2CMPA

Crystal structure of the dna binding domain of g1p small terminase subunit from bacteriophage sf6
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
56
structure length
56
Chain Sequence
KLSPKQERFIEEYFINDMNATKAAIAAGYSKNSASAIGAENLQKPAIRARIDARLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The 1.58 A Resolution Structure of the DNA-Binding Domain of Bacteriophage Sf6 Small Terminase Provides New Hints on DNA Binding
pubmed doi rcsb
source organism Bacteriophage sf6
molecule tags Viral protein
molecule keywords TERMINASE SMALL SUBUNIT
total genus 19
structure length 56
sequence length 56
ec nomenclature
pdb deposition date 2006-05-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1400 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2cmpA00
4ZC3A 2CMPA 3ZQQA
chains in the Genus database with same CATH superfamily
1KZHA 1KU2A 1R1VA 4ZDLA 2VUMJ 1ERDA 4FETA 4KJZA 3L2WA 4AD9A 1MBFA 3W6KB 4E7KA 2VC1A 1HW5A 4P1WA 4E6KG 4E7LA 1O7FA 2VBXA 2ZO4A 3WODF 4L9NA 3RQIA 3KLOA 2OQRA 1N75A 1D8KA 4Y4RA 1E3PA 1JKRC 2E1MB 1S72I 3E5XA 3HOWJ 2JJ7A 1X19A 2VQGA 3I5UA 1UG2A 2VBWA 3QPHA 1B72B 2R5ZB 3C7JA 3L2UA 4Y7NJ 3CCMI 1ZG1A 3F9KA 4IHTA 3GMEA 1WVRA 2CJJA 2FNAA 2PMZN 1D8JA 3BROA 4PZJA 1V3FA 1OKRA 2BGCA 4HSTA 3I56I 1KYWA 2LVSA 3T0YA 1FMVA 2CQ7A 3C1DA 1ZN2A 4OIRF 3L2VA 1U8RA 1XGSA 5HLGA 4A3GJ 3V7RA 2L02A 2RAEA 4V2GA 2BEOA 4D5FA 3TBIA 2LG4A 1QPIA 3GYHX 1Z1DA 4RMNA 4BEHA 4X6AJ 3HOUJ 4C2TA 1ON1A 4A3EJ 2OTJI 2DCEA 3H9GA 3F0CA 4KICA 1DU6A 2VIXA 2DA6A 3AG3H 3ASOH 1I6XA 1Z77A 2VJ4A 2XF5A 2NNNA 2L7MP 1F36A 2P5LC 1TWAJ 3BR2A 3M4OJ 4YEJA 3BG5A 2XSJC 1YHQI 1YRNB 3IP4B 4Y15A 2DN0A 1ZAOA 1W7PA 4LG0A 4ABZA 4OOIA 3H5AA 1ZRCA 2CGPA 2NAZA 1XTAA 2KFDA 3WTSC 1MH3A 2PMHA 4DGWB 1Q1VA 5H2FC 2V1UA 2LFBA 3QOEA 4BNCA 3IRRA 4A0ZA 3RJPA 1EH8A 2VQHA 1ZKGA 1IN5A 3BJ6A 3DP7A 1IUFA 2QSFX 1AU7A 2R7RA 1S9HA 4ESBA 3TKYA 4KNYA 4BXFA 1BW6A 1MBEA 2V1NA 5C4JJ 2EFQA 4RDUA 2W1OA 1MBKA 3KEYA 4HX7A 1RUOA 3E5QA 2LYCA 5J4VA 4BJTA 1RUNA 1SFKA 2WB1N 3ZMDA 1N77A 5DYMA 2H27A 4CSWA 1O7LA 4RGSA 3N05A 2OCEA 4HQMA 4YFKF 4YIFA 4NQWB 1R00A 1ZARA 4DQ2A 1IW7F 1WI3A 2UUZA 3PO3J 5L3EA 1MMAA 2BOLA 3I4PA 3A01A 4AM3A 3GTPJ 2VT3A 3CP2A 2BVLA 2AHQA 1J7KA 4MLOA 3FMRA 1FSEA 5FD5A 4YIRX 4IRIA 2XAJA 3JRCA 2DK5A 4HW0A 4R1HA 4B09A 1ACIA 4RA2A 3U1DA 5DV5A 3KIOA 1A6QA 2VASA 5CVUA 2XAGA 1OFCX 4DJAA 4KITB 2VJJA 1S8NA 2K9LA 4WF2A 3G3ZA 1HW1A 2R5YA 2ZMEC 4M72A 5IP6A 2BVMA 5HNHA 3E6DA 3HBLA 2Y75A 4PJNA 2QENA 2NOGA 4RAYA 2MH2A 3U2RA 2DA5A 2V26A 2GA2A 4UUVA 3ZQCA 3OYGA 2K85A 3HOZJ 4N4OB 1Z67A 2E34A 4YRVA 5BNGA 1FOXA 2FOKA 1SD5A 2UV1A 3ASNH 1LJ9A 2OA4A 2ZMEB 3MVPA 4IXAA 3V8KA 2ZKZA 1IN6A 4BHBA 5J40A 3J81Z 3OYKA 3HZJA 2EQRA 1QHGA 2XVCA 2VPRA 1KQ9A 2AQFA 3BZKA 2GOXB 3S1RJ 2HDCA 1KGSA 2VI6A 3HPGA 5BPDA 1G3SA 1LFUP 4JP0A 2R7QA 2OJED 5LFAA 1D1BA 4KN7X 2ECCA 2O6GE 4I7HA 4KUMA 1TT5B 3OYMA 3QYFA 2H8WA 3RKWA 1QA6A 1GXPA 1NG7A 3EUHC 2BE5F 5D6FA 4B1RA 5D8KB 3PSIA 3KP4A 1JKOC 2F5CA 3K4KA 1BR4A 1AOYA 2CRGA 3W6VA 2XASA 4D7MA 3OYHA 2H6CA 2IT0A 3WTXC 2CO5A 2FRHA 4EV0A 1YJWI 4II2A 5HS8A 2L3DA 2F5VA 3W2WA 4X0GA 1K4TA 4XK4A 2CSOA 2CWEA 3TW7A 3LWFA 3TDZC 1ON2A 2JUGA 1OYIA 3HOYJ 5CVVA 3MZ8A 4HNVA 2Y31A 3WGGA 4IKFA 4S0HB 3CCRI 1O4XA 4IQJA 2EFPA 4PK4A 4BEHB 5BQTA 1U5TA 3SFIA 2HDWA 2K9QA 4YIIA 1TWGJ 4L9JA 1W5SA 2MD5A 3K4MA 2O5RA 1ZG5A 2E1MC 4HZFA 4OIOF 4BE2A 5GPCA 5C4XJ 3Q0VA 3DLLF 4A2UA 2JN6A 1GV5A 3T8RA 3E6MA 3NWTA 5FFZA 2R7VA 3RPUD 4HLXA 4L5EA 4CUGA 5B5EC 3LQQA 1K83J 1R58A 1E3HA 3G71I 1E17A 1DGRM 2W7NA 1B72A 5KAIC 1W1WE 3K2AA 4ZTFA 1X4OA 1JT6A 4UUSB 4AIKA 4CHUA 4LIVA 2JA5J 1BC8C 2CUJA 2KRCA 4DNCA 1A35A 2R4GA 4NHJA 2BY1A 1MD0A 2XKOA 2OQGA 3JREA 3JR9A 1WJDA 4U0WA 3OYBA 3GTKJ 2Z9OA 1BJZA 1QHHD 5IT9K 4HNUA 1TQPA 2DDAA 2XHKA 3CD6I 3GTMJ 1FP1D 4HG2A 3ZQFA 2DMPA 2EFOA 3CCVI 5B1AH 5AIPA 5E3OA 2HQAA 3WHBA 4BXXJ 4YFXF 5GAGJ 1HKTA 4XKBA 5TRDA 3FM3A 3LFUA 5HS7A 3B02A 4IX7A 4HLYA 1YFHA 4M74A 2VT2A 1TW2A 1X58A 1OYWA 1VNDA 5LLQA 2MFZA 3GFJA 4C2UA 2KIMA 2KQRA 2HYFA 4HYEA 2QYOA 3M3YJ 4HF1A 1NHAA 2NS8A 3OWTA 4G7ZF 4OAYA 2XGEA 3KEQA 2HOSA 3DKYA 3JTGA 4UY8I 4F52A 1MJ9A 4OMYA 3L09A 2XF7A 4ZYDA 1QNTA 1X4PA 2OF7A 3EDPA 5F04A 4F7ZA 2M4KA 3M9AA 2H6BA 3TP0A 4Z2YA 1R71A 1VQ4I 1F5TA 1D0XA 4KT5C 3S32A 4PFPA 4A3KJ 1SAUA 1GXQA 3DCFA 2A05A 2CS3A 4PJLA 3TO6A 2ZJPF 3G4SI 3TO7A 4ASNA 3FXUA 3KETA 3ZP5A 3HYIA 3F8CA 3E6BA 1DU0A 2VL8A 3BY6A 2ME0A 4A3FJ 3IKTA 2WB1A 2BHZA 5HLIA 5FLXZ 4A5MA 3QPSA 9ANTA 3KFWX 3GZ6A 4UVCA 2WAQN 4XN3A 4AU7A 5IOZA 1B59A 2QSGX 3M07A 1YITI 3H35A 4DZJA 4XLFA 1CGPA 5JI6A 5DD4A 3FBNB 3K0LA 3QP5A 3H92A 3CTAA 4UHTA 5J1UA 5EGOA 1AKHB 5DTDA 4HX4A 1M1EB 2VJ5A 4XL9A 3HJEA 1X1PA 2ID3A 3CMAI 3CCJI 1CF7B 4TV7A 2K9NA 1F4KA 3RKXA 4C3JJ 4BGDA 1OR7C 1KU9A 4ENKA 1QVTA 4G12A 1P2FA 4M6YA 4L5IA 4EJOA 1TL8A 2E5NA 3ZN1A 1X3ZB 5C44J 1MH4A 2GZWA 3ONQA 2QBYB 5M5XJ 3CMYA 1VQLI 3HDDA 2DXIA 3MKLA 4CXFA 2XAQA 4GRIA 3ZMTA 1L0OC 1FZPB 4GYGA 3SEZA 2L4MA 2HWVA 3WTVC 2IA0A 2HDDA 1IXRC 3DEUA 1SANA 1YS7A 4RBOA 3GCMA 4NBQA 1XX5A 2KJBA 1T38A 2NVXJ 5E17F 4HPQA 1R1TA 2O7OA 3J7ZI 4EM2A 3EYIA 1PYVA 3O8GA 1MBGA 2B9SA 1SVMA 2M8EA 2P5VA 2Z99A 3BLYA 3R0AA 3QOPA 3HRTA 2OBPA 5E1XA 2XPWA 4P96A 1DPUA 2F6CA 1ZLJA 2ZXJA 4F55A 2DQRA 5AIQA 4V2FA 3OYDA 2KHMA 1YI2I 3GFLA 5EEAA 1BIAA 4EMSA 2I8DA 3VYSB 5LRRA 3HSRA 5D4RA 1FOKA 2DMNA 2JWTA 3DPUA 3ROUA 2EK5A 5ILVA 2STWA 1IRZA 2ZFUA 3MZYA 4L5JA 3RPUA 3M7GA 1R7JA 1I1SA 2OCCH 2OPTA 1I27A 4KIFA 4CCJA 5IT9Z 5E3NA 2QBYA 3ECOA 2WAEA 4QIWN 3LL7A 1ETOA 2VKVA 4JX6A 6PAXA 3MFKA 4QPOA 1P7IA 4KDPA 1K7AA 2XC7A 2XKPA 3CCLI 2Y69H 2DU9A 1TT0A 3SXYA 3CP8A 3TMOA 5DEQA 3IL2A 2VQCA 2DMQA 3L2RA 3VOEA 3BR1A 2R7SA 1UELB 1UHWA 3G2BA 2QKMB 1MMSA 3P9KA 2DMUA 4AWXB 3HUGA 2DPDA 2HI3A 1VTNC 1A31A 3VPRA 4M3GA 5ILUA 4CCKA 3FXKA 2AO9A 2CU7A 1BBYA 2FD5A 4B43A 3D5RC 4I98B 2CG4A 3L7WA 4U0YA 2ZB9A 3CESA 3ZMSA 2DOAA 3TW6A 1TZLA 2M7BA 1ETWA 4U7DA 3LMMA 1U3EM 5DS9A 3HKZA 4GDFA 4M73A 2K5CA 3NRVA 1CF7A 2PI0A 2DI3A 5J8FA 2ZSIB 3A02A 1ODDA 3BJOA 4GGGA 4HSRA 2DAOA 3MKZA 1WFXA 2XGCA 4LGWA 5EGOB 1AKHA 1ZGAA 4P9UA 1POGA 2ZJRF 1R23A 4AIDA 2OC6A 4EJTA 4GYIA 3GW2A 1Y0UA 1Y8QB 1QZZA 4RLQA 2A68F 2DW4A 1K78B 1XSXA 3A4CA 4GO1A 3VSLA 1SVLA 4GXOA 1VF9A 3F8BA 5KK1A 5LGNA 1ETQA 3ZQHA 1VQNI 3BG7A 1RZ4A 3BCAA 1HF0A 4PSWA 3S17J 4EEFG 1QGPA 2Z1DA 4MFEA 4F92B 1BR2A 1WJFA 2XV4S 3ABKH 2PG4A 1APLC 4I0AA 2BW3A 2HZTA 5CJ9A 2KP6A 5FO5A 1FTZA 2ELKA 3BJAA 4G7OF 3ZMUA 2RDPA 5DM6F 3DU6A 3RTRA 4WXDA 4OINF 4E7IA 2QLZA 1ZH5A 1LVAA 2KDZA 1CQTA 3BCBA 2GAUA 3CJQB 1ZR4A 1S6LA 3R61A 5IT3A 3I3LA 4RB1A 3AL0C 4U7BA 1BI0A 2DA3A 4J19A 5C3EJ 1KONA 3CF5F 1TQIA 4JQFA 4MTEA 4UB8C 3SZTA 2O8KA 2MBFA 3WU2C 2GBYA 1T33A 2PQ8A 3VYUB 3CCSI 1Z6TA 2X6WA 1UMQA 1ZG3A 3I55I 2TDXA 2Y9YA 4UVAA 3FXRA 5B66C 1WI9A 1FY7A 1EH7A 3EUAA 2IS1A 1SMTA 3B6CA 2A61A 5BPIA 1XCBA 3TP3A 3BR5A 3F22A 4OU0A 2FE3A 4CCMA 4BE0A 1OISA 3B6AA 2MH9A 3SZGA 3U21A 3HTUA 4L0ZB 2P7CB 1XDSA 3L1PA 5LHGA 4XBFA 4BHCA 2WV1A 5F0HA 3Q9VA 2Z33A 3Q0UA 5F08A 3EETA 2EIJH 2IPQX 3BTJA 4FX0A 1BW5A 3U1KA 2CQKA 1MNMC 2NVQJ 1U5TB 3FIWA 2DFFA 1GLNA 2BV6A 1FC3A 4WCGA 1B8IA 1JJ8C 1W0TA 4O3MA 3OIOA 5F1JA 2PJRA 5JFRA 1W36C 1SC7A 3BC8A 4UV9A 3G1OA 1FYLA 2ESHA 3PL8A 1BL0A 2Q2EA 4FT8A 4JYKA 5J4YA 4AUXA 4G7HF 3BG6A 4B47A 2A69F 4KMFA 3ULQB 2EPFA 3G1LA 3K1MA 3C2GA 2Q8KA 1I3AA 2NYXA 3HGGA 4PDKA 3RQ4A 1LNWA 5L3FA 2M9HA 3O2PE 3OYNA 1BIBA 3OSGA 1WH7A 1K78A 3FISA 3I0TA 1ZK8A 2ELJA 5EF6A 3WE2A 2KDOA 3TGNA 1B9MA 3FMQA 3DXJF 