3IWZ A;  2ECB A;  3OYK A;  2E7W A;  1FPQ A;  2CGP A;  3FKJ A;  1F5T A;  2UXX A;  1S7E A;  3HGG A;  1WI3 A;  2LD5 A;  4D0P A;  4GFB A;  2M4G A;  1I39 A;  4JQF A;  1D5Y A;  1E0E A;  1HBX G;  1X4P A;  3TW7 A;  3Q9S A;  4Y7N J;  3I59 B;  3K0L A;  3WGI A;  3N05 A;  2CQQ A;  4JX6 A;  1IUF A;  2W84 A;  3OYN A;  5JHU A;  3GZ5 A;  1OCT C;  3CUQ B;  4M6X A;  1KU2 A;  3H36 A;  4Q5S F;  3KP6 A;  3CCS I;  2KRH A;  3V7S A;  1BW6 A;  1U78 A;  2ME6 A;  4BHB A;  1FNN A;  2NNY A;  1B72 B;  2M7A A;  1WH5 A;  2F4M B;  2P4W A;  4BAC A;  4IPA A;  3IWF A;  1AWC A;  3HUG B;  1XSV A;  5FKL A;  1FOY A;  3ZRG A;  2K3P A;  2ZC2 A;  4XR6 A;  2EFW A;  2DPD A;  1E3H A;  2KPM A;  2WB1 A;  3ZP5 A;  2DFF A;  3PNY A;  2W57 A;  3ZN0 A;  6PAX A;  2VIX A;  1W5C C;  5FKO A;  3EUK L;  3L2Q A;  2QSF X;  1BI2 A;  5HDG A;  2R5Y B;  1O4X A;  2WY8 Q;  1UMQ A;  2V1X A;  4RB0 A;  2L9S A;  2VI6 A;  3CUQ A;  4XNF A;  1ZRF A;  4P9U A;  1IV8 A;  2COB A;  5EG0 B;  4JYK A;  3OYF A;  3KZZ A;  3FHZ A;  4D5F A;  3IV5 A;  4AIH A;  1RKT A;  5FLX K;  3HGY A;  4HF0 A;  2M5W A;  3LSM A;  2L54 A;  2JA6 J;  4QPO A;  2Z16 A;  3WHC A;  3HUG A;  3QOP A;  1BR2 A;  4EM0 B;  2EBI A;  4JX4 A;  3BPX A;  3F6V A;  1ZG1 A;  3VYU B;  3LAP A;  3ZQC A;  4GYI A;  2XAF A;  3LSP A;  4UB6 C;  4ENJ A;  1K6Y A;  4BBR J;  2EWN A;  2VON A;  2BXZ A;  2DMT A;  4DOZ A;  2BHY A;  4EQQ A;  5K5Q A;  3OYJ A;  3OSG A;  1SFU A;  3HG9 A;  4M3B A;  2JSC A;  3P5J A;  4OIR F;  2DT5 A;  3ZQG A;  3HL2 A;  2R5Y A;  4BE0 A;  2LY1 A;  5F6F A;  3HOT A;  4IXA A;  3RKX A;  2Z9O A;  2V9K A;  1FBU A;  2X6W A;  3E1S A;  4NHJ A;  5IYC J;  3LSJ A;  1CF7 A;  3WU1 B;  3HPG A;  2B9S A;  1ETW A;  1X2N A;  2FE3 A;  1SVL A;  4DQ2 A;  1HLV A;  2OZU A;  5FFZ A;  3CF2 A;  2PMZ A;  3S1Q J;  1ETV A;  3H9G A;  1R1U A;  3ZQF A;  1YQA A;  2IXS A;  2RVC A;  2GQQ A;  5K7F A;  2MBF A;  1K61 A;  3K1P A;  2IW5 A;  1D1B A;  1PUF B;  2L7K A;  4PFO A;  3K2A A;  1H9T A;  4BXF A;  3PIO F;  1MMD A;  3HC7 A;  4HQM A;  4PCQ A;  2H6C A;  4BGD A;  2MYS A;  3OS0 A;  4MQ9 F;  1P2F A;  1W1W E;  2WAD A;  3OYL A;  1W0U A;  1ACI A;  3HOV J;  1MND A;  3BTI A;  4EJV A;  3I56 I;  1YX5 A;  5LGT A;  3S1R J;  5K7H A;  4ZDP A;  4DJA A;  3KEQ A;  4WF2 A;  2ZME C;  4XIC A;  4XSZ F;  1G3T A;  2MC4 A;  3HRM A;  2BXY A;  2KL4 A;  5J1U A;  2Y48 A;  3D1N I;  1ON2 A;  1SFK A;  1YHQ I;  3JRF A;  1T08 B;  1BBY A;  4KN4 X;  1VQP I;  5GTH C;  2DT7 B;  3M8J A;  2PJP A;  1OCP A;  4B3X A;  2R7X A;  2X1C A;  3C2G A;  2PN6 A;  1PUF A;  2CO5 A;  4GO1 A;  5FLV A;  3R61 A;  4II3 A;  1ZN2 A;  4Z6Y A;  4S04 A;  1LEA A;  2EFQ A;  3KPH A;  4KIG A;  3CCE I;  3TDU C;  4HAM A;  3U9G A;  4F55 A;  1X3W B;  3PO3 J;  5JVT A;  2H1L A;  2AQF A;  3KYD B;  1HKS A;  3FBN B;  2JQ7 A;  3HRU A;  2K7L A;  3HOX J;  4E4H A;  2W00 A;  3L9F A;  2LBF B;  4LB6 B;  3DCF A;  5GAG J;  1FWZ A;  5HS8 A;  3K7A J;  3AG3 H;  4UXN A;  1S9H A;  1TW3 A;  5CVV A;  4BS9 A;  5B3S H;  2J5O A;  3Q0U A;  2ZCW A;  3FIW A;  4PDK A;  1HDP A;  2DLL A;  2G7H A;  2F5F A;  2VLA A;  3N4M A;  3SZT A;  3CP2 A;  3V7C A;  3IC7 A;  2DA1 A;  2AXT C;  3ZMT A;  3HOW J;  2COM A;  3H5N A;  2EV6 A;  2XDV A;  2IGM A;  1HW1 A;  4JX5 A;  3JAM K;  1YE9 A;  1A6I A;  1S7A A;  2VQC A;  2FNP A;  2FSW A;  4KIF A;  2FX0 A;  1YS7 A;  3RYR A;  1Y8Q B;  2H27 A;  2V6E A;  2W85 A;  1SEU A;  2F6C A;  5FRN A;  1UEL B;  5DCM