2CMPA

Crystal structure of the dna binding domain of g1p small terminase subunit from bacteriophage sf6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
KLSPKQERFIEEYFINDMNATKAAIAAGYSKNSASAIGAENLQKPAIRARIDARLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.58 A Resolution Structure of the DNA-Binding Domain of Bacteriophage Sf6 Small Terminase Provides New Hints on DNA Binding
pubmed doi rcsb
source organism Bacteriophage sf6
molecule tags Viral protein
molecule keywords TERMINASE SMALL SUBUNIT
total genus 19
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cmpA00
4ZC3A 2CMPA 3ZQQA
chains in the Genus database with same CATH superfamily
3S8PA 2YR2A 1EV7A 4LJZF 3ZQQA 3DFGA 3BZ6A 1AKHB 4RGRA 3ZP5A 3DU6A 4HG2A 2C6YA 3VFZA 1UCRA 1ONVA 4KDPA 4I0BA 3FXUA 5GAHJ 1YRNA 3FXOA 1KONA 4HZFA 1W7PB 2A3SA 2E36A 4KN7X 3IRQA 4A3JJ 2VJ4A 1LDDA 2HQNA 2JPCA 2Q2EA 2W24A 4RAGA 5LD2C 3B73A 1ENHA 5J47A 3R60A 2UZKA 2MG4A 4ZDOA 2R7XA 2OCEA 3TW6A 4BGDA 3KLNA 3SDBA 2R92J 1U3EM 1KU9A 2XVCA 5L3DA 4G7ZF 4Q5SF 1T0FA 2B7EA 5BPDA 2EINH 1TWCJ 3O6BB 3KETA 2ICWG 2WADA 1GT0C 3ZMUA 2E1OA 5IT3A 1X1CA 2R7UA 2DFIA 3GUDA 3MKYB 3HGGA 1ZR2A 4XKWA 4CCOA 4WWCA 3QYEA 4UB6C 5FJ8J 4PSWA 1J59A 1FYKA 1QZYA 4PJMA 1LE8A 3FX3A 1I27A 1R5GA 2CUJA 2XPUA 1SD7A 4NNJA 1V5FA 3KP4A 2EV6A 4D9JA 4IHWA 2BBYA 2DA3A 1TWAJ 2QCOA 2PFBA 4F7ZA 4RAFA 3IV5A 1OQYA 3I58A 4LITA 2OQRA 2HVSA 2MLKA 2OZUA 5LEKA 2K27A 2DFFA 3IHUA 4WF2A 3WTSC 1PP8F 2E7WA 2M45A 3DEWA 2BOLA 2L9NA 3HHGA 3Q9VA 1WZ2A 3M1EA 2XB5A 1U5TC 3W3CA 2E60A 3VB2A 3IC7A 3BR3A 1Z1DA 1Y56A 3TEDA 1BOAA 2EZHA 1D0XA 1WH7A 4EQQA 3MD2A 3FWEA 5KK1A 1Z6RA 3H35A 3QODA 1XDSA 1IN6A 2JRMA 2OD5A 3BG9A 4FISA 4U87A 2LTPA 3PQJA 1RETA 1JKPC 3ZR8X 1FSHA 1KYWA 2D5VA 4B48A 2ZJRF 2XKOA 4FQGA 4EGYA 4B8XA 3C3WA 2XF6A 4C30A 1XGOA 3IH4A 4L9TA 1WRJA 4I6ZA 1CF7A 3F8MA 5JVTA 2FNPA 4ZC3A 1RUNA 5LRSA 2X6XA 3RTRA 3U2RA 4A3KJ 4HQEA 4CA0A 4U0WA 2HQAA 4ESBA 4NQWA 4UV8A 1JHFA 1AHDP 4ABZA 3RKYA 1XCBA 2FMLA 1G59A 4HRIA 3IAM2 1F36A 2KHMA 2NNYA 1W0UA 3GEZA 3F8NA 1FC3A 1X4PA 3BR2A 2M2EA 4WXCA 4ZYAA 2IA1A 1U9NA 4RBOA 4XR6A 2DA2A 3WU1B 3JR9A 2LMDA 5JLWA 1R58A 2X51A 1ZG1A 2X48A 4Y3OA 3WTXC 3JRCA 2PJPA 1ZREA 2F5DA 2P8TA 2L5QA 4R1HA 5D5WB 2VC0A 2O3FA 4CUGA 1S29A 2R7DA 1OCOH 2QGUA 5BMZA 1O3QA 3LSMA 5D5UB 2CV0A 5HVQC 2DFEA 1NTCA 1H8AC 2XDVA 2VKEA 3TKYA 2XAQA 3GZ5A 2JVHA 2DN0A 3ZN1A 2XRLA 5CVIA 2Y2ZA 1H88C 3OYAA 4X1EA 3DU5A 2BGCA 2FQ4A 4AWXB 4IHSA 1IRZA 2NVXJ 2W1OA 3LSPA 3W2WA 5DM6F 4UHTA 2BE5F 3CCVI 2F5CA 1FNNA 4UV9A 3UR3C 1FT9A 3BTIA 1TLHB 2VLAA 2XRNA 1EH7A 1AWCA 2AO9A 1MJBA 4HX4A 1JHHA 4BQOA 2Z5UA 2OZ6A 1RKWA 4IX7A 1CQTA 3PQKA 5TISC 1C0WA 1IXRC 4V2FA 4S05A 1S6LA 3GCMA 3IRRA 3GFLA 1V55H 1PDNC 2VE9A 5LGTA 1I1GA 1R1VA 4CXFA 4W1UA 5AONA 3DPLC 1RRJA 1IN7A 1MBGA 3EUKL 2E1MB 4Y4RA 4QLCU 2X6YA 2L0KA 1P4WA 1D5YA 4EJWA 5HLGA 3ABUA 1EKEA 1HXDA 2IAIA 5LRRA 1W0TA 1G3SA 1XCVA 4NQWB 4PCQA 3SEQA 3V8LA 4OIRF 4OWRB 5BOXA 5BPIA 3QWLA 1OYWA 2DJNA 4HF0A 3L7WA 1USSA 2LOOA 2P81A 4KT5C 3HDDA 1RIOH 3ZQLA 1CF7B 3K70D 1VQPI 3EYIA 2HDDA 2KT0A 4QIWN 1T2KA 2VJJA 4ZTFA 1APLC 1NK3P 1WWXA 4KIBA 5BQTA 2NYXA 2COMA 5FLMJ 5J1RA 2L02A 4O3MA 3LSTA 3Q0VA 1LFUP 2PMZA 2XAFA 3OYEA 5K1YA 1IJWC 5IYBJ 1FOYA 4M73A 4FASD 3NAUA 3CCJI 3MAJA 3T5XA 5K5QA 3K4MA 2M0MA 3DPUA 2H1KA 2A6HF 3TO7A 1I6XA 2OF7A 4EM0B 5ICEA 1BJZA 1X1DA 2OV7A 3BTLA 2IGKA 3K69A 3MZHA 2V1NA 2VQGA 3H9GA 2P5KA 2COBA 3H5AA 3BP8A 2DA7A 5F0CA 4UNOA 3UNGC 4CO8A 4D5FA 2JSPA 2Q1ZB 1XN7A 2KKOA 1LE8B 3IAS2 3KE2A 3O3KA 5M5XJ 3I4NJ 4H0EA 4A3FJ 2PX9A 3K2AA 3NARA 2R7VA 3A02A 3ABLH 4RB3C 4A3GJ 4G7OF 2OUMA 2HXOA 4YIFA 2JA2A 2IGNA 4EGZA 2ZCWA 4ON0A 5GPCA 1TWGJ 1G2HA 2DBBA 1T38A 3DV8A 1XTAA 5CPRB 3ZCOA 2RQQA 4ENKA 4AVZA 1JT0A 3WE3A 1MNEA 1IAWA 3ROUA 4CCNA 3J80K 3G2BA 3ECHA 4LG3A 1D5VA 2P4WA 4JX4A 4YFXF 3P7NA 1ZELA 3OYLA 2EBIA 3Q0WA 3DCFA 4XSXF 1ZHFA 4QWQA 1MMDA 4EJVA 3KP6A 2Q2EB 3LSIA 3HOZJ 2LLKA 1W7PA 1MBEA 4JK1X 1DPRA 3TL4X 1YRNB 5IP6A 2K85A 1ZN2A 2V1XA 2X1EA 3JTGA 3PFIA 4ASNA 2B9SA 3BROA 1AKHA 5L3GA 4HX7A 4I99C 4I0AA 1MBJA 1OCPA 3N4MA 2OQGA 1ZKGA 3SDGA 1YIOA 3TP0A 1UFMA 2IP2A 4IJAA 1I3AA 3ELKA 3BT9A 2KZGA 2DMUA 2I5UA 2M7AA 4NBQA 2HEOA 3KEQA 3GYHX 4RA2A 4XRSG 3W2AA 1Z7LA 2WB1N 2GLOA 4XSZF 3VYTB 2JUGA 2HYJA 3NEUA 3W6KB 2ESNA 1PP7U 2FF4A 2LKPA 1ZGWA 3DKXA 1YE9A 4M6XA 4XL9A 1S7OA 3G73A 4A12A 3DQVC 3VSLA 2QLZA 1MZBA 2YX4A 5H6RA 4BYYA 1UHSA 3FKIJ 2V4JC 4DW6A 3FDYA 2K9LA 1H9GA 3GTMJ 3LFUA 2ZFUA 4XLAA 1J2XA 3T0YA 1OR7C 4RGXA 2K02A 4I7HA 1XG1A 1GXQA 4Y33A 4MTEA 1VQKI 2RVCA 3VDXA 3ECOA 2DOAA 2QQ8A 4XRSA 2ECBA 4PFPA 2Y9YA 3NQOA 5FLXZ 1MSFC 4BJ6C 1S7EA 4C2MJ 1J75A 2B0LA 4MNUA 1YLFA 4AIDA 5EZGA 4L5IA 1FMVA 4ZJZA 2PEXA 3SFIA 3KZYA 4IXAA 1E2XA 2K4JA 3C18A 4JYKA 5DCFA 4GYGA 3WHBA 3WHCA 3MZYA 3AL0C 3IUOA 5IP7J 4HDUA 1HKTA 3LA7A 3F23A 2F5EA 4CYCA 2DA5A 2JT1A 2EFQA 2NS7A 1JJ6C 2DPDA 2P7CB 2M7BA 3TOBA 4M72A 2GXBA 4ESFA 1WQ2A 4RS8A 4KMFA 3J7ZI 2MLGA 4EVIA 4XOTA 2QBYA 4NUBA 1WSUA 2HPMA 2E2HJ 4CDGA 4MGRA 2ZXWH 2DA4A 1FPQA 1MMNA 2AQEA 5B66C 2XGXA 1ORKA 2CUZA 1RUOA 3CD6I 4IEJA 2CQXA 2L7ZA 5DD8A 1DGRM 3IP4B 3M9AA 3HC7A 3MCZA 5J40A 3HSRA 3K4JA 4UY8I 2PN6A 4FT8A 1VQMI 1A35A 1W4MA 4QPQA 1U0JA 2R7WA 1G6NA 5BS6A 3CDLA 2JSCA 1DP7P 2BHZA 1O7LA 4N9HA 4L5EA 2LH9A 4XN3A 4XM3A 3B6AA 3CCRI 1BA5A 4IZZA 4XLEA 2CV2A 1XGMA 1UMQA 4PJLA 2L9SA 3U1DA 3M8FA 4XORA 5FKNA 4EJTA 1X58A 4IL6C 4PSXA 4YFKF 1ZGJA 5J4VA 3VEPA 2BVLA 2M87A 3AAFA 2K5CA 3QQAA 1VFCA 4M9SA 1B6AA 1RPWA 1YX3A 1G8XA 2ZXJA 3CMAI 3HB9A 2XSJC 3ZQIA 4CSWA 3MKLA 3E1SA 2E19A 1IDYA 1JKOC 2JJ7A 2E71A 1Z91A 3J81Z 4DYCA 4GDFA 4A0ZA 3JSPA 4BQAA 1I50J 4X6AJ 2QSFX 1KA8A 1BR4A 2HXIA 1QRYA 5DS9A 1S3JA 1XMKA 5FLVA 2DA6A 3DPTA 4Q4ZF 1TWFJ 3S16J 1R00A 3DXJF 3H5RA 2K7LA 2ZO4A 3OL3A 1JUSA 2E5NA 3FXMA 4BHPA 4XKVA 4XOPA 3CMEI 1DUXC 5AIQA 1SD5A 3FXKA 3QP5A 1FY7A 4ZYHA 3FKJA 2VJ5A 4BKXA 2V9KA 5E1XA 2GM4A 2O03A 6PAXA 3D1NI 1XDUA 1MJAA 3BQZA 4P96A 1ZR4A 4MEXF 3N05A 1MIJA 3F72A 2ZMEC 1IN8A 1HW2A 1ETVA 2LBFB 3FZVA 4E7IA 3RDIA 2NAZA 1OISA 1K78A 1ETQA 3CQZJ 2Q8KA 4E7LA 3K4NA 5B1BH 1P6RA 4GRIA 3GVAA 2HOSA 2VIXA 2HGCA 2LK2A 2HWVA 2E2IJ 1CGPA 3R61A 1IW7F 1A5JA 3VYSB 3I53A 4M6YA 2EIJH 3KP5A 5BNGA 2KIQA 4P1WA 4E7SA 3JCUC 3E6DA 3OYMA 3GFIA 3AG4H 3R6SA 1P7IA 2W82A 3PNVA 1I39A 4EATA 3C2GA 1G4DA 3WTUC 4AIJA 4ANJA 1F4KA 2LF8A 3P9CA 3I59A 4JOMA 2IS6A 3VOEA 5DEQA 4BU2A 5E8IA 1ZGAA 1YQAA 4LB6B 4AVPA 1YW7A 3OSFA 2MC3A 4IRHA 3ABTA 2VOPA 2CWEA 2Y0SA 3PSIA 4A3CJ 1V5GA 5L3EA 3K10A 3OYDA 1FZPB 3GO5A 3HM5A 2JA6J 3K70C 3HGYA 3K4LA 4IPAA 1OYYA 2H94A 3TBIA 3PIPF 4KFCA 3PUFA 3BLYA 1HLVA 3V8JA 1TWHJ 3C7JA 5EGOA 3TDZC 3GZ6A 2EA2A 1FP1D 4FE7A 1X2NA 5HNFA 1VQ5I 3QPTA 1HC8A 3ZRGA 3G1MA 1HKQA 2A6EF 1J9IA 1FWZA 1MH4A 2FMYA 1S9HA 2RNGA 1X1AA 2HQ5A 2LP0A 2Z99A 2R7TA 2QYOA 3PM1A 5HLIA 4HAMA 2VPLA 4HLXA 2VBYA 1XPXA 5TRDA 1P2FA 4XK4A 5HDNA 5EF6A 3L2VA 1X3UA 4P9FA 4BNCA 1RESA 1GVJA 3SJMA 2K86A 2OJED 2KQRA 4NB5A 2BXZA 3HPHA 4N4OB 2X85A 1EA3A 2X6WA 4MQ9F 3OR2C 4M3EA 3CMYA 4K2EA 2ISYA 2M5WA 1OCCH 3QYFA 5K5OA 2Y48A 3GBGA 1O3SA 2VN2A 4ZZDA 3D0SA 2K4BA 3CCEI 2O9LA 3K4BA 4DZPA 4ENJA 4LFUA 3MKZA 5CVUA 2KRFA 1UAAA 4BE0A 1B9NA 3HKZN 2HOAA 2QUFA 3A4CA 4HW0A 2P6TA 2V7FA 1S8NA 5F0FA 2MGQA 2P5LC 2RQPA 2Z33A 2FU4A 5FKMA 1WJCA 4XKBA 1MD0A 1Z3YA 2JUCA 2M0CA 4HV5A 4BY7J 5J3LA 3ONQA 1PUEE 4YIIA 5DCMB 2H09A 4BEHA 5JHUA 3BJAA 1IN4A 4QTRA 2X0LA 2KFDA 4FETA 2XSDC 3OMYA 2CGPA 1ETYA 2ZBKA 3E6MA 4U7BA 3CUOA 2GZWA 1Z21A 