1PP7U 1LQ1A 1XMXA 2JUCA 2DLLA 1R6RA 2V9PA 4BUPA 1KQ8A 1JUPA 2ADUA 1G3WA 3KZZA 5HODA 1XPXA 3QYBA 4PCQA 1R22A 4HQEA 1BC7C 2XGXA 4XR6A 1R49A 2VC0A 3SDGA 3K69A 2FBKA 1KU3A 3HOXJ 1Z3XA 4IHWA 3N4MA 1TC3C 1LUJB 1MGTA 2MGQA 4AYBA 1XCVA 2HXOA 3HUGB 1MMGA 3F72A 2NVTJ 1SFEA 2M45A 4A6EA 3LA7A 4AVZA 2L9SA 1Y8RB 2ZXWH 1P92A 3HL2A 3TL4X 3L2QA 4M6VA 1RESA 3Q3SA 3K2ZA 2FF4A 4RM3A 1ETYA 2P4WA 3WTUC 3IKVA 1LEBA 2VXDA 2HOTA 5ICFA 3IV5A 2JK3A 4OIPF 1QZEA 2E1NA 1U5TC 1B1BA 1B6AA 5E1WA 4ZJZA 2LP0A 2G7UA 2YR2A 3SEQA 3OYIA 2K02A 1RIOH 1ZELA 4YG2F 1JKQC 2OTLI 2KRFA 2Y30A 2MD0A 3UNGC 2MA3A 2M8GX 3KYLA 2X51A 5FRNA 2IA1A 5ILSA 3A01B 4IHVA 4XOPA 3DU5A 4LD5A 3RIRA 2NXNB 1R5GA 5FFXA 5K7ZA 3MN2A 2R5YB 5F0CA 4JK1X 2VONA 3DPTA 1W7PD 4UVBA 3CJRB 1LFBA 3H9QA 1WHUA 3LQRA 4BXUA 2K7LA 2XB0X 1VI0A 3I71A 1TQMA 4ZYAA 1IXCA 2HFHA 3DEWA 5CQGA 3IH4A 4EJVA 4HRIA 3CJTB 1KQ0A 2NNYA 4IHYA 4PGGA 3J7YJ 2V1DA 2DFHA 2WADA 1S7AA 1Z05A 3G6EI 1ULYA 1FTTA 1ONVA 2L7ZA 4CH7A 2YUSA 3ZGKA 2OD5A 2HPMA 1IN7A 2K3PA 5IP9J 2LH9A 3RDIA 5FGMA 1QRYA 2LC2A 3M8FA 2VBZA 2LMDA 2LF7A 3P9IA 3QP6A 3LAPA 4CGZA 2R7WA 4BBSJ 2JZYA 2VJIA 3K4JA 3MAJA 1T0FC 1E3OC 1J0RA 4EGYA 2ZFWA 3FX3A 1S3JA 3DPLC 1NK3P 2HQ5A 2EINH 4RGXA 3P9CA 5FJ8J 2DBBA 2ZNYA 3FM5A 2CFXA 3DV8A 1R4NB 2STTA 1FOYA 1OJLA 2GLOA 1T08B 1W7PB 5DUKA 2RKHA 1UHSA 4G8XA 4IL6C 2I10A 1FMWA 2HTJA 5J6XA 4M9ZA 5DM7F 1K4SA 3H5RA 1TNSA 3FHNA 2FBHA 3IHUA 3IWFA 4HF2A 3GF2A 1Z6RA 2LLKA 3RYRA 1YW9A 4W1UA 3HPHA 4IVNA 4A3DJ 2EA2A 1X1CA 1Z7UA 2CYYA 3ISPA 4C3IJ 1NH3A 1XD7A 3GTGJ 2O03A 2CQQA 3LSTA 1RKTA 3MKYB 1JXSA 4YFNF 1DPRA 2PFBA 1V5EA 1VQ9I 3OYLA 3FWEA 4XLHA 5D5UB 4NB5A 3ZQQA 3ABLH 4U87A 3LA3A 4J00A 4DBQA 4XIDA 4FX4A 2P6SA 1Z9CA 4CYCB 3BG3A 4CCOA 2H1LA 1TWFJ 2BZTA 4Q48A 1WCMJ 2HVQA 3J7AY 1OQYA 2KLOA 4RAGA 1S7EA 1R36A 3VSKA 3A0HC 2Z2SB 2CW7A 2PJPA 1RI7A 5B1BH 1K6YA 3NARA 2R5ZA 2KMUA 2L5QA 3LSGA 3RZOJ 1X1DA 2E36A 1LB2A 4AIJA 1RC9A 3HC7A 1J59A 2CUFA 3DKWA 3FXJA 2E7WA 2AS5F 1UHMA 4MEXF 1F9NA 4JOMA 1O57A 5IYDJ 1G8XA 3GZNB 2DT5A 2LK2A 4C3HJ 5FRMA 1ITYA 3DWLE 2EFWA 2P0WA 1BOBA 3LNQA 2FSWA 5DDGA 3H9JA 4LK1F 4UUTA 2VXZA 3MMYB 5CKTA 2V9KA 3JTHA 2F48A 4AVPA 4FASD 3PM1A 3JCUC 2YX4A 2M5WA 4HX8A 1REPC 4HEA2 4M3FA 1JHHA 4BJ6C 1HKQA 1N25A 2BW3B 2BYVE 5FKKA 1AA7A 2DPUA 2R7XA 4IPAA 5TJJA 4BY1J 2VKEA 4HAMA 2OU2A 4I0BA 2DOEA 2LRDA 3S1NJ 2QM3A 1BM9A 3OIPA 2CW0F 2DFEA 1JGGA 4NC7A 1WJEA 3BR3A 3JRDA 1FYMA 3NWSA 1BOAA 3FZVA 1GDTA 3I58A 1IDYA 2VKDA 4WXHA 5FKMA 3K70D 2R7TA 4A3MJ 1YJ9I 1I6HJ 4S05A 1EV7A 1QO0D 5FKLA 4XMYA 2KZGA 1WJAA 2V4JC 5F6FA 2ID6A 4DOZA 1D0YA 3IUOA 3QU3A 3O8HA 4ZDPA 4QWQA 5LEKA 4N9HA 3JSPA 1OCCH 2C6YA 3F8NA 4UV8A 2X85A 3CO7C 2EILH 1IRGA 1ETXA 1S29A 1RPWA 4IJAA 2A3SA 1F43A 5M5YJ 5EG0B 3RYPA 3HEFA 1E0EA 2IVMA 3CUQA 1SMYF 1LKXA 3RZDJ 1T0FA 2L54A 2LNBA 2EIMH 2IRFG 3MZHA 2CUZA 2EV5A 3HIFA 4IQ4A 3BPXA 3GX4X 3HXLA 3Q5FA 1SFXA 1Y56A 3FK6A 5JLWA 1D3YA 3RI4A 3E97A 1A36A 3JRFA 2HNHA 1WSUA 3K4CA 2FA5A 4G6DA 1JUSA 1UCRA 4FISA 4MO7A 5E79C 2NS0A 2W82A 4B8XA 1P4AA 3V7SA 2LBFA 3V42A 3CCQI 1UJ8A 4WX9A 2TCTA 1HDPA 4RAZA 1R5HA 3LSPA 2G9WA 2M3AA 4KIGA 2O61A 3OYCA 1WWXA 2BBYA 2Z3YA 2F5FA 3VDXA 2HQNA 3DF8A 2L7KA 3ZOBA 3DTEA 4MQ9F 2HKXA 4LJZF 2CFOA 3FK7A 4XSZF 2Q1ZB 5FLXK 3WG7H 3QWLA 3K1PA 2ZJQF 2I5UA 1PVEA 3R6SA 5J47A 3KP6A 3PJRA 5HDGA 2DYRH 4P55A 2OZUA 1VQ7I 2Y9ZA 2X1DA 3CLOA 4M6XA 1J5YA 3PQJA 4A3BJ 4UXNA 4DIQA 2IS6A 1R1UA 2KRHA 3WTZA 2MW8A 3ABTA 5ERIA 5GADJ 2WA0A 2F4OB 4LB6B 1WJBA 2L9VA 3MWMA 2WY7Q 4CICA 3ZQIA 3KYDB 4D0PA 5F0FA 3HRSA 3KZIC 3S3MA 2PX9A 3JRIA 1V4RA 1W5CC 3HSFA 3IRQA 1MBHA 1EH6A 1YW8A 4OMZA 1XGNA 5J3LA 1RRJA 2V9VA 1F1ZA 1KU7A 4I2OA 1VQ5I 1RETA 1FLIA 2P6TA 3K7AJ 2DA2A 4BKXA 4CZZA 3VWBA 2MLGA 4KN4X 4EJWA 2JMWA 1ETVA 2X6YA 4II3A 3ZRGA 2D1HA 1ZREA 2XB5A 3LOCA 2UWMA 3S93A 3JRHA 3IH2A 3FXOA 2WTEA 4CA0A 3O3KA 2K4BA 5JVGF 5FKNA 3HHHA 2GOMA 4A3JJ 4N0BA 3GVAA 4CDGA 2WAFA 3IWZA 2EWNA 3WTTC 3HRMA 1YLFA 4ITVA 1X1BA 2X1CA 4EQQA 2L9RA 2R93J 4LLNA 1LDDA 1MNEA 3WE3A 5L3DA 2JA7J 4PFOA 4MFDA 5EZHA 2KL4A 3RSNA 5LGTA 1LE8A 5FLMJ 2E2HJ 2MC4A 2LY9A 3E5UA 4ZYEA 1K6OA 2E2JJ 2JVGA 5L3BA 4LG0B 4HNTA 2HOAA 1YG2A 3FDYA 2Q2EB 2VN2A 2OAZA 3BG9A 1Z7LA 2FUG2 4ESFA 2R3SA 4BQAA 2QQBA 2VBYA 2GQQA 4CCLA 3FKIJ 5HDKA 5J1RA 4BU2A 3HOSA 2F2EA 2B0LA 4ENNA 1ENHA 4FHTA 4LLGF 4V19K 2JRMA 2GA1A 2IAIA 2H09A 3AG2H 3F6OA 2GXAA 1IV6A 1O3RA 4ZH4F 1SEUA 1YQAA 1BA5A 1KYZA 2WV0A 2JTVA 3E1SA 3E6CC 1HSJA 4XRSA 2VE9A 1YW7A 3S3OA 5A2QK 2Q0OA 3CC4I 3DKXA 2QA4I 1W5TA 3J7AO 5CVJA 5E20A 4A69C 2E2IJ 2PN6A 3K4BA 1YIOA 3MD2A 3JRAA 2LSOA 2QF7A 2VB6A 4A3IJ 2L7FP 2D1VA 2M0CA 2PJRB 5LD2C 2GXBA 3BZ6A 3FBIB 1MW7A 1B8IB 1IF1A 1Y6IA 3V4GA 2HU9A 1DP7P 5H6RA 1TNTA 2EB7A 2WWYA 3BT9A 3L2CA 1B9NA 4ZZDA 1W0UA 4HDVA 2RQQA 3O6BB 2BHYA 2LY2A 2RNJA 1QU3A 2YS9A 2M30A 1TTYA 2HQRA 2QZ8A 2YSRA 1JTXA 2ZJ2A 3HRUA 3K4NA 2ICWG 4BBRJ 3N97A 3D1NI 4DYQA 4PJJA 4ENJA 3VFZA 3JRBA 2Z16A 3ZMVA 1U6GA 1LDJA 3OYJA 3PO2J 4XLAA 2UXNA 4H0EA 2VE8A 1SD7A 2J5PA 2M0MA 1V5GA 2PMZA 1T39A 2XGDA 4UUSA 1G3YA 1T95A 2IA2A 1P6RA 2XRLA 1V54H 3KZYA 1G59A 4BE1A 2CQNA 3H1CA 2FXAA 2R7UA 4E7HA 5ICEA 4LFUA 5CYVA 4LK0F 2KT0A 1VQ6I 3HOTA 3FXLA 2W48A 3SFZA 4ENMA 2BY3A 2KKOA 2IXSA 4G94A 3CMEI 2KIUA 4F3QA 1XC5A 5F1RA 5ED4A 2VPLA 2L9NA 3OS1A 3VEPA 4NC8A 2TRTA 2NRAC 4I76A 2DDBA 5ICCA 2HOEA 3ZN0A 3HM5A 3HG9A 1HLVA 3I54A 4CO8A 2KIQA 4IHSA 5FB2A 4S04A 3CCYA 1SAXA 3JAMK 1GT0C 3MCZA 1W36D 3MQ0A 4RS8A 1YO5C 2WAQA 4QLCU 1IUYA 1DP3A 2LKSA 1YIJI 1T6SA 2AXTC 3HB9A 3I4MJ 2RN7A 3EUKL 5JLXA 5F27A 1GV2A 2Y48A 4RGUA 4XONA 5HS9A 4XICA 1QVUA 3A2KA 3ERMA 2EZHA 4EATA 1VQKI 1WJCA 2F5EA 1OCOH 2E5ZA 1YE9A 1P4XA 4FE7A 1V5FA 2L0KA 3K6GA 2ZSHB 1X2NA 3F8FA 1IJWC 3BR6A 5J1YA 1XG1A 2DA1A 3FXQA 2QEXI 5M3FJ 3SJMA 3CDIA 2LD5A 1GUUA 3ESWB 5D5XB 2IGNA 3FHZA 4EVIA 1FPQA 2KIFA 2H1KA 1LPQA 1VZ0A 2R7FA 2YPRA 2WC2A 4XSXF 3DFGA 3RPQA 3ERED 2COBA 3DBRB 3PUBA 2KPMA 3DTIA 4KT6A 3H0DA 2F5DA 2XIGA 2NOJB 4BL0B 4IF4A 4EJUA 3UKGA 3CUQB 1GVJA 1H8AC 3LSJA 4ANJA 3H3UA 4XQFA 3E0JB 4XRMA 4G6TB 3U9GA 2RC4A 3WGHA 3LAJA 3I4NJ 3NEUA 3Q9SA 3MKWB 1U8BA 1HC8A 5EEGA 5E3LA 1FIAA 3OSFA 1VQ8I 3OIQA 2Y0MA 4QSHA 5A2QZ 3WTYC 3GLXA 3V8LA 4EM0B 1IGNA 5FROA 3S2HJ 1XDUA 3QPLA 3F21A 2QQ9A 3D5LA 3HKZN 5DCFA 2IJLA 4UB6C 1RR7A 4E70A 2E60A 1TWHJ 2V7FA 4M9XA 4F91B 5DCMA 2X6OA 1Y0NA 3DQVC 2HVRA 1YS6A 1XB4A 3CQZJ 1VQOI 4FTHA 2L2OA 1TP4A 4MGRA 3ZR8X 3GTJJ 3R60A 1U0JA 2JVHA 3C2BA 2R0QC 2DFIA 2XAUA 4KMUX 4RB2C 5HVQC 1P4WA 2HEOA 4XKCA 2VOPA 3OL4A 3ZXSA 5JR3A 3B73A 3EPZA 3M8EA 1VQMI 3QU6A 1FOWA 1D5VA 5IYBJ 5HNFA 2NVUB 3GTQJ 1J9IA 4E7SA 2XPUA 4I02A 3LSRA 4RM2A 2ZBKA 2DT7B 3L00A 1D5YA 3S1MJ 1MZBA 3F6VA 5GTHC 4A93J 2OUMA 4XKVA 1C0WA 3L9FA 3NAUA 1OPCA 4MNUA 5KAFC 1U9OA 3KPHA 1I39A 1MSEC 1JTYA 3AKZA 1Z21A 3CCEI 1V55H 4BACA 1Y1WJ 1ZRFA 2R7ZJ 4DYCA 2ECBA 2NS7A 3VYTB 3FF5A 2LTPA 5ICGA 1OLTA 2EBIA 2ACJA 1MJAA 1HSTA 1YRNA 3LFKA 4WWCA 3KP3A 1N78A 5GAHJ 3BTCA 1TBXA 2DA7A 4LITA 3GEZA 3CC2I 2HYGD 3GUDA 3OMYA 1UFMA 2AXLA 5CQEA 2XSDC 3H5NA 4ETSA 4JX4A 3X2QH 2HTSA 5K7FA 2L01A 5B3SH 2O8XA 5FKOA 1EJ9A 3C18A 4JX5A 3HTSB 2CH0A 5KCMA 2BY0A 3PNYA 3C3WA 4M3EA 3CLQA 2M1BA 3IAS2 4Y52J 3OYEA 2ETHA 4HF0A 3H3ZA 4DBRA 5KNLA 4FCYA 5KHDA 1JJ6C 1J75A 2G7HA 4RB0A 1JE8A 2JRTA 4DZPA 1JHFA 1OCRH 4KIBA 4NDLA 1Z0XA 5K7HA 4BY7J 4BDZA 3BTLA 3JW4A 2IS4A 2Y2ZA 1PUFA 2K4JA 4A3LJ 2GIZA 4M3BA 4AC0A 3F23A 3OR2C 1UG0A 1T98A 2DQLA 4Y13A 1MDMB 4D9JA 1XSVA 2XDVA 3CZ6A 5M3MJ 4RB3C 2KZVA 3ML6A 1XMAA 4G6QA 1AWCA 2XF6A 3FXMA 2DTZA 4X1EA 