B;  5CPR B;  4A5M A;  5B1A H;  3BDD A;  3QP6 A;  1DPU A;  1BM9 A;  3RYP A;  3RIR A;  1P7J A;  2QEX I;  2HQN A;  3R6S A;  2HDW A;  1A5J A;  1YW7 A;  4UUT A;  4N9H A;  1FJL A;  2FOK A;  4HOB A;  1S3J A;  3DEW A;  3MMY B;  4NUB A;  3HOY J;  3CC2 I;  2LVS A;  4EGZ A;  1YYV A;  3FMQ A;  5ILU A;  2VPR A;  2QQA A;  3Q9V A;  5GAE J;  4Y4R A;  4C2U A;  2R92 J;  1T8I A;  2JA8 J;  2Q2E A;  1MJB A;  2DA7 A;  4KT5 C;  3A01 B;  2L7Z A;  2IA2 A;  2W7N A;  2Y9Z A;  2X85 A;  1T0F C;  1BA5 A;  3IKV A;  1STZ A;  1IDZ A;  5E1X A;  3FXQ A;  4RLQ A;  3S8P A;  1ZH5 A;  3BR5 A;  2HYF A;  3FX3 A;  1B8I B;  1XGN A;  2KIM A;  1WJB A;  2F5D A;  2E71 A;  2GIZ A;  3DWL E;  1QQI A;  4XBF A;  2FQ3 A;  4PK4 A;  1J09 A;  2E36 A;  2VT2 A;  4KIB A;  2RNJ A;  1QZE A;  1U0J A;  4HF2 A;  1G2H A;  3CO6 C;  2QUF A;  1IUY A;  2DYS H;  3HSR A;  3W2A A;  2LH9 A;  2IS1 A;  4IEJ A;  3J81 Z;  4B44 A;  5FGM A;  2P0W A;  1ZYR F;  5JI6 A;  4UB8 C;  1XB4 A;  2A6E F;  4XN3 A;  4CYD A;  2A61 A;  3A01 A;  1OCO H;  2PMH A;  3ABU A;  3BQY A;  3GO5 A;  2FUG 2;  5J8F A;  1MKM A;  2PJR B;  2XPU A;  1QZY A;  1YTY A;  1JHH A;  3S3O A;  1B8I A;  4CGZ A;  1FSE A;  3FXU A;  2QF7 A;  1J2X A;  2DDA A;  2VB6 A;  2NVU B;  2EIK H;  3GCM A;  1LFB A;  3TDZ C;  3GFI A;  2Q8K A;  2BEO A;  1UHW A;  5FB2 A;  3FXJ A;  3HYI A;  1N78 A;  5DV5 A;  3BG6 A;  3QU6 A;  1CGP A;  1LE8 B;  2FQ4 A;  3PL8 A;  4MIM A;  4ZTF A;  5L3C A;  4BHP A;  2ZME B;  4KMU X;  2L7F P;  4D1Q A;  3S93 A;  2M1B A;  2V9V A;  4Y17 A;  5EGO A;  3AKZ A;  4ON0 A;  3FXR A;  1N77 A;  3FXO A;  2R7Q A;  2WTE A;  3BQZ A;  4CCJ A;  4L5J A;  2KDZ A;  2PJR A;  2V9P A;  1VI0 A;  4Q48 A;  5E3N A;  2CU7 A;  3BC8 A;  4Y15 A;  2R7Z J;  2F48 A;  3R60 A;  2XPV A;  3S1N J;  3BCB A;  2MGQ A;  1GUU A;  1DQU A;  1UZC A;  1JUP A;  1IJW C;  3S32 A;  2X6Y A;  3QU3 A;  1P4X A;  3T8R A;  4ZYD A;  3BLY A;  1V5F A;  3CO7 C;  2HVR A;  3MD2 A;  4BU2 A;  5E3M A;  1LE8 A;  5LFA A;  2XAG A;  2ZJP F;  4IO9 F;  1KU7 A;  3H3Z A;  3ESW B;  1Z91 A;  2ZME A;  3C2H A;  4Z2Y A;  3O2P E;  3OYB A;  2YSR A;  1WFX A;  1P6R A;  3V42 A;  2STW A;  2LLK A;  3W2W A;  1IN6 A;  2IVM A;  4ZJZ A;  3K4L A;  1B9M A;  1T2K A;  4MEX F;  1WZ2 A;  4DBQ A;  1G3S A;  2HI3 A;  2EB7 A;  2XF7 A;  2Z3Y A;  4XMY A;  4XKB A;  3BT9 A;  4LMY A;  1YIT I;  3U2R A;  2PX9 A;  4XKC A;  4S05 A;  2FML A;  3CMY A;  4RA2 A;  2BW3 A;  2K9S A;  2HZD A;  2JVH A;  2E1C A;  1VQ8 I;  1TT0 A;  2LMD A;  1TWA J;  3V4G A;  3CDI A;  3F0C A;  4W97 A;  1E3O C;  1W5S A;  4ANJ A;  2HXI A;  1YO5 C;  4F3Q A;  4RGX A;  2JA7 J;  4WXH A;  4KN7 X;  1WJA A;  2GA1 A;  3PFY A;  5HDK A;  5D4R A;  5C4X J;  3BY6 A;  4PJM A;  2LYC A;  2X48 A;  4NQW B;  4RAY A;  5D6E A;  1ZRC A;  4CYC A;  1HC8 A;  1YG2 A;  3DLL F;  2LR8 A;  2VOP A;  2V4J C;  2QLZ A;  3OR2 C;  2OZ6 A;  2P6T A;  2VT3 A;  3EUH C;  1XSX A;  2HNH A;  3JR9 A;  3IHU A;  5L3F A;  2LP0 A;  3VFZ A;  1JGG A;  5EF6 A;  1RKW A;  2L5Q A;  1XDU A;  4BY1 J;  3VPR A;  4LIT A;  1Z67 A;  3IRQ A;  3B6C A;  5HLG A;  2LY2 A;  2HQR A;  2X6X A;  4OIN F;  3L2C A;  1MJA A;  2CG4 A;  1ETQ A;  5TJJ A;  2F2E A;  2IEK A;  4UUV A;  4ENM A;  3W6J B;  2Y0S N;  4NQW A;  4E7S A;  1O7F A;  3VDX A;  2H1K A;  4IRI A;  4DYQ A;  2NAZ A;  3LWF A;  4HX8 A;  2A6T A;  1AHD P;  2Y0M A;  1FP1 D;  5GAH J;  2P7C B;  1FLI A;  5HS7 A;  2YUS A;  1SAX A;  5IT9 Z;  2VKV A;  