1A6IA 4XLNF 2K9MA 2HI3A 4V19K 2YU3A 4A0XA 1IC8A 3MN2A 2F4MB 5D4RA 2CQQA 4C3IJ 2R0QC 4FE4A 3GMEA 5IT9K 1JTXA 1MJ9A 4HNVA 1BR1A 1O3RA 1BW5A 1NH3A 2BW3B 2XPWA 5F27A 1Z6TA 5EZHA 3A0BC 1D0YA 1IG7A 4A3BJ 4KNYA 1PUFB 3A01A 1I3QJ 1W5CC 4ESJA 2DOEA 5DUKA 3LA2A 4IHVA 2CW0F 1HKSA 5FD5A 4M3GA 3OYFA 4Y52J 2ZKZA 3K4KA 3VSKA 1ON1A 1IO2A 3K1MA 3REOA 4IHXA 2BHYA 1VQOI 5D8LB 4HDVA 1ODDA 3ISPA 5DV5A 4N9IA 2F5FA 3W6JB 3KP2A 4E70A 5LEJA 4H4KC 4DYRA 4LK1F 2R93J 1QBJA 3BJOA 3HG9A 1HF0A 1NHAA 4DGWB 3NWSA 1YHQI 4C2UA 2GQQA 2VXDA 1X4OA 2XB0X 4LB5A 2D45A 2QENA 1ZARA 2ELHA 1LQ1A 3KYCB 1OPCA 3NRVA 4I02A 2XGEA 1LFPA 1RKTA 4U7DA 4I01A 2O61A 3LL7A 1IF1A 3TW7A 3T8RA 5GADJ 4M6VA 1YO5C 1I1SA 4RB0A 3OYGA 4A93J 4DZJA 3CJQB 4BBRJ 2RKHA 2DAOA 2KIFA 4TV7A 3R0JA 4XKCA 2ZMEA 4U0VA 5J1UA 3RPUA 4BE2A 4BAYA 1R1TA 3HOVJ 4ZTJA 2R5ZB 2JZYA 2E5ZA 5E17F 2H6BA 3LQQA 2M4KA 3E5UA 2DODA 3M3YJ 1F43A 2Z16A 2KL4A 3ZQHA 3GF2A 4YG2F 1POGA 5J4YA 4RDUA 4HF2A 2O6GE 1WJ5A 1BC7C 4L0ZB 3ERMA 3CUQB 3IH3A 2WAQN 3LSHA 5KVRA 4V2GA 2R7QA 4BQQA 4E7ZA 1MMAA 5E18F 1J7KA 2L4MA 4DYQA 5C4XJ 1MH3A 1R4NB 4RAZA 3ZMZA 3GWZA 3DF8A 3QYBA 4I98B 4E4HA 2HYFA 2LKSA 2WTEA 3TP3A 2W25A 3RQIA 2JQ7A 4UVCA 3HL2A 4M74A 5KNLA 1B72A 2QQBA 5F0HA 5ILVA 3TO9A 2ESHA 1ZRDA 2EFNA 3JSOA 1XGSA 2E1CA 4CCJA 1P4XA 4L9NA 2GA2A 4Y15A 4HPQA 4C3JJ 3F0CA 3E3VA 1VZ0A 5E3NA 3KP3A 4Z6YA 3E6BA 2A61A 4A3MJ 1WPKA 3E97A 1JT6A 2WC2A 3HUGA 3FM5A 5J1YA 2E34A 3L2CA 1HDPA 4UUTA 3DBRB 4HLYA 1W5SA 1T98A 4PJ0C 3RYRA 3EYYA 2KDZA 3QU6A 3OY9A 3A0HC 1UG0A 2P5VA 3CESA 3I3LA 2XF5A 1NK2P 3SQNA 4I2OA 1MBFA 5HLTA 2MSYA 3J7AY 2GXAA 2F5VA 5B3SH 2G7UA 5K7HA 4Z2YA 4WXDA 3RKQA 5D4SA 1EF4A 3HIFA 2LRDA 3H1CA 1P92A 3KLOA 2EPFA 5KCMA 3EETA 1TW2A 2KPMA 4B09A 3S2HJ 1WCMJ 2HOTA 3WG7H 4AUXA 4O5VA 3L00A 5D5XB 3U21A 5DUIA 1BW6A 2H6CA 4P9UA 2A05A 5ICGA 4MTDA 2EZIA 3GZNB 4LD5A 2O8KA 1S7AA 2VE8A 1OFCX 4XLCA 2DMQA 5JHFA 2H1LA 4FHTA 3QP6A 4P55A 1W36C 4NDLA 1RZ4A 4ITVA 2RC4A 1FOKA 1LDJA 2R7OA 2R7FA 1K6YA 4XBFA 4IRGA 2FOWA 1DU6A 5TJJA 2ELJA 3TQNA 2OBPA 3BTCA 2OC6A 1JGSA 3F21A 3HYIA 1S5LC 3ERED 5JVGF 1VNDA 4C3HJ 3EPZA 1RNLA 1R49A 1Y1WJ 3DKWA 3S1MJ 2HVRA 2CSOA 3L2QA 2DK8A 2DJIA 2EIMH 2B63J 2M8GX 4EMSA 4M3FA 3OYJA 4UVAA 1HDDC 2FE3A 1DQUA 3RIRA 2HZTA 2XPVA 2XROA 3GTLJ 1D0ZA 3OIQA 4WCGA 1HA8A 1XMXA 1HQCA 3G1OA 1LVAA 4RB1A 2FQ3A 3HSEA 3CP2A 3I71A 4GGGA 4EM1A 1SAUA 3DEUA 1TNTA 1TNSA 2LG4A 3LMMA 2W4SA 1MGTA 4EV0A 1QO0D 3HBLA 4ENNA 2VKVA 1OR7A 3DLLF 1WJEA 4PDKA 2CS3A 3ZMVA 1XB4A 3CCLI 3KEYA 1IV6A 1KU2A 4AIKA 3PSFA 3K1PA 1P4AA 4MHGA 4A6EA 3FXRA 4WXHA 5FKKA 5IPAA 4L0YB 1T08B 1U8BA 3GTOJ 2A69F 4LIUA 1OCRH 2LY9A 2VL8A 1YS7A 2EQRA 2M34A 4FX0A 2AXLA 4OMYA 2EK5A 4DOZA 3I55I 1K7AA 1BI0A 2R5YB 5F64A 3IKVA 1JKRC 4II3A 2KJCA 3ZPLA 1PYVA 5HLHA 2EH3A 1TC3C 1R5HA 3IKTA 3FHZA 3AG1H 1DPUA 2Y0SN 3IWFA 1BN5A 1WVRA 3DP7A 3K1NA 4GFBA 5H2FC 1K6OA 2KJBA 5FFXA 2FNAA 3ZQFA 2JTVA 1YW8A 1D1BA 1SVMA 1WI3A 2DU9A 2WV0A 2GA1A 4GCVA 5GAGJ 3B02A 2ID6A 3WE2A 5FRMA 2FBHA 1XC5A 5FFZA 3S1NJ 4ZYDA 2OTJI 3CJNA 3MQ0A 3JAMK 2VUMJ 3PO2J 2HNHA 3H36A 3G71I 1B9MA 2D2WA 3GTQJ 2EFWA 2NOJB 4KIGA 1FBUA 2XIGA 4XONA 4E7JA 3CLOA 2L54A 3RQ4A 4IHYA 3X2QH 4L5JA 5GTHC 4M3DA 3L2RA 3KP7A 1BJAA 2DTRA 2E35A 1X3WB 1WFXA 3TDUC 5LHGA 1JUMA 1ZH5A 2JMWA 3RKXA 2LSOA 1GV2A 2DYRH 3IH2A 2DXIA 4AYBA 3L2UA 3M1CA 2L2OA 5F1JA 2CRGA 2OCCH 5DD4A 4HX8A 1QZEA 5CQGA 5ERIA 2MW8A 1ZLKA 1X1BA 3EUAA 2KDOA 5IT9Z 1U8RA 1TQPA 4UUSA 1E3PA 3G6EI 3KX2A 2BV6A 4XN0A 2P6SA 2GIVA 3TMOA 3GFJA 1ZRCA 3W6VA 2FD5A 1U5TB 3V8KA 4XLHA 5LHHA 2F2EA 3JRFA 2Z2SB 2XF7A 1L3LA 2NVYJ 4DBRA 3WGIA 1FMWA 3D5RC 1Q1HA 3K9TA 5F08A 1XSXA 2XAUA 3EQLF 4F93B 2BY3A 4IHTA 1IRXA 3I9V2 1B8IA 1KQ0A 4A3DJ 3WTYC 3EDPA 1Z0XA 2CQNA 2FA5A 2LR8A 2X6OA 3PUBA 4UXNA 4R8HA 3U1KA 2TDXA 3RSNA 2VKDA 1M1EB 3HXLA 4A2UA 3FBNB 4HYEA 2K40A 3B6CA 1LJ9A 2Y31A 2PBIA 2V26A 2LFBA 5C3EJ 5KHDA 2OTLI 4AIHA 1TQIA 3CCSI 3JRIA 4OINF 2LVSA 1VQ9I 1PJRA 3MMYB 2YU9J 4NHJA 5KAFC 3RJPA 2WAFA 4MEYF 3DBLB 3CCMI 4A3IJ 4A3LJ 2DQLA 2EZKA 4JX5A 4S04A 4QPOA 4OIOF 3CCYA 3MWMA 1R5ID 2DQRA 4LG0B 4L18B 3BG6A 4B47A 4XLPF 1I5ZA 1HSTA 2CW7A 1TBXA 3I64A 1Z05A 4DIQA 2ELKA 2TRTA 2ZXHA 3M7GA 1XS9A 1E17A 3KIOA 5LGNA 2KIUA 1ETWA 1IUYA 3K7AJ 1T39A 3U9GA 2F4OB 1LPQA 1WJDA 2UXXA 4J19A 2PMZN 1GXPA 3I56I 5FB2A 4LK0F 1PVEA 4KITB 3M4OJ 3ZQCA 2VQHA 2FRHA 2DFHA 3S2DJ 3FK6A 2PJRB 4WK8F 1QQIA 3OYIA 1MDMB 5EG0B 2H27A 2M4GA 2IXSA 1Z7UA 2K9NA 1N25A 2P7VB 2L9VA 1IGNA 3CLQA 1HCRA 4L9VA 1ETKA 3S1RJ 5EG0A 5ICCA 3DEEA 1MDMA 3DLAA 2R4GA 2LY1A 4XNFA 3OOPA 2PJRA 1IZ1A 1UG2A 1AU7A 4G94A 4F3QA 3JRGA 2IS2A 3GX4X 1OCZH 4YFNF 5ILSA 1N78A 1SEUA 4KT6A 3FXQA 2MBFA 3BY6A 2CG4A 2EFPA 2XUBA 1ITYA 2DDBA 2OPTA 2XGCA 2BEOA 2ZNYA 1OKRA 4KJZA 1K4SA 2CJJA 2HZDA 2E1MC 3W2VA 4LG0A 2QF7A 5AIPA 2VONA 4IOAF 2J5PA 1FBSA 3BR6A 3FMRA 5D8KB 2JA8J 2BXYA 2WA0A 2FUG2 1MW7A 3Q5FA 1TT0A 2WAEA 1QPIA 2HDWA 3G1LA 3MVPA 4N0BA 3RPUD 4D7NA 3S17J 1T6SA 3KEOA 2UWMA 5E1ZB 4U88A 1YITI 2BY1A 4B44A 1ZG3A 3RPQA 4XICA 3LAJA 1NG7A 2LREA 2QQ9A 4RGSA 4IOCF 3PNYA 4XIDA 1JJ8C 3BPVA 2Y69H 4OIQF 1LNWA 1FX7A 4I76A 3ZXSA 1GDTA 2G0EA 2VC1A 3AG3H 3KZIC 5IY5H 5LBQA 3E7LA 2HR3A 4Q48A 5IOYA 3OYCA 4G6DA 3FM3A 1B8IB 3GFMA 3DWLE 5H6QA 2CV1A 5H20A 1JKQC 5E79C 3FIWA 1BR2A 4B3XA 5F6FA 3HPGA 1E3OC 3F8BA 1P7JA 2CMPA 1WI9A 2QZ8A 1BBYA 2KLOA 2V1DA 4IQ4A 5L3FA 2IBDA 1ZQ3P 3KPHA 2V9PA 5M3MJ 4ZYEA 1SMYF 5K5RA 1R4MB 3FXJA 2M8EA 3CO7C 1U5TA 1IRFA 5CVJA 1T33A 2VQCA 2A68F 5EEGA 4A5NA 1YIJI 2DW4A 5GP9A 3R4KA 5J8FA 5HS8A 1B1BA 4PGGA 1OMIA 3N97A 2VBZA 4BHBA 3QRFF 4MFEA 1U6GA 4UUSB 2IGOA 5GTIC 2EV0A 4CYDA 1W36D 2O8XA 2Y75A 1ZTRA 2DT5A 2GOMA 3H9JA 4WX9A 2WY8Q 1F1ZA 4ZDLA 4YELA 3S93A 3CDIA 2JK3A 2LKXA 2QWWA 1A6QA 5CVVA 2V79A 2VB6A 1UJ8A 3E6CC 3BWGA 2JN6A 3SHFA 1SMTA 1ULYA 4KISA 3ZQ7A 1QVTA 1T8IA 1ZK8A 2ECCA 1X1PA 1U9OA 1LEAA 4CICA 4AC0A 5K7ZA 1T0FC 1MBHA 3IWZA 2HTSA 2P0WA 3VWBA 1VQ6I 3HRUA 4RLQA 5HS9A 3AKZA 4ZDPA 1TQMA 3RCOA 3H92A 4A5MA 1ZLJA 1XX5A 2BY2A 2IEKA 3K0LA 4HF1A 2NS8A 2XAJA 3SZPA 2YX7A 3S32A 1R23A 3CP8A 3SFZA 1IV8A 1FBQA 4MFDA 2CH0A 1BL0A 2XAHA 3ZOBA 2ZB9A 1WKMA 4KN4X 1WGXA 1LKXA 3HKZA 2DPUA 4KIFA 1N75A 3HRSA 4KYWA 1BIBA 2ZSIB 2STWA 3GTJJ 3KFWX 3AFHA 3WTWC 1J5YA 4HEA2 3J7YJ 5DM7F 1Z77A 2KP6A 3BTJA 4UVBA 1WHUA 1VTNC 4EJOA 2K3PA 1G3TA 1SAXA 3BR1A 2O5RA 3PL8A 5LFAA 3QPSA 3R0AA 3ESWB 1KQ8A 2PMUA 2R5YA 1Z67A 5B1AH 2NNNA 3I54A 2XASA 2ETHA 4MO7A 3BPXA 5FGMA 2KISA 1BI1A 2VODA 4G6QA 2IA2A 2L01A 2HTJA 1WJAA 4CH7A 1WH5A 4BJTA 1I6HJ 1TW3A 2PLYA 4IF4A 1D1CA 5DYMA 2QA4I 3BG5A 2Z9OA 2HYGD 3K4CA 1GV5A 3DTIA 3GLLA 4BHCA 1FYMA 1QHGA 3KYLA 3BG7A 1REPC 4IQJA 5L3CA 5FD6A 4IRIA 2I10A 4QSHA 5EJCA 2VBWA 4PUSA 1VQ7I 3V7CA 3TGNA 5HS7A 1BIAA 1SFKA 2YPRA 3AL0B 4DQ2A 3SEZA 5IP9J 3A2KA 4GXOA 2WAQA 3EUHA 3ZGKA 2GOXB 2DO7A 3BC8A 4A69C 2GXGA 3ABKH 1H0MA 1LDKB 2KIMA 3OS0A 2MFZA 3OSGA 3HOSA 5KAIC 3SXYA 4J01A 4BBSJ 4UUVA 3HHHA 3H3VK 1O57A 5CQEA 4AM3A 3HZJA 3FK7A 2AXTC 4M9XA 4MQVA 4NC7A 4YEJA 3OYNA 3MZ8A 1RR7A 5D6EA 2M1BA 3M07A 3QPLA 2A5YB 2PI0A 5EEAA 2WY7Q 5HDGA 3ZQGA 2BVMA 3GTGJ 5F1RA 5FROA 1GUUA 1V5EA 3H3UA 5M3FJ 1HSJA 2LDUA 4CZZA 1ETOA 3QU3A 4GYIA 1Y0UA 4BS9A 1UELB 3WG9A 2MD0A 3C2BA 2LC2A 2WV1A 2IPQX 3S3OA 2UV1A 4E7KA 1EH8A 1FTTA 1HBXG 3HJEA 3COAC 1NG6A 1QPMA 3ML6A 3F8FA 3G3ZA 2FBKA 1K4TA 2R7SA 4OAYA 1GHCA 4F92B 3BZCA 2KRCA 2W57A 4MLOA 2QKLB 2HS5A 2R7RA 2UUZA 3PFYA 1JGGA 3FMQA 4UB8C 3ZN0A 4CZCA 1BC8C 2CFXA 4YIRX 1EJ9A 3J80Z 3HUGB 4CCLA 4M9ZA 1UB9A 1WJBA 3LFKA 1QA6A 4B3AA 1BM9A 3I4MJ 2F4IA 2QVOA 4B4CA 1TP4A 1H89C 2CYYA 4BUPA 1JTYA 4R79A 1QU3A 4OMZA 1V54H 2JPBA 5E8GA 2VT3A 1FLIA 4PZJA 4DJAA 1O3TA 1VQNI 3OIOA 3PNTA 3DTKA 2IS4A 1YJ9I 5HDKA 1B72B 3IL2A 2MA3A 3CCQI 3JRAA 4BJ5C 4AD9A 1ETXA 1OJLA 1R1UA 1O4XA 4CGZA 2L7KA 3LA3A 4BL0B 1R22A 3GLXA 3BOQA 4XMYA 1SFOJ 2FX0A 5EEHA 3ABMH 2DLLA 2RGVA 1YFHA 1VQ4I 2V1UA 3CUQA 2VKHA 3ULQB 3HOUJ 2ZJQF 4Y7NJ 1SD6A 3FMSA 3OYBA 1KZHA 4L9JA 2EB7A 2IS1A 5E3LA 1T95A 1QZZA 1TT5B 3HTUA 2IRFG 2HDCA 2FXAA 2HQRA 3BG3A 4JQFA 2JWTA 1P9QC 2AS5F 2MC4A 2CUEA 5TGTA 2Y9ZA 3GXOA 1BI2A 2R5ZA 4KUMA 2W00A 3K6GA 5CYVA 1E3HA 4BE1A 2EWNA 2ZMEB 3CZ6A 2WB1A 1QNTA 4IKFA 3S1QJ 1K83J 3VODA 4PGHA 4B43A 3P9IA 4PK4A 1OYIA 2R3SA 3FHNA 2ZJ2A 4XLFA 1XSDA 2DMPA 3LSRA 3J7AO 2QM3A 2ZJPF 1TTYA 1RC9A 3QOPA 4EJUA 2QSGX 4B1RA 4RB2C 4D5CA 1TL8A 2NVTJ 2J5OA 9ANTA 4GO1A 1HW1A 4EEFG 3HRTA 3BDDA 3E0JB 3VPRA 3S2WA 1DP3A 3PO3J 1LVKA 3LNQA 2QEXI 3Q3SA 5FLXK 3PIOF 1FJLA 3QOEA 2E2JJ 1SVOA 2YSRA 3LSKA 1AA7A 1O7FA 4HNTA 3OIPA 1XSVA 2RN7A 5ICFA 2WBMA 3OS1A 4XQFA 4HOBA 1J09A 2D1VA 3ASNH 1XD7A 4A0YA 2CUFA 5CKTA 3CO6C 5J8CA 3I5UA 3F9KA 3A01B 1EH6A 1D1AA 1PUFA 3O2PE 2KZVA 1FOWA 1S72I 1QVUA 3WTZA 2QSHX 2V9VA 2BW3A 2Z3YA 2IT0A 1L0OC 1ZG5A 1BI3A 2K9QA 3CCUI 2IVMA 1STZA 3AG2H 2UXNA 2G9WA 4HV6A 1SC7A 4BDYA 3NWTA 2NRAC 4C9YA 4P5OA 2W7NA 4NC6A 3FBIB 3C2HA 3HRMA 4KMUX 4OOIA 4FX4A 1SFXA 2ADUA 2ACJA 3F6VA 4RLFA 2VBXA 1OLTA 3TO6A 5DCMA 4BEHB 1V4RA 5EDNA 4CHUA 3H0DA 2CW8A 3JRBA 1E0EA 3WGGA 3M8JA 2DT6A 5HNHA 1ZAOA 2HKXA 1KU7A 2EIKH 1ZYRF 3FISA 5C4JJ 1HOMA 1SD4A 5HOOA 5E3MA 2MABA 3GTPJ 5M5YJ 2W85A 1R36A 1U2WA 1U78A 3JRHA 2OU2A 3BCAA 1Y0NA 2CU7A 3RZOJ 5CLSA 1FP2A 2VASA 2IA0A 3HEFA 1LB2A 1Z3XA 3OWTA 2LF7A 5ILUA 4BXXJ 1B59A 1SANA 1RI7A 3WU0A 2FBIA 2HOEA 1G3WA 3O8GA 1FIAA 3V7RA 1DGWY 4LOCA 1MKMA 5EYRA 5JR3A 1VQ8I 2DMTA 2NVUB 4XRMA 3DKYA 2EJRA 5FO5A 2ME6A 1IXSB 3HOWJ 5IOZA 1LEBA 2X1CA 3JREA 2HVQA 5FKOA 4HSTA 2ZSHB 5JI6A 2M30A 3T8TA 3F3XA 1YW9A 4U0YA 5J6XA 5HODA 1D8JA 3H5NA 1W5TA 2EV5A 2XAGA 1KGSA 4RAYA 1Y8QB 2F48A 1OCTC 1IN5A 2LY2A 3BQYA 1YTYA 3SZGA 3VYRB 1A36A 3BR0A 5C44J 4F52A 2AHQA 2DOFA 2KRHA 2R7ZJ 5E3OA 3HOXJ 4Y13A 2YS9A 2FSWA 3J81K 1XMAA 3JAMZ 1YG2A 2L9RA 3FF5A 1VI0A 1D8KA 4ZH4F 2PMHA 3DTEA 4XRFA 4NC8A 3G4SI 3OS2A 2IJLA 3L2WA 1YJNI 2OA4A 5EGOB 2LD5A 2KMUA 1F9NA 2BYVE 5GPAA 3Q0UA 2F6CA 2FEZA 1R7JA 4C2TA 1SFEA 5DDGA 1QGPA 1KYZA 2DYSH 2V6CA 3Q9SA 3PJRA 3HOTA 5D5VB 3S3MA 3A1YA 4AYBN 3WTTC 3LSJA 3F8CA 4OAZA 4G8XA 1R9TJ 4Q47A 1ACIA 2Q0OA 2Y30A 2YUSA 2XV4S 3KYDB 4BH9A 4ZYGA 3OV8A 2OAZA 3JTHA 2EILH 3I59B 1A04A 3F22A 4LLNA 1QHHD 2HPIA 3S3NA 1W7PD 2BZTA 1MMGA 2JVGA 2K9SA 1Y8RB 2AQFA 1UHMA 1ERDA 2DCEA 5K7FA 5LLQA 1R6RA 4RM3A 5IYDJ 2L7FP 2M9HA 4A3EJ 2L3DA 3KCCA 2VI6A 1X19A 4OIPF 4JBAA 2H8RA 1YS6A 5JFRA 3DBHB 2JA7J 3GW2A 3LOCA 3OYHA 5B5EC 1K61A 2VT2A 2LYCA 4D1QA 1JXSA 3SYTA 4DNCA 1JI8A 2I8DA 1TZLA 2IW5A 3CF5F 3H0GJ 1K78B 3VYUB 1K79A 1G3YA 2JA5J 1SVLA 3JRDA 1Y1VJ 2LBFA 2RNJA 2TCTA 1IXCA 4LMYA 2O7OA 2XHKA 2DDAA 3LAPA 2ZNZA 2X1DA 4FCYA 2EZLA 3A03A 2DT7B 3BCBA 4PJJA 1LUJB 2VXZA 5L3BA 2N8GA 2EA4A 3QPHA 4CCMA 3FXLA 1MMSA 1MNDA 1UZCA 2XGDA 4BQNA 5A2QZ 1Y6IA 3WGHA 2MH9A 2BY0A 2JRTA 2NOGA 2FJ1A 4BACA 1R71A 4BY1J 4M71A 3M8EA 2GIZA 2H8WA 1SFUA 3CUQC 1GLNA 2X4HA 4II2A 1KQ9A 4HNUA 3CDHA 3E5XA 4G12A 4HSRA 5LHIA 2W84A 4J00A 3HSFA 2RDPA 3P5JA 3F6OA 2RAEA 4N4NB 4IO9F 4ZZLA 2G7HA 4AU7A 2XKPA 2LNBA 1FOXA 4MIMA 3LQRA 1GVDA 1ON2A 3HTSB 4D7MA 4KA4A 2ME0A 4W97A 4Y17A 2E7XA 3ZMSA 3D5LA 2PG4A 1N77A 4BXUA 1YX5A 3OL4A 3C1DA 1D3YA 5CJ9A 4RMNA 3QAHA 1WJFA 1DU0A 2CQKA 1Q1VA 5E1WA 2DK5A 1FIPA 4HQMA 5CVRA 3MKWB 2HKOA 3SZTA 2MD5A 1JUPA 2DMNA 3OR1C 2Y0MA 1YI2I 2NXNB 1YJWI 3D5SC 5E20A 3CC7I 2VPRA 3L9FA 1W1WE 3CC4I 4YRVA 3RYPA 4OU0A 3E5QA 3ZMTA 3H9QA 2W48A 2EFOA 3P9KA 4E7HA 3ZMDA 3ASOH 2NS0A 1FYLA 4G6TB 5ED4A 2MYSA 3V42A 1UHWA 2CO5A 4M3BA 4F91B 3GTKJ 1VF9A 3HOYJ 4G9YA 2NVQJ 1Z9CA 2STTA 2VJIA 4LIVA 2O0YA 4I09A 2D1HA 2IGMA 5D6FA 4HA8A 4E6KG 3BJ6A 4BDZA 2V6EA 3L1PA 1V3FA 1LFBA 2X9DA 1T56A 2VOOA 3OYKA 2A07F 3WODF 1J0RA 3V7SA 2QBYB 3S14J 1YYVA 1AOYA 3CC2I 2DI3A 3K2ZA 3RZDJ 5DTDA 2ZXIA 2L7MP 3H3ZA 3OOUA 2E1NA 3UKGA 3I0TA 3MEXA 1A31A 1VQLI 4FTHA 2GAUA 1MNMC 4ETSA 3CMMA 1JE8A 5IYCJ 1Y39A 4G7HF 3CF2A 1X3ZB 5A2QK 4F55A 2ID3A 4JP0A 4RM2A 1X2MA 3TOAA 1MSEC 5FRNA 1FSEA 4ENMA 4CYCB 1XGNA 3LSGA 2CQ7A 3EUHC 4BXFA 2M3AA 4EM2A 2GBYA 3CTAA 4O6JA 2CFOA 1FTZA 2FOKA 4CCKA 1ZRFA 3I4PA 2HFHA 1FEXA 4PJNA 4PFOA 2L4AA 4KICA 2QKMB 3O8HA 3S15J 4S0HB 4X0GA 4DBQA 2Z1DA 5GAEJ 1F5TA 4LGWA 2MH2A 4IVNA 2GWRA 4A6DA 4D0PA 2A6TA 5JLXA 1RR8C 2RV8A 2VQLA 2ISZA 3JW4A 2RREA 4LLGF 1IUFA 3MFKA 4HBLA 1DDNA 2DA1A 3WU2C 1H9TA 3KZZA 1IRGA 2WWYA 1B4AA 3LWFA 5LGUA 4JX6A 1MBKA 1USTA 2ZC2A 2QQAA 1KU3A 2XC7A 2PQ8A 3L09A 2DTZA 5F04A 3RKWA 2HU9A 3BR5A 4RGUA 3T1BA 3RI4A 3CJTB 2K3FA 5M5WJ 1HW5A 3BZKA 5FKLA 3CJRB 2ZFWA 1BOBA 3WTVC 3V4GA 2A5WA 4LLLA 1YOVB 1IDZA
chains in the Genus database with same CATH topology
3S8PA 3ZQQA 4BJ5C 2L7KA 4BL0B 3DU6A 4HG2A 1BR4A 1D1BA 4XMYA 3DPTA 1KONA 2VJ4A 5FRMA 3H5RA 5LD2C 2VKHA 3OL3A 2E5NA 3OYBA 4XKVA 4XOPA 2IS1A 4ZDOA 2R7XA 4BGDA 2HNHA 1T95A 3SDBA 4JQFA 2NOJB 3FKJA 4XONA 2VJ5A 4E7JA 1P9QC 2V9KA 3RQ4A 2MC4A 5TGTA 3L2RA 1WFXA 2W00A 2WADA 3K6GA 3N05A 2R7UA 1X1CA 4BE1A 3MKYB 2DXIA 4AYBA 3L2UA 3CZ6A 2WB1A 3M1CA 4XKWA 4CCOA 3QYEA 2L2OA 2LBFB 4E7IA 4IKFA 4PSWA 4B43A 4PK4A 4PJMA 2CUJA 3FHNA 4XLFA 4E7LA 5CQGA 4NNJA 3K4NA 1V5FA 4D9JA 1X1BA 4GRIA 3EUAA 2VIXA 2KDOA 4LITA 2HVSA 3KX2A 4XN0A 3VYSB 3E0JB 2BOLA 2L9NA 1DP3A 1LVKA 3TMOA 4P1WA 4E7SA 3OYMA 3W3CA 4XLHA 2E60A 3QOEA 3LSKA 4BS9A 2Z2SB 1AA7A 1Y56A 2W82A 2XF7A 4HNTA 3PNVA 1D0XA 3OIPA 4EATA 3C2GA 3MD2A 4DBRA 3H35A 4ANJA 3QODA 2WBMA 3OS1A 1FMWA 4XQFA 3D5RC 4U87A 2IS6A 4JOMA 1J09A 2XAUA 4F93B 1IRXA 3I9V2 4BU2A 5CKTA 3ZR8X 3F9KA 3PUBA 1D1AA 4B48A 2Y0SA 3RSNA 2VKDA 3HXLA 3FBNB 3PSIA 2KZVA 1V5GA 2XF6A 3K10A 4C30A 2BW3A 3OYDA 4ZC3A 2V26A 3K70C 2X6XA 3RTRA 3K4LA 5KHDA 4CA0A 2HQAA 4BDYA 1PJRA 3MMYB 3NWTA 3TBIA 4C9YA 4P5OA 2W7NA 3FBIB 2WAFA 3BLYA 3C2HA 4HRIA 1G59A 3IAM2 2KHMA 4QPOA 4RLFA 5HNFA 3BG6A 3ZRGA 1X4PA 1OLTA 4B47A 2CW7A 4ZYAA 4BEHB 4XR6A 3H0DA 2CW8A 4DIQA 1E0EA 1S9HA 2ZXHA 2X51A 2RNGA 1X1AA 3M8JA 2R7TA 2DT6A 4Y3OA 5HNHA 2VPLA 3L2VA 5HOOA 2MABA 1WJDA 2L5QA 2KQRA 3HPHA 4N4OB 2X85A 4CUGA 4KITB 3BCAA 1EA3A 3LSMA 2CV0A 2VQHA 2X6WA 5HVQC 2VASA 3OR2C 1Z3XA 3OWTA 2XDVA 2PJRB 3OYIA 2JVHA 2M4GA 2IXSA 3QYFA 3GBGA 3OYAA 1DGWY 3DU5A 3K4BA 2W1OA 3DEEA 3DKYA 3DLAA 2R4GA 2LY1A 4XNFA 3W2WA 3MKZA 1UAAA 4BE0A 2PJRA 3UR3C 2X1CA 2HVQA 4HSTA 2ZSHB 4F3QA 2VLAA 3A4CA 2IS2A 2V7FA 3H5NA 1N78A 4BQOA 1WJCA 4XKBA 4IX7A 4KT6A 1Z3YA 2LY2A 3SZGA 3VYRB 4F52A 3ONQA 2KRHA 4KJZA 4BEHA 2HZDA 3DPLC 2E1MC 2E1MB 3EUKL 4FETA 4Y4RA 3W2VA 2X6YA 3OMYA 3DTEA 4NC8A 3OS2A 4U7BA 3L2WA 1Z21A 2KMUA 2K9MA 2WA0A 2FUG2 4NQWB 3SEQA 1MW7A 1TT0A 2WAEA 4OWRB 2HDWA 2F6CA 3RPUD 4C2TA 2LOOA 2UWMA 3PJRA 1BR1A 4B44A 3HOTA 3S3MA 1NG7A 2BW3B 2LREA 3A1YA 3K70D 3PNYA 1D0YA 4OAZA 3ZXSA 2VJJA 4ZTFA 3OYCA 2PMZA 3DWLE 3OYEA 2CV1A 3OYFA 1BR2A 3K4KA 4B3XA 3HPGA 4FASD 1QHHD 2CMPA 2HPIA 3VSKA 3S3NA 1MMGA 2JVGA 2KLOA 2AQFA 3K4MA 4IQ4A 2M0MA 3DPUA 1ERDA 2DCEA 1R6RA 4RM3A 4H4KC 1X19A 2VQCA 3HG9A 1X1DA 4DGWB 2OV7A 3NWSA 2IGKA 2V1NA 4C2UA 2VXDA 1X4OA 2VQGA 3H9GA 3OYHA 2IGOA 3H5AA 1W36D 1LFPA 2GOMA 3H9JA 2WY8Q 2LYCA 4D1QA 3LL7A 3UNGC 2JSPA 2Q1ZB 3SYTA 4ZDLA 1JI8A 2I8DA 1TZLA 4YELA 3S93A 3VYUB 3IAS2 3OYGA 3CJQB 