4Y33A 1PUFB 4IEJA 2E7XA 1VQPI 4C30A 2PLYA 2XAFA 2EZKA 3I64A 4NNJA 4BS9A 1A6IA 1P9QC 5M5WJ 2CUEA 3A03A 5KVRA 1OR7A 2IP2A 4I01A 3OS2A 3S1QJ 2DODA 4A6DA 4MIMA 4MQVA 2COMA 3DBLB 4XLCA 1I1GA 5D5WB 4EM1A 1A04A 3GZ5A 3S2WA 4P9FA 2R7OA 1DUXC 3EYYA 3OYFA 2BY2A 1H9TA 2W24A 5BOXA 3AG1H 2IW5A 2D2WA 2HR3A 1BN5A 2E35A 4A0XA 5K1YA 1EF4A 1X3UA 1YYVA 2XAHA 1DQUA 2DTRA 1TWCJ 3T5XA 4MHGA 1X3WB 5K5RA 3CC7I 2EV0A 4I6ZA 4D1QA 1XSDA 1KA8A 1MIJA 2IGMA 1MSFC 1D0ZA 4BHPA 1LDKB 3KX2A 4IOCF 4B48A 5GTIC 4AIHA 4CCNA 2FX0A 5H6QA 2QGUA 3H0GJ 4CYCA 4IRHA 5E8GA 1UAAA 2QVOA 2EV6A 3AL0B 5D4SA 3ABUA 2X6XA 3UR3C 2HS5A 1MBJA 2LDUA 1O3SA 4PUSA 4XORA 2FQ4A 2P7VB 3PUFA 2F4MB 2J5OA 4Z6YA 1WZ2A 2JSPA 5J8CA 1H88C 4D5CA 2RQPA 2ESNA 4Q47A 1WPKA 2PEXA 5EEHA 4XN0A 2ZC2A 4B44A 4A12A 4Y17A 2JSCA 1IG7A 2JA6J 4YELA 5LHHA 1ZGWA 3KEOA 4K2EA 3DEEA 1YX5A 3ZQ7A 3ELKA 2W00A 5DCMB 2FJ1A 2HZDA 5GP9A 5FLVA 2RNGA 2ZNZA 1UB9A 1WH5A 1MNDA 1BI1A 2V6EA 1HXDA 3FKJA 3K70C 1OYYA 1I50J 1EA3A 1FP2A 5D6EA 4RGRA 2LKXA 4LB5A 3QPTA 1OMIA 4XLNF 1J2XA 2LREA 2ZCWA 4KISA 4FE4A 3G1MA 2HXIA 2QKLB 2KISA 4MTDA 3TEDA 2R92J 5HOOA 1X1AA 1IRXA 1ETKA 4NUBA 5HLTA 1MKMA 3D0SA 1O3QA 3ZQLA 2EJRA 2P5KA 2YX7A 5EZGA 4A5NA 2QSHX 3SZPA 2E1CA 2VLAA 4DW6A 1HDDC 3JSOA 1NTCA 1OCPA 4CYDA 5AONA 2W57A 3EQLF 2FBIA 1FBUA 2RREA 1OCTC 3CO6C 1K61A 3AG4H 3VODA 2Y0SN 3FMSA 1ZRDA 4ZDOA 2B7EA 1BR1A 3PIOF 4QTRA 2DJIA 3S16J 3AAFA 5LEJA 3WGIA 5JHFA 2R7DA 3RKYA 4L9TA 4M9SA 4BH9A 4AYBN 2JQ7A 1RKWA 1XN7A 5E8IA 2JA2A 2QQ8A 3J80Z 3BPVA 4N9IA 2MABA 2RVCA 4F93B 3K1NA 1W4MA 2M7AA 4P5OA 4E4HA 1AHDP 1FWZA 4GFBA 5D8LB 3IH3A 2GWRA 3VB2A 2ZMEA 1RR8C 2A5WA 1IC8A 4I09A 2X48A 3BWGA 4O5VA 3BQYA 1EKEA 4B4CA 4HDUA 5JVTA 5E1ZB 3PSFA 5DD8A 1PP8F 3P7NA 3PNTA 5E3MA 4ESJA 1NK2P 3H36A 5E18F 1OCZH 1XGMA 2FOWA 4KA4A 4NQWA 2DYSH 1O3TA 3LSMA 4LG3A 4WK8F 1Z3YA 2WY8Q 3M8JA 2X9DA 1ZLKA 4UNOA 1WKMA 3KP2A 3ECHA 3OL3A 4HV6A 4XRFA 4PJ0C 1WRJA 1UZCA 3W2AA 4E7JA 2YU9J 2LR8A 1XGOA 3SYTA 2VQLA 3V7CA 1G4DA 1HA8A 2HKOA 2PBIA 4CZCA 5HLHA 3QAHA 1BI2A 4J01A 4IO9F 4IRGA 1FBQA 5TISC 1SVOA 4A0YA 1FJLA 3ABMH 2MG4A 3KYCB 1QZYA 4M3DA 2XUBA 4Y3OA 1HW2A 1HQCA 2M34A 3M1EA 5IOYA 3PQKA 4XKWA 4QPQA 2GIVA 3R0JA 1ZYRF 3TDUC 3TQNA 4Q4ZF 5K5QA 3CCUI 5D5VB 1T56A 3GWZA 2VOOA 2LKPA 1HOMA 1BI3A 3TOAA 2M4GA 2DK8A 5LGUA 3C2HA 3NQOA 4HOBA 3QODA 2RGVA 3CDLA 3OR1C 3ZMZA 4B3AA 2VODA 2ELHA 1ZHFA 4DYRA 2M2EA 5IPAA 2O0YA 1TLHB 5BS6A 3S8PA 4L9VA 2A6HF 3K4LA 2DO7A 3CDHA 3H3VK 1IAWA 2YU3A 1I3QJ 2GM4A 3DBHB 3F8MA 4R8HA 4XNFA 4PGHA 3PIPF 3PFIA 1MDMA 3OY9A 3BR0A 4XM3A 4L18B 4EGZA 2JA8J 1JGSA 4U0VA 2W85A 5JHUA 3SHFA 4NC6A 1J09A 3OS0A 5IP7J 2RV8A 5L3GA 2QUFA 4RAFA 2EIKH 1LVKA 1LE8B 3GO5A 2PMUA 3MEXA 1H9GA 1U2WA 1IO2A 3ZPLA 1USTA 2CMPA 2ISYA 5LHIA 1U9NA 2IGOA 2H94A 2EA4A 2H8RA 3T1BA 3KCCA 4D7NA 1A5JA 3GTOJ 1Q1HA 4IOAF 1BJAA 5GPAA 4RLFA 4Q5SF 2K9SA 3HHGA 5LRSA 5CPRB 2DT6A 4OAZA 2D45A 4I99C 1K79A 3WG9A 5TGTA 4C9YA 4BAYA 1L3LA 3LSIA 3HSEA 1G3TA 1YX3A 1PDNC 1Y39A 2W84A 4PSXA 3S14J 4JBAA 1D1CA 1JUMA 2FU4A 2W25A 3K10A 3HGYA 4LLLA 1NG6A 2XPVA 3COAC 1PUEE 3VYRB 3ZCOA 2OZ6A 3KP7A 4ZC3A 4L0YB 1ZGJA 2DOFA 1IN8A 2ISZA 2IBDA 3J80K 2D5VA 2JPBA 1FEXA 4HV5A 3S15J 2LOOA 4KYWA 4E7ZA 2EH3A 1Y1VJ 2XROA 1WJ5A 2E71A 1YTYA 1SFOJ 1G6NA 3SQNA 4O6JA 2IEKA 4BJ5C 3GFMA 3S3NA 2V6CA 1E2XA 2Z5UA 1HBXG 1T2KA 4BYYA 4A3CJ 1MJBA 3I59A 1LFPA 3KLNA 4XLPF 1XS9A 2M87A 3E7LA 4OIQF 2QQAA 1PJRA 2FNPA 3BTIA 2ME6A 3DTKA 1IN4A 2K40A 3T8TA 1JI8A 3WHCA 2Y0SA 3E3VA 5CLSA 2HYJA 4ZZLA 4R79A 1IZ1A 3OYAA 4C2MJ 1S5LC 2P8TA 2O3FA 2L4AA 4WXCA 3W6JB 5IYCJ 1R9TJ 4LOCA 3GXOA 5LBQA 2IS2A 2N8GA 3CJNA 2IGKA 2K9MA 1STZA 5L3CA 1YJNI 2FEZA 4HBLA 4M71A 5F64A 2UZKA 3JRGA 1SD6A 2EFNA 2B63J 2QWWA 3QQAA 3P5JA 3S2DJ 2E1OA 4GCVA 1FBSA 3GLLA 1FNNA 1YOVB 3WU1B 2MYSA 1I5ZA 3GFIA 1IV8A 1ZR2A 5HDNA 2A5YB 2VKHA 2FQ3A 1SD4A 2V1XA 3F3XA 3LSHA 5EDNA 4IZZA 1S7OA 1JT0A 1HCRA 1QPMA 4XLEA 1R4MB 3PNVA 2JT1A 3D5SC 2LF8A 4FQGA 3RCOA 1R5ID 1GVDA 3HOVJ 5CVIA 1B4AA 2E19A 1FX7A 1XMKA 4LIUA 2AQEA 1DDNA 1LEAA 3CF2A 3IC7A 1FSHA 3CUQC 1P7JA 2MSYA 3SDBA 2W4SA 2LBFB 4LMYA 3W3CA 3TOBA 1ZTRA 2DJNA 2K86A 4W97A 2CV1A 3I9V2 3RKQA 3V8JA 3OOUA 3BOQA 3OOPA 5GAEJ 2CW8A 4OWRB 3WU0A 3WTWC 1G2HA 1U78A 1IDZA 2BXYA 2A07F 2A6EF 1MMNA 3IAM2 4ON0A 1FYKA 4BQNA 3G73A 1IXSB 4ZTJA 3BP8A 1FT9A 4PJMA 2DMTA 1GHCA 3REOA 2X4HA 4ZYHA 5FD6A 5EG0A 1Z91A 3KE2A 2HGCA 2EZIA 4BQOA 3JAMZ 5EJCA 3PFYA 2XRNA 1ORKA 2MC3A 2FMLA 2V79A 3ZQGA 3A0BC 2MLKA 5EYRA 3LSKA 1H0MA 3TO9A 1TW3A 2P81A 2UXXA 2F4IA 2ZXHA 3I53A 1WGXA 3GBGA 4N4NB 3I59B 3LA2A 4IHXA 2KJCA 4U88A 3BDDA 2FMYA 3A1YA 4MEYF 2HVSA 3AFHA 1VFCA 2DA4A 1X2MA 2HPIA 3K9TA 1MMDA 1QBJA 1QQIA 2EZLA 3DLAA 1ZQ3P 4B3XA 2OV7A 2CV2A 5DUIA 2ZXIA 5H20A 1IRFA 3M1CA 2QCOA 3OV8A 5IY5H 1DGWY 2WBMA 1USSA 1RNLA 3BQZA 3CMMA 2K3FA 2BXZA 2NVYJ 3Q0WA 4G9YA 3W2VA 3QRFF 4BDYA 1HKSA 1H89C 4ZYGA 4KFCA 2O9LA 2A6TA 1T8IA 2CQXA 4H4KC 4XOTA 5BMZA 4XRSG 3EUHA 3KP5A 2K27A 3QYEA 4BQQA 2G0EA 1D1AA 1JKPC 3GTLJ 2X1EA 1WQ2A 2X0LA 1SFUA 2JPCA 1FIPA 2GXGA 3BZCA 2LY1A 4HA8A 2CV0A 3CUOA 5CVRA 3J81K 5K5OA 3R4KA
chains in the Genus database with same CATH topology
4ZDLA 2W82A 1ERDA 3CESA 4FETA 2DOAA 2LBFA 1TZLA 2M7BA 4KJZA 3L2WA 3LMMA 1DQUA 4E7KA 3V42A 3HKZA 4P1WA 2K5CA 4E6KG 4E7LA 4D1QA 2M3AA 2IGMA 2ZSIB 3OYCA 1D0ZA 4HSRA 1N75A 3VDXA 1LDKB 1WFXA 3KX2A 2L7KA 3MKZA 4Y4RA 4B48A 4CCNA 3DTEA 2E1MB 1X19A 2VQGA 2OC6A 1UAAA 3L2UA 2CFOA 3AL0B 3F9KA 2Q1ZB 4RLQA 2X6XA 3UR3C 3A4CA 4PUSA 3VSLA 3PJRA 4XORA 3BG7A 3BCAA 2X1DA 4HSTA 4PSWA 2JSPA 2Z1DA 1FMVA 4DIQA 3L2VA 2IS6A 4F92B 4XN0A 2KRHA 4B44A 1WJFA 1BR2A 2WA0A 1WJBA 4YELA 2BW3A 2WY7Q 3TBIA 2LG4A 3DEEA 1YX5A 4RMNA 2KP6A 4BEHA 2W00A 2HZDA 4C2TA 2RNGA 2DCEA 3H9GA 1MNDA 2VIXA 3S3MA 3DU6A 2V6EA 2VJ4A 3FKJA 2XF5A 3RTRA 3K70C 1EA3A 4E7IA 3BCBA 4YEJA 2XSJC 2LREA 3IP4B 4KISA 3CJQB 2QKLB 3VWBA 3H5AA 3I3LA 5HOOA 3AL0C 4U7BA 1X1AA 1IRXA 2X6YA 4II3A 4NUBA 5HLTA 3ZRGA 1KONA 4DGWB 4JQFA 2UWMA 3QOEA 3S93A 2VQHA 4CA0A 3VYUB 2R7RA 1S9HA 2GOMA 4BXFA 2X6WA 2VLAA 2V1NA 2W1OA 3KEYA 2LYCA 4BJTA 2WAFA 1SFKA 1N77A 4ITVA 4CSWA 1X1BA 2X1CA 3N05A 2RREA 1MNEA 3EUAA 2IS1A 4NQWB 4PFOA 2KL4A 3RSNA 2UUZA 4ZDOA 2MC4A 1MMAA 2BOLA 4CCMA 1BR1A 4BE0A 2DJIA 2JVGA 3SZGA 3U21A 3CP2A 2BVLA 4HNTA 5JHFA 4MLOA 3FDYA 2Q2EB 2JA2A 1Z7LA 2FUG2 2MABA 4CCLA 4F93B 3HOSA 4BU2A 2M7AA 2VASA 4P5OA 4E4HA 1GLNA 4DJAA 4KITB 2VJJA 2K9LA 2A5WA 2PJRA 1W36C 3BC8A 3E1SA 3PL8A 3S3OA 2BVMA 3BG6A 4B47A 5HNHA 3DKXA 3PSFA 4PJNA 3PNTA 3C2GA 2V26A 3K4BA 3RQ4A 3OYNA 3MD2A 3OYGA 2VB6A 2ELJA 4N4OB 2KDOA 3LSMA 4LG3A 4YRVA 1Z3YA 5LD2C 2WY8Q 3M8JA 2PJRB 2UV1A 3FBIB 1MW7A 3OYKA 1Y6IA 2HU9A 3OL3A 1QHGA 1R6RA 4BUPA 3W2AA 4E7JA 2AQFA 3SYTA 2GOXB 2VQLA 2RQQA 1QU3A 2LY2A 3HPGA 1HA8A 3QYBA 4CZCA 2R7QA 5LFAA 1D1BA 4XR6A 4J01A 3K4NA 3OYMA 3QYFA 1Z3XA 1NG7A 3EUHC 4PJJA 4AYBA 3PSIA 3K4KA 3HUGB 2Z16A 1BR4A 1MMGA 4Y3OA 3OYJA 4XLAA 3OYHA 2M0MA 4AVZA 1V5GA 2PMZA 4XKWA 2L9SA 4II2A 4QPQA 1T95A 2F5VA 3W2WA 3HL2A 3TL4X 4X0GA 3L2QA 1G59A 2M4GA 2JUGA 4RM3A 4BE1A 3C2HA 3QODA 2VXDA 3OR1C 2R7UA 4IKFA 4E7HA 4IQJA 4ZJZA 4PK4A 3S8PA 4BEHB 3HOTA 3SEQA 3OYIA 3K4LA 2HDWA 1ZELA 2IXSA 4F3QA 2MD0A 3K4MA 2O5RA 4XNFA 2VPLA 2E1MC 2L9NA 3UNGC 3OS1A 4BE2A 3OY9A 4XM3A 4NC8A 3KYLA 1J09A 3OS0A 2X51A 5FRNA 3NWTA 2R7VA 1LVKA 4XOPA 3DU5A 3RPUD 3HG9A 4CUGA 1DGRM 2CMPA 3DPTA 2W7NA 3CJRB 2IGOA 4ZTFA 1X4OA 3H9QA 1W36D 2WAQA 4RLFA 1DP3A 4LIVA 5CPRB 2DT6A 4OAZA 4ZYAA 3EUKL 2CUJA 2KRCA 5CQGA 5TGTA 4HRIA 4C9YA 4XONA 2R4GA 3LSIA 2WADA 