1R7J A;  1TW2 A;  3VOE A;  4M9X A;  1YS6 A;  2CWE A;  3ZN1 A;  4LD5 A;  4RM3 A;  4IHT A;  2CFX A;  3GLL A;  1LFU P;  1BC7 C;  1S8N A;  3DBL B;  1MSE C;  5LGN A;  1WJC A;  1JT0 A;  1ZLJ A;  3PSF A;  1B59 A;  3I71 A;  2QSG X;  2K4B A;  2RKH A;  3KYL A;  3PFI A;  3A0H C;  2H09 A;  1XGM A;  3V8L A;  2ME0 A;  2PFB A;  2L4A A;  1W7P B;  2FRH A;  2QQ9 A;  5E3L A;  2HOE A;  2VE8 A;  1BR4 A;  2E1N A;  1ZR4 A;  2O03 A;  4M73 A;  1DU6 A;  3K4K A;  4RGS A;  4EEF G;  4GXO A;  1KYZ A;  5ERI A;  2DFE A;  4EM2 A;  2YS9 A;  1E3P A;  4U0Y A;  3G4S I;  3LA3 A;  1MW7 A;  4H4K C;  3W3C A;  2L01 A;  2GOX B;  5EZG A;  2I8D A;  3HDD A;  2C6Y A;  2CQX A;  4QWQ A;  3SFI A;  3HHG A;  2LC2 A;  1LEB A;  2CW0 F;  4BYY A;  3MAJ A;  3ZQ7 A;  4M6V A;  2FU4 A;  4FQG A;  1VQ6 I;  2P5K A;  5D6F A;  2A68 F;  3FIS A;  1FYL A;  4I98 B;  1OPC A;  1XPX A;  1LDD A;  1R58 A;  1I27 A;  1H0M A;  4IVN A;  1W7P A;  1X19 A;  1ZK8 A;  4XON A;  1TNS A;  2XAU A;  4ZC3 A;  1SD4 A;  3C3W A;  1OJL A;  4R79 A;  1OFC X;  2QSH X;  2XVC A;  3I0T A;  4CCK A;  1R4M B;  3H0G J;  1MBG A;  2V1U A;  3K4B A;  4YII A;  2KIU A;  2GOM A;  2JA2 A;  1O7L A;  2Y30 A;  3K9T A;  2IGK A;  3F8B A;  2O8K A;  3GTO J;  2RQQ A;  4LIV A;  4EAT A;  2GIV A;  4YG2 F;  4HX4 A;  1Y6I A;  2UUZ A;  1SMT A;  3I3L A;  3A03 A;  2ZFU A;  3EDP A;  3WE2 A;  1P7I A;  4A5N A;  2RNG A;  3JRC A;  4L0Z B;  3SDG A;  3GX4 X;  3OV8 A;  4L5I A;  1TL8 A;  3M4O J;  4CCN A;  3WTU C;  2DCE A;  4ESJ A;  3KZI C;  3D5L A;  2LG4 A;  1TQP A;  3KLN A;  2KRF A;  2GZW A;  4ZZL A;  3D5S C;  2CFO A;  1OCZ H;  3UNG C;  1Y1W J;  1FIP A;  2AQE A;  4BNC A;  4HNV A;  1UG2 A;  2UXN A;  3VYT B;  1QVU A;  2M9H A;  3WTS C;  2Y69 H;  5LHG A;  1AOY A;  3CC4 I;  3VOD A;  3EQL F;  3M8E A;  4UY8 I;  3ZMS A;  2EA4 A;  2KIS A;  2CQN A;  4PGH A;  2NS8 A;  1S7O A;  4G6Q A;  2DAO A;  3EUA A;  3JSP A;  3I55 I;  3I64 A;  3ZMD A;  5M5W J;  2OTJ I;  3H3U A;  3PUF A;  3HM5 A;  1ZRE A;  3F8M A;  2P7V B;  3BJ6 A;  4I02 A;  2DMQ A;  2ZNZ A;  1LQ1 A;  3CQZ J;  2MC3 A;  2GWR A;  2XB5 A;  3AG1 H;  3SDB A;  2LKP A;  1ZTR A;  2LFB A;  2PEX A;  2M45 A;  3O8G A;  4GDF A;  3TOB A;  3EPZ A;  2JSP A;  2K02 A;  3M1E A;  4G7H F;  2E2I J;  2ZFW A;  3L00 A;  3NEU A;  2EZL A;  2FD5 A;  4A3C J;  1VQM I;  1QO0 D;  2HU9 A;  4N9I A;  2UWM A;  2QZ8 A;  2GBY A;  1K83 J;  3CC7 I;  5BQT A;  3S14 J;  1YLF A;  2DQR A;  3PO2 J;  4ZH4 F;  4XRF A;  2CH0 A;  1FBS A;  3BG9 A;  1R49 A;  2KHM A;  2WV0 A;  1MBE A;  3FXL A;  1WHU A;  2MFZ A;  4B48 A;  5E1Z B;  4YRV A;  1H89 C;  1SD7 A;  1FIA A;  2CW7 A;  1PJR A;  1R1T A;  3EUH A;  3IAM 2;  4MO7 A;  4A6D A;  4HA8 A;  1JGS A;  3KZY A;  1D1C A;  4LK1 F;  3OIQ A;  3WG7 H;  2DOD A;  1ZHF A;  3J81 K;  3CCR I;  2LSO A;  1EV7 A;  2EZK A;  2XGC A;  3OIO A;  5DM7 F;  1DU0 A;  3ZPL A;  3OL4 A;  1W7P D;  2OCC H;  2YU9 J;  2KRC A;  2JRM A;  4XN0 A;  4L0Y B;  1VQL I;  1F36 A;  1TP4 A;  2R3S A;  4PSX A;  2B7E A;  3DXJ F;  3CCY A;  3U1D A;  4E7I A;  2B63 J;  3R4K A;  4BAY A;  3BG7 A;  4QPQ A;  1I3Q J;  2BHZ A;  1R5I D;  3AG4 H;  4C3J J;  5LLQ A;  3QAH A;  3IAS 2;  3C7J A;  3HXL A;  2E5N A;  1EH8 A;  3G2B A;  3P9K A;  3ROU A;  4XRS G;  4D9J A;  2ICW G;  3RKW A;  4YFK F;  1I3A A;  4QTR A;  3OYM A;  3CCM I;  1HCR A;  4IZZ A;  2UZK A;  1IDY A;  1NG7 A;  3LQQ A;  2VQH A;  4XSX F;  3HOS A;  1KQ8 A;  3FZV A;  2NOG A;  1LDJ A;  5H6R A;  3KYC B;  4DNC A;  5DM6 F;  3I59 A;  2YR2 A;  4AYB A;  2GA2 A;  2R93 J;  2H94 A;  3CP8 A;  3LL7 A;  2YU3 A;  3T8T A;  2R5Z B;  2CW8 A;  2DK5 A;  3R0J A;  3VYS B;  5GAD J;  3KEO A;  2H8R A;  3V8K A;  2KDO A;  1JT6 A;  2O5R A;  3CLO A;  4IHS A;  3IH2 A;  4RMN A;  3OYA A;  1X4O A;  1B72 A;  5IP6 A;  1HF0 A;  4Q4Z F;  2X51 A;  4L9N A;  1MBJ A;  1IRF A;  3NWS A;  4AID A;  5IP9 J;  3IP4 B;  3T0Y A;  1EA3 A;  1KZH A;  1Y39 A;  2M8E A;  1ZKG A;  2HGC A;  4M72 A;  1TQM A;  3L1P A;  5DCF A;  2BV6 A;  4Y33 A;  5F0H A;  1VQ7 I;  1HA8 A;  2OV7 A;  2K5C A;  4LOC A;  3RKQ A;  4E7J A;  2G7U A;  5CYV A;  5EG0 A;  3NQO A;  4CZZ A;  2O9L A;  4E7H A;  2DTR A;  3BCA A;  1YW8 A;  4A3E J;  3Q0W A;  5C4J J;  4FX4 A;  4HRI A;  1Z6T A;  1ZAR A;  3GEZ A;  3OIP A;  1JTX A;  3G3Z A;  2FA5 A;  5F1R A;  3GME A;  3E0J B;  1T33 A;  5EEH A;  3F6O A;  3BR2 A;  2F4I A;  2HVS A;  3T5X A;  3I54 A;  4ZZD A;  1KQ9 A;  1DPR A;  1X1C A;  3KEY A;  4PJL A;  1Z3Y A;  2XSD C;  5EEG A;  3TP3 A;  3R0A A;  1WSU A;  1XGS A;  3I4M J;  3K1M A;  2ELH A;  2LF8 A;  4HZF A;  2HQA A;  2XRN A;  4JBA A;  1YI2 I;  1GXQ A;  4XLF A;  4ENN A;  3EET A;  3GFJ A;  2HOA A;  1ETO A;  2CSO A;  2LDU A;  2O3F A;  3OMY A;  2XKP A;  4QSH A;  3QQA A;  4XOP A;  3H9Q A;  3QYE A;  2VJJ A;  1T6S A;  2RC4 A;  3TQN A;  2EJR A;  1B4A A;  1W4M A;  1MMN A;  4BKX A;  2XGD A;  2LKX A;  3LSG A;  5BMZ A;  2PLY A;  3LA7 A;  4CUG A;  2EFO A;  2FMY A;  4LG0 B;  3LST A;  2M30 A;  2M3A A;  4RS8 A;  1GV5 A;  3F8F A;  2K9Q A;  3DPL C;  1IRX A;  4MHG A;  2DI3 A;  3OL3 A;  1REP C;  1X1A A;  1ZG3 A;  1JI8 A;  1VQK I;  1MBH A;  3QPS A;  2IBD A;  2ISY A;  2EPF A;  3OYE A;  1VQ9 I;  1XCV A;  2WB1 N;  3ECH A;  5IT9 K;  1L0O C;  4K2E A;  1FT9 A;  2ZXI A;  4WK8 F;  2IS2 A;  1R00 A;  1FSH A;  3HIF A;  4HBL A;  1HSJ A;  3K2Z A;  1D0Y A;  1TLH B;  4G8X A;  3Q3S A;  1MBK A;  2OQG A;  3KP4 A;  1TTY A;  1Z6R A;  3FBI B;  1S5L C;  1YOV B;  3KET A;  2Y75 A;  1IV6 A;  1Z0X A;  2E34 A;  3SJM A;  2K27 A;  1W5T A;  1X2M A;  5D8K B;  5FLM J;  3CUO A;  4QIW N;  3KP5 A;  3IH3 A;  3I4N J;  2BY2 A;  3F72 A;  2QWW A;  1T39 A;  1OCR H;  2OAZ A;  3JRB A;  1KYW A;  1MH4 A;  4DIQ A;  4IHW A;  1IN4 A;  2RV8 A;  2I5U A;  2EQR A;  4XRS A;  2X9D A;  4HPQ A;  3FKI J;  3GTJ J;  3PUB A;  3GFM A;  3GTL J;  5BPI A;  2LBF A;  2L3D A;  2XPW A;  5C44 J;  3BOQ A;  1NK3 P;  1OR7 C;  3BZK A;  2L2O A;  1JTY A;  2WAQ A;  4BXX J;  2OBP A;  5J6X A;  4IF4 A;  2AO9 A;  3GYH X;  1G6N A;  5DTD A;  3J7A O;  3S17 J;  3S2H J;  2BYV E;  1ZGW A;  3CTA A;  2DA4 A;  3QWL A;  2XB0 X;  3X2Q H;  4IOC F;  2PMZ N;  2WBM A;  3HSF A;  4L9V A;  2XAJ A;  5F1J A;  4DZJ A;  1EJ9 A;  5F08 A;  5LGU A;  3NAU A;  2DDB A;  1PP7 U;  5J1R A;  5DEQ A;  1MJ9 A;  4A3K J;  2XGE A;  3PQK A;  1LPQ A;  4KIS A;  2CUJ A;  1R71 A;  2IJL A;  3QYB A;  1D0Z A;  5DCM A;  2XRO A;  3OSF A;  1HDD C;  4XL9 A;  1GXP A;  5E1W A;  1DP3 A;  1FMW A;  1JKQ C;  1ODD A;  2ZSI B;  3H92 A;  4IKF A;  1BJA A;  3AFH A;  1X58 A;  3JCU C;  2VQG A;  4S0H B;  5CVR A;  3JRI A;  3DKX A;  2MD5 A;  4GRI A;  1U8R A;  1KGS A;  2W24 A;  1RRJ A;  4JP0 A;  3FM5 A;  3Q5F A;  4HDV A;  2ADU A;  4BQN A;  3ELK A;  5D8L B;  4KFC A;  1HKT A;  1K79 A;  5DDG A;  1ETY A;  4OIO F;  2EZH A;  3RPU D;  2V1N A;  4HNU A;  1MZB A;  3VSL A;  2X1E A;  3GTP J;  1ON1 A;  5FO5 A;  1R36 A;  1NG6 A;  