2LBFA 2R7VA 2VB6A 4XKCA 4BE2A 4KISA 2X1DA 2OUMA 4ZTJA 2JA2A 2E5ZA 2IGNA 2DT7B 3BCBA 4PJJA 2VXZA 5CPRB 3ZCOA 1T0FC 2M4KA 2RQQA 4CCMA 2P0WA 3VWBA 1MNDA 4AVZA 1MNEA 4BQNA 2Z16A 4RLQA 1Y6IA 2KL4A 3AKZA 4ZDPA 3RCOA 4CCNA 4BACA 3G2BA 4LG3A 1WJ5A 1ZELA 3OYLA 1GLNA 4II2A 1MMDA 4HNUA 3LSIA 2Q2EB 3S32A 3CP8A 3LSHA 4HSRA 4J00A 2R7QA 2CH0A 4BQQA 3TL4X 4E7ZA 1MMAA 4N4NB 3HKZA 1LKXA 2X1EA 4AU7A 1N75A 3QYBA 4E4HA 2ZSIB 3AFHA 4HEA2 2KP6A 3HL2A 5KNLA 3D5LA 2K3PA 1N77A 1YX5A 3OL4A 2M7AA 4RMNA 2O5RA 1WJFA 3PL8A 5LFAA 3W2AA 4CCJA 1Z7LA 3VYTB 2JUGA 4HPQA 3MKWB 1VZ0A 3DKXA 1YE9A 4XL9A 3OR1C 3DQVC 3VSLA 3D5SC 2V4JC 3FDYA 1WJAA 4YRVA 4CH7A 2K9LA 3OY9A 4BJTA 1UG0A 3CESA 3I3LA 2XF5A 3LFUA 2ZFUA 4XLAA 3H9QA 5HLTA 1OR7C 1D1CA 3J7AY 2F5VA 4Y33A 4E7HA 3VDXA 4G6TB 2MYSA 2DOAA 3V42A 3K4CA 4PFPA 3DTIA 4F91B 4BJ6C 1QHGA 3KYLA 3BG7A 2LRDA 4IQJA 5KCMA 2VJIA 1FMVA 2KPMA 4LIVA 4ZJZA 4PUSA 3U21A 2IGMA 2V6EA 4E6KG 4BDZA 1SFKA 3AL0B 3AL0C 3IUOA 3SEZA 3A2KA 2WAQA 3ZGKA 3OYKA 2GOXB 3BC8A 4XLCA 5JHFA 1LDKB 3OS0A 1W36C 2MFZA 4ITVA 3HOSA 2ZXIA 3OOUA 4J01A 2R7OA 1K6YA 2M7BA 5CQEA 2ELJA 2OC6A 4NC7A 4YEJA 3OYNA 3CMMA 3CF2A 3EPZA 4F55A 4XOTA 4NUBA 2WY7Q 4RM2A 2HVRA 2BVMA 2HPMA 5FRNA 3L2QA 3LSGA 2DJIA 3EUHC 4BXFA 1MMNA 2AQEA 2M3AA 5FROA 3OYJA 2CUZA 2CFOA 1V5EA 4CCKA 1DQUA 4PJNA 1D0ZA 1UELB 3OIQA 4PFOA 2MD0A 1DGRM 3IP4B 2QKMB 2LC2A 3HC7A 3S3OA 2UV1A 3K4JA 1HA8A 4E7KA 4X0GA 4DBQA 2Z1DA 3CP2A 4QPQA 1NG6A 1U0JA 1SAUA 3LMMA 2LG4A 2A6TA 2W4SA 2R7WA 2VQLA 2R7SA 4OAYA 4F92B 2RREA 2KRCA 2LH9A 4MLOA 4XN3A 2QKLB 4XM3A 1WJEA 2R7RA 2CS3A 4IZZA 3KEYA 2UUZA 3PFYA 4XLEA 3PSFA 4CZCA 2CV2A 4PJLA 2L9SA 4XORA 3HUGB 2XC7A 4CCLA 4PSXA 1WJBA 4LIUA 2VL8A 2F4IA 4DOZA 2BVLA 2HU9A 4II3A 2K5CA 4R79A 4BUPA 1QU3A 1PYVA 4DJAA 3CJRB 1YX3A 1G8XA 1BOBA 3PNTA 3DTKA 2XSJC 4CSWA 2IS4A 2A5WA 3E1SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZC3 A;  2CMP A;  3ZQQ A; 
#chains in the Genus database with same CATH topology
 3S8P A;  2YR2 A;  1EV7 A;  4LJZ F;  3ZQQ A;  3DFG A;  3BZ6 A;  1AKH B;  4RGR A;  3ZP5 A;  3DU6 A;  4HG2 A;  2C6Y A;  3VFZ A;  1UCR A;  1ONV A;  4KDP A;  4I0B A;  3FXU A;  5GAH J;  1YRN A;  3FXO A;  1KON A;  4HZF A;  1W7P B;  2A3S A;  2E36 A;  4KN7 X;  3IRQ A;  4A3J J;  2VJ4 A;  1LDD A;  2HQN A;  2JPC A;  2Q2E A;  2W24 A;  4RAG A;  5LD2 C;  3B73 A;  1ENH A;  5J47 A;  3R60 A;  2UZK A;  2MG4 A;  4ZDO A;  2R7X A;  2OCE A;  3TW6 A;  4BGD A;  3KLN A;  3SDB A;  2R92 J;  1U3E M;  1KU9 A;  2XVC A;  5L3D A;  4G7Z F;  4Q5S F;  1T0F A;  2B7E A;  5BPD A;  2EIN H;  1TWC J;  3O6B B;  3KET A;  2ICW G;  2WAD A;  1GT0 C;  3ZMU A;  2E1O A;  5IT3 A;  1X1C A;  2R7U A;  2DFI A;  3GUD A;  3MKY B;  3HGG A;  1ZR2 A;  4XKW A;  4CCO A;  4WWC A;  3QYE A;  4UB6 C;  5FJ8 J;  4PSW A;  1J59 A;  1FYK A;  1QZY A;  4PJM A;  1LE8 A;  3FX3 A;  1I27 A;  1R5G A;  2CUJ A;  2XPU A;  1SD7 A;  4NNJ A;  1V5F A;  3KP4 A;  2EV6 A;  4D9J A;  4IHW A;  2BBY A;  2DA3 A;  1TWA J;  2QCO A;  2PFB A;  4F7Z A;  4RAF A;  3IV5 A;  1OQY A;  3I58 A;  4LIT A;  2OQR A;  2HVS A;  2MLK A;  2OZU A;  5LEK A;  2K27 A;  2DFF A;  3IHU A;  4WF2 A;  3WTS C;  1PP8 F;  2E7W A;  2M45 A;  3DEW A;  2BOL A;  2L9N A;  3HHG A;  3Q9V A;  1WZ2 A;  3M1E A;  2XB5 A;  1U5T C;  3W3C A;  2E60 A;  3VB2 A;  3IC7 A;  3BR3 A;  1Z1D A;  1Y56 A;  3TED A;  1BOA A;  2EZH A;  1D0X A;  1WH7 A;  4EQQ A;  3MD2 A;  3FWE A;  5KK1 A;  1Z6R A;  3H35 A;  3QOD A;  1XDS A;  1IN6 A;  2JRM A;  2OD5 A;  3BG9 A;  4FIS A;  4U87 A;  2LTP A;  3PQJ A;  1RET A;  1JKP C;  3ZR8 X;  1FSH A;  1KYW A;  2D5V A;  4B48 A;  2ZJR F;  2XKO A;  4FQG A;  4EGY A;  4B8X A;  3C3W A;  2XF6 A;  4C30 A;  1XGO A;  3IH4 A;  4L9T A;  1WRJ A;  4I6Z A;  1CF7 A;  3F8M A;  5JVT A;  2FNP A;  4ZC3 A;  1RUN A;  5LRS A;  2X6X A;  3RTR A;  3U2R A;  4A3K J;  4HQE A;  4CA0 A;  4U0W A;  2HQA A;  4ESB A;  4NQW A;  4UV8 A;  1JHF A;  1AHD P;  4ABZ A;  3RKY A;  1XCB A;  2FML A;  1G59 A;  4HRI A;  3IAM 2;  1F36 A;  2KHM A;  2NNY A;  1W0U A;  3GEZ A;  3F8N A;  1FC3 A;  1X4P A;  3BR2 A;  2M2E A;  4WXC A;  4ZYA A;  2IA1 A;  1U9N A;  4RBO A;  4XR6 A;  2DA2 A;  3WU1 B;  3JR9 A;  2LMD A;  5JLW A;  1R58 A;  2X51 A;  1ZG1 A;  2X48 A;  4Y3O A;  3WTX C;  3JRC A;  2PJP A;  1ZRE A;  2F5D A;  2P8T A;  2L5Q A;  4R1H A;  5D5W B;  2VC0 A;  2O3F A;  4CUG A;  1S29 A;  2R7D A;  1OCO H;  2QGU A;  5BMZ A;  1O3Q A;  3LSM A;  5D5U B;  2CV0 A;  5HVQ C;  2DFE A;  1NTC A;  1H8A C;  2XDV A;  2VKE A;  3TKY A;  2XAQ A;  3GZ5 A;  2JVH A;  2DN0 A;  3ZN1 A;  2XRL A;  5CVI A;  2Y2Z A;  1H88 C;  3OYA A;  4X1E A;  3DU5 A;  2BGC A;  2FQ4 A;  4AWX B;  4IHS A;  1IRZ A;  2NVX J;  2W1O A;  3LSP A;  3W2W A;  5DM6 F;  4UHT A;  2BE5 F;  3CCV I;  2F5C A;  1FNN A;  4UV9 A;  3UR3 C;  1FT9 A;  3BTI A;  1TLH B;  2VLA A;  2XRN A;  1EH7 A;  1AWC A;  2AO9 A;  1MJB A;  4HX4 A;  1JHH A;  4BQO A;  2Z5U A;  2OZ6 A;  1RKW A;  4IX7 A;  1CQT A;  3PQK A;  5TIS C;  1C0W A;  1IXR C;  4V2F A;  4S05 A;  1S6L A;  3GCM A;  3IRR A;  3GFL A;  1V55 H;  1PDN C;  2VE9 A;  5LGT A;  1I1G A;  1R1V A;  4CXF A;  4W1U A;  5AON A;  3DPL C;  1RRJ A;  1IN7 A;  1MBG A;  3EUK L;  2E1M B;  4Y4R A;  4QLC U;  2X6Y A;  2L0K A;  1P4W A;  1D5Y A;  4EJW A;  5HLG A;  3ABU A;  1EKE A;  1HXD A;  2IAI A;  5LRR A;  1W0T A;  1G3S A;  1XCV A;  4NQW B;  4PCQ A;  3SEQ A;  3V8L A;  4OIR F;  4OWR B;  5BOX A;  5BPI A;  3QWL A;  1OYW A;  2DJN A;  4HF0 A;  3L7W A;  1USS A;  2LOO A;  2P81 A;  4KT5 C;  3HDD A;  1RIO H;  3ZQL A;  1CF7 B;  3K70 D;  1VQP I;  3EYI A;  2HDD A;  2KT0 A;  4QIW N;  1T2K A;  2VJJ A;  4ZTF A;  1APL C;  1NK3 P;  1WWX A;  4KIB A;  5BQT A;  2NYX A;  2COM A;  5FLM J;  5J1R A;  2L02 A;  4O3M A;  3LST A;  3Q0V A;  1LFU P;  2PMZ A;  2XAF A;  3OYE A;  5K1Y A;  1IJW C;  5IYB J;  1FOY A;  4M73 A;  4FAS D;  3NAU A;  3CCJ I;  3MAJ A;  3T5X A;  5K5Q A;  3K4M A;  2M0M A;  3DPU A;  2H1K A;  2A6H F;  3TO7 A;  1I6X A;  2OF7 A;  4EM0 B;  5ICE A;  1BJZ A;  1X1D A;  2OV7 A;  3BTL A;  2IGK A;  3K69 A;  3MZH A;  2V1N A;  2VQG A;  3H9G A;  2P5K A;  2COB A;  3H5A A;  3BP8 A;  2DA7 A;  5F0C A;  4UNO A;  3UNG C;  4CO8 A;  4D5F A;  2JSP A;  2Q1Z B;  1XN7 A;  2KKO A;  1LE8 B;  3IAS 2;  3KE2 A;  3O3K A;  5M5X J;  3I4N J;  4H0E A;  4A3F J;  2PX9 A;  3K2A A;  3NAR A;  2R7V A;  3A02 A;  3ABL H;  4RB3 C;  4A3G J;  4G7O F;  2OUM A;  2HXO A;  4YIF A;  2JA2 A;  2IGN A;  4EGZ A;  2ZCW A;  4ON0 A;  5GPC A;  1TWG J;  1G2H A;  2DBB A;  1T38 A;  3DV8 A;  1XTA A;  5CPR B;  3ZCO A;  2RQQ A;  4ENK A;  4AVZ A;  1JT0 A;  3WE3 A;  1MNE A;  1IAW A;  3ROU A;  4CCN A;  3J80 K;  3G2B A;  3ECH A;  4LG3 A;  1D5V A;  2P4W A;  4JX4 A;  4YFX F;  3P7N A;  1ZEL A;  3OYL A;  2EBI A;  3Q0W A;  3DCF A;  4XSX F;  1ZHF A;  4QWQ A;  1MMD A;  4EJV A;  3KP6 A;  2Q2E B;  3LSI A;  3HOZ J;  2LLK A;  1W7P A;  1MBE A;  4JK1 X;  1DPR A;  3TL4 X;  1YRN B;  5IP6 A;  2K85 A;  1ZN2 A;  2V1X A;  2X1E A;  3JTG A;  3PFI A;  4ASN A;  2B9S A;  3BRO A;  1AKH A;  5L3G A;  4HX7 A;  4I99 C;  4I0A A;  1MBJ A;  1OCP A;  3N4M A;  2OQG A;  1ZKG A;  3SDG A;  1YIO A;  3TP0 A;  1UFM A;  2IP2 A;  4IJA A;  1I3A A;  3ELK A;  3BT9 A;  2KZG A;  2DMU A;  2I5U A;  2M7A A;  4NBQ A;  2HEO A;  3KEQ A;  3GYH X;  4RA2 A;  4XRS G;  3W2A A;  1Z7L A;  2WB1 N;  2GLO A;  4XSZ F;  3VYT B;  2JUG A;  2HYJ A;  3NEU A;  3W6K B;  2ESN A;  1PP7 U;  2FF4 A;  2LKP A;  1ZGW A;  3DKX A;  1YE9 A;  4M6X A;  4XL9 A;  