3A2KA 4EATA 1YX3A 1WJCA 1WJDA 4PSXA 3OYBA 2E5ZA 1YE9A 1V5FA 1QHHD 3K6GA 4CH7A 1D1CA 4HNUA 2ZSHB 3K10A 3ZGKA 2HPMA 1NG6A 4HG2A 2K3PA 3VYRB 3ZCOA 4ZC3A 2LH9A 2LC2A 2IGNA 2R7WA 2HQAA 2VJIA 3K4JA 1VZ0A 1T0FC 2LOOA 3PUBA 4KT6A 4XKBA 2KPMA 3DTIA 4E7ZA 3H0DA 3DPLC 2NOJB 3LFUA 1WJ5A 4BL0B 4IX7A 4BJ5C 3S3NA 4ANJA 4XQFA 3E0JB 4G6TB 2MFZA 4C2UA 2KQRA 1LFPA 3MKWB 3OWTA 1PJRA 3OIQA 4OAYA 3DTKA 5FROA 1FMWA 3DKYA 4F52A 1JI8A 3H5RA 3FHNA 2XF7A 2Y0SA 1X4PA 3OYAA 4R79A 3D5LA 2M4KA 2E60A 3HPHA 1D0XA 2V7FA 4F91B 1X1CA 2IS2A 3S32A 4PFPA 2IGKA 1SAUA 2K9MA 3DQVC 4PJLA 3MKYB 2CS3A 2HVRA 1V5EA 3OYLA 4XLHA 2L2OA 2VL8A 4U87A 3ZQQA 2WB1A 4J00A 3ZR8X 1U0JA 4DBQA 2JVHA 2XAUA 4CCOA 2MYSA 4XN3A 4AU7A 2HVQA 3J7AY 5HVQC 3H35A 2KLOA 4XKCA 2VKHA 3OL4A 4XLFA 3ZXSA 3VSKA 2Z2SB 2CW7A 3EPZA 3FBNB 1K6YA 3LSHA 2KMUA 2L5QA 3LSGA 1X1DA 5HNFA 4IZZA 4XLEA 4E7SA 3HC7A 3PNVA 4RM2A 2VJ5A 2DT7B 3D5SC 4XL9A 2OUMA 3RCOA 4XKVA 4JOMA 4LIUA 4BGDA 2AQEA 1OR7C 1G8XA 3AKZA 3CF2A 1Z21A 4BACA 3SDBA 2W4SA 2LBFB 5FRMA 3DWLE 3VYTB 2P0WA 1BOBA 2E5NA 3W3CA 1OLTA 3ONQA 3H9JA 2CV1A 3I9V2 2VXZA 1N78A 2DXIA 3MMYB 3OOUA 5CKTA 4LITA 2V9KA 4GRIA 3OMYA 2CW8A 5CQEA 4OWRB 3H5NA 4FASD 3SEZA 3IAM2 1MMNA 4HEA2 4BJ6C 2CH0A 4BQNA 5KCMA 4HPQA 4ZTJA 3PNYA 2BW3B 3IAS2 4PJMA 3OYEA 1AA7A 1PYVA 4DBRA 5KNLA 2R7XA 5KHDA 3BLYA 2LRDA 3OIPA 4BQOA 4NC7A 1WJEA 2F6CA 3PFYA 3NWSA 4F55A 4BDZA 2IS4A 3OYDA 2KHMA 2VKDA 3LSKA 3K70D 2R7TA 2I8DA 3VYSB 3OR2C 1UG0A 2ZXHA 2F4IA 3DPUA 4XMYA 4D9JA 3GBGA 4N4NB 2ZFUA 2XDVA 3CZ6A 1WJAA 2KZVA 2V4JC 4DOZA 2XF6A 3IUOA 1D0YA 3A1YA 4Y33A 4CCJA 3AFHA 2HVSA 4ZDPA 2HPIA 4C30A 4NNJA 4BS9A 1MMDA 3DLAA 2X85A 1P9QC 2WAEA 4B3XA 2OV7A 3LL7A 2CV2A 2ZXIA 3M1CA 1DGWY 2WBMA 3W2VA 3CMMA 4QPOA 3OS2A 1E0EA 4BDYA 1LKXA 2XC7A 4XLCA 2A6TA 1TT0A 3CP8A 3TMOA 3L2RA 2VQCA 2R7OA 4H4KC 3OYFA 4XOTA 2R7SA 2CUZA 1UELB 3G2BA 2QKMB 4IQ4A 3QYEA 3HXLA 4BQQA 1Y56A 1D1AA 2X1EA 4CCKA 2HNHA 2LY1A 2CV0A 3K4CA 4B43A 3D5RC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ZC3 A;  2CMP A;  3ZQQ A; 
#chains in the Genus database with same CATH topology
 1KZH A;  1KU2 A;  1R1V A;  4ZDL A;  2VUM J;  1ERD A;  4FET A;  4KJZ A;  3L2W A;  4AD9 A;  1MBF A;  3W6K B;  4E7K A;  2VC1 A;  1HW5 A;  4P1W A;  4E6K G;  4E7L A;  1O7F A;  2VBX A;  2ZO4 A;  3WOD F;  4L9N A;  3RQI A;  3KLO A;  2OQR A;  1N75 A;  1D8K A;  4Y4R A;  1E3P A;  1JKR C;  2E1M B;  1S72 I;  3E5X A;  3HOW J;  2JJ7 A;  1X19 A;  2VQG A;  3I5U A;  1UG2 A;  2VBW A;  3QPH A;  1B72 B;  2R5Z B;  3C7J A;  3L2U A;  4Y7N J;  3CCM I;  1ZG1 A;  3F9K A;  4IHT A;  3GME A;  1WVR A;  2CJJ A;  2FNA A;  2PMZ N;  1D8J A;  3BRO A;  4PZJ A;  1V3F A;  1OKR A;  2BGC A;  4HST A;  3I56 I;  1KYW A;  2LVS A;  3T0Y A;  1FMV A;  2CQ7 A;  3C1D A;  1ZN2 A;  4OIR F;  3L2V A;  1U8R A;  1XGS A;  5HLG A;  4A3G J;  3V7R A;  2L02 A;  2RAE A;  4V2G A;  2BEO A;  4D5F A;  3TBI A;  2LG4 A;  1QPI A;  3GYH X;  1Z1D A;  4RMN A;  4BEH A;  4X6A J;  3HOU J;  4C2T A;  1ON1 A;  4A3E J;  2OTJ I;  2DCE A;  3H9G A;  3F0C A;  4KIC A;  1DU6 A;  2VIX A;  2DA6 A;  3AG3 H;  3ASO H;  1I6X A;  1Z77 A;  2VJ4 A;  2XF5 A;  2NNN A;  2L7M P;  1F36 A;  2P5L C;  1TWA J;  3BR2 A;  3M4O J;  4YEJ A;  3BG5 A;  2XSJ C;  1YHQ I;  1YRN B;  3IP4 B;  4Y15 A;  2DN0 A;  1ZAO A;  1W7P A;  4LG0 A;  4ABZ A;  4OOI A;  3H5A A;  1ZRC A;  2CGP A;  2NAZ A;  1XTA A;  2KFD A;  3WTS C;  1MH3 A;  2PMH A;  4DGW B;  1Q1V A;  5H2F C;  2V1U A;  2LFB A;  3QOE A;  4BNC A;  3IRR A;  4A0Z A;  3RJP A;  1EH8 A;  2VQH A;  1ZKG A;  1IN5 A;  3BJ6 A;  3DP7 A;  1IUF A;  2QSF X;  1AU7 A;  2R7R A;  1S9H A;  4ESB A;  3TKY A;  4KNY A;  4BXF A;  1BW6 A;  1MBE A;  2V1N A;  5C4J J;  2EFQ A;  4RDU A;  2W1O A;  1MBK A;  3KEY A;  4HX7 A;  1RUO A;  3E5Q A;  2LYC A;  5J4V A;  4BJT A;  1RUN A;  1SFK A;  2WB1 N;  3ZMD A;  1N77 A;  5DYM A;  2H27 A;  4CSW A;  1O7L A;  4RGS A;  3N05 A;  2OCE A;  4HQM A;  4YFK F;  4YIF A;  4NQW B;  1R00 A;  1ZAR A;  4DQ2 A;  1IW7 F;  1WI3 A;  2UUZ A;  3PO3 J;  5L3E A;  1MMA A;  2BOL A;  3I4P A;  3A01 A;  4AM3 A;  3GTP J;  2VT3 A;  3CP2 A;  2BVL A;  2AHQ A;  1J7K A;  4MLO A;  3FMR A;  1FSE A;  5FD5 A;  4YIR X;  4IRI A;  2XAJ A;  3JRC A;  2DK5 A;  4HW0 A;  4R1H A;  4B09 A;  1ACI A;  4RA2 A;  3U1D A;  5DV5 A;  3KIO A;  1A6Q A;  2VAS A;  5CVU A;  2XAG A;  1OFC X;  4DJA A;  4KIT B;  2VJJ A;  1S8N A;  2K9L A;  4WF2 A;  3G3Z A;  1HW1 A;  2R5Y A;  2ZME C;  4M72 A;  5IP6 A;  2BVM A;  5HNH A;  3E6D A;  3HBL A;  2Y75 A;  4PJN A;  2QEN A;  2NOG A;  4RAY A;  2MH2 A;  3U2R A;  2DA5 A;  2V26 A;  2GA2 A;  4UUV A;  3ZQC A;  3OYG A;  2K85 A;  3HOZ J;  4N4O B;  1Z67 A;  2E34 A;  4YRV A;  5BNG A;  1FOX A;  2FOK A;  1SD5 A;  2UV1 A;  3ASN H;  1LJ9 A;  2OA4 A;  2ZME B;  3MVP A;  4IXA A;  3V8K A;  2ZKZ A;  1IN6 A;  4BHB A;  5J40 A;  3J81 Z;  3OYK A;  3HZJ A;  2EQR A;  1QHG A;  2XVC A;  2VPR A;  1KQ9 A;  2AQF A;  3BZK A;  2GOX B;  3S1R J;  2HDC A;  1KGS A;  2VI6 A;  3HPG A;  5BPD A;  1G3S A;  1LFU P;  4JP0 A;  2R7Q A;  2OJE D;  5LFA A;  1D1B A;  4KN7 X;  2ECC A;  2O6G E;  4I7H A;  4KUM A;  1TT5 B;  3OYM A;  3QYF A;  2H8W A;  3RKW A;  1QA6 A;  1GXP A;  1NG7 A;  3EUH C;  2BE5 F;  5D6F A;  4B1R A;  5D8K B;  3PSI A;  3KP4 A;  1JKO C;  2F5C A;  3K4K A;  1BR4 A;  1AOY A;  2CRG A;  3W6V A;  2XAS A;  4D7M A;  3OYH A;  2H6C A;  2IT0 A;  3WTX C;  2CO5 A;  2FRH A;  4EV0 A;  1YJW I;  4II2 A;  5HS8 A;  2L3D A;  2F5V A;  3W2W A;  4X0G A;  1K4T A;  4XK4 A;  2CSO A;  2CWE A;  3TW7 A;  3LWF A;  3TDZ C;  1ON2 A;  2JUG A;  1OYI A;  3HOY J;  5CVV A;  3MZ8 A;  4HNV A;  2Y31 A;  3WGG A;  4IKF A;  4S0H B;  3CCR I;  1O4X A;  4IQJ A;  2EFP A;  4PK4 A;  4BEH B;  5BQT A;  1U5T A;  3SFI A;  2HDW A;  2K9Q A;  4YII A;  1TWG J;  4L9J A;  1W5S A;  2MD5 A;  3K4M A;  2O5R A;  1ZG5 A;  2E1M C;  4HZF A;  4OIO F;  4BE2 A;  5GPC A;  5C4X J;  3Q0V A;  3DLL F;  4A2U A;  2JN6 A;  1GV5 A;  3T8R A;  3E6M A;  3NWT A;  5FFZ A;  2R7V A;  3RPU D;  4HLX A;  4L5E A;  4CUG A;  5B5E C;  3LQQ A;  1K83 J;  1R58 A;  1E3H A;  3G71 I;  1E17 A;  1DGR M;  2W7N A;  1B72 A;  5KAI C;  1W1W E;  3K2A A;  4ZTF A;  1X4O A;  1JT6 A;  4UUS B;  4AIK A;  4CHU A;  4LIV A;  2JA5 J;  1BC8 C;  2CUJ A;  2KRC A;  4DNC A;  1A35 A;  2R4G A;  4NHJ A;  2BY1 A;  1MD0 A;  2XKO A;  2OQG A;  3JRE A;  3JR9 A;  1WJD A;  4U0W A;  3OYB A;  3GTK J;  2Z9O A;  1BJZ A;  1QHH D;  5IT9 K;  4HNU A;  1TQP A;  2DDA A;  2XHK A;  3CD6 I;  3GTM J;  1FP1 D;  4HG2 A;  3ZQF A;  2DMP A;  2EFO A;  3CCV I;  5B1A H;  5AIP A;  5E3O A;  2HQA A;  3WHB A;  4BXX J;  4YFX F;  5GAG J;  1HKT A;  4XKB A;  5TRD A;  3FM3 A;  3LFU A;  5HS7 A;  3B02 A;  4IX7 A;  4HLY A;  1YFH A;  4M74 A;  2VT2 A;  1TW2 A;  1X58 A;  1OYW A;  1VND A;  5LLQ A;  2MFZ A;  3GFJ A;  4C2U A;  2KIM A;  2KQR A;  2HYF A;  4HYE A;  2QYO A;  3M3Y J;  4HF1 A;  1NHA A;  2NS8 A;  3OWT A;  4G7Z F;  4OAY A;  2XGE A;  3KEQ A;  2HOS A;  3DKY A;  3JTG A;  4UY8 I;  4F52 A;  1MJ9 A;  4OMY A;  3L09 A;  2XF7 A;  4ZYD A;  1QNT A;  1X4P A;  2OF7 A;  3EDP A;  5F04 A;  4F7Z A;  2M4K A;  3M9A A;  2H6B A;  3TP0 A;  4Z2Y A;  1R71 A;  1VQ4 I;  1F5T A;  1D0X A;  4KT5 C;  3S32 A;  4PFP A;  4A3K J;  1SAU A;  1GXQ A;  3DCF A;  2A05 A;  2CS3 A;  4PJL A;  3TO6 A;  2ZJP F;  3G4S I;  3TO7 A;  4ASN A;  3FXU A;  3KET A;  3ZP5 A;  3HYI A;  3F8C A;  3E6B A;  1DU0 A;  2VL8 A;  3BY6 A;  2ME0 A;  4A3F J;  3IKT A;  2WB1 A;  2BHZ A;  5HLI A;  5FLX Z;  4A5M A;  3QPS