2KZG A;  5FJ8 J;  3KP7 A;  1JKO C;  4CCL A;  4AUX A;  4CIC A;  2VAS A;  1JKR C;  2M2E A;  2DA3 A;  2ZNY A;  1YJN I;  1R6R A;  1ETX A;  2VC0 A;  1GHC A;  4M6Y A;  2DMP A;  2RQP A;  1JUM A;  2V26 A;  1ENH A;  2E7X A;  4O6J A;  1QPM A;  3BJA A;  1K6O A;  1X1D A;  5J4Y A;  4L9J A;  3F23 A;  3M9A A;  3OY9 A;  4N4O B;  3GUD A;  2RRE A;  1LVA A;  5D5X B;  2D1V A;  1OCC H;  2ZJ2 A;  9ANT A;  2VL8 A;  3CF5 F;  2XF5 A;  3DBH B;  2DU9 A;  2A07 F;  3BPV A;  4CCO A;  3MKW B;  3ZQH A;  1TWC J;  5EZH A;  3ULQ B;  5IYB J;  1B9N A;  2ELK A;  4AIJ A;  4PUS A;  2IS6 A;  1BI3 A;  3U21 A;  4PZJ A;  1G3W A;  3A4C A;  1BC8 C;  4E6K G;  2GLO A;  4I2O A;  4UVB A;  3L2W A;  1A31 A;  1A6Q A;  4XQF A;  1PDN C;  5E18 F;  4FCY A;  3GTQ J;  1FYM A;  1Q1H A;  3FK7 A;  4G9Y A;  2V7F A;  3S15 J;  2L0K A;  1S29 A;  2VUM J;  4RAZ A;  2DBB A;  2BY3 A;  2L9V A;  5F27 A;  2A5W A;  1G59 A;  2CV0 A;  3REO A;  2LRD A;  2K9N A;  3HZJ A;  2A69 F;  4YFN F;  3CLQ A;  1V55 H;  4RM2 A;  2FXA A;  2P8T A;  4DYC A;  5D5W B;  3KP2 A;  5IPA A;  1VQ4 I;  4L18 B;  4V19 K;  4IRG A;  2RDP A;  3J80 Z;  1EH7 A;  3LSH A;  2HXO A;  3E5Q A;  4U0W A;  4C9Y A;  2BVM A;  1QPI A;  3IH4 A;  1JJ6 C;  3B6A A;  2E35 A;  1U6G A;  3QYF A;  2DO7 A;  4XLH A;  1J59 A;  2K9L A;  1FX7 A;  3TO6 A;  4XM3 A;  5KAF C;  3SEZ A;  2HDD A;  2HPI A;  2PQ8 A;  3RQ4 A;  5CVJ A;  2VKH A;  5B1B H;  2QCO A;  4AC0 A;  1P92 A;  1UHM A;  3MKZ A;  2L9N A;  2W48 A;  5TRD A;  1ULY A;  4UNO A;  3G73 A;  2BBY A;  5E8G A;  3E5X A;  3HBL A;  4BDY A;  2XRL A;  2E1M C;  3I4P A;  3GF2 A;  1FYK A;  2DOE A;  5LRS A;  3A02 A;  2NRA C;  2H8W A;  5BOX A;  2LF7 A;  4UVC A;  3BZC A;  4RB3 C;  4C2T A;  3KCC A;  2QQB A;  2F5C A;  1XMX A;  5ICE A;  3GW2 A;  5H2F C;  2HEO A;  1GDT A;  3OYD A;  1WGX A;  3GWZ A;  1EKE A;  2JUC A;  4XLC A;  3DKY A;  2EV0 A;  3TKY A;  5D4S A;  4Q47 A;  2XC7 A;  1D1A A;  1RET A;  1OKR A;  5DUI A;  1WKM A;  4ABZ A;  2IAI A;  4EMS A;  4IL6 C;  4YIF A;  3CCL I;  1UJ8 A;  4BDZ A;  2LTP A;  3C1D A;  1WH7 A;  1X3Z B;  2KIQ A;  1M1E B;  3GTG J;  2G0E A;  5IT3 A;  5JFR A;  4OIQ F;  4N4N B;  1BIA A;  4YIR X;  1UHS A;  1OQY A;  4XKW A;  1X1P A;  1FY7 A;  2ZXH A;  2TCT A;  3LFK A;  1OYI A;  1MNM C;  3EYI A;  3JRA A;  4PJN A;  4G7Z F;  3FDY A;  4J19 A;  3IKT A;  4O3M A;  2KP6 A;  2TRT A;  3LMM A;  4JK1 X;  5K5R A;  3L2V A;  4FTH A;  2KMU A;  4AU7 A;  4A69 C;  3CJT B;  4B09 A;  2D1H A;  2VBY A;  5FKK A;  1IN5 A;  3JW4 A;  1TWF J;  1I1S A;  2E1O A;  2XAQ A;  1U5T C;  2HOS A;  3GXO A;  1I50 J;  3OS1 A;  1SD5 A;  1T0F A;  1RUO A;  5A2Q Z;  3MEX A;  1Z3X A;  1K4T A;  3E6B A;  2HPM A;  2QKM B;  4U88 A;  2DMN A;  4BJ5 C;  2HTJ A;  3E97 A;  2F4O B;  3ML6 A;  4CDG A;  5HOO A;  1YJW I;  1UST A;  3M07 A;  3NAR A;  3IRR A;  1RNL A;  4R1H A;  4WX9 A;  2BZT A;  1QA6 A;  4M3E A;  2ID6 A;  1V3F A;  2G9W A;  4LK0 F;  5GPC A;  4EVI A;  1A35 A;  5HLT A;  1H88 C;  3CUQ C;  4YFX F;  1HW5 A;  3S2D J;  4NC8 A;  1XS9 A;  3QPL A;  1I6H J;  1ZG5 A;  3NRV A;  1F1Z A;  1KQ0 A;  3OYC A;  3D0S A;  4CSW A;  1TZL A;  4WXC A;  5CVI A;  3S16 J;  4RGU A;  2HZT A;  3K10 A;  2AXL A;  5J47 A;  5M3F J;  3OR1 C;  5HVQ C;  1Z7U A;  4HG2 A;  2RGV A;  3MVP A;  3UR3 C;  1BL0 A;  3WE3 A;  1NHA A;  3HKZ A;  1D8J A;  4MGR A;  4FE4 A;  3W6V A;  5JLX A;  3WTX C;  4YEJ A;  2X6O A;  4B3A A;  4ETS A;  3DV8 A;  2CUF A;  2EK5 