1S7O A;  3G73 A;  4A12 A;  3DQV C;  3VSL A;  2QLZ A;  1MZB A;  2YX4 A;  5H6R A;  4BYY A;  1UHS A;  3FKI J;  2V4J C;  4DW6 A;  3FDY A;  2K9L A;  1H9G A;  3GTM J;  3LFU A;  2ZFU A;  4XLA A;  1J2X A;  3T0Y A;  1OR7 C;  4RGX A;  2K02 A;  4I7H A;  1XG1 A;  1GXQ A;  4Y33 A;  4MTE A;  1VQK I;  2RVC A;  3VDX A;  3ECO A;  2DOA A;  2QQ8 A;  4XRS A;  2ECB A;  4PFP A;  2Y9Y A;  3NQO A;  5FLX Z;  1MSF C;  4BJ6 C;  1S7E A;  4C2M J;  1J75 A;  2B0L A;  4MNU A;  1YLF A;  4AID A;  5EZG A;  4L5I A;  1FMV A;  4ZJZ A;  2PEX A;  3SFI A;  3KZY A;  4IXA A;  1E2X A;  2K4J A;  3C18 A;  4JYK A;  5DCF A;  4GYG A;  3WHB A;  3WHC A;  3MZY A;  3AL0 C;  3IUO A;  5IP7 J;  4HDU A;  1HKT A;  3LA7 A;  3F23 A;  2F5E A;  4CYC A;  2DA5 A;  2JT1 A;  2EFQ A;  2NS7 A;  1JJ6 C;  2DPD A;  2P7C B;  2M7B A;  3TOB A;  4M72 A;  2GXB A;  4ESF A;  1WQ2 A;  4RS8 A;  4KMF A;  3J7Z I;  2MLG A;  4EVI A;  4XOT A;  2QBY A;  4NUB A;  1WSU A;  2HPM A;  2E2H J;  4CDG A;  4MGR A;  2ZXW H;  2DA4 A;  1FPQ A;  1MMN A;  2AQE A;  5B66 C;  2XGX A;  1ORK A;  2CUZ A;  1RUO A;  3CD6 I;  4IEJ A;  2CQX A;  2L7Z A;  5DD8 A;  1DGR M;  3IP4 B;  3M9A A;  3HC7 A;  3MCZ A;  5J40 A;  3HSR A;  3K4J A;  4UY8 I;  2PN6 A;  4FT8 A;  1VQM I;  1A35 A;  1W4M A;  4QPQ A;  1U0J A;  2R7W A;  1G6N A;  5BS6 A;  3CDL A;  2JSC A;  1DP7 P;  2BHZ A;  1O7L A;  4N9H A;  4L5E A;  2LH9 A;  4XN3 A;  4XM3 A;  3B6A A;  3CCR I;  1BA5 A;  4IZZ A;  4XLE A;  2CV2 A;  1XGM A;  1UMQ A;  4PJL A;  2L9S A;  3U1D A;  3M8F A;  4XOR A;  5FKN A;  4EJT A;  1X58 A;  4IL6 C;  4PSX A;  4YFK F;  1ZGJ A;  5J4V A;  3VEP A;  2BVL A;  2M87 A;  3AAF A;  2K5C A;  3QQA A;  1VFC A;  4M9S A;  1B6A A;  1RPW A;  1YX3 A;  1G8X A;  2ZXJ A;  3CMA I;  3HB9 A;  2XSJ C;  3ZQI A;  4CSW A;  3MKL A;  3E1S A;  2E19 A;  1IDY A;  1JKO C;  2JJ7 A;  2E71 A;  1Z91 A;  3J81 Z;  4DYC A;  4GDF A;  4A0Z A;  3JSP A;  4BQA A;  1I50 J;  4X6A J;  2QSF X;  1KA8 A;  1BR4 A;  2HXI A;  1QRY A;  5DS9 A;  1S3J A;  1XMK A;  5FLV A;  2DA6 A;  3DPT A;  4Q4Z F;  1TWF J;  3S16 J;  1R00 A;  3DXJ F;  3H5R A;  2K7L A;  2ZO4 A;  3OL3 A;  1JUS A;  2E5N A;  3FXM A;  4BHP A;  4XKV A;  4XOP A;  3CME I;  1DUX C;  5AIQ A;  1SD5 A;  3FXK A;  3QP5 A;  1FY7 A;  4ZYH A;  3FKJ A;  2VJ5 A;  4BKX A;  2V9K A;  5E1X A;  2GM4 A;  2O03 A;  6PAX A;  3D1N I;  1XDU A;  1MJA A;  3BQZ A;  4P96 A;  1ZR4 A;  4MEX F;  3N05 A;  1MIJ A;  3F72 A;  2ZME C;  1IN8 A;  1HW2 A;  1ETV A;  2LBF B;  3FZV A;  4E7I A;  3RDI A;  2NAZ A;  1OIS A;  1K78 A;  1ETQ A;  3CQZ J;  2Q8K A;  4E7L A;  3K4N A;  5B1B H;  1P6R A;  4GRI A;  3GVA A;  2HOS A;  2VIX A;  2HGC A;  2LK2 A;  2HWV A;  2E2I J;  1CGP A;  3R61 A;  1IW7 F;  1A5J A;  3VYS B;  3I53 A;  4M6Y A;  2EIJ H;  3KP5 A;  5BNG A;  2KIQ A;  4P1W A;  4E7S A;  3JCU C;  3E6D A;  3OYM A;  3GFI A;  3AG4 H;  3R6S A;  1P7I A;  2W82 A;  3PNV A;  1I39 A;  4EAT A;  3C2G A;  1G4D A;  3WTU C;  4AIJ A;  4ANJ A;  1F4K A;  2LF8 A;  3P9C A;  3I59 A;  4JOM A;  2IS6 A;  3VOE A;  5DEQ A;  4BU2 A;  5E8I A;  1ZGA A;  1YQA A;  4LB6 B;  4AVP A;  1YW7 A;  3OSF A;  2MC3 A;  4IRH A;  3ABT A;  2VOP A;  2CWE A;  2Y0S A;  3PSI A;  4A3C J;  1V5G A;  5L3E A;  3K10 A;  3OYD A;  1FZP B;  3GO5 A;  3HM5 A;  2JA6 J;  3K70 C;  3HGY A;  3K4L A;  4IPA A;  1OYY A;  2H94 A;  3TBI A;  3PIP F;  4KFC A;  3PUF A;  3BLY A;  1HLV A;  3V8J A;  1TWH J;  3C7J A;  5EGO A;  3TDZ C;  3GZ6 A;  2EA2 A;  1FP1 D;  4FE7 A;  1X2N A;  5HNF A;  1VQ5 I;  3QPT A;  1HC8 A;  3ZRG A;  3G1M A;  1HKQ A;  2A6E F;  1J9I A;  1FWZ A;  1MH4 A;  2FMY A;  1S9H A;  2RNG A;  1X1A A;  2HQ5 A;  2LP0 A;  2Z99 A;  2R7T A;  2QYO A;  3PM1 A;  5HLI A;  4HAM A;  2VPL A;  4HLX A;  2VBY A;  1XPX A;  5TRD A;  1P2F A;  4XK4 A;  5HDN A;  5EF6 A;  3L2V A;  1X3U A;  4P9F A;  4BNC A;  1RES A;  1GVJ A;  3SJM A;  2K86 A;  2OJE D;  2KQR A;  4NB5 A;  2BXZ A;  3HPH A;  4N4O B;  2X85 A;  1EA3 A;  2X6W A;  4MQ9 F;  3OR2 C;  4M3E A;  3CMY A;  4K2E A;  2ISY A;  2M5W A;  1OCC H;  3QYF A;  5K5O A;  2Y48 A;  3GBG A;  1O3S A;  2VN2 A;  4ZZD A;  3D0S A;  2K4B A;  3CCE I;  2O9L A;  3K4B A;  4DZP A;  4ENJ A;  4LFU A;  3MKZ A;  5CVU A;  2KRF A;  1UAA A;  4BE0 A;  1B9N A;  3HKZ N;  2HOA A;  2QUF A;  3A4C A;  4HW0 A;  2P6T A;  2V7F A;  1S8N A;  5F0F A;  2MGQ A;  2P5L C;  2RQP A;  2Z33 A;  2FU4 A;  5FKM A;  1WJC A;  4XKB A;  1MD0 A;  1Z3Y A;  2JUC A;  2M0C A;  4HV5 A;  4BY7 J;  5J3L A;  3ONQ A;  1PUE E;  4YII A;  5DCM B;  2H09 A;  4BEH A;  5JHU A;  3BJA A;  1IN4 A;  4QTR A;  2X0L A;  2KFD A;  4FET A;  2XSD C;  3OMY A;  2CGP A;  1ETY A;  2ZBK A;  3E6M A;  4U7B A;  3CUO A;  2GZW A;  1Z21 A;  1A6I A;  4XLN F;  2K9M A;  2HI3 A;  4V19 K;  2YU3 A;  4A0X A;  1IC8 A;  3MN2 A;  2F4M B;  5D4R A;  2CQQ A;  4C3I J;  2R0Q C;  4FE4 A;  3GME A;  5IT9 K;  1JTX A;  1MJ9 A;  4HNV A;  1BR1 A;  1O3R A;  1BW5 A;  1NH3 A;  2BW3 B;  2XPW A;  5F27 A;  1Z6T A;  5EZH A;  3A0B C;  1D0Y A;  1IG7 A;  4A3B J;  4KNY A;  1PUF B;  3A01 A;  1I3Q J;  1W5C C;  4ESJ A;  2DOE A;  5DUK A;  3LA2 A;  4IHV A;  2CW0 F;  1HKS A;  5FD5 A;  4M3G A;  3OYF A;  4Y52 J;  2ZKZ A;  3K4K A;  3VSK A;  1ON1 A;  1IO2 A;  3K1M A;  3REO A;  4IHX A;  2BHY A;  1VQO I;  5D8L B;  4HDV A;  1ODD A;  3ISP A;  5DV5 A;  4N9I A;  2F5F A;  3W6J B;  3KP2 A;  4E70 A;  5LEJ A;  4H4K C;  4DYR A;  4LK1 F;  2R93 J;  1QBJ A;  3BJO A;  3HG9 A;  1HF0 A;  1NHA A;  4DGW B;  3NWS A;  1YHQ I;  4C2U A;  2GQQ A;  2VXD A;  1X4O A;  2XB0 X;  4LB5 A;  2D45 A;  2QEN A;  1ZAR A;  2ELH A;  1LQ1 A;  3KYC B;  1OPC A;  3NRV A;  4I02 A;  2XGE A;  1LFP A;  1RKT A;  4U7D A;  4I01 A;  2O61 A;  3LL7 A;  1IF1 A;  3TW7 A;  3T8R A;  5GAD J;  4M6V A;  1YO5 C;  1I1S A;  4RB0 A;  3OYG A;  4A93 J;  4DZJ A;  3CJQ B;  4BBR J;  2RKH A;  2DAO A;  2KIF A;  4TV7 A;  3R0J A;  4XKC A;  2ZME A;  4U0V A;  5J1U A;  3RPU A;  4BE2 A;  4BAY A;  1R1T A;  3HOV J;  4ZTJ A;  2R5Z B;  2JZY A;  2E5Z A;  5E17 F;  2H6B A;  3LQQ A;  2M4K A;  3E5U A;  2DOD A;  3M3Y J;  1F43 A;  2Z16 A;  2KL4 A;  3ZQH A;  3GF2 A;  4YG2 F;  1POG A;  5J4Y A;  4RDU A;  4HF2 A;  2O6G E;  1WJ5 A;  1BC7 C;  4L0Z B;  3ERM A;  3CUQ B;  3IH3 A;  2WAQ N;  3LSH A;  5KVR A;  4V2G A;  2R7Q A;  4BQQ A;  4E7Z A;  1MMA A;  5E18 F;  1J7K A;  2L4M A;  4DYQ A;  5C4X J;  1MH3 A;  1R4N B;  4RAZ A;  3ZMZ A;  3GWZ A;  3DF8 A;  3QYB A;  4I98 B;  4E4H A;  2HYF A;  2LKS A;  2WTE A;  3TP3 A;  2W25 A;  3RQI A;  2JQ7 A;  4UVC A;  3HL2 A;  4M74 A;  5KNL A;  1B72 A;  2QQB A;  5F0H A;  5ILV A;  3TO9 A;  2ESH A;  1ZRD A;  2EFN A;  3JSO A;  1XGS A;  2E1C A;  4CCJ A;  1P4X A;  4L9N A;  2GA2 A;  4Y15 A;  4HPQ A;  4C3J J;  3F0C A;  3E3V A;  1VZ0 A;  5E3N A;  3KP3 A;  4Z6Y A;  3E6B A;  2A61 A;  4A3M J;  1WPK A;  3E97 A;  1JT6 A;  2WC2 A;  3HUG A;  3FM5 A;  5J1Y A;  2E34 A;  3L2C A;  1HDP A;  4UUT A;  3DBR B;  4HLY A;  1W5S A;  1T98 A;  4PJ0 C;  3RYR A;  3EYY A;  2KDZ A;  3QU6 A;  3OY9 A;  3A0H C;  1UG0 A;  2P5V A;  3CES A;  3I3L A;  2XF5 A;  1NK2 P;  3SQN A;  4I2O A;  1MBF A;  5HLT A;  2MSY A;  3J7A Y;  2GXA A;  2F5V A;  5B3S H;  2G7U A;  5K7H A;  4Z2Y A;  4WXD A;  3RKQ A;  5D4S A;  1EF4 A;  3HIF A;  2LRD A;  3H1C A;  1P92 A;  3KLO A;  2EPF A;  5KCM A;  3EET A;  1TW2 A;  2KPM A;  4B09 A;  3S2H J;  1WCM J;  2HOT A;  3WG7 H;  4AUX A;  4O5V A;  3L00 A;  5D5X B;  3U21 A;  5DUI A;  1BW6 A;  2H6C A;  4P9U A;  2A05 A;  5ICG A;  4MTD A;  2EZI A;  3GZN B;  4LD5 