A;  9ANT A;  3KFW X;  3GZ6 A;  4UVC A;  2WAQ N;  4XN3 A;  4AU7 A;  5IOZ A;  1B59 A;  2QSG X;  3M07 A;  1YIT I;  3H35 A;  4DZJ A;  4XLF A;  1CGP A;  5JI6 A;  5DD4 A;  3FBN B;  3K0L A;  3QP5 A;  3H92 A;  3CTA A;  4UHT A;  5J1U A;  5EGO A;  1AKH B;  5DTD A;  4HX4 A;  1M1E B;  2VJ5 A;  4XL9 A;  3HJE A;  1X1P A;  2ID3 A;  3CMA I;  3CCJ I;  1CF7 B;  4TV7 A;  2K9N A;  1F4K A;  3RKX A;  4C3J J;  4BGD A;  1OR7 C;  1KU9 A;  4ENK A;  1QVT A;  4G12 A;  1P2F A;  4M6Y A;  4L5I A;  4EJO A;  1TL8 A;  2E5N A;  3ZN1 A;  1X3Z B;  5C44 J;  1MH4 A;  2GZW A;  3ONQ A;  2QBY B;  5M5X J;  3CMY A;  1VQL I;  3HDD A;  2DXI A;  3MKL A;  4CXF A;  2XAQ A;  4GRI A;  3ZMT A;  1L0O C;  1FZP B;  4GYG A;  3SEZ A;  2L4M A;  2HWV A;  3WTV C;  2IA0 A;  2HDD A;  1IXR C;  3DEU A;  1SAN A;  1YS7 A;  4RBO A;  3GCM A;  4NBQ A;  1XX5 A;  2KJB A;  1T38 A;  2NVX J;  5E17 F;  4HPQ A;  1R1T A;  2O7O A;  3J7Z I;  4EM2 A;  3EYI A;  1PYV A;  3O8G A;  1MBG A;  2B9S A;  1SVM A;  2M8E A;  2P5V A;  2Z99 A;  3BLY A;  3R0A A;  3QOP A;  3HRT A;  2OBP A;  5E1X A;  2XPW A;  4P96 A;  1DPU A;  2F6C A;  1ZLJ A;  2ZXJ A;  4F55 A;  2DQR A;  5AIQ A;  4V2F A;  3OYD A;  2KHM A;  1YI2 I;  3GFL A;  5EEA A;  1BIA A;  4EMS A;  2I8D A;  3VYS B;  5LRR A;  3HSR A;  5D4R A;  1FOK A;  2DMN A;  2JWT A;  3DPU A;  3ROU A;  2EK5 A;  5ILV A;  2STW A;  1IRZ A;  2ZFU A;  3MZY A;  4L5J A;  3RPU A;  3M7G A;  1R7J A;  1I1S A;  2OCC H;  2OPT A;  1I27 A;  4KIF A;  4CCJ A;  5IT9 Z;  5E3N A;  2QBY A;  3ECO A;  2WAE A;  4QIW N;  3LL7 A;  1ETO A;  2VKV A;  4JX6 A;  6PAX A;  3MFK A;  4QPO A;  1P7I A;  4KDP A;  1K7A A;  2XC7 A;  2XKP A;  3CCL I;  2Y69 H;  2DU9 A;  1TT0 A;  3SXY A;  3CP8 A;  3TMO A;  5DEQ A;  3IL2 A;  2VQC A;  2DMQ A;  3L2R A;  3VOE A;  3BR1 A;  2R7S A;  1UEL B;  1UHW A;  3G2B A;  2QKM B;  1MMS A;  3P9K A;  2DMU A;  4AWX B;  3HUG A;  2DPD A;  2HI3 A;  1VTN C;  1A31 A;  3VPR A;  4M3G A;  5ILU A;  4CCK A;  3FXK A;  2AO9 A;  2CU7 A;  1BBY A;  2FD5 A;  4B43 A;  3D5R C;  4I98 B;  2CG4 A;  3L7W A;  4U0Y A;  2ZB9 A;  3CES A;  3ZMS A;  2DOA A;  3TW6 A;  1TZL A;  2M7B A;  1ETW A;  4U7D A;  3LMM A;  1U3E M;  5DS9 A;  3HKZ A;  4GDF A;  4M73 A;  2K5C A;  3NRV A;  1CF7 A;  2PI0 A;  2DI3 A;  5J8F A;  2ZSI B;  3A02 A;  1ODD A;  3BJO A;  4GGG A;  4HSR A;  2DAO A;  3MKZ A;  1WFX A;  2XGC A;  4LGW A;  5EGO B;  1AKH A;  1ZGA A;  4P9U A;  1POG A;  2ZJR F;  1R23 A;  4AID A;  2OC6 A;  4EJT A;  4GYI A;  3GW2 A;  1Y0U A;  1Y8Q B;  1QZZ A;  4RLQ A;  2A68 F;  2DW4 A;  1K78 B;  1XSX A;  3A4C A;  4GO1 A;  3VSL A;  1SVL A;  4GXO A;  1VF9 A;  3F8B A;  5KK1 A;  5LGN A;  1ETQ A;  3ZQH A;  1VQN I;  3BG7 A;  1RZ4 A;  3BCA A;  1HF0 A;  4PSW A;  3S17 J;  4EEF G;  1QGP A;  2Z1D A;  4MFE A;  4F92 B;  1BR2 A;  1WJF A;  2XV4 S;  3ABK H;  2PG4 A;  1APL C;  4I0A A;  2BW3 A;  2HZT A;  5CJ9 A;  2KP6 A;  5FO5 A;  1FTZ A;  2ELK A;  3BJA A;  4G7O F;  3ZMU A;  2RDP A;  5DM6 F;  3DU6 A;  3RTR A;  4WXD A;  4OIN F;  4E7I A;  2QLZ A;  1ZH5 A;  1LVA A;  2KDZ A;  1CQT A;  3BCB A;  2GAU A;  3CJQ B;  1ZR4 A;  1S6L A;  3R61 A;  5IT3 A;  3I3L A;  4RB1 A;  3AL0 C;  4U7B A;  1BI0 A;  2DA3 A;  4J19 A;  5C3E J;  1KON A;  3CF5 F;  1TQI A;  4JQF A;  4MTE A;  4UB8 C;  3SZT A;  2O8K A;  2MBF A;  3WU2 C;  2GBY A;  1T33 A;  2PQ8 A;  3VYU B;  3CCS I;  1Z6T A;  2X6W A;  1UMQ A;  1ZG3 A;  3I55 I;  2TDX A;  2Y9Y A;  4UVA A;  3FXR A;  5B66 C;  1WI9 A;  1FY7 A;  1EH7 A;  3EUA A;  2IS1 A;  1SMT A;  3B6C A;  2A61 A;  5BPI A;  1XCB A;  3TP3 A;  3BR5 A;  3F22 A;  4OU0 A;  2FE3 A;  4CCM A;  4BE0 A;  1OIS A;  3B6A A;  2MH9 A;  3SZG A;  3U21 A;  3HTU A;  4L0Z B;  2P7C B;  1XDS A;  3L1P A;  5LHG A;  4XBF A;  4BHC A;  2WV1 A;  5F0H A;  3Q9V A;  2Z33 A;  3Q0U A;  5F08 A;  3EET A;  2EIJ H;  2IPQ X;  3BTJ A;  4FX0 A;  1BW5 A;  3U1K A;  2CQK A;  1MNM C;  2NVQ J;  1U5T B;  3FIW A;  2DFF A;  1GLN A;  2BV6 A;  1FC3 A;  4WCG A;  1B8I A;  1JJ8 C;  1W0T A;  4O3M A;  3OIO A;  5F1J A;  2PJR A;  5JFR A;  1W36 C;  1SC7 A;  3BC8 A;  4UV9 A;  3G1O A;  1FYL A;  2ESH A;  3PL8 A;  1BL0 A;  2Q2E A;  4FT8 A;  4JYK A;  5J4Y A;  4AUX A;  4G7H F;  3BG6 A;  4B47 A;  2A69 F;  4KMF A;  3ULQ B;  2EPF A;  3G1L A;  3K1M A;  3C2G A;  2Q8K A;  1I3A A;  2NYX A;  3HGG A;  4PDK A;  3RQ4 A;  1LNW A;  5L3F A;  2M9H A;  3O2P E;  3OYN A;  1BIB A;  3OSG A;  1WH7 A;  1K78 A;  3FIS A;  3I0T A;  1ZK8 A;  2ELJ A;  5EF6 A;  3WE2 A;  2KDO A;  3TGN A;  1B9M A;  3FMQ A;  3DXJ F;  1PP7 U;  1LQ1 A;  1XMX A;  2JUC A;  2DLL A;  1R6R A;  2V9P A;  4BUP A;  1KQ8 A;  1JUP A;  2ADU A;  1G3W A;  3KZZ A;  5HOD A;  1XPX A;  3QYB A;  4PCQ A;  1R22 A;  4HQE A;  1BC7 C;  2XGX A;  4XR6 A;  1R49 A;  2VC0 A;  3SDG A;  3K69 A;  2FBK A;  1KU3 A;  3HOX J;  1Z3X A;  4IHW A;  3N4M A;  1TC3 C;  1LUJ B;  1MGT A;  2MGQ A;  4AYB A;  1XCV A;  2HXO A;  3HUG B;  1MMG A;  3F72 A;  2NVT J;  1SFE A;  2M45 A;  4A6E A;  3LA7 A;  4AVZ A;  2L9S A;  1Y8R B;  2ZXW H;  1P92 A;  3HL2 A;  3TL4 X;  3L2Q A;  4M6V A;  1RES A;  3Q3S A;  3K2Z A;  2FF4 A;  4RM3 A;  1ETY A;  2P4W A;  3WTU C;  3IKV A;  1LEB A;  2VXD A;  2HOT A;  5ICF A;  3IV5 A;  2JK3 A;  4OIP F;  1QZE A;  2E1N A;  1U5T C;  1B1B A;  1B6A A;  5E1W A;  4ZJZ A;  2LP0 A;  2G7U A;  2YR2 A;  3SEQ A;  3OYI A;  2K02 A;  1RIO H;  1ZEL A;  4YG2 F;  1JKQ C;  2OTL I;  2KRF A;  2Y30 A;  2MD0 A;  3UNG C;  2MA3 A;  2M8G X;  3KYL A;  2X51 A;  5FRN A;  2IA1 A;  5ILS A;  3A01 B;  4IHV A;  4XOP A;  3DU5 A;  4LD5 A;  3RIR A;  2NXN B;  1R5G A;  5FFX A;  5K7Z A;  3MN2 A;  2R5Y B;  5F0C A;  4JK1 X;  2VON A;  3DPT A;  1W7P D;  4UVB A;  3CJR B;  1LFB A;  3H9Q A;  1WHU A;  3LQR A;  4BXU A;  2K7L A;  2XB0 X;  1VI0 A;  3I71 A;  1TQM A;  4ZYA A;  1IXC A;  2HFH A;  3DEW A;  5CQG A;  3IH4 A;  4EJV A;  4HRI A;  3CJT B;  1KQ0 A;  2NNY A;  4IHY A;  4PGG A;  3J7Y J;  2V1D A;  2DFH A;  2WAD A;  1S7A A;  1Z05 A;  3G6E I;  1ULY A;  1FTT A;  1ONV A;  2L7Z A;  4CH7 A;  2YUS A;  3ZGK A;  2OD5 A;  2HPM A;  1IN7 A;  2K3P A;  5IP9 J;  2LH9 A;  3RDI A;  5FGM A;  1QRY A;  2LC2 A;  3M8F A;  2VBZ A;  2LMD A;  2LF7 A;  3P9I A;  3QP6 A;  3LAP A;  4CGZ A;  2R7W A;  4BBS J;  2JZY A;  2VJI A;  3K4J A;  3MAJ A;  1T0F C;  1E3O C;  1J0R A;  4EGY A;  2ZFW A;  3FX3 A;  1S3J A;  3DPL C;  1NK3 P;  2HQ5 A;  2EIN H;  4RGX A;  3P9C A;  5FJ8 J;  2DBB A;  2ZNY A;  3FM5 A;  2CFX A;  3DV8 A;  1R4N B;  2STT A;  1FOY A;  1OJL A;  2GLO A;  1T08 B;  1W7P B;  5DUK A;  2RKH A;  1UHS A;  4G8X A;  4IL6 C;  2I10 A;  1FMW A;  2HTJ A;  5J6X A;  4M9Z A;  5DM7 F;  1K4S A;  3H5R A;  1TNS A;  3FHN A;  2FBH A;  3IHU A;  3IWF A;  4HF2 A;  3GF2 A;  1Z6R A;  2LLK A;  3RYR A;  1YW9 A;  4W1U A;  3HPH A;  4IVN A;  4A3D J;  2EA2 A;  1X1C A;  1Z7U A;  2CYY A;  3ISP A;  4C3I J;  1NH3 A;  1XD7 A;  3GTG J;  2O03 A;  2CQQ A;  3LST A;  1RKT A;  3MKY B;  1JXS A;  4YFN F;  1DPR A;  2PFB A;  1V5E A;  1VQ9 I;  3OYL A;  3FWE A;  4XLH A;  5D5U B;  4NB5 A;  3ZQQ A;  3ABL H;  4U87 A;  3LA3 A;  4J00 A;  4DBQ A;  4XID A;  4FX4 A;  2P6S A;  1Z9C A;  4CYC B;  3BG3 A;  4CCO A;  2H1L A;  1TWF J;  2BZT A;  4Q48 A;  1WCM J;  2HVQ A;  3J7A Y;  1OQY A;  2KLO A;  4RAG A;  1S7E A;  1R36 A;  3VSK A;  3A0H C;  2Z2S B;  2CW7 A;  2PJP A;  1RI7 A;  5B1B H;  1K6Y A;  3NAR A;  2R5Z A;  2KMU A;  2L5Q A;  3LSG A;  3RZO J;  1X1D A;  2E36 A;  1LB2 A;  4AIJ A;  1RC9 A;  3HC7 A;  1J59 A;  2CUF A;  3DKW A;  3FXJ A;  2E7W A;  2AS5 F;  1UHM A;  