A;  4HF1 A;  1A04 A;  1BR1 A;  2EFN A;  2HFH A;  2Z5U A;  3HRS A;  4LJZ F;  2ID3 A;  2ESH A;  4BUP A;  1GT0 C;  2IT0 A;  3KE2 A;  3DTE A;  4KIT B;  4RBO A;  1X3U A;  4G12 A;  4A0Y A;  1DGR M;  1QRY A;  1R5G A;  2LRE A;  5B66 C;  1O3Q A;  2EH3 A;  1Z1D A;  1WJE A;  2M7B A;  4RDU A;  4M71 A;  1DUX C;  2MD0 A;  5LD2 C;  2Z99 A;  1ZRD A;  5L3B A;  1WPK A;  5ICF A;  4XLA A;  2E60 A;  3WGH A;  3ASN H;  4KA4 A;  2Q0O A;  1V4R A;  2V79 A;  2OQR A;  1F9N A;  5EJC A;  1ZR2 A;  3AL0 C;  5LBQ A;  3F8C A;  2JT1 A;  2QKL B;  4F93 B;  4IRH A;  1OYW A;  3HB9 A;  2M8G X;  1S72 I;  3WTW C;  3C2B A;  3OYI A;  4EJO A;  2FBI A;  2MH9 A;  2LKS A;  5K1Y A;  4BQQ A;  2HKO A;  2VKE A;  4XRM A;  3K4J A;  2LOO A;  2R7O A;  1R23 A;  1ITY A;  3KLO A;  1VFC A;  1IZ1 A;  2BE5 F;  3FMR A;  3V8J A;  3AG2 H;  1P4A A;  4HQE A;  2VC1 A;  1TWH J;  4KMF A;  2TDX A;  5FD6 A;  3BZ6 A;  2AS5 F;  2QBY B;  2E1M B;  4G94 A;  1QGP A;  2KKO A;  4P55 A;  2CUZ A;  2A05 A;  2O8X A;  3CCU I;  2Z33 A;  1OYY A;  2ZJQ F;  2PMU A;  4XOT A;  2DW4 A;  2BGC A;  1U3E M;  5D5V B;  3OYG A;  4PJ0 C;  3LNQ A;  2P5L C;  1WJ5 A;  4J01 A;  4OAZ A;  5J3L A;  3DLA A;  2K85 A;  4XOR A;  1FTT A;  5FFX A;  3TL4 X;  3TMO A;  4NB5 A;  4HLX A;  3B73 A;  4BEH B;  4D5C A;  3G71 I;  3HTS B;  4MNU A;  2DA5 A;  1XD7 A;  4U7D A;  2CUE A;  1K78 B;  2JZY A;  5HNF A;  1XN7 A;  2EV5 A;  4LLN A;  5BPD A;  1EH6 A;  1TT5 B;  1QNT A;  1C0W A;  3SYT A;  4XK4 A;  3MFK A;  1QZZ A;  4XKV A;  2CV1 A;  1W0T A;  4I99 C;  3GBG A;  2DFI A;  2VBW A;  2A5Y B;  2WY7 Q;  2FJ1 A;  1HW2 A;  3LSR A;  1MMA A;  2QM3 A;  2VJI A;  3L2R A;  3A2K A;  4RB1 A;  3J7Z I;  1EF4 A;  2FNA A;  4E7K A;  2BY0 A;  5F04 A;  5TGT A;  4L9T A;  3ZQI A;  2P81 A;  4LB5 A;  3HRT A;  3CES A;  1LJ9 A;  1QHH D;  1IRG A;  2DJN A;  2DFH A;  3F9K A;  2NVQ J;  1T38 A;  3HOU J;  4PFP A;  3GZN B;  3N97 A;  4BEH A;  1VF9 A;  3RQI A;  2M0M A;  1U5T B;  2K3F A;  4A3D J;  3HKZ N;  3TGN A;  4G7O F;  4DZP A;  2R7D A;  4U7B A;  4RGR A;  3WU2 C;  3H35 A;  2Y2Z A;  3O8H A;  2LNB A;  1Z77 A;  3GVA A;  2RN7 A;  4ASN A;  2DN0 A;  5E3O A;  5M5Y J;  1E17 A;  1WCM J;  5AON A;  1N25 A;  1IF1 A;  3HOZ J;  3TO7 A;  1BOA A;  1Q1V A;  1XMK A;  1T56 A;  4I0A A;  4RLF A;  2EZI A;  1H8A C;  5FRM A;  5KK1 A;  3DTI A;  4C3I J;  1BIB A;  1KA8 A;  5BS6 A;  1R22 A;  4V2G A;  1RUN A;  2F5E A;  1UCR A;  5KHD A;  2VQL A;  5FKM A;  2K4J A;  1Y8R B;  4LLL A;  2ELJ A;  2XUB A;  5CLS A;  2GAU A;  1APL C;  1F43 A;  1YJ9 I;  5KNL A;  3E6C C;  1U5T A;  3SFZ A;  1I6X A;  5IOY A;  3A0B C;  1DGW Y;  2D2W A;  3C18 A;  1OLT A;  3V7R A;  3JRG A;  4FX0 A;  1TNT A;  2V6C A;  3VEP A;  3HJE A;  4E7L A;  5L3D A;  2Z1D A;  4ESB A;  1O3T A;  3GFL A;  1W36 C;  1LKX A;  2W25 A;  1R5H A;  2NYX A;  4ZDL A;  2AHQ A;  5B5E C;  2E5Z A;  1I5Z A;  2ZB9 A;  1XTA A;  3K4N A;  2HQ5 A;  2HKX A;  4OAY A;  4OWR B;  4CO8 A;  2E2H J;  1Y0N A;  2W4S A;  3ONQ A;  4HDU A;  1CF7 B;  3ZGK A;  2D45 A;  5F0C A;  3ABK H;  1V54 H;  2QYO A;  5DUK A;  1UB9 A;  4RAF A;  2PG4 A;  2QA4 I;  1AU7 A;  2VXZ A;  1S6L A;  4BJT A;  1MMG A;  2R5Z A;  1JXS A;  1FC3 A;  3FF5 A;  5LEK A;  3J80 K;  1RPW A;  1BW5 A;  4AVZ A;  2EIJ H;  1RC9 A;  3BG3 A;  1JHF A;  3LOC A;  2MW8 A;  4A3J J;  2GXA A;  3S3M A;  3RJP A;  3W6K B;  3JRD A;  4DGW B;  5EEA A;  3AL0 B;  2LY9 A;  2NVY J;  4HV5 A;  4V2F A;  3PQJ A;  1VND A;  4BXU A;  3WTT C;  1POG A;  2OJE D;  1UG0 A;  3PSI A;  3LA2 A;  4KT6 A;  4X1E A;  1K4S A;  4ITV A;  3MN2 A;  5E8I A;  2K9M A;  2IA0 A;  2FBH A;  2K40 A;  1IGN A;  4BQO A;  3G1L A;  2NS7 A;  3CMM A;  4GCV A;  4Y3O A;  2ZKZ A;  3B02 A; 