A;  2O8K A;  1S7A A;  2VE8 A;  1OFC X;  4XLC A;  2DMQ A;  5JHF A;  2H1L A;  4FHT A;  3QP6 A;  4P55 A;  1W36 C;  4NDL A;  1RZ4 A;  4ITV A;  2RC4 A;  1FOK A;  1LDJ A;  2R7O A;  2R7F A;  1K6Y A;  4XBF A;  4IRG A;  2FOW A;  1DU6 A;  5TJJ A;  2ELJ A;  3TQN A;  2OBP A;  3BTC A;  2OC6 A;  1JGS A;  3F21 A;  3HYI A;  1S5L C;  3ERE D;  5JVG F;  1VND A;  4C3H J;  3EPZ A;  1RNL A;  1R49 A;  1Y1W J;  3DKW A;  3S1M J;  2HVR A;  2CSO A;  3L2Q A;  2DK8 A;  2DJI A;  2EIM H;  2B63 J;  2M8G X;  4EMS A;  4M3F A;  3OYJ A;  4UVA A;  1HDD C;  2FE3 A;  1DQU A;  3RIR A;  2HZT A;  2XPV A;  2XRO A;  3GTL J;  1D0Z A;  3OIQ A;  4WCG A;  1HA8 A;  1XMX A;  1HQC A;  3G1O A;  1LVA A;  4RB1 A;  2FQ3 A;  3HSE A;  3CP2 A;  3I71 A;  4GGG A;  4EM1 A;  1SAU A;  3DEU A;  1TNT A;  1TNS A;  2LG4 A;  3LMM A;  2W4S A;  1MGT A;  4EV0 A;  1QO0 D;  3HBL A;  4ENN A;  2VKV A;  1OR7 A;  3DLL F;  1WJE A;  4PDK A;  2CS3 A;  3ZMV A;  1XB4 A;  3CCL I;  3KEY A;  1IV6 A;  1KU2 A;  4AIK A;  3PSF A;  3K1P A;  1P4A A;  4MHG A;  4A6E A;  3FXR A;  4WXH A;  5FKK A;  5IPA A;  4L0Y B;  1T08 B;  1U8B A;  3GTO J;  2A69 F;  4LIU A;  1OCR H;  2LY9 A;  2VL8 A;  1YS7 A;  2EQR A;  2M34 A;  4FX0 A;  2AXL A;  4OMY A;  2EK5 A;  4DOZ A;  3I55 I;  1K7A A;  1BI0 A;  2R5Y B;  5F64 A;  3IKV A;  1JKR C;  4II3 A;  2KJC A;  3ZPL A;  1PYV A;  5HLH A;  2EH3 A;  1TC3 C;  1R5H A;  3IKT A;  3FHZ A;  3AG1 H;  1DPU A;  2Y0S N;  3IWF A;  1BN5 A;  1WVR A;  3DP7 A;  3K1N A;  4GFB A;  5H2F C;  1K6O A;  2KJB A;  5FFX A;  2FNA A;  3ZQF A;  2JTV A;  1YW8 A;  1D1B A;  1SVM A;  1WI3 A;  2DU9 A;  2WV0 A;  2GA1 A;  4GCV A;  5GAG J;  3B02 A;  2ID6 A;  3WE2 A;  5FRM A;  2FBH A;  1XC5 A;  5FFZ A;  3S1N J;  4ZYD A;  2OTJ I;  3CJN A;  3MQ0 A;  3JAM K;  2VUM J;  3PO2 J;  2HNH A;  3H36 A;  3G71 I;  1B9M A;  2D2W A;  3GTQ J;  2EFW A;  2NOJ B;  4KIG A;  1FBU A;  2XIG A;  4XON A;  4E7J A;  3CLO A;  2L54 A;  3RQ4 A;  4IHY A;  3X2Q H;  4L5J A;  5GTH C;  4M3D A;  3L2R A;  3KP7 A;  1BJA A;  2DTR A;  2E35 A;  1X3W B;  1WFX A;  3TDU C;  5LHG A;  1JUM A;  1ZH5 A;  2JMW A;  3RKX A;  2LSO A;  1GV2 A;  2DYR H;  3IH2 A;  2DXI A;  4AYB A;  3L2U A;  3M1C A;  2L2O A;  5F1J A;  2CRG A;  2OCC H;  5DD4 A;  4HX8 A;  1QZE A;  5CQG A;  5ERI A;  2MW8 A;  1ZLK A;  1X1B A;  3EUA A;  2KDO A;  5IT9 Z;  1U8R A;  1TQP A;  4UUS A;  1E3P A;  3G6E I;  3KX2 A;  2BV6 A;  4XN0 A;  2P6S A;  2GIV A;  3TMO A;  3GFJ A;  1ZRC A;  3W6V A;  2FD5 A;  1U5T B;  3V8K A;  4XLH A;  5LHH A;  2F2E A;  3JRF A;  2Z2S B;  2XF7 A;  1L3L A;  2NVY J;  4DBR A;  3WGI A;  1FMW A;  3D5R C;  1Q1H A;  3K9T A;  5F08 A;  1XSX A;  2XAU A;  3EQL F;  4F93 B;  2BY3 A;  4IHT A;  1IRX A;  3I9V 2;  1B8I A;  1KQ0 A;  4A3D J;  3WTY C;  3EDP A;  1Z0X A;  2CQN A;  2FA5 A;  2LR8 A;  2X6O A;  3PUB A;  4UXN A;  4R8H A;  3U1K A;  2TDX A;  3RSN A;  2VKD A;  1M1E B;  3HXL A;  4A2U A;  3FBN B;  4HYE A;  2K40 A;  3B6C A;  1LJ9 A;  2Y31 A;  2PBI A;  2V26 A;  2LFB A;  5C3E J;  5KHD A;  2OTL I;  4AIH A;  1TQI A;  3CCS I;  3JRI A;  4OIN F;  2LVS A;  1VQ9 I;  1PJR A;  3MMY B;  2YU9 J;  4NHJ A;  5KAF C;  3RJP A;  2WAF A;  4MEY F;  3DBL B;  3CCM I;  4A3I J;  4A3L J;  2DQL A;  2EZK A;  4JX5 A;  4S04 A;  4QPO A;  4OIO F;  3CCY A;  3MWM A;  1R5I D;  2DQR A;  4LG0 B;  4L18 B;  3BG6 A;  4B47 A;  4XLP F;  1I5Z A;  1HST A;  2CW7 A;  1TBX A;  3I64 A;  1Z05 A;  4DIQ A;  2ELK A;  2TRT A;  2ZXH A;  3M7G A;  1XS9 A;  1E17 A;  3KIO A;  5LGN A;  2KIU A;  1ETW A;  1IUY A;  3K7A J;  1T39 A;  3U9G A;  2F4O B;  1LPQ A;  1WJD A;  2UXX A;  4J19 A;  2PMZ N;  1GXP A;  3I56 I;  5FB2 A;  4LK0 F;  1PVE A;  4KIT B;  3M4O J;  3ZQC A;  2VQH A;  2FRH A;  2DFH A;  3S2D J;  3FK6 A;  2PJR B;  4WK8 F;  1QQI A;  3OYI A;  1MDM B;  5EG0 B;  2H27 A;  2M4G A;  2IXS A;  1Z7U A;  2K9N A;  1N25 A;  2P7V B;  2L9V A;  1IGN A;  3CLQ A;  1HCR A;  4L9V A;  1ETK A;  3S1R J;  5EG0 A;  5ICC A;  3DEE A;  1MDM A;  3DLA A;  2R4G A;  2LY1 A;  4XNF A;  3OOP A;  2PJR A;  1IZ1 A;  1UG2 A;  1AU7 A;  4G94 A;  4F3Q A;  3JRG A;  2IS2 A;  3GX4 X;  1OCZ H;  4YFN F;  5ILS A;  1N78 A;  1SEU A;  4KT6 A;  3FXQ A;  2MBF A;  3BY6 A;  2CG4 A;  2EFP A;  2XUB A;  1ITY A;  2DDB A;  2OPT A;  2XGC A;  2BEO A;  2ZNY A;  1OKR A;  4KJZ A;  1K4S A;  2CJJ A;  2HZD A;  2E1M C;  3W2V A;  4LG0 A;  2QF7 A;  5AIP A;  2VON A;  4IOA F;  2J5P A;  1FBS A;  3BR6 A;  3FMR A;  5D8K B;  2JA8 J;  2BXY A;  2WA0 A;  2FUG 2;  1MW7 A;  3Q5F A;  1TT0 A;  2WAE A;  1QPI A;  2HDW A;  3G1L A;  3MVP A;  4N0B A;  3RPU D;  4D7N A;  3S17 J;  1T6S A;  3KEO A;  2UWM A;  5E1Z B;  4U88 A;  1YIT I;  2BY1 A;  4B44 A;  1ZG3 A;  3RPQ A;  4XIC A;  3LAJ A;  1NG7 A;  2LRE A;  2QQ9 A;  4RGS A;  4IOC F;  3PNY A;  4XID A;  1JJ8 C;  3BPV A;  2Y69 H;  4OIQ F;  1LNW A;  1FX7 A;  4I76 A;  3ZXS A;  1GDT A;  2G0E A;  2VC1 A;  3AG3 H;  3KZI C;  5IY5 H;  5LBQ A;  3E7L A;  2HR3 A;  4Q48 A;  5IOY A;  3OYC A;  4G6D A;  3FM3 A;  1B8I B;  3GFM A;  3DWL E;  5H6Q A;  2CV1 A;  5H20 A;  1JKQ C;  5E79 C;  3FIW A;  1BR2 A;  4B3X A;  5F6F A;  3HPG A;  1E3O C;  3F8B A;  1P7J A;  2CMP A;  1WI9 A;  2QZ8 A;  1BBY A;  2KLO A;  2V1D A;  4IQ4 A;  5L3F A;  2IBD A;  1ZQ3 P;  3KPH A;  2V9P A;  5M3M J;  4ZYE A;  1SMY F;  5K5R A;  1R4M B;  3FXJ A;  2M8E A;  3CO7 C;  1U5T A;  1IRF A;  5CVJ A;  1T33 A;  2VQC A;  2A68 F;  5EEG A;  4A5N A;  1YIJ I;  2DW4 A;  5GP9 A;  3R4K A;  5J8F A;  5HS8 A;  1B1B A;  4PGG A;  1OMI A;  3N97 A;  2VBZ A;  4BHB A;  3QRF F;  4MFE A;  1U6G A;  4UUS B;  2IGO A;  5GTI C;  2EV0 A;  4CYD A;  1W36 D;  2O8X A;  2Y75 A;  1ZTR A;  2DT5 A;  2GOM A;  3H9J A;  4WX9 A;  2WY8 Q;  1F1Z A;  4ZDL A;  4YEL A;  3S93 A;  3CDI A;  2JK3 A;  2LKX A;  2QWW A;  1A6Q A;  5CVV A;  2V79 A;  2VB6 A;  1UJ8 A;  3E6C C;  3BWG A;  2JN6 A;  3SHF A;  1SMT A;  1ULY A;  4KIS A;  3ZQ7 A;  1QVT A;  1T8I A;  1ZK8 A;  2ECC A;  1X1P A;  1U9O A;  1LEA A;  4CIC A;  4AC0 A;  5K7Z A;  1T0F C;  1MBH A;  3IWZ A;  2HTS A;  2P0W A;  3VWB A;  1VQ6 I;  3HRU A;  4RLQ A;  5HS9 A;  3AKZ A;  4ZDP A;  1TQM A;  3RCO A;  3H92 A;  4A5M A;  1ZLJ A;  1XX5 A;  2BY2 A;  2IEK A;  3K0L A;  4HF1 A;  2NS8 A;  2XAJ A;  3SZP A;  2YX7 A;  3S32 A;  1R23 A;  3CP8 A;  3SFZ A;  1IV8 A;  1FBQ A;  4MFD A;  2CH0 A;  1BL0 A;  2XAH A;  3ZOB A;  2ZB9 A;  1WKM A;  4KN4 X;  1WGX A;  1LKX A;  3HKZ A;  2DPU A;  4KIF A;  1N75 A;  3HRS A;  4KYW A;  1BIB A;  2ZSI B;  2STW A;  3GTJ J;  3KFW X;  3AFH A;  3WTW C;  1J5Y A;  4HEA 2;  3J7Y J;  5DM7 F;  1Z77 A;  2KP6 A;  3BTJ A;  4UVB A;  1WHU A;  1VTN C;  4EJO A;  2K3P A;  1G3T A;  1SAX A;  3BR1 A;  2O5R A;  3PL8 A;  5LFA A;  3QPS A;  3R0A A;  3ESW B;  1KQ8 A;  2PMU A;  2R5Y A;  1Z67 A;  5B1A H;  2NNN A;  3I54 A;  2XAS A;  2ETH A;  4MO7 A;  3BPX A;  5FGM A;  2KIS A;  1BI1 A;  2VOD A;  4G6Q A;  2IA2 A;  2L01 A;  2HTJ A;  1WJA A;  4CH7 A;  1WH5 A;  4BJT A;  1I6H J;  1TW3 A;  2PLY A;  4IF4 A;  1D1C A;  5DYM A;  2QA4 I;  3BG5 A;  2Z9O A;  2HYG D;  3K4C A;  1GV5 A;  3DTI A;  3GLL A;  4BHC A;  1FYM A;  1QHG A;  3KYL A;  3BG7 A;  1REP C;  4IQJ A;  5L3C A;  5FD6 A;  4IRI A;  2I10 A;  4QSH A;  5EJC A;  2VBW A;  4PUS A;  1VQ7 I;  3V7C A;  3TGN A;  5HS7 A;  1BIA A;  1SFK A;  2YPR A;  3AL0 B;  4DQ2 A;  3SEZ A;  5IP9 J;  3A2K A;  4GXO A;  2WAQ A;  3EUH A;  3ZGK A;  2GOX B;  2DO7 A;  3BC8 A;  4A69 C;  2GXG A;  3ABK H;  1H0M A;  1LDK B;  2KIM A;  3OS0 A;  2MFZ A;  3OSG A;  3HOS