4MEX F;  1F9N A;  4JOM A;  1O57 A;  5IYD J;  1G8X A;  3GZN B;  2DT5 A;  2LK2 A;  4C3H J;  5FRM A;  1ITY A;  3DWL E;  2EFW A;  2P0W A;  1BOB A;  3LNQ A;  2FSW A;  5DDG A;  3H9J A;  4LK1 F;  4UUT A;  2VXZ A;  3MMY B;  5CKT A;  2V9K A;  3JTH A;  2F48 A;  4AVP A;  4FAS D;  3PM1 A;  3JCU C;  2YX4 A;  2M5W A;  4HX8 A;  1REP C;  4HEA 2;  4M3F A;  1JHH A;  4BJ6 C;  1HKQ A;  1N25 A;  2BW3 B;  2BYV E;  5FKK A;  1AA7 A;  2DPU A;  2R7X A;  4IPA A;  5TJJ A;  4BY1 J;  2VKE A;  4HAM A;  2OU2 A;  4I0B A;  2DOE A;  2LRD A;  3S1N J;  2QM3 A;  1BM9 A;  3OIP A;  2CW0 F;  2DFE A;  1JGG A;  4NC7 A;  1WJE A;  3BR3 A;  3JRD A;  1FYM A;  3NWS A;  1BOA A;  3FZV A;  1GDT A;  3I58 A;  1IDY A;  2VKD A;  4WXH A;  5FKM A;  3K70 D;  2R7T A;  4A3M J;  1YJ9 I;  1I6H J;  4S05 A;  1EV7 A;  1QO0 D;  5FKL A;  4XMY A;  2KZG A;  1WJA A;  2V4J C;  5F6F A;  2ID6 A;  4DOZ A;  1D0Y A;  3IUO A;  3QU3 A;  3O8H A;  4ZDP A;  4QWQ A;  5LEK A;  4N9H A;  3JSP A;  1OCC H;  2C6Y A;  3F8N A;  4UV8 A;  2X85 A;  3CO7 C;  2EIL H;  1IRG A;  1ETX A;  1S29 A;  1RPW A;  4IJA A;  2A3S A;  1F43 A;  5M5Y J;  5EG0 B;  3RYP A;  3HEF A;  1E0E A;  2IVM A;  3CUQ A;  1SMY F;  1LKX A;  3RZD J;  1T0F A;  2L54 A;  2LNB A;  2EIM H;  2IRF G;  3MZH A;  2CUZ A;  2EV5 A;  3HIF A;  4IQ4 A;  3BPX A;  3GX4 X;  3HXL A;  3Q5F A;  1SFX A;  1Y56 A;  3FK6 A;  5JLW A;  1D3Y A;  3RI4 A;  3E97 A;  1A36 A;  3JRF A;  2HNH A;  1WSU A;  3K4C A;  2FA5 A;  4G6D A;  1JUS A;  1UCR A;  4FIS A;  4MO7 A;  5E79 C;  2NS0 A;  2W82 A;  4B8X A;  1P4A A;  3V7S A;  2LBF A;  3V42 A;  3CCQ I;  1UJ8 A;  4WX9 A;  2TCT A;  1HDP A;  4RAZ A;  1R5H A;  3LSP A;  2G9W A;  2M3A A;  4KIG A;  2O61 A;  3OYC A;  1WWX A;  2BBY A;  2Z3Y A;  2F5F A;  3VDX A;  2HQN A;  3DF8 A;  2L7K A;  3ZOB A;  3DTE A;  4MQ9 F;  2HKX A;  4LJZ F;  2CFO A;  3FK7 A;  4XSZ F;  2Q1Z B;  5FLX K;  3WG7 H;  3QWL A;  3K1P A;  2ZJQ F;  2I5U A;  1PVE A;  3R6S A;  5J47 A;  3KP6 A;  3PJR A;  5HDG A;  2DYR H;  4P55 A;  2OZU A;  1VQ7 I;  2Y9Z A;  2X1D A;  3CLO A;  4M6X A;  1J5Y A;  3PQJ A;  4A3B J;  4UXN A;  4DIQ A;  2IS6 A;  1R1U A;  2KRH A;  3WTZ A;  2MW8 A;  3ABT A;  5ERI A;  5GAD J;  2WA0 A;  2F4O B;  4LB6 B;  1WJB A;  2L9V A;  3MWM A;  2WY7 Q;  4CIC A;  3ZQI A;  3KYD B;  4D0P A;  5F0F A;  3HRS A;  3KZI C;  3S3M A;  2PX9 A;  3JRI A;  1V4R A;  1W5C C;  3HSF A;  3IRQ A;  1MBH A;  1EH6 A;  1YW8 A;  4OMZ A;  1XGN A;  5J3L A;  1RRJ A;  2V9V A;  1F1Z A;  1KU7 A;  4I2O A;  1VQ5 I;  1RET A;  1FLI A;  2P6T A;  3K7A J;  2DA2 A;  4BKX A;  4CZZ A;  3VWB A;  2MLG A;  4KN4 X;  4EJW A;  2JMW A;  1ETV A;  2X6Y A;  4II3 A;  3ZRG A;  2D1H A;  1ZRE A;  2XB5 A;  3LOC A;  2UWM A;  3S93 A;  3JRH A;  3IH2 A;  3FXO A;  2WTE A;  4CA0 A;  3O3K A;  2K4B A;  5JVG F;  5FKN A;  3HHH A;  2GOM A;  4A3J J;  4N0B A;  3GVA A;  4CDG A;  2WAF A;  3IWZ A;  2EWN A;  3WTT C;  3HRM A;  1YLF A;  4ITV A;  1X1B A;  2X1C A;  4EQQ A;  2L9R A;  2R93 J;  4LLN A;  1LDD A;  1MNE A;  3WE3 A;  5L3D A;  2JA7 J;  4PFO A;  4MFD A;  5EZH A;  2KL4 A;  3RSN A;  5LGT A;  1LE8 A;  5FLM J;  2E2H J;  2MC4 A;  2LY9 A;  3E5U A;  4ZYE A;  1K6O A;  2E2J J;  2JVG A;  5L3B A;  4LG0 B;  4HNT A;  2HOA A;  1YG2 A;  3FDY A;  2Q2E B;  2VN2 A;  2OAZ A;  3BG9 A;  1Z7L A;  2FUG 2;  4ESF A;  2R3S A;  4BQA A;  2QQB A;  2VBY A;  2GQQ A;  4CCL A;  3FKI J;  5HDK A;  5J1R A;  4BU2 A;  3HOS A;  2F2E A;  2B0L A;  4ENN A;  1ENH A;  4FHT A;  4LLG F;  4V19 K;  2JRM A;  2GA1 A;  2IAI A;  2H09 A;  3AG2 H;  3F6O A;  2GXA A;  1IV6 A;  1O3R A;  4ZH4 F;  1SEU A;  1YQA A;  1BA5 A;  1KYZ A;  2WV0 A;  2JTV A;  3E1S A;  3E6C C;  1HSJ A;  4XRS A;  2VE9 A;  1YW7 A;  3S3O A;  5A2Q K;  2Q0O A;  3CC4 I;  3DKX A;  2QA4 I;  1W5T A;  3J7A O;  5CVJ A;  5E20 A;  4A69 C;  2E2I J;  2PN6 A;  3K4B A;  1YIO A;  3MD2 A;  3JRA A;  2LSO A;  2QF7 A;  2VB6 A;  4A3I J;  2L7F P;  2D1V A;  2M0C A;  2PJR B;  5LD2 C;  2GXB A;  3BZ6 A;  3FBI B;  1MW7 A;  1B8I B;  1IF1 A;  1Y6I A;  3V4G A;  2HU9 A;  1DP7 P;  5H6R A;  1TNT A;  2EB7 A;  2WWY A;  3BT9 A;  3L2C A;  1B9N A;  4ZZD A;  1W0U A;  4HDV A;  2RQQ A;  3O6B B;  2BHY A;  2LY2 A;  2RNJ A;  1QU3 A;  2YS9 A;  2M30 A;  1TTY A;  2HQR A;  2QZ8 A;  2YSR A;  1JTX A;  2ZJ2 A;  3HRU A;  3K4N A;  2ICW G;  4BBR J;  3N97 A;  3D1N I;  4DYQ A;  4PJJ A;  4ENJ A;  3VFZ A;  3JRB A;  2Z16 A;  3ZMV A;  1U6G A;  1LDJ A;  3OYJ A;  3PO2 J;  4XLA A;  2UXN A;  4H0E A;  2VE8 A;  1SD7 A;  2J5P A;  2M0M A;  1V5G A;  2PMZ A;  1T39 A;  2XGD A;  4UUS A;  1G3Y A;  1T95 A;  2IA2 A;  1P6R A;  2XRL A;  1V54 H;  3KZY A;  1G59 A;  4BE1 A;  2CQN A;  3H1C A;  2FXA A;  2R7U A;  4E7H A;  5ICE A;  4LFU A;  5CYV A;  4LK0 F;  2KT0 A;  1VQ6 I;  3HOT A;  3FXL A;  2W48 A;  3SFZ A;  4ENM A;  2BY3 A;  2KKO A;  2IXS A;  4G94 A;  3CME I;  2KIU A;  4F3Q A;  1XC5 A;  5F1R A;  5ED4 A;  2VPL A;  2L9N A;  3OS1 A;  3VEP A;  4NC8 A;  2TRT A;  2NRA C;  4I76 A;  2DDB A;  5ICC A;  2HOE A;  3ZN0 A;  3HM5 A;  3HG9 A;  1HLV A;  3I54 A;  4CO8 A;  2KIQ A;  4IHS A;  5FB2 A;  4S04 A;  3CCY A;  1SAX A;  3JAM K;  1GT0 C;  3MCZ A;  1W36 D;  3MQ0 A;  4RS8 A;  1YO5 C;  2WAQ A;  4QLC U;  1IUY A;  1DP3 A;  2LKS A;  1YIJ I;  1T6S A;  2AXT C;  3HB9 A;  3I4M J;  2RN7 A;  3EUK L;  5JLX A;  5F27 A;  1GV2 A;  2Y48 A;  4RGU A;  4XON A;  5HS9 A;  4XIC A;  1QVU A;  3A2K A;  3ERM A;  2EZH A;  4EAT A;  1VQK I;  1WJC A;  2F5E A;  1OCO H;  2E5Z A;  1YE9 A;  1P4X A;  4FE7 A;  1V5F A;  2L0K A;  3K6G A;  2ZSH B;  1X2N A;  3F8F A;  1IJW C;  3BR6 A;  5J1Y A;  1XG1 A;  2DA1 A;  3FXQ A;  2QEX I;  5M3F J;  3SJM A;  3CDI A;  2LD5 A;  1GUU A;  3ESW B;  5D5X B;  2IGN A;  3FHZ A;  4EVI A;  1FPQ A;  2KIF A;  2H1K A;  1LPQ A;  1VZ0 A;  2R7F A;  2YPR A;  2WC2 A;  4XSX F;  3DFG A;  3RPQ A;  3ERE D;  2COB A;  3DBR B;  3PUB A;  2KPM A;  3DTI A;  4KT6 A;  3H0D A;  2F5D A;  2XIG A;  2NOJ B;  4BL0 B;  4IF4 A;  4EJU A;  3UKG A;  3CUQ B;  1GVJ A;  1H8A C;  3LSJ A;  4ANJ A;  3H3U A;  4XQF A;  3E0J B;  4XRM A;  4G6T B;  3U9G A;  2RC4 A;  3WGH A;  3LAJ A;  3I4N J;  3NEU A;  3Q9S A;  3MKW B;  1U8B A;  1HC8 A;  5EEG A;  5E3L A;  1FIA A;  3OSF A;  1VQ8 I;  3OIQ A;  2Y0M A;  4QSH A;  5A2Q Z;  3WTY C;  3GLX A;  3V8L A;  4EM0 B;  1IGN A;  5FRO A;  3S2H J;  1XDU A;  3QPL A;  3F21 A;  2QQ9 A;  3D5L A;  3HKZ N;  5DCF A;  2IJL A;  4UB6 C;  1RR7 A;  4E70 A;  2E60 A;  1TWH J;  2V7F A;  4M9X A;  4F91 B;  5DCM A;  2X6O A;  1Y0N A;  3DQV C;  2HVR A;  1YS6 A;  1XB4 A;  3CQZ J;  1VQO I;  4FTH A;  2L2O A;  1TP4 A;  4MGR A;  3ZR8 X;  3GTJ J;  3R60 A;  1U0J A;  2JVH A;  3C2B A;  2R0Q C;  2DFI A;  2XAU A;  4KMU X;  4RB2 C;  5HVQ C;  1P4W A;  2HEO A;  4XKC A;  2VOP A;  3OL4 A;  3ZXS A;  5JR3 A;  3B73 A;  3EPZ A;  3M8E A;  1VQM I;  3QU6 A;  1FOW A;  1D5V A;  5IYB J;  5HNF A;  2NVU B;  3GTQ J;  1J9I A;  4E7S A;  2XPU A;  4I02 A;  3LSR A;  4RM2 A;  2ZBK A;  2DT7 B;  3L00 A;  1D5Y A;  3S1M J;  1MZB A;  3F6V A;  5GTH C;  4A93 J;  2OUM A;  4XKV A;  1C0W A;  3L9F A;  3NAU A;  1OPC A;  4MNU A;  5KAF C;  1U9O A;  3KPH A;  1I39 A;  1MSE C;  1JTY A;  3AKZ A;  1Z21 A;  3CCE I;  1V55 H;  4BAC A;  1Y1W J;  1ZRF A;  2R7Z J;  4DYC A;  2ECB A;  2NS7 A;  3VYT B;  3FF5 A;  2LTP A;  5ICG A;  1OLT A;  2EBI A;  2ACJ A;  1MJA A;  1HST A;  1YRN A;  3LFK A;  4WWC A;  3KP3 A;  1N78 A;  5GAH J;  3BTC A;  1TBX A;  2DA7 A;  4LIT A;  3GEZ A;  3CC2 I;  2HYG D;  3GUD A;  3OMY A;  1UFM A;  2AXL A;  5CQE A;  