2CNNA

Crystal structures of caspase-3 in complex with aza-peptide epoxide inhibitors.
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
146
structure length
146
Chain Sequence
SGISLDNSYKMDYPEMGLCIIINNKNFHKSTGMTSRSGTDVDAANLRETFRNLKYEVRNKNDLTREEIVELMRDVSKEDHSKRSSFVCVLLSHGEEGIIFGTNGPVDLKKITNFFRGDRCRSLTGKPKLFIIQACRGTELDCGIET
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Exploring the S4 and S1 Prime Subsite Specificities in Caspase-3 with Aza-Peptide Epoxide Inhibitors
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords CASPASE-3 SUBUNIT P17
total genus 54
structure length 146
sequence length 146
ec nomenclature ec 3.4.22.56: Caspase-3.
pdb deposition date 2006-05-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1460 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 2cnnA00
4DCOA 2QL5A 3R5KA 4M9RA 3IBFA 5LUBA 2CNLA 3S70A 1IBCA 4QUDA 4EHLA 4QTYA 4N6GA 3DEIA 4HQRA 4N7JA 4QU8A 1K86A 4AW9A 3EDRA 4JR1A 3UOAB 1I4OA 4QU5A 4ZVSA 4EHFA 4JQZA 3H11A 4IYRA 2AR9A 1I3OA 4ZVTA 4QUBA 5LUAA 1F9EA 3GJSA 2C2KA 3V55A 5IC4A 3R6GA 3R6LA 1CP3A 5IAEA 2C2OA 4N7MA 4AWBA 2H4YA 2HBZA 5IBPA 3D6MA 2H48A 4HQ0A 4I1PA 1SHLA 2CDRA 4JQYA 5IANA 3NR2A 5K20A 2FP3A 4HVAA 3EDQA 4ZVOA 1JXQA 1PAUA 1KMCA 1RWKA 2H4WA 2J33A 3DEHA 3PCXA 1NW9B 3KJFA 4QUGA 2P2CA 4EHKA 2H65A 2HBRA 1RWMA 4N5DA 4ZVUA 2CNKA 2XZDA 3V6MA 2Y0BA 2CJXA 3IBCA 3KJQA 1RHKA 3DEKA 1RWOA 4PS1A 5I9TA 3UO8B 1RWNA 4PRZA 4FDLA 4QUJA 2FQQA 1NMQA 3H0EA 4ZVQA 3R7SA 1RHJA 2H51A 5I9BA 3DEJA 4N6OA 5IC6A 2QL7A 1CVRA 1ICEA 2CJYA 3BIJA 3R5JA 4NBLA 4NOLA 4D3ZA 3KJNA 3RJMA 5IARA 4D3XA 2XYHA 4JJEA 2K7ZA 3R7NA 1NMEA 3S8EA 4PRYA 1SC3A 1RHRA 3H13A 3GJTA 4QTXA 