A;  5KAI C;  3SXY A;  4J01 A;  4BBS J;  4UUV A;  3HHH A;  3H3V K;  1O57 A;  5CQE A;  4AM3 A;  3HZJ A;  3FK7 A;  2AXT C;  4M9X A;  4MQV A;  4NC7 A;  4YEJ A;  3OYN A;  3MZ8 A;  1RR7 A;  5D6E A;  2M1B A;  3M07 A;  3QPL A;  2A5Y B;  2PI0 A;  5EEA A;  2WY7 Q;  5HDG A;  3ZQG A;  2BVM A;  3GTG J;  5F1R A;  5FRO A;  1GUU A;  1V5E A;  3H3U A;  5M3F J;  1HSJ A;  2LDU A;  4CZZ A;  1ETO A;  3QU3 A;  4GYI A;  1Y0U A;  4BS9 A;  1UEL B;  3WG9 A;  2MD0 A;  3C2B A;  2LC2 A;  2WV1 A;  2IPQ X;  3S3O A;  2UV1 A;  4E7K A;  1EH8 A;  1FTT A;  1HBX G;  3HJE A;  3COA C;  1NG6 A;  1QPM A;  3ML6 A;  3F8F A;  3G3Z A;  2FBK A;  1K4T A;  2R7S A;  4OAY A;  1GHC A;  4F92 B;  3BZC A;  2KRC A;  2W57 A;  4MLO A;  2QKL B;  2HS5 A;  2R7R A;  2UUZ A;  3PFY A;  1JGG A;  3FMQ A;  4UB8 C;  3ZN0 A;  4CZC A;  1BC8 C;  2CFX A;  4YIR X;  1EJ9 A;  3J80 Z;  3HUG B;  4CCL A;  4M9Z A;  1UB9 A;  1WJB A;  3LFK A;  1QA6 A;  4B3A A;  1BM9 A;  3I4M J;  2F4I A;  2QVO A;  4B4C A;  1TP4 A;  1H89 C;  2CYY A;  4BUP A;  1JTY A;  4R79 A;  1QU3 A;  4OMZ A;  1V54 H;  2JPB A;  5E8G A;  2VT3 A;  1FLI A;  4PZJ A;  4DJA A;  1O3T A;  1VQN I;  3OIO A;  3PNT A;  3DTK A;  2IS4 A;  1YJ9 I;  5HDK A;  1B72 B;  3IL2 A;  2MA3 A;  3CCQ I;  3JRA A;  4BJ5 C;  4AD9 A;  1ETX A;  1OJL A;  1R1U A;  1O4X A;  4CGZ A;  2L7K A;  3LA3 A;  4BL0 B;  1R22 A;  3GLX A;  3BOQ A;  4XMY A;  1SFO J;  2FX0 A;  5EEH A;  3ABM H;  2DLL A;  2RGV A;  1YFH A;  1VQ4 I;  2V1U A;  3CUQ A;  2VKH A;  3ULQ B;  3HOU J;  2ZJQ F;  4Y7N J;  1SD6 A;  3FMS A;  3OYB A;  1KZH A;  4L9J A;  2EB7 A;  2IS1 A;  5E3L A;  1T95 A;  1QZZ A;  1TT5 B;  3HTU A;  2IRF G;  2HDC A;  2FXA A;  2HQR A;  3BG3 A;  4JQF A;  2JWT A;  1P9Q C;  2AS5 F;  2MC4 A;  2CUE A;  5TGT A;  2Y9Z A;  3GXO A;  1BI2 A;  2R5Z A;  4KUM A;  2W00 A;  3K6G A;  5CYV A;  1E3H A;  4BE1 A;  2EWN A;  2ZME B;  3CZ6 A;  2WB1 A;  1QNT A;  4IKF A;  3S1Q J;  1K83 J;  3VOD A;  4PGH A;  4B43 A;  3P9I A;  4PK4 A;  1OYI A;  2R3S A;  3FHN A;  2ZJ2 A;  4XLF A;  1XSD A;  2DMP A;  3LSR A;  3J7A O;  2QM3 A;  2ZJP F;  1TTY A;  1RC9 A;  3QOP A;  4EJU A;  2QSG X;  4B1R A;  4RB2 C;  4D5C A;  1TL8 A;  2NVT J;  2J5O A;  9ANT A;  4GO1 A;  1HW1 A;  4EEF G;  3HRT A;  3BDD A;  3E0J B;  3VPR A;  3S2W A;  1DP3 A;  3PO3 J;  1LVK A;  3LNQ A;  2QEX I;  3Q3S A;  5FLX K;  3PIO F;  1FJL A;  3QOE A;  2E2J J;  1SVO A;  2YSR A;  3LSK A;  1AA7 A;  1O7F A;  4HNT A;  3OIP A;  1XSV A;  2RN7 A;  5ICF A;  2WBM A;  3OS1 A;  4XQF A;  4HOB A;  1J09 A;  2D1V A;  3ASN H;  1XD7 A;  4A0Y A;  2CUF A;  5CKT A;  3CO6 C;  5J8C A;  3I5U A;  3F9K A;  3A01 B;  1EH6 A;  1D1A A;  1PUF A;  3O2P E;  2KZV A;  1FOW A;  1S72 I;  1QVU A;  3WTZ A;  2QSH X;  2V9V A;  2BW3 A;  2Z3Y A;  2IT0 A;  1L0O C;  1ZG5 A;  1BI3 A;  2K9Q A;  3CCU I;  2IVM A;  1STZ A;  3AG2 H;  2UXN A;  2G9W A;  4HV6 A;  1SC7 A;  4BDY A;  3NWT A;  2NRA C;  4C9Y A;  4P5O A;  2W7N A;  4NC6 A;  3FBI B;  3C2H A;  3HRM A;  4KMU X;  4OOI A;  4FX4 A;  1SFX A;  2ADU A;  2ACJ A;  3F6V A;  4RLF A;  2VBX A;  1OLT A;  3TO6 A;  5DCM A;  4BEH B;  1V4R A;  5EDN A;  4CHU A;  3H0D A;  2CW8 A;  3JRB A;  1E0E A;  3WGG A;  3M8J A;  2DT6 A;  5HNH A;  1ZAO A;  2HKX A;  1KU7 A;  2EIK H;  1ZYR F;  3FIS A;  5C4J J;  1HOM A;  1SD4 A;  5HOO A;  5E3M A;  2MAB A;  3GTP J;  5M5Y J;  2W85 A;  1R36 A;  1U2W A;  1U78 A;  3JRH A;  2OU2 A;  3BCA A;  1Y0N A;  2CU7 A;  3RZO J;  5CLS A;  1FP2 A;  2VAS A;  2IA0 A;  3HEF A;  1LB2 A;  1Z3X A;  3OWT A;  2LF7 A;  5ILU A;  4BXX J;  1B59 A;  1SAN A;  1RI7 A;  3WU0 A;  2FBI A;  2HOE A;  1G3W A;  3O8G A;  1FIA A;  3V7R A;  1DGW Y;  4LOC A;  1MKM A;  5EYR A;  5JR3 A;  1VQ8 I;  2DMT A;  2NVU B;  4XRM A;  3DKY A;  2EJR A;  5FO5 A;  2ME6 A;  1IXS B;  3HOW J;  5IOZ A;  1LEB A;  2X1C A;  3JRE A;  2HVQ A;  5FKO A;  4HST A;  2ZSH B;  5JI6 A;  2M30 A;  3T8T A;  3F3X A;  1YW9 A;  4U0Y A;  5J6X A;  5HOD A;  1D8J A;  3H5N A;  1W5T A;  2EV5 A;  2XAG A;  1KGS A;  4RAY A;  1Y8Q B;  2F48 A;  1OCT C;  1IN5 A;  2LY2 A;  3BQY A;  1YTY A;  3SZG A;  3VYR B;  1A36 A;  3BR0 A;  5C44 J;  4F52 A;  2AHQ A;  2DOF A;  2KRH A;  2R7Z J;  5E3O A;  3HOX J;  4Y13 A;  2YS9 A;  2FSW A;  3J81 K;  1XMA A;  3JAM Z;  1YG2 A;  2L9R A;  3FF5 A;  1VI0 A;  1D8K A;  4ZH4 F;  2PMH A;  3DTE A;  4XRF A;  4NC8 A;  3G4S I;  3OS2 A;  2IJL A;  3L2W A;  1YJN I;  2OA4 A;  5EGO B;  2LD5 A;  2KMU A;  1F9N A;  2BYV E;  5GPA A;  3Q0U A;  2F6C A;  2FEZ A;  1R7J A;  4C2T A;  1SFE A;  5DDG A;  1QGP A;  1KYZ A;  2DYS H;  2V6C A;  3Q9S A;  3PJR A;  3HOT A;  5D5V B;  3S3M A;  3A1Y A;  4AYB N;  3WTT C;  3LSJ A;  3F8C A;  4OAZ A;  4G8X A;  1R9T J;  4Q47 A;  1ACI A;  2Q0O A;  2Y30 A;  2YUS A;  2XV4 S;  3KYD B;  4BH9 A;  4ZYG A;  3OV8 A;  2OAZ A;  3JTH A;  2EIL H;  3I59 B;  1A04 A;  3F22 A;  4LLN A;  1QHH D;  2HPI A;  3S3N A;  1W7P D;  2BZT A;  1MMG A;  2JVG A;  2K9S A;  1Y8R B;  2AQF A;  1UHM A;  1ERD A;  2DCE A;  5K7F A;  5LLQ A;  1R6R A;  4RM3 A;  5IYD J;  2L7F P;  2M9H A;  4A3E J;  2L3D A;  3KCC A;  2VI6 A;  1X19 A;  4OIP F;  4JBA A;  2H8R A;  1YS6 A;  5JFR A;  3DBH B;  2JA7 J;  3GW2 A;  3LOC A;  3OYH A;  5B5E C;  1K61 A;  2VT2 A;  2LYC A;  4D1Q A;  1JXS A;  3SYT A;  4DNC A;  1JI8 A;  2I8D A;  1TZL A;  2IW5 A;  3CF5 F;  3H0G J;  1K78 B;  3VYU B;  1K79 A;  1G3Y A;  2JA5 J;  1SVL A;  3JRD A;  1Y1V J;  2LBF A;  2RNJ A;  2TCT A;  1IXC A;  4LMY A;  2O7O A;  2XHK A;  2DDA A;  3LAP A;  2ZNZ A;  2X1D A;  4FCY A;  2EZL A;  3A03 A;  2DT7 B;  3BCB A;  4PJJ A;  1LUJ B;  2VXZ A;  5L3B A;  2N8G A;  2EA4 A;  3QPH A;  4CCM A;  3FXL A;  1MMS A;  1MND A;  1UZC A;  2XGD A;  4BQN A;  5A2Q Z;  1Y6I A;  3WGH A;  2MH9 A;  2BY0 A;  2JRT A;  2NOG A;  2FJ1 A;  4BAC A;  1R71 A;  4BY1 J;  4M71 A;  3M8E A;  2GIZ A;  2H8W A;  1SFU A;  3CUQ C;  1GLN A;  2X4H A;  4II2 A;  1KQ9 A;  4HNU A;  3CDH A;  3E5X A;  4G12 A;  4HSR A;  5LHI A;  2W84 A;  4J00 A;  3HSF A;  2RDP A;  3P5J A;  3F6O A;  2RAE A;  4N4N B;  4IO9 F;  4ZZL A;  2G7H A;  4AU7 A;  2XKP A;  2LNB A;  1FOX A;  4MIM A;  3LQR A;  1GVD A;  1ON2 A;  3HTS B;  4D7M A;  4KA4 A;  2ME0 A;  4W97 A;  4Y17 A;  2E7X A;  3ZMS A;  3D5L A;  2PG4 A;  1N77 A;  4BXU A;  1YX5 A;  3OL4 A;  3C1D A;  1D3Y A;  5CJ9 A;  4RMN A;  3QAH A;  1WJF A;  1DU0 A;  2CQK A;  1Q1V A;  5E1W A;  2DK5 A;  1FIP A;  4HQM A;  5CVR A;  3MKW B;  2HKO A;  3SZT A;  2MD5 A;  1JUP A;  2DMN A;  3OR1 C;  2Y0M A;  1YI2 I;  2NXN B;  1YJW I;  3D5S C;  5E20 A;  3CC7 I;  2VPR A;  3L9F A;  1W1W E;  3CC4 I;  4YRV A;  3RYP A;  4OU0 A;  3E5Q A;  3ZMT A;  3H9Q A;  2W48 A;  2EFO A;  3P9K A;  4E7H A;  3ZMD A;  3ASO H;  2NS0 A;  1FYL A;  4G6T B;  5ED4 A;  2MYS A;  3V42 A;  1UHW A;  2CO5 A;  4M3B A;  4F91 B;  3GTK J;  1VF9 A;  3HOY J;  4G9Y A;  2NVQ J;  1Z9C A;  2STT A;  2VJI A;  4LIV A;  2O0Y A;  4I09 A;  2D1H A;  2IGM A;  5D6F A;  4HA8 A;  4E6K G;  3BJ6 A;  4BDZ A;  2V6E A;  3L1P A;  1V3F A;  1LFB A;  2X9D A;  1T56 A;  2VOO A;  3OYK A;  2A07 F;  3WOD F;  1J0R A;  3V7S A;  2QBY B;  3S14 J;  1YYV A;  1AOY A;  3CC2 I;  2DI3 A;  3K2Z A;  3RZD J;  5DTD A;  2ZXI A;  2L7M P;  3H3Z A;  3OOU A;  2E1N A;  3UKG A;  3I0T A;  3MEX A;  1A31 A;  1VQL I;  4FTH A;  2GAU A;  1MNM C;  4ETS A;  3CMM A;  1JE8 A;  5IYC J;  1Y39 A;  4G7H F;  3CF2 A;  1X3Z B;  5A2Q K;  4F55 A;  2ID3 A;  4JP0 A;  4RM2 A;  1X2M A;  3TOA A;  1MSE C;  5FRN A;  1FSE A;  4ENM A;  4CYC B;  1XGN A;  3LSG A;  2CQ7 A;  3EUH C;  4BXF A;  2M3A A;  4EM2 A;  2GBY A;  3CTA A;  4O6J A;  2CFO A;  1FTZ A;  2FOK A;  4CCK A;  1ZRF A;  3I4P A;  2HFH A;  1FEX A;  4PJN A;  4PFO A;  2L4A A;  4KIC A;  2QKM B;  3O8H A;  3S15 J;  4S0H B;  4X0G A;  4DBQ A;  2Z1D A;  5GAE J;  1F5T A;  4LGW A;  2MH2 A;  4IVN A;  2GWR A;  4A6D A;  4D0P A;  2A6T A;  5JLX A;  1RR8 C;  2RV8 A;  2VQL A;  2ISZ A;  3JW4 A;  2RRE A;  4LLG F;  1IUF A;  3MFK A;  4HBL A;  1DDN A;  2DA1 A;  3WU2 C;  1H9T A;  3KZZ A;  1IRG A;  2WWY A;  1B4A A;  3LWF A;  5LGU A;  4JX6 A;  1MBK A;  1UST A;  2ZC2 A;  2QQA A;  1KU3 A;  2XC7 A;  2PQ8 A;  3L09 A;  2DTZ A;  5F04 A;  3RKW A;  2HU9 A;  3BR5 A;  4RGU A;  3T1B A;  3RI4 A;  3CJT B;  2K3F A;  5M5W J;  1HW5 A;  3BZK A;  5FKL A;  3CJR B;  2ZFW A;  1BOB A;  3WTV C;  3V4G A;  2A5W A;  4LLL A;  1YOV B;  1IDZ A; 