2XSD C;  3H5N A;  4ETS A;  4JX4 A;  3X2Q H;  2HTS A;  5K7F A;  2L01 A;  5B3S H;  2O8X A;  5FKO A;  1EJ9 A;  3C18 A;  4JX5 A;  3HTS B;  2CH0 A;  5KCM A;  2BY0 A;  3PNY A;  3C3W A;  4M3E A;  3CLQ A;  2M1B A;  3IAS 2;  4Y52 J;  3OYE A;  2ETH A;  4HF0 A;  3H3Z A;  4DBR A;  5KNL A;  4FCY A;  5KHD A;  1JJ6 C;  1J75 A;  2G7H A;  4RB0 A;  1JE8 A;  2JRT A;  4DZP A;  1JHF A;  1OCR H;  4KIB A;  4NDL A;  1Z0X A;  5K7H A;  4BY7 J;  4BDZ A;  3BTL A;  3JW4 A;  2IS4 A;  2Y2Z A;  1PUF A;  2K4J A;  4A3L J;  2GIZ A;  4M3B A;  4AC0 A;  3F23 A;  3OR2 C;  1UG0 A;  1T98 A;  2DQL A;  4Y13 A;  1MDM B;  4D9J A;  1XSV A;  2XDV A;  3CZ6 A;  5M3M J;  4RB3 C;  2KZV A;  3ML6 A;  1XMA A;  4G6Q A;  1AWC A;  2XF6 A;  3FXM A;  2DTZ A;  4X1E A;  4Y33 A;  1PUF B;  4IEJ A;  2E7X A;  1VQP I;  4C30 A;  2PLY A;  2XAF A;  2EZK A;  3I64 A;  4NNJ A;  4BS9 A;  1A6I A;  1P9Q C;  5M5W J;  2CUE A;  3A03 A;  5KVR A;  1OR7 A;  2IP2 A;  4I01 A;  3OS2 A;  3S1Q J;  2DOD A;  4A6D A;  4MIM A;  4MQV A;  2COM A;  3DBL B;  4XLC A;  1I1G A;  5D5W B;  4EM1 A;  1A04 A;  3GZ5 A;  3S2W A;  4P9F A;  2R7O A;  1DUX C;  3EYY A;  3OYF A;  2BY2 A;  1H9T A;  2W24 A;  5BOX A;  3AG1 H;  2IW5 A;  2D2W A;  2HR3 A;  1BN5 A;  2E35 A;  4A0X A;  5K1Y A;  1EF4 A;  1X3U A;  1YYV A;  2XAH A;  1DQU A;  2DTR A;  1TWC J;  3T5X A;  4MHG A;  1X3W B;  5K5R A;  3CC7 I;  2EV0 A;  4I6Z A;  4D1Q A;  1XSD A;  1KA8 A;  1MIJ A;  2IGM A;  1MSF C;  1D0Z A;  4BHP A;  1LDK B;  3KX2 A;  4IOC F;  4B48 A;  5GTI C;  4AIH A;  4CCN A;  2FX0 A;  5H6Q A;  2QGU A;  3H0G J;  4CYC A;  4IRH A;  5E8G A;  1UAA A;  2QVO A;  2EV6 A;  3AL0 B;  5D4S A;  3ABU A;  2X6X A;  3UR3 C;  2HS5 A;  1MBJ A;  2LDU A;  1O3S A;  4PUS A;  4XOR A;  2FQ4 A;  2P7V B;  3PUF A;  2F4M B;  2J5O A;  4Z6Y A;  1WZ2 A;  2JSP A;  5J8C A;  1H88 C;  4D5C A;  2RQP A;  2ESN A;  4Q47 A;  1WPK A;  2PEX A;  5EEH A;  4XN0 A;  2ZC2 A;  4B44 A;  4A12 A;  4Y17 A;  2JSC A;  1IG7 A;  2JA6 J;  4YEL A;  5LHH A;  1ZGW A;  3KEO A;  4K2E A;  3DEE A;  1YX5 A;  3ZQ7 A;  3ELK A;  2W00 A;  5DCM B;  2FJ1 A;  2HZD A;  5GP9 A;  5FLV A;  2RNG A;  2ZNZ A;  1UB9 A;  1WH5 A;  1MND A;  1BI1 A;  2V6E A;  1HXD A;  3FKJ A;  3K70 C;  1OYY A;  1I50 J;  1EA3 A;  1FP2 A;  5D6E A;  4RGR A;  2LKX A;  4LB5 A;  3QPT A;  1OMI A;  4XLN F;  1J2X A;  2LRE A;  2ZCW A;  4KIS A;  4FE4 A;  3G1M A;  2HXI A;  2QKL B;  2KIS A;  4MTD A;  3TED A;  2R92 J;  5HOO A;  1X1A A;  1IRX A;  1ETK A;  4NUB A;  5HLT A;  1MKM A;  3D0S A;  1O3Q A;  3ZQL A;  2EJR A;  2P5K A;  2YX7 A;  5EZG A;  4A5N A;  2QSH X;  3SZP A;  2E1C A;  2VLA A;  4DW6 A;  1HDD C;  3JSO A;  1NTC A;  1OCP A;  4CYD A;  5AON A;  2W57 A;  3EQL F;  2FBI A;  1FBU A;  2RRE A;  1OCT C;  3CO6 C;  1K61 A;  3AG4 H;  3VOD A;  2Y0S N;  3FMS A;  1ZRD A;  4ZDO A;  2B7E A;  1BR1 A;  3PIO F;  4QTR A;  2DJI A;  3S16 J;  3AAF A;  5LEJ A;  3WGI A;  5JHF A;  2R7D A;  3RKY A;  4L9T A;  4M9S A;  4BH9 A;  4AYB N;  2JQ7 A;  1RKW A;  1XN7 A;  5E8I A;  2JA2 A;  2QQ8 A;  3J80 Z;  3BPV A;  4N9I A;  2MAB A;  2RVC A;  4F93 B;  3K1N A;  1W4M A;  2M7A A;  4P5O A;  4E4H A;  1AHD P;  1FWZ A;  4GFB A;  5D8L B;  3IH3 A;  2GWR A;  3VB2 A;  2ZME A;  1RR8 C;  2A5W A;  1IC8 A;  4I09 A;  2X48 A;  3BWG A;  4O5V A;  3BQY A;  1EKE A;  4B4C A;  4HDU A;  5JVT A;  5E1Z B;  3PSF A;  5DD8 A;  1PP8 F;  3P7N A;  3PNT A;  5E3M A;  4ESJ A;  1NK2 P;  3H36 A;  5E18 F;  1OCZ H;  1XGM A;  2FOW A;  4KA4 A;  4NQW A;  2DYS H;  1O3T A;  3LSM A;  4LG3 A;  4WK8 F;  1Z3Y A;  2WY8 Q;  3M8J A;  2X9D A;  1ZLK A;  4UNO A;  1WKM A;  3KP2 A;  3ECH A;  3OL3 A;  4HV6 A;  4XRF A;  4PJ0 C;  1WRJ A;  1UZC A;  3W2A A;  4E7J A;  2YU9 J;  2LR8 A;  1XGO A;  3SYT A;  2VQL A;  3V7C A;  1G4D A;  1HA8 A;  2HKO A;  2PBI A;  4CZC A;  5HLH A;  3QAH A;  1BI2 A;  4J01 A;  4IO9 F;  4IRG A;  1FBQ A;  5TIS C;  1SVO A;  4A0Y A;  1FJL A;  3ABM H;  2MG4 A;  3KYC B;  1QZY A;  4M3D A;  2XUB A;  4Y3O A;  1HW2 A;  1HQC A;  2M34 A;  3M1E A;  5IOY A;  3PQK A;  4XKW A;  4QPQ A;  2GIV A;  3R0J A;  1ZYR F;  3TDU C;  3TQN A;  4Q4Z F;  5K5Q A;  3CCU I;  5D5V B;  1T56 A;  3GWZ A;  2VOO A;  2LKP A;  1HOM A;  1BI3 A;  3TOA A;  2M4G A;  2DK8 A;  5LGU A;  3C2H A;  3NQO A;  4HOB A;  3QOD A;  2RGV A;  3CDL A;  3OR1 C;  3ZMZ A;  4B3A A;  2VOD A;  2ELH A;  1ZHF A;  4DYR A;  2M2E A;  5IPA A;  2O0Y A;  1TLH B;  5BS6 A;  3S8P A;  4L9V A;  2A6H F;  3K4L A;  2DO7 A;  3CDH A;  3H3V K;  1IAW A;  2YU3 A;  1I3Q J;  2GM4 A;  3DBH B;  3F8M A;  4R8H A;  4XNF A;  4PGH A;  3PIP F;  3PFI A;  1MDM A;  3OY9 A;  3BR0 A;  4XM3 A;  4L18 B;  4EGZ A;  2JA8 J;  1JGS A;  4U0V A;  2W85 A;  5JHU A;  3SHF A;  4NC6 A;  1J09 A;  3OS0 A;  5IP7 J;  2RV8 A;  5L3G A;  2QUF A;  4RAF A;  2EIK H;  1LVK A;  1LE8 B;  3GO5 A;  2PMU A;  3MEX A;  1H9G A;  1U2W A;  1IO2 A;  3ZPL A;  1UST A;  2CMP A;  2ISY A;  5LHI A;  1U9N A;  2IGO A;  2H94 A;  2EA4 A;  2H8R A;  3T1B A;  3KCC A;  4D7N A;  1A5J A;  3GTO J;  1Q1H A;  4IOA F;  1BJA A;  5GPA A;  4RLF A;  4Q5S F;  2K9S A;  3HHG A;  5LRS A;  5CPR B;  2DT6 A;  4OAZ A;  2D45 A;  4I99 C;  1K79 A;  3WG9 A;  5TGT A;  4C9Y A;  4BAY A;  1L3L A;  3LSI A;  3HSE A;  1G3T A;  1YX3 A;  1PDN C;  1Y39 A;  2W84 A;  4PSX A;  3S14 J;  4JBA A;  1D1C A;  1JUM A;  2FU4 A;  2W25 A;  3K10 A;  3HGY A;  4LLL A;  1NG6 A;  2XPV A;  3COA C;  1PUE E;  3VYR B;  3ZCO A;  2OZ6 A;  3KP7 A;  4ZC3 A;  4L0Y B;  1ZGJ A;  2DOF A;  1IN8 A;  2ISZ A;  2IBD A;  3J80 K;  2D5V A;  2JPB A;  1FEX A;  4HV5 A;  3S15 J;  2LOO A;  4KYW A;  4E7Z A;  2EH3 A;  1Y1V J;  2XRO A;  1WJ5 A;  2E71 A;  1YTY A;  1SFO J;  1G6N A;  3SQN A;  4O6J A;  2IEK A;  4BJ5 C;  3GFM A;  3S3N A;  2V6C A;  1E2X A;  2Z5U A;  1HBX G;  1T2K A;  4BYY A;  4A3C J;  1MJB A;  3I59 A;  1LFP A;  3KLN A;  4XLP F;  1XS9 A;  2M87 A;  3E7L A;  4OIQ F;  2QQA A;  1PJR A;  2FNP A;  3BTI A;  2ME6 A;  3DTK A;  1IN4 A;  2K40 A;  3T8T A;  1JI8 A;  3WHC A;  2Y0S A;  3E3V A;  5CLS A;  2HYJ A;  4ZZL A;  4R79 A;  1IZ1 A;  3OYA A;  4C2M J;  1S5L C;  2P8T A;  2O3F A;  2L4A A;  4WXC A;  3W6J B;  5IYC J;  1R9T J;  4LOC A;  3GXO A;  5LBQ A;  2IS2 A;  2N8G A;  3CJN A;  2IGK A;  2K9M A;  1STZ A;  5L3C A;  1YJN I;  2FEZ A;  4HBL A;  4M71 A;  5F64 A;  2UZK A;  3JRG A;  1SD6 A;  2EFN A;  2B63 J;  2QWW A;  3QQA A;  3P5J A;  3S2D J;  2E1O A;  4GCV A;  1FBS A;  3GLL A;  1FNN A;  1YOV B;  3WU1 B;  2MYS A;  1I5Z A;  3GFI A;  1IV8 A;  1ZR2 A;  5HDN A;  2A5Y B;  2VKH A;  2FQ3 A;  1SD4 A;  2V1X A;  3F3X A;  3LSH A;  5EDN A;  4IZZ A;  1S7O A;  1JT0 A;  1HCR A;  1QPM A;  4XLE A;  1R4M B;  3PNV A;  2JT1 A;  3D5S C;  2LF8 A;  4FQG A;  3RCO A;  1R5I D;  1GVD A;  3HOV J;  5CVI A;  1B4A A;  2E19 A;  1FX7 A;  1XMK A;  4LIU A;  2AQE A;  1DDN A;  1LEA A;  3CF2 A;  3IC7 A;  1FSH A;  3CUQ C;  1P7J A;  2MSY A;  3SDB A;  2W4S A;  2LBF B;  4LMY A;  3W3C A;  3TOB A;  1ZTR A;  2DJN A;  2K86 A;  4W97 A;  2CV1 A;  3I9V 2;  3RKQ A;  3V8J A;  3OOU A;  3BOQ A;  3OOP A;  5GAE J;  2CW8 A;  4OWR B;  3WU0 A;  3WTW C;  1G2H A;  1U78 A;  1IDZ A;  2BXY A;  2A07 F;  2A6E F;  1MMN A;  3IAM 2;  4ON0 A;  1FYK A;  4BQN A;  3G73 A;  1IXS B;  4ZTJ A;  3BP8 A;  1FT9 A;  4PJM A;  2DMT A;  1GHC A;  3REO A;  2X4H A;  4ZYH A;  5FD6 A;  5EG0 A;  1Z91 A;  3KE2 A;  2HGC A;  2EZI A;  4BQO A;  3JAM Z;  5EJC A;  3PFY A;  2XRN A;  1ORK A;  2MC3 A;  2FML A;  2V79 A;  3ZQG A;  3A0B C;  2MLK A;  5EYR A;  3LSK A;  1H0M A;  3TO9 A;  1TW3 A;  2P81 A;  2UXX A;  2F4I A;  2ZXH A;  3I53 A;  1WGX A;  3GBG A;  4N4N B;  3I59 B;  3LA2 A;  4IHX A;  2KJC A;  4U88 A;  3BDD A;  2FMY A;  3A1Y A;  4MEY F;  2HVS A;  3AFH A;  1VFC A;  2DA4 A;  1X2M A;  2HPI A;  3K9T A;  1MMD A;  1QBJ A;  1QQI A;  2EZL A;  3DLA A;  1ZQ3 P;  4B3X A;  2OV7 A;  2CV2 A;  5DUI A;  2ZXI A;  5H20 A;  1IRF A;  3M1C A;  2QCO A;  3OV8 A;  5IY5 H;  1DGW Y;  2WBM A;  1USS A;  1RNL A;  3BQZ A;  3CMM A;  2K3F A;  2BXZ A;  2NVY J;  3Q0W A;  4G9Y A;  3W2V A;  3QRF F;  4BDY A;  1HKS A;  1H89 C;  4ZYG A;  4KFC A;  2O9L A;  2A6T A;  1T8I A;  2CQX A;  4H4K C;  4XOT A;  5BMZ A;  4XRS G;  3EUH A;  3KP5 A;  2K27 A;  3QYE A;  4BQQ A;  2G0E A;  1D1A A;  1JKP C;  3GTL J;  2X1E A;  1WQ2 A;  2X0L A;  1SFU A;  2JPC A;  1FIP A;  2GXG A;  3BZC A;  2LY1 A;  4HA8 A;  2CV0 A;  3CUO A;  5CVR A;  3J81 K;  5K5O A;  3R4K A; 