4D3YA 4I1RA 2FUNB 1RE1A 2XYPA 3V6LA 3NKFA 1NMSA 3P45A 3R7BA 4NBKA 1QX3A 2QLBA 3GJRA 4FXOA 4JJ8A 4DCJA 3H11B 2Y1LA 1GFWA 4JR2A 5JFTA 1GQFA 3H1PA 1K88A 4PS0A 4JJ7A 3PD1A 4JR0A 1I51A 4IEFB 2DKOA 4ZVRA 1RHUA 1SHJA 3V3KA 5IAGA 4NOMA 1SC1A 2H5JA 3V4OA 1QDUA 3SIPA 3P4UA 4ZVPA 5IAJA 4AWAA 5IASA 4EHDA 3ITNA 5IABA 1I4EB 4EHAA 1PYOA 3OD5A 5LU9A 4NOKA 1RWXA 3QNWA 4DCPA 4EHNA 3GJQA 5IBCA 2H54A 2QL9A 1F1JA 3D6FA 4QULA 3PD0A 4EJFA 2XYGA 2HBYA 1SC4A 4QUHA 4QUIA 1RWVA 4QUEA 2QLFA 5H0IA 5IBRA 3K7EA 4QU0A 4NOJA 1RHMA 3D6HA 2J32A 2C1EA 2J31A 2NN3C 1M72A 1RWPA 2HBQA 2QLJA 2C2ZA 3NS7A 4JB8A 2C2MA 2CNOA 2H5IA 4QUAA 1RHQA 4QU9A 3SIRA 5IAKA 3V4LA 3E4CA 2J30A 2XZTA 4FEAA 1BMQA 4FGUA 4LSZA 2CNNA 1RWWA 4NBNA 2WDPA 4EHHA 5LU8A 1QTNA 4N6NA
chains in the Genus database with same CATH superfamily
3OZCA 2A9VA 2BV3A 3HGTA 2JJ2A 1KBOA 5BXYA 1TYAE 3ACBA 4BUZA 4OLBA 5IAAA 3CZAA 4QRIA 5EVCA 5IH3A 1PJ8A 4CR8A 4E13A 3W78A 1A2QA 1XK6A 3F47A 1KI9A 2JD1A 2FKAA 1R66A 1RAAA 5EJFA 4B4VA 5C8VA 5K6TA 1XXHE 2VQ3A 1RQXA 4ETNA 5B55A 1S2DA 1U4NA 2GVDC 2CLEB 4IMRA 2GCOB 1OFUA 4DM3A 5M2QA 3COJA 4M1YA 5I7WA 4N7MA 2YY5A 5JXIA 4R8LA 1RKQA 3BAFA 1EGMB 3I2GA 3WGUA 1GPDG 2F67A 4PZZA 1AKRA 2V7XA 3DOCA 2YDYA 4BASA 1BG6A 1DZIA 3CKMA 3B53X 3HKEA 1R0LA 4X7RA 1L5GB 2CVQA 3WYDA 5LOVB 4DA8A 2DQKA 1V5FA 2I80A 3QKIA 1FZQA 4L9SA 5BN4B 3MWLA 3KTAB 5FV7A 2HI0A 3Q41A 2QVLA 2QTTA 2GNPA 2GT1A 2MYPA 5AJWA 1D7AA 3AOGA 2IZ7A 2QEQA 3K70D 1OXMA 1RJDA 1YZUA 5C3MA 4EFLA 1K1EA 3IBCA 3JQAD 1QH9A 1HDRA 4B2YA 1AGXA 1NN5A 2Y67A 1N0VC 4Z1MA 3FUTA 4L08A 3PEYA 2DLDA 2IPLA 1FP7A 1XAIA 4MLCA 5FH9A 2BM8A 3R7SA 2OCBA 4DV4B 4EKNB 3EC2A 4G5GA 4TTRA 5F1OA 1HFWA 2QPOA 3PD7A 3PT9A 1EK0A 