#chains in the Genus database with same CATH homology
 1ERD A;  4CCM A;  2VAS A;  1UAA A;  3ZR8 X;  4IQJ A;  1R6R A;  2V26 A;  1Z21 A;  1V5E A;  2BOL A;  1X1D A;  3CJR B;  4YEL A;  4RM3 A;  3OY9 A;  4N4O B;  1D0X A;  3OWT A;  4B43 A;  2RRE A;  4PSW A;  3PJR A;  1SAU A;  1YX3 A;  4NC7 A;  4U87 A;  2VL8 A;  1WJC A;  3TBI A;  3PSF A;  2XF5 A;  3CJQ B;  4LG3 A;  4CCO A;  3KYL A;  4BJ6 C;  2DOA A;  2W1O A;  3MKW B;  3W2V A;  4E7Z A;  2XF6 A;  3OYK A;  4PUS A;  3FKJ A;  2IS6 A;  3OYH A;  1GLN A;  1BR4 A;  3U21 A;  4FET A;  3K4K A;  2IS4 A;  3A4C A;  4E6K G;  2M4G A;  4JQF A;  3L2W A;  1E0E A;  4PJJ A;  4XQF A;  3OOU A;  2BVL A;  1X4P A;  3ZXS A;  2KLO A;  3K70 C;  1MW7 A;  3N05 A;  4H4K C;  2V7F A;  3W3C A;  1N75 A;  2GOX B;  3OYN A;  2I8D A;  2R7R A;  2KRH A;  2LC2 A;  2A5W A;  1G59 A;  2CV0 A;  2LRD A;  2M7A A;  2JVG A;  4BAC A;  2VKD A;  3HUG B;  1X19 A;  4RM2 A;  3KX2 A;  4XON A;  3ZRG A;  2K3P A;  2XAU A;  4ZC3 A;  4XR6 A;  4R79 A;  3LSH A;  4C9Y A;  2BVM A;  4CCK A;  2KPM A;  2WB1 A;  2DJI A;  3K4B A;  3ZQQ A;  1T95 A;  2IGO A;  2GOM A;  2JA2 A;  2XSJ C;  2IGK A;  2WAE A;  3PNY A;  3QYF A;  2Q2E B;  4XLH A;  2RQQ A;  4LIV A;  2VIX A;  4EAT A;  2K9L A;  2OUM A;  3EUK L;  3L2Q A;  1LVK A;  2WY8 Q;  4XM3 A;  2VJ4 A;  2L9S A;  1Y6I A;  2UUZ A;  3SEZ A;  3I3L A;  4XNF A;  2ZFU A;  2F5V A;  2HPI A;  2RNG A;  3K4M A;  3OYF A;  3RQ4 A;  2VKH A;  4CCN A;  4XLE A;  2DCE A;  2HVQ A;  3D5L A;  2LG4 A;  2L9N A;  3MKZ A;  3LSM A;  4QPO A;  2Z16 A;  3DU5 A;  3D5S C;  2CFO A;  1BR2 A;  3UNG C;  2AQE A;  3VYU B;  4BDY A;  1FMV A;  2E1M C;  3VYT B;  3VYR B;  1K6Y A;  5KCM A;  4DOZ A;  2W82 A;  1PYV A;  3OYJ A;  4C2T A;  3HG9 A;  1VZ0 A;  2IGN A;  3HL2 A;  3EUA A;  3VWB A;  4BE0 A;  2LY1 A;  3QOD A;  3HOT A;  3OYD A;  2R7S A;  2V9K A;  4XLC A;  2X6W A;  3DKY A;  3E1S A;  3HPG A;  1D1A A;  2XC7 A;  3CF2 A;  2PMZ A;  4BDZ A;  3H9G A;  3SDB A;  2IXS A;  3DU6 A;  5CQG A;  2DT6 A;  1D1B A;  4N4N B;  2L7K A;  4PFO A;  4BXF A;  4XKW A;  3EPZ A;  1MMD A;  3HC7 A;  2CS3 A;  4BGD A;  3OS0 A;  2ZXH A;  2MYS A;  2JSP A;  3OYL A;  2WAD A;  4PJN A;  3FDY A;  1MND A;  2KP6 A;  3L2V A;  3LMM A;  2KQR A;  2UV1 A;  1YX5 A;  4JOM A;  2KMU A;  4ZDP A;  4AU7 A;  4DJA A;  2HU9 A;  2UWM A;  3NWT A;  2MC4 A;  4ZYA A;  3OS1 A;  2KL4 A;  2CH0 A;  1QU3 A;  2KHM A;  4B48 A;  1SFK A;  2MFZ A;  1Z3X A;  3I9V 2;  4CH7 A;  4YRV A;  2HPM A;  2QKM B;  4BJ5 C;  2CW7 A;  1PJR A;  2DT7 B;  5HOO A;  3M8J A;  1BOB A;  2Y0S A;  4B3X A;  3IAM 2;  3RSN A;  2R7X A;  2X1C A;  4CA0 A;  3M1C A;  3C2G A;  4BE1 A;  1D1C A;  2R4G A;  3OIQ A;  3QOE A;  4II3 A;  5FRO A;  3OL4 A;  3K6G A;  2ZSH B;  2KRC A;  4ZDO A;  4XN0 A;  5HLT A;  4NC8 A;  4HNT A;  3J7A Y;  4F55 A;  4PSX A;  1Y56 A;  4E7I A;  3OS2 A;  2WA0 A;  3OYC A;  2AQF A;  4MLO A;  3FBN B;  3BG7 A;  4CSW A;  4QPQ A;  1TZL A;  1LDK B;  2Z2S B;  4E4H A;  3IAS 2;  3K10 A;  2W00 A;  3OR1 C;  3HXL A;  2E5N A;  2LBF B;  5HVQ C;  1Z7L A;  4HG2 A;  1S9H A;  3G2B A;  2BW3 B;  3LSK A;  3UR3 C;  4BS9 A;  4D9J A;  1MNE A;  3IUO A;  3OYM A;  3HKZ A;  4IZZ A;  