#chains in the Genus database with same CATH homology
 3S8P A;  3ZQQ A;  4BJ5 C;  2L7K A;  4BL0 B;  3DU6 A;  4HG2 A;  1BR4 A;  1D1B A;  4XMY A;  3DPT A;  1KON A;  2VJ4 A;  5FRM A;  3H5R A;  5LD2 C;  2VKH A;  3OL3 A;  2E5N A;  3OYB A;  4XKV A;  4XOP A;  2IS1 A;  4ZDO A;  2R7X A;  4BGD A;  2HNH A;  1T95 A;  3SDB A;  4JQF A;  2NOJ B;  3FKJ A;  4XON A;  2VJ5 A;  4E7J A;  1P9Q C;  2V9K A;  3RQ4 A;  2MC4 A;  5TGT A;  3L2R A;  1WFX A;  2W00 A;  2WAD A;  3K6G A;  3N05 A;  2R7U A;  1X1C A;  4BE1 A;  3MKY B;  2DXI A;  4AYB A;  3L2U A;  3CZ6 A;  2WB1 A;  3M1C A;  4XKW A;  4CCO A;  3QYE A;  2L2O A;  2LBF B;  4E7I A;  4IKF A;  4PSW A;  4B43 A;  4PK4 A;  4PJM A;  2CUJ A;  3FHN A;  4XLF A;  4E7L A;  5CQG A;  4NNJ A;  3K4N A;  1V5F A;  4D9J A;  1X1B A;  4GRI A;  3EUA A;  2VIX A;  2KDO A;  4LIT A;  2HVS A;  3KX2 A;  4XN0 A;  3VYS B;  3E0J B;  2BOL A;  2L9N A;  1DP3 A;  1LVK A;  3TMO A;  4P1W A;  4E7S A;  3OYM A;  3W3C A;  4XLH A;  2E60 A;  3QOE A;  3LSK A;  4BS9 A;  2Z2S B;  1AA7 A;  1Y56 A;  2W82 A;  2XF7 A;  4HNT A;  3PNV A;  1D0X A;  3OIP A;  4EAT A;  3C2G A;  3MD2 A;  4DBR A;  3H35 A;  4ANJ A;  3QOD A;  2WBM A;  3OS1 A;  1FMW A;  4XQF A;  3D5R C;  4U87 A;  2IS6 A;  4JOM A;  1J09 A;  2XAU A;  4F93 B;  1IRX A;  3I9V 2;  4BU2 A;  5CKT A;  3ZR8 X;  3F9K A;  3PUB A;  1D1A A;  4B48 A;  2Y0S A;  3RSN A;  2VKD A;  3HXL A;  3FBN B;  3PSI A;  2KZV A;  1V5G A;  2XF6 A;  3K10 A;  4C30 A;  2BW3 A;  3OYD A;  4ZC3 A;  2V26 A;  3K70 C;  2X6X A;  3RTR A;  3K4L A;  5KHD A;  4CA0 A;  2HQA A;  4BDY A;  1PJR A;  3MMY B;  3NWT A;  3TBI A;  4C9Y A;  4P5O A;  2W7N A;  3FBI B;  2WAF A;  3BLY A;  3C2H A;  4HRI A;  1G59 A;  3IAM 2;  2KHM A;  4QPO A;  4RLF A;  5HNF A;  3BG6 A;  3ZRG A;  1X4P A;  1OLT A;  4B47 A;  2CW7 A;  4ZYA A;  4BEH B;  4XR6 A;  3H0D A;  2CW8 A;  4DIQ A;  1E0E A;  1S9H A;  2ZXH A;  2X51 A;  2RNG A;  1X1A A;  3M8J A;  2R7T A;  2DT6 A;  4Y3O A;  5HNH A;  2VPL A;  3L2V A;  5HOO A;  2MAB A;  1WJD A;  2L5Q A;  2KQR A;  3HPH A;  4N4O B;  2X85 A;  4CUG A;  4KIT B;  3BCA A;  1EA3 A;  3LSM A;  2CV0 A;  2VQH A;  2X6W A;  5HVQ C;  2VAS A;  3OR2 C;  1Z3X A;  3OWT A;  2XDV A;  2PJR B;  3OYI A;  2JVH A;  2M4G A;  2IXS A;  3QYF A;  3GBG A;  3OYA A;  1DGW Y;  3DU5 A;  3K4B A;  2W1O A;  3DEE A;  3DKY A;  3DLA A;  2R4G A;  2LY1 A;  4XNF A;  3W2W A;  3MKZ A;  1UAA A;  4BE0 A;  2PJR A;  3UR3 C;  2X1C A;  2HVQ A;  4HST A;  2ZSH B;  4F3Q A;  2VLA A;  3A4C A;  2IS2 A;  2V7F A;  3H5N A;  1N78 A;  4BQO A;  1WJC A;  4XKB A;  4IX7 A;  4KT6 A;  1Z3Y A;  2LY2 A;  3SZG A;  3VYR B;  4F52 A;  3ONQ A;  2KRH A;  4KJZ A;  4BEH A;  2HZD A;  3DPL C;  2E1M C;  2E1M B;  3EUK L;  4FET A;  4Y4R A;  3W2V A;  2X6Y A;  3OMY A;  3DTE A;  4NC8 A;  3OS2 A;  4U7B A;  3L2W A;  1Z21 A;  2KMU A;  2K9M A;  2WA0 A;  2FUG 2;  4NQW B;  3SEQ A;  1MW7 A;  1TT0 A;  2WAE A;  4OWR B;  2HDW A;  2F6C A;  3RPU D;  4C2T A;  2LOO A;  2UWM A;  3PJR A;  1BR1 A;  4B44 A;  3HOT A;  3S3M A;  1NG7 A;  2BW3 B;  2LRE A;  3A1Y A;  3K70 D;  3PNY A;  1D0Y A;  4OAZ A;  3ZXS A;  2VJJ A;  4ZTF A;  3OYC A;  2PMZ A;  3DWL E;  3OYE A;  2CV1 A;  3OYF A;  1BR2 A;  3K4K A;  4B3X A;  3HPG A;  4FAS D;  1QHH D;  2CMP A;  2HPI A;  3VSK A;  3S3N A;  1MMG A;  2JVG A;  2KLO A;  2AQF A;  3K4M A;  4IQ4 A;  2M0M A;  3DPU A;  1ERD A;  2DCE A;  1R6R A;  4RM3 A;  4H4K C;  1X19 A;  2VQC A;  3HG9 A;  1X1D A;  4DGW B;  2OV7 A;  3NWS A;  2IGK A;  2V1N A;  4C2U A;  2VXD A;  1X4O A;  2VQG A;  3H9G A;  3OYH A;  2IGO A;  3H5A A;  1W36 D;  1LFP A;  2GOM A;  3H9J A;  2WY8 Q;  2LYC A;  4D1Q A;  3LL7 A;  3UNG C;  2JSP A;  2Q1Z B;  3SYT A;  4ZDL A;  1JI8 A;  2I8D A;  1TZL A;  4YEL A;  3S93 A;  3VYU B;  3IAS 2;  3OYG A;  3CJQ B;  2LBF A;  2R7V A;  2VB6 A;  4XKC A;  4BE2 A;  4KIS A;  2X1D A;  2OUM A;  4ZTJ A;  2JA2 A;  2E5Z A;  2IGN A;  2DT7 B;  3BCB A;  4PJJ A;  2VXZ A;  5CPR B;  3ZCO A;  1T0F C;  2M4K A;  2RQQ A;  4CCM A;  2P0W A;  3VWB A;  1MND A;  4AVZ A;  1MNE A;  4BQN A;  2Z16 A;  4RLQ A;  1Y6I A;  2KL4 A;  3AKZ A;  4ZDP A;  3RCO A;  4CCN A;  4BAC A;  3G2B A;  4LG3 A;  1WJ5 A;  1ZEL A;  3OYL A;  1GLN A;  4II2 A;  1MMD A;  4HNU A;  3LSI A;  2Q2E B;  3S32 A;  3CP8 A;  3LSH A;  4HSR A;  4J00 A;  2R7Q A;  2CH0 A;  4BQQ A;  3TL4 X;  4E7Z A;  1MMA A;  4N4N B;  3HKZ A;  1LKX A;  2X1E A;  4AU7 A;  1N75 A;  3QYB A;  4E4H A;  2ZSI B;  3AFH A;  4HEA 2;  2KP6 A;  3HL2 A;  5KNL A;  3D5L A;  2K3P A;  1N77 A;  1YX5 A;  3OL4 A;  2M7A A;  4RMN A;  2O5R A;  1WJF A;  3PL8 A;  5LFA A;  3W2A A;  4CCJ A;  1Z7L A;  3VYT B;  2JUG A;  4HPQ A;  3MKW B;  1VZ0 A;  3DKX A;  1YE9 A;  4XL9 A;  3OR1 C;  3DQV C;  3VSL A;  3D5S C;  2V4J C;  3FDY A;  1WJA A;  4YRV A;  4CH7 A;  2K9L A;  3OY9 A;  4BJT A;  1UG0 A;  3CES A;  3I3L A;  2XF5 A;  3LFU A;  2ZFU A;  4XLA A;  3H9Q A;  5HLT A;  1OR7 C;  1D1C A;  3J7A Y;  2F5V A;  4Y33 A;  4E7H A;  3VDX A;  4G6T B;  2MYS A;  2DOA A;  3V42 A;  3K4C A;  4PFP A;  3DTI A;  4F91 B;  4BJ6 C;  1QHG A;  3KYL A;  3BG7 A;  2LRD A;  4IQJ A;  5KCM A;  2VJI A;  1FMV A;  2KPM A;  4LIV A;  4ZJZ A;  4PUS A;  3U21 A;  2IGM A;  2V6E A;  4E6K G;  4BDZ A;  1SFK A;  3AL0 B;  3AL0 C;  3IUO A;  3SEZ A;  3A2K A;  2WAQ A;  3ZGK A;  3OYK A;  2GOX B;  3BC8 A;  4XLC A;  5JHF A;  1LDK B;  3OS0 A;  1W36 C;  2MFZ A;  4ITV A;  3HOS A;  2ZXI A;  3OOU A;  4J01 A;  2R7O A;  1K6Y A;  2M7B A;  5CQE A;  2ELJ A;  2OC6 A;  4NC7 A;  4YEJ A;  3OYN A;  3CMM A;  3CF2 A;  3EPZ A;  4F55 A;  4XOT A;  4NUB A;  2WY7 Q;  4RM2 A;  2HVR A;  2BVM A;  2HPM A;  5FRN A;  3L2Q A;  3LSG A;  2DJI A;  3EUH C;  4BXF A;  1MMN A;  2AQE A;  2M3A A;  5FRO A;  3OYJ A;  2CUZ A;  2CFO A;  1V5E A;  4CCK A;  1DQU A;  4PJN A;  1D0Z A;  1UEL B;  3OIQ A;  4PFO A;  2MD0 A;  1DGR M;  3IP4 B;  2QKM B;  2LC2 A;  3HC7 A;  3S3O A;  2UV1 A;  3K4J A;  1HA8 A;  4E7K A;  4X0G A;  4DBQ A;  2Z1D A;  3CP2 A;  4QPQ A;  1NG6 A;  1U0J A;  1SAU A;  3LMM A;  2LG4 A;  2A6T A;  2W4S A;  2R7W A;  2VQL A;  2R7S A;  4OAY A;  4F92 B;  2RRE A;  2KRC A;  2LH9 A;  4MLO A;  4XN3 A;  2QKL B;  4XM3 A;  1WJE A;  2R7R A;  2CS3 A;  4IZZ A;  3KEY A;  2UUZ A;  3PFY A;  4XLE A;  3PSF A;  4CZC A;  2CV2 A;  4PJL A;  2L9S A;  4XOR A;  3HUG B;  2XC7 A;  4CCL A;  4PSX A;  1WJB A;  4LIU A;  2VL8 A;  2F4I A;  4DOZ A;  2BVL A;  2HU9 A;  4II3 A;  2K5C A;  4R79 A;  4BUP A;  1QU3 A;  1PYV A;  4DJA A;  3CJR B;  1YX3 A;  1G8X A;  1BOB A;  3PNT A;  3DTK A;  2XSJ C;  4CSW A;  2IS4 A;  2A5W A;  3E1S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...