2OO7A 2BP7B 3KEMA 4N6OA 4Q16A 2WJ3A 2XV1A 4DRZA 1OIVA 3ZG6A 3OT1B 3DBRA 1R6VA 2GN2A 1JSCA 2HQBA 2YZNA 3RCBA 3SE0A 5G0TA 1LLDA 1H8ED 2AMJA 2GHRA 3ITDA 1F60A 3H1TA 4ALIA 2FPLA 2HOQA 4JNKA 2WY2D 4ARBA 1L2TA 3QVGA 4LXYA 1UPAA 3KOWA 4TMKA 3W77A 3QKTA 3VHQA 2XD4A 2G9QA 1XRLA 1H4VB 1QVAA 3VO9A 4XXHA 2QOEA 3CLTC 4EB3A 1T24A 3TNLA 2VA8A 3LVBA 1C0KA 5H82A 4LX8A 3OLZA 3OX4A 1E2UA 3THOA 2IF0A 3E18A 4EGQA 3BN3A 3I5MA 5JS2A 5HIKA 1MDBA 1WDKA 3OCYA 3OQIA 4LHZA 4LW8A 4TWIA 3CE9A 2LPMA 3JAKA 3SIPA 3PQEA 3L3BA 4A8JB 3FLEA 1NUPA 5CLGA 4F4HA 2J3QA 1MVOA 1ZR4A 2J0UB 3ZCUA 1Z75A 3I6QA 4HBZA 4RJLA 1GHTA 5EUMA 1LUAA 3S2YA 1E9FA 7ADHA 4V0KA 2D0PB 3LC2O 4YCSA 1EFPA 3PIIA 5AJUA 1RWBA 3EQ6A 3WIVA 4B3CA 1HOTA 4FLMA 3GJ7A 3IBGA 4ESVA 1BDBA 1G5IA 1NE7A 2YINC 2FSUA 3DPIA 5C4GB 3VYUB 1J8MF 3OIFA 3QVJA 3GGCA 1VSQA 5DN9A 2BEVB 3ESRA 1O4VA 1ZH2A 4B3XA 2VYVD 5EMNA 2YXNA 1MC4A 4ZC1A 4D9IA 1WUKS 2F4VB 2CMHA 1KY4A 3DTVA 4W4TA 3LUKA 1WW3A 3CH4B 3IXMA 1FLAA 2OEPA 2UUOA 2LVBA 4MCHA 3BMOA 5CW2A 1FXUA 1GUAA 4R3UC 3R5KA 2PNJA 1Y82A 4DV5B 2QMUA 3UJDA 2WHEA 1V11A 2TS1A 4QVIA 4Y2XA 1DFGA 3SLRA 4IZOA 4UMVA 1PGPA 2A9RA 2Q50A 4BBAA 2HSJA 3FNFA 4ILKA 2JLYA 3QFRA 1H4TA 2YOGA 3W6PA 3QSGA 5EKUA 3HUEA 4BKOA 3ESDA 3RSHA 3GHHA 5JSYA 1F3LA 1I2BA 4CF6A 4Y6QA 1CIVA 2PUBA 5EWMA 1OWOA 2ODEA 4YI5A 2B35A 5AJTA 2BY4A 2FYTA 4RPLA 3AHJA 4MK4A 2XT9A 1R5BA 2PKWA 4F1WA 1W5EA 4KFUA 1I6WA 1ZGCA 4ZGWA 4FR5A 1RBMA 1XVIA 1XDBA 2XCQA 1MKYA 1QG0A 1J0EA 1H2HA 1SFRA 2YX1A 1M2NA 3IERA 2HL6A 3OHPA 3OM0A 4OHFA 4PCLA 4BFVA 4HZGA 1CJKC 1L1QA 3MAGA 4CDRA 3WRXA 1RRGA 3CC8A 3OKFA 3RRYA 3DUFA 4TGLA 2F90A 1J7JA 2ODQA 2QM8A 3EYAA 4PSVA 4QOJA 2GAIA 1DC3A 5EMHA 1B0PA 3EAQA 2I54A 