#chains in the Genus database with same CATH homology
 4ZDL A;  2W82 A;  1ERD A;  3CES A;  4FET A;  2DOA A;  2LBF A;  1TZL A;  2M7B A;  4KJZ A;  3L2W A;  3LMM A;  1DQU A;  4E7K A;  3V42 A;  3HKZ A;  4P1W A;  2K5C A;  4E6K G;  4E7L A;  4D1Q A;  2M3A A;  2IGM A;  2ZSI B;  3OYC A;  1D0Z A;  4HSR A;  1N75 A;  3VDX A;  1LDK B;  1WFX A;  3KX2 A;  2L7K A;  3MKZ A;  4Y4R A;  4B48 A;  4CCN A;  3DTE A;  2E1M B;  1X19 A;  2VQG A;  2OC6 A;  1UAA A;  3L2U A;  2CFO A;  3AL0 B;  3F9K A;  2Q1Z B;  4RLQ A;  2X6X A;  3UR3 C;  3A4C A;  4PUS A;  3VSL A;  3PJR A;  4XOR A;  3BG7 A;  3BCA A;  2X1D A;  4HST A;  4PSW A;  2JSP A;  2Z1D A;  1FMV A;  4DIQ A;  3L2V A;  2IS6 A;  4F92 B;  4XN0 A;  2KRH A;  4B44 A;  1WJF A;  1BR2 A;  2WA0 A;  1WJB A;  4YEL A;  2BW3 A;  2WY7 Q;  3TBI A;  2LG4 A;  3DEE A;  1YX5 A;  4RMN A;  2KP6 A;  4BEH A;  2W00 A;  2HZD A;  4C2T A;  2RNG A;  2DCE A;  3H9G A;  1MND A;  2VIX A;  3S3M A;  3DU6 A;  2V6E A;  2VJ4 A;  3FKJ A;  2XF5 A;  3RTR A;  3K70 C;  1EA3 A;  4E7I A;  3BCB A;  4YEJ A;  2XSJ C;  2LRE A;  3IP4 B;  4KIS A;  3CJQ B;  2QKL B;  3VWB A;  3H5A A;  3I3L A;  5HOO A;  3AL0 C;  4U7B A;  1X1A A;  1IRX A;  2X6Y A;  4II3 A;  4NUB A;  5HLT A;  3ZRG A;  1KON A;  4DGW B;  4JQF A;  2UWM A;  3QOE A;  3S93 A;  2VQH A;  4CA0 A;  3VYU B;  2R7R A;  1S9H A;  2GOM A;  4BXF A;  2X6W A;  2VLA A;  2V1N A;  2W1O A;  3KEY A;  2LYC A;  4BJT A;  2WAF A;  1SFK A;  1N77 A;  4ITV A;  4CSW A;  1X1B A;  2X1C A;  3N05 A;  2RRE A;  1MNE A;  3EUA A;  2IS1 A;  4NQW B;  4PFO A;  2KL4 A;  3RSN A;  2UUZ A;  4ZDO A;  2MC4 A;  1MMA A;  2BOL A;  4CCM A;  1BR1 A;  4BE0 A;  2DJI A;  2JVG A;  3SZG A;  3U21 A;  3CP2 A;  2BVL A;  4HNT A;  5JHF A;  4MLO A;  3FDY A;  2Q2E B;  2JA2 A;  1Z7L A;  2FUG 2;  2MAB A;  4CCL A;  4F93 B;  3HOS A;  4BU2 A;  2M7A A;  2VAS A;  4P5O A;  4E4H A;  1GLN A;  4DJA A;  4KIT B;  2VJJ A;  2K9L A;  2A5W A;  2PJR A;  1W36 C;  3BC8 A;  3E1S A;  3PL8 A;  3S3O A;  2BVM A;  3BG6 A;  4B47 A;  5HNH A;  3DKX A;  3PSF A;  4PJN A;  3PNT A;  3C2G A;  2V26 A;  3K4B A;  3RQ4 A;  3OYN A;  3MD2 A;  3OYG A;  2VB6 A;  2ELJ A;  4N4O B;  2KDO A;  3LSM A;  4LG3 A;  4YRV A;  1Z3Y A;  5LD2 C;  2WY8 Q;  3M8J A;  2PJR B;  2UV1 A;  3FBI B;  1MW7 A;  3OYK A;  1Y6I A;  2HU9 A;  3OL3 A;  1QHG A;  1R6R A;  4BUP A;  3W2A A;  4E7J A;  2AQF A;  3SYT A;  2GOX B;  2VQL A;  2RQQ A;  1QU3 A;  2LY2 A;  3HPG A;  1HA8 A;  3QYB A;  4CZC A;  2R7Q A;  5LFA A;  1D1B A;  4XR6 A;  4J01 A;  3K4N A;  3OYM A;  3QYF A;  1Z3X A;  1NG7 A;  3EUH C;  4PJJ A;  4AYB A;  3PSI A;  3K4K A;  3HUG B;  2Z16 A;  1BR4 A;  1MMG A;  4Y3O A;  3OYJ A;  4XLA A;  3OYH A;  2M0M A;  4AVZ A;  1V5G A;  2PMZ A;  4XKW A;  2L9S A;  4II2 A;  4QPQ A;  1T95 A;  2F5V A;  3W2W A;  3HL2 A;  3TL4 X;  4X0G A;  3L2Q A;  1G59 A;  2M4G A;  2JUG A;  4RM3 A;  4BE1 A;  3C2H A;  3QOD A;  2VXD A;  3OR1 C;  2R7U A;  4IKF A;  4E7H A;  4IQJ A;  4ZJZ A;  4PK4 A;  3S8P A;  4BEH B;  3HOT A;  3SEQ A;  3OYI A;  3K4L A;  2HDW A;  1ZEL A;  2IXS A;  4F3Q A;  2MD0 A;  3K4M A;  2O5R A;  4XNF A;  2VPL A;  2E1M C;  2L9N A;  3UNG C;  3OS1 A;  4BE2 A;  3OY9 A;  4XM3 A;  4NC8 A;  3KYL A;  1J09 A;  3OS0 A;  2X51 A;  5FRN A;  3NWT A;  2R7V A;  1LVK A;  4XOP A;  3DU5 A;  3RPU D;  3HG9 A;  4CUG A;  1DGR M;  2CMP A;  3DPT A;  2W7N A;  3CJR B;  2IGO A;  4ZTF A;  1X4O A;  3H9Q A;  1W36 D;  2WAQ A;  4RLF A;  1DP3 A;  4LIV A;  5CPR B;  2DT6 A;  4OAZ A;  4ZYA A;  3EUK L;  2CUJ A;  2KRC A;  5CQG A;  5TGT A;  4HRI A;  4C9Y A;  4XON A;  2R4G A;  3LSI A;  2WAD A;  3A2K A;  4EAT A;  1YX3 A;  1WJC A;  1WJD A;  4PSX A;  3OYB A;  2E5Z A;  1YE9 A;  1V5F A;  1QHH D;  3K6G A;  4CH7 A;  1D1C A;  4HNU A;  2ZSH B;  3K10 A;  3ZGK A;  2HPM A;  1NG6 A;  4HG2 A;  2K3P A;  3VYR B;  3ZCO A;  4ZC3 A;  2LH9 A;  2LC2 A;  2IGN A;  2R7W A;  2HQA A;  2VJI A;  3K4J A;  1VZ0 A;  1T0F C;  2LOO A;  3PUB A;  4KT6 A;  4XKB A;  2KPM A;  3DTI A;  4E7Z A;  3H0D A;  3DPL C;  2NOJ B;  3LFU A;  1WJ5 A;  4BL0 B;  4IX7 A;  4BJ5 C;  3S3N A;  4ANJ A;  4XQF A;  3E0J B;  4G6T B;  2MFZ A;  4C2U A;  2KQR A;  1LFP A;  3MKW B;  3OWT A;  1PJR A;  3OIQ A;  4OAY A;  3DTK A;  5FRO A;  1FMW A;  3DKY A;  4F52 A;  1JI8 A;  3H5R A;  3FHN A;  2XF7 A;  2Y0S A;  1X4P A;  3OYA A;  4R79 A;  3D5L A;  2M4K A;  2E60 A;  3HPH A;  1D0X A;  2V7F A;  4F91 B;  1X1C A;  2IS2 A;  3S32 A;  4PFP A;  2IGK A;  1SAU A;  2K9M A;  3DQV C;  4PJL A;  3MKY B;  2CS3 A;  2HVR A;  1V5E A;  3OYL A;  4XLH A;  2L2O A;  2VL8 A;  4U87 A;  3ZQQ A;  2WB1 A;  4J00 A;  3ZR8 X;  1U0J A;  4DBQ A;  2JVH A;  2XAU A;  4CCO A;  2MYS A;  4XN3 A;  4AU7 A;  2HVQ A;  3J7A Y;  5HVQ C;  3H35 A;  2KLO A;  4XKC A;  2VKH A;  3OL4 A;  4XLF A;  3ZXS A;  3VSK A;  2Z2S B;  2CW7 A;  3EPZ A;  3FBN B;  1K6Y A;  3LSH A;  2KMU A;  2L5Q A;  3LSG A;  1X1D A;  5HNF A;  4IZZ A;  4XLE A;  4E7S A;  3HC7 A;  3PNV A;  4RM2 A;  2VJ5 A;  2DT7 B;  3D5S C;  4XL9 A;  2OUM A;  3RCO A;  4XKV A;  4JOM A;  4LIU A;  4BGD A;  2AQE A;  1OR7 C;  1G8X A;  3AKZ A;  3CF2 A;  1Z21 A;  4BAC A;  3SDB A;  2W4S A;  2LBF B;  5FRM A;  3DWL E;  3VYT B;  2P0W A;  1BOB A;  2E5N A;  3W3C A;  1OLT A;  3ONQ A;  3H9J A;  2CV1 A;  3I9V 2;  2VXZ A;  1N78 A;  2DXI A;  3MMY B;  3OOU A;  5CKT A;  4LIT A;  2V9K A;  4GRI A;  3OMY A;  2CW8 A;  5CQE A;  4OWR B;  3H5N A;  4FAS D;  3SEZ A;  3IAM 2;  1MMN A;  4HEA 2;  4BJ6 C;  2CH0 A;  4BQN A;  5KCM A;  4HPQ A;  4ZTJ A;  3PNY A;  2BW3 B;  3IAS 2;  4PJM A;  3OYE A;  1AA7 A;  1PYV A;  4DBR A;  5KNL A;  2R7X A;  5KHD A;  3BLY A;  2LRD A;  3OIP A;  4BQO A;  4NC7 A;  1WJE A;  2F6C A;  3PFY A;  3NWS A;  4F55 A;  4BDZ A;  2IS4 A;  3OYD A;  2KHM A;  2VKD A;  3LSK A;  3K70 D;  2R7T A;  2I8D A;  3VYS B;  3OR2 C;  1UG0 A;  2ZXH A;  2F4I A;  3DPU A;  4XMY A;  4D9J A;  3GBG A;  4N4N B;  2ZFU A;  2XDV A;  3CZ6 A;  1WJA A;  2KZV A;  2V4J C;  4DOZ A;  2XF6 A;  3IUO A;  1D0Y A;  3A1Y A;  4Y33 A;  4CCJ A;  3AFH A;  2HVS A;  4ZDP A;  2HPI A;  4C30 A;  4NNJ A;  4BS9 A;  1MMD A;  3DLA A;  2X85 A;  1P9Q C;  2WAE A;  4B3X A;  2OV7 A;  3LL7 A;  2CV2 A;  2ZXI A;  3M1C A;  1DGW Y;  2WBM A;  3W2V A;  3CMM A;  4QPO A;  3OS2 A;  1E0E A;  4BDY A;  1LKX A;  2XC7 A;  4XLC A;  2A6T A;  1TT0 A;  3CP8 A;  3TMO A;  3L2R A;  2VQC A;  2R7O A;  4H4K C;  3OYF A;  4XOT A;  2R7S A;  2CUZ A;  1UEL B;  3G2B A;  2QKM B;  4IQ4 A;  3QYE A;  3HXL A;  4BQQ A;  1Y56 A;  1D1A A;  2X1E A;  4CCK A;  2HNH A;  2LY1 A;  2CV0 A;  3K4C A;  4B43 A;  3D5R C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...