2VXD A;  2VLA A;  1NG7 A;  2VQH A;  3HOS A;  3CP2 A;  4YEJ A;  3D5R C;  2VJ5 A;  3RCO A;  3H5N A;  2XDV A;  1BR1 A;  1P9Q C;  2IGM A;  4IQ4 A;  4AYB A;  4BUP A;  3CP8 A;  3LL7 A;  1YE9 A;  2VQC A;  3DTE A;  4KIT B;  2CW8 A;  3DQV C;  1DGR M;  3VYS B;  2LRE A;  2V6E A;  2KDO A;  2F6C A;  3DTK A;  5FRN A;  1UEL B;  1WJE A;  2M7B A;  5CPR B;  1LFP A;  3DPU A;  2O5R A;  2DXI A;  4RMN A;  2MD0 A;  3OYA A;  5LD2 C;  1X4O A;  4XLA A;  2HDW A;  2E60 A;  2WAF A;  2X51 A;  3MMY B;  3NWS A;  4HEA 2;  4NUB A;  3IP4 B;  4B47 A;  3AL0 C;  1EA3 A;  2QKL B;  4F93 B;  4X0G A;  3H5R A;  1W36 D;  1WJF A;  4Y4R A;  4C2U A;  3OYI A;  4Y33 A;  1HA8 A;  2OV7 A;  4BQQ A;  2W7N A;  3K4J A;  2K5C A;  2LOO A;  2X85 A;  1KON A;  1T0F C;  2R7O A;  4E7J A;  4F52 A;  4RLQ A;  3S8P A;  5CQE A;  4E7H A;  3PNV A;  3VSK A;  3BCA A;  1WJB A;  4DBR A;  3SEQ A;  2E1M B;  4HRI A;  3DWL E;  4F91 B;  2CUZ A;  3OIP A;  4PK4 A;  1J09 A;  4XOT A;  2VPL A;  1U0J A;  3OYG A;  1WJ5 A;  3E0J B;  4J01 A;  3CZ6 A;  4OAZ A;  4ZTJ A;  2F4I A;  3DLA A;  3DEE A;  2LH9 A;  3W2A A;  4XOR A;  2IS1 A;  2HVS A;  4B44 A;  3TL4 X;  3TMO A;  4CZC A;  2P0W A;  1X1C A;  4P5O A;  4BEH B;  3MKY B;  2R7W A;  3KEY A;  4PJL A;  1Z3Y A;  4XN3 A;  2R7V A;  5HNF A;  2R7U A;  2FUG 2;  2PJR B;  1V5G A;  3SYT A;  2HQA A;  4XKV A;  2CV1 A;  3GBG A;  3S3O A;  2WY7 Q;  4XLF A;  2VB6 A;  3OMY A;  1MMA A;  2VJI A;  3L2R A;  3A2K A;  3LSI A;  4XOP A;  3H9Q A;  3QYE A;  2VJJ A;  2R7T A;  1N78 A;  4E7K A;  1MMN A;  3BG6 A;  5HNH A;  5TGT A;  1G8X A;  2NOJ B;  3CES A;  3LSG A;  1QHH D;  3PL8 A;  4CUG A;  4ZTF A;  3F9K A;  2M3A A;  4PFP A;  4HSR A;  4D1Q A;  4BEH A;  3DPL C;  1IRX A;  3S93 A;  2M0M A;  2MAB A;  3OL3 A;  3PNT A;  3AKZ A;  1X1A A;  1JI8 A;  1N77 A;  2R7Q A;  3H5A A;  4CCJ A;  4U7B A;  4BL0 B;  3H35 A;  2CV2 A;  3OYE A;  2PJR A;  3K4C A;  4LIU A;  3BC8 A;  2ZXI A;  2IS2 A;  3BCB A;  1ZEL A;  3DPT A;  4IX7 A;  4F92 B;  1DQU A;  1D0Y A;  3S32 A;  2X6Y A;  3ZCO A;  3BLY A;  3FBI B;  4KJZ A;  1V5F A;  2HVR A;  4RLF A;  3MD2 A;  5FRM A;  4BU2 A;  3DTI A;  5LFA A;  5KHD A;  2VQL A;  2ELJ A;  4C30 A;  3C2H A;  3OYB A;  4HST A;  1WFX A;  2Q1Z B;  5KNL A;  3V42 A;  3W2W A;  1DGW Y;  4ZJZ A;  3K70 D;  3K4L A;  1OLT A;  5CKT A;  4DIQ A;  4DBQ A;  2JUG A;  4HPQ A;  2XF7 A;  3PUB A;  4XMY A;  4XKB A;  4E7L A;  2Z1D A;  2LBF A;  1W36 C;  1LKX A;  1X1B A;  4XKC A;  4ZDL A;  1OR7 C;  3L2U A;  3H0D A;  2BW3 A;  2L2O A;  2HZD A;  2JVH A;  4BE2 A;  2WAQ A;  2E5Z A;  2KZV A;  3SZG A;  1TT0 A;  3K4N A;  4J00 A;  4OAY A;  4OWR B;  4ANJ A;  5JHF A;  4F3Q A;  2W4S A;  1WJA A;  3ONQ A;  3PFY A;  3ZGK A;  2WBM A;  4PJM A;  3FHN A;  2LYC A;  4NQW B;  4NNJ A;  2VXZ A;  4BJT A;  4FAS D;  3H9J A;  1MMG A;  2V4J C;  4KIS A;  3A1Y A;  3OR2 C;  2CUJ A;  4AVZ A;  3QYB A;  1D0Z A;  1QHG A;  3EUH C;  4XL9 A;  2HNH A;  1DP3 A;  1FMW A;  2ZSI B;  4IKF A;  3AFH A;  3S3M A;  2L5Q A;  2VQG A;  4DGW B;  3AL0 B;  3LFU A;  4P1W A;  4G6T B;  3DKX A;  2OC6 A;  4LIT A;  3RTR A;  4GRI A;  2LY2 A;  2X6X A;  1UG0 A;  3PSI A;  4KT6 A;  4BQN A;  4ITV A;  2M4K A;  1WJD A;  1AA7 A;  3HPH A;  2K9M A;  2V1N A;  2X1D A;  3RPU D;  4HNU A;  3VSL A;  2X1E A;  4E7S A;  2CMP A;  3VDX A;  4BQO A;  3S3N A;  1NG6 A;  4II2 A;  3CMM A;  4Y3O A;  4CCL A;  2A6T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...