3ZU2A 2OZPA 4P83A 4RIHA 4UCWA 3SNKA 3R41A 2VJQA 3KQPA 2IXBA 1NXVA 3FNGA 1R8SA 5EJMA 3DZIA 3K4QA 2AA3A 4ER7A 3VC3A 4A2QA 1AMNA 1NWHA 1SVUA 3KVYA 4IEEA 2D2XA 1XVTA 1SCBA 4F45A 1Q2UA 2DQZA 2LV8A 2PZLA 3UK6A 7ABPA 1F17A 2FX3A 3HJTA 1M5TA 3G2MA 4Y98A 4AKEA 3AI2A 1Z47A 3T9DA 4F4JA 1I33A 3PE4A 5E2BA 5IZ4A 1CYDA 2GLUA 3R3SA 3SVTA 3OTHA 4EB0A 3HGQA 3M9WA 5CEEA 2X9NA 4FUTA 1FNDA 2Y92A 3KWJA 4ZPJA 4GRDA 4B17A 5ELMA 2QN1A 4IHJB 2OFFA 5C8ZA 4CW7A 1YS7A 1GT91 4BPRA 5JFTA 2MSDB 3IUEA 3ZXXA 1AKMA 2R6ZA 3NBQA 4ZN6A 5KOJA 3EZNA 3QXSA 1ZD4A 2B7CA 1FW6A 3FPBA 4PLYA 2G07A 1H2FA 1UMDB 1ZOLA 2AHRA 4O25A 4TXMA 5CDFA 3TF5A 4J7UA 1VL8A 1XTJA 1X0VA 3CIFA 3LI2A 1DWQA 1VJ0A 4PZUA 1N6PA 4UQPA 7REQB 3E7FA 3KKOA 3RRMA 1YHYA 5FT9A 3HNRA 4GYJA 4UTVA 4YT4A 2JLWA 1USVA 3C8HA 2VPPA 2PS0A 3ECSA 1E3DA 1IB6A 1QV9A 1ZK1A 4YRFA 1VIMA 1NRWA 4D4GA 3WWPA 1OAAA 1TD1A 1Z5UA 3BJEA 5IZCA 4FNAA 1ZJ6A 5FIUA 2QD3A 5I7AA 3I9MA 4CM8B 4LOIA 2QRKA 3BCRA 3KKPA 4Q9LA 3ORYA 4L74A 5HWSA 3GUZA 3H1AA 4GRIA 3RVDA 4DS3A 1XZKA 4Z1MD 1UMKA 3UUGA 1M34A 4TMYA 2YIVX 4B84A 4FBGA 4LGCA 1V1RA 1S7GA 1XWWA 4NFLA 1MJGM 2W22A 3C8UA 4G0QA 2Q21A 3P4YA 1XE3A 2BHTA 2PX3A 2ZRGA 4IHJF 3MSCA 1Y8RA 4EJ0A 2HEIA 1Y6FA 1R8YA 1RYMA 1U4OA 1WF3A 1YL6A 3L06A 4LV5B 3UAVA 2QL5A 1GPUA 5AVZA 3ZDAA 1L5HA 4CLRA 1HZZC 2EL7A 3LSTA 5EC8A 4PAQA 1CVLA 1R3UA 2RHTA 2M1ZA 3G2IA 2PJZA 2DC1A 3HZHA 2BGNA 3HA7A 4FX5A 4N7JA 4Q03A 2VQFB 2FSPA 4KH1A 3VHXB 4G97A 2OESA 2R8BA 3NT5A 1ESMA 3BCUA 5KWEA 1EZ4A 2IQ5A 3F7TA 4Q3CA 3SBOA 1AUPA 3WWZA 2ZI9A 3F6YA 3CLSC 3NEJA 3GNLA 2GBPA 2AKYA 4FJ1A 2O2EA 2NUTA 3ZDYB 5LD2C 1DV2A 1JLLA 4GFDA 3DHWC 4YJHB 2H59A 3RANA 2VBIA 2QPAA 3KSUA 3H5OA 4EAAA 3CW8X 3EVCA 2O0JA 3GPIA 4JP3A 1XNQB 5FPYA 3B9PA 2OV8A 4OLHA 1W47A 3B5IA 4WWHA 3O1LA 1F06A 4LAFA 4R0MA 4ZIRA 3O03A 2A1TR 3NHKA 3QEMB 4CBVA 2PVCA 2XH8A 3R20A 4DBLC 2R96A 4AMZA 3WSTA 2J6BA 2XOEA 3WLFA 2JGKA 4UUMA 1SBNE 1NC1A 1RJ9B 3W5UA 2OAGA 4KCGA 5JD6A 4MO9A 2I66A 5KYTA 1LV8A 1AZWA 4WERA 5LQRA 3UMYA 5B3AA 2W2KA 1RABA 3ODGA 4IXWA 4ZAWA 4IXMA 2QVCA 4R2HA 2D1YA 3UWDA 3MRXA 1U2EA 3DXZA 4NDZA 1YOBA 2JAHA 3H9QA 4MVJP 4X6XA 3SDSA 5LBIA 5BWNA 3DMTC 4EARA 4HVTA 4HDAA 1WB9A 4AO8A 1B8PA 3OWHA 1T9ZA 4IXNA 2VDNB 3GFPA 2XOKD 3OEEA 4QLAA 1JAZA 5CVDA 3IP3A 4F3TA 1SXJD 1JLHA 4MQEB 4NU0A 5AK4A 1NJ5A 3L7LA 4TRMA 2EFDB 1B8NA 1E6LA 3KDSE 4LDJA 1AQNA 2WUVA 1JQJC 3R9KA 1YJBA 4IO1A 5AH0A 2A92A 3H11B 1HLDA 2Q4RA 3IVAA 4YRBA 2Y0EA 3PR2B 4UM9D 4B81A 4DIEA 4PX2A 3G17A 2NXCA 2HRRA 1YCFA 2ATXA 5B4VA 1PFKA 5B1HA 3WLLA 3LPMA 3OF3A 3ADDA 2GF2A 4ED9A 4GOXA 4HN9A 1FTGA 4LVUA 3T6KA 3HFJA 4DLTA 2XVZA 1TCVA 5CX1B 1U2GA 1Q0PA 2QN8A 3O8LA 3DO6A 4M0UA 4BKPA 2RHDA 1SM4A 4L51A 5DHFA 3ENKA 1DL5A 1EWKA 4URYR 1P7CA 3S40A 5CDTA 4G07A 3NKVA 5JAMA 2QX6A 1E3LA 2D6FA 2QR3A 1UPBA 2GF9A 1E1LA 1CDDA 3AEQA 1VHTA 5CGZA 1RHMA 2PSDA 2OXEA 2NXJA 1M7GA 1ULBA 3D3WA 1X1EA 2J31A 3GJ3A 3RKUA 5BR1A 5AVWA 4HFJA 4E3WA 1ZNZA 3B36A 2GPYA 4ZT4A 4CIYA 1NPDA 3LKBA 2VAMA 5KOIA 1QOQB 5LJLA 1EFDN 1FUYB 1LPAB 1U1DA 4CMIB 2XUPA 2O7RA 4AJOA 1PT5A 3EDCA 1DT3A 4Q1BA 4MV0A 2ZJ6A 3HJAA 2R25B 1QC5A 4C0WA 1IY9A 4LHYA 4D1YA 1UDWA 2VZ0A 4YH1A 3A10A 1S8NA 3GVHA 5BW6B 4UM9B 3ETCA 1UFQA 2IHUA 5CA1A 3STVA 3PEVA 4D8XA 4DJFC 3HMQA 5JBNA 3RVBA 4Q15A 1XA4A 5ALEA 3V55A 1JPUA 1H66A 3QVLA 5JSUA 3U4CA 4N3AA 4YJ2F 1IXSB 1LNSA 1QDLB 1W87A 3NOXA 4QICA 4TV8F 4BO0A 1W36C 1WDWB 2J4CA 1YZFA 1D9XA 1H1TA 2PGLA 4HL6A 5ESXA 3G2PA 4I4NA 5A7GA 5LYJA 5K20A 4CZ2A 3RLIA 2ZJAA 4ZU1X 1UXHA 4GO1A 3BCHA 1MB3A 1QVRA 4X1OA 1A8SA 1XRQA 4EEKA 2OAP1 3TLGB 1NVVR 1DIOB 2OXFA 1THMA 1UKEA 1LK5A 4RO0A 1XZJA 4MW2A 3RYCA 3HKDB 4MIEA 4KYUA 5KKCA 4ENQA 1K7XB 4S3MA 2F64A 2C9YA 1YASA 2CZQA 4HDKA 4NULA 4B79A 2I3GA 3V7YA 3KQNA 2VAPA 5EKXA 4YJGA 1HRDA 1YMUA 3F4BA 1P62B 2ONZA 3BBPA 2QX4A 4M7WA 4K46A 4I4TF 1N7IA 4P81A 4R98A 5CFOA 1P6UA 1YE5A 2H9AA 2IDKA 3L4SO 3F5MA 2VRBA 1QQAA 4YCCA 2HFJA 1BE8A 2YYZA 3PICA 2K2QB 4HFMA 4DQVA 4ESEA 4F3YA 4C3UA 3FPEA 1QIEA 2AHOA 1WV1A 2HUNA 2XQIA 1T3GA 2HADA 3PSAA 4OXRA 4LDPA 4RY2A 2NMVA 1E60A 1Z38A 3G0GA 5CVJA 4CLRB 4N41A 1DDIA 3UNXA 4OKSA 1W88A 2ZKIA 1KQPA 2KHZA 1K0FA 2AFHA 1MN6A 3R1IA 3TRIA 2BR3A 1D03A 4HEA6 1RBZA 1FXWF 1A69A 1EJ0A 2XYVA 3VHXA 1CS4C 1VKOA 4HWRA 5AMXA 5H7XA 3KB6A 4PSAA 1JH9A 3EG5A 1SU7A 3GFOA 5ALTA 1NR1A 1ECJA 1U3GA 2UVPA 3NOQA 2DQ4A 2X5JO 3QLVC 1ISHA 1QV6A 3FMIA 3VC2A 1EK2A 3LV8A 4A6EA 3IEKA 1I7PA 2OO3A 1KNXA 1SPXA 4HRYA 1NSFA 1KI6A 2B1GA 3BTSA 4LJLA 1PDOA 2X5XA 2ZG6A 4HFRA 2GTPA 1Z33A 2JI6A 3UEOA 5KVVA 2KS6A 1BCSB 1CUCA 2BKVA 2GZHA 2VP4A 1EH5A 3HA3A 4NOKA 3WGMA 3LGSA 2WB4A 3AO0B 3CNOA 2Q1XA 1EE9A 5FWYB 3DAGA 5DTIA 1U9JA 3ASYA 1YI1A 4DPLA 4EM6A 4WE3A 2PH5A 3C5WP 4RVCA 4URUR 2G1AA 3K5WA 5KJEA 3F5FA 5K8UA 1Q16A 2PKXA 1VL0A 4OFXA 3KJXA 2AMLA 2DY1A 1B6RA 1SVNA 3IVXA 1JKJB 1RMTA 4BNFA 3NNDA 2OK8A 1Y1KE 3R0IA 3NHSA 1WCWA 5JLAA 4BKRA 3WP1B 4QNMA 1BMQA 1BXKA 1GU7A 2Z3VA 3QBJA 1QHYA 5JQGF 1D4ZA 3NXSA 3KUUA 5CVTA 1I0ZA 2AL7A 2YOFA 4KVGA 1FS5A 1N25A 1N0WA 3AJRA 4RHEA 4TUYA 5FA8A 3I1IA 3WMGA 1ZGAA 3NWOA 1DRVA 5HA5A 2Y0PA 3D0KA 3IUQA 4JYAB 4IR7A 4BMZA 3I6YA 1ZC4A 3DEIA 4B6FA 1T6NA 3DW3X 2A58A 3EDRA 1E5TA 1M8PA 2O8EA 3NBMA 3ODPA 1BWSA 1GKIA 3C3YA 3LF2A 4J07A 3UXHA 1U2TA 3WDLA 1OH8A 5BNZA 1W581 4V24A 4WUTA 2WV9A 3HN2A 4LMPA 4GOKA 5AP9A 1Z18A 2PD3A 2CXXA 5A62A 1SG6A 3SM3A 1ONSA 2HA2A 1M0TA 1DQZA 3BCSA 3CINA 1LBSA 4RF2A 3RIMA 1SQ6A 8LDHA 4R7ZA 4K88A 4FVTA 3FM9A 4JI8B 4V3BA 1Z68A 4WZZA 3AR6A 1ZK0A 2I9PA 4FOTA 4HEA1 5DE3A 2ZR8A 1SHZA 4XB1A 3DKIA 2OCPA 4KRYA 5E2AA 4EJSB 1UBMS 4Z4FA 5CD1A 3IUPA 2H08A 1IWBB 5DT2A 1BA3A 4E03A 3BGIA 1PLLA 4K9SA 3QELA 4IS2A 3IIJA 4DLNA 3RODA 1PJLA 2FFRA 3OZRA 2H1RA 3FHCB 4BX3A 4YY3B 3GRUA 3LT0A 3MTQA 4E5VA 3ZZ0A 2Q9CA 2E7ZA 3BPSA 3F71A 3OAAD 4RA6A 4CTMA 3STXA 2ZRPA 3GGDA 5I6DA 2IHJA 5HQ3A 3FN4A 4F7WA 4QD3A 1T2AA 1ZFNA 2R68A 4O2BF 3FRIA 1D04A 2I2FA 1N6HA 4JVSB 4FC7A 2X6RA 4P7JA 2YV3A 1GU1A 5KNCH 3CUSA 3TLBA 1XVLA 1K3TA 1R2QA 2OFXA 2OVBA 3W2HA 1SKAA 2QAGA 2R65A 2ON6A 3PJEA 4FCCA 2HN9A 4LRXA 1PU2A 4QXPA 4JK3A 2XXAB 2RI6A 3ZLUA 3HR7A 2AI2A 4UXJA 2ZATA 5HG0A 421PA 3DFUA 1MX5A 4MA5A 4WUVA 5J4LA 3OM9A 4TSFA 1BXRB 2YZ2A 2QAIA 4OHZA 4ZHQF 2IEAA 3H7IA 2IW1A 5HGXA 1K5GA 2CXSA 4ISBA 1NG1A 2Z2ZA 3GFVA 3UB4A 3ZNNA 4AKIA 1DIGA 1K88A 3KQVA 2AZ4A 1SU4A 1X38A 2EBUA 4QTUB 2Q5JA 4H1WA 2BE9A 4IEFB 2Q6LA 3ME5A 4KKXB 1BYUA 4JLKA 4JJKA 4MITA 3V3KA 2C7PA 2LCQA 4ZCSA 2J3MA 4POOA 2QQ0A 5KTNA 2ZYRA 3RUEA 2PV7A 4RC9A 1F0NA 5AI9A 3IQGX 2P2YA 1SKQA 1G2IA 1Z6TA 5A1TA 1U9IA 4XKJA 2I22A 3LIPA 2WP0A 1UXOA 1DAEA 4PVDA 2HX1A 3E7PA 3BFXA 1XZHA 2P3OA 2ZXFA 3GLHE 4WJZA 4DBZA 2YKGA 2I29A 4NATA 1W49A 2PZGA 1JA0A 3I1YA 4V1CI 1XZCA 2Q9AA 1ZD2P 2PUVA 4Y6SA 4D6XA 4OQMA 3WLKX 4WKNA 1VM6A 1LC0A 4H9GA 3RTBA 1WUTA 4LHEA 1L3IA 4KR9A 2EGUA 5FPKA 1YU9A 2IYFA 4OHMA 3WRWA 1J09A 3CQ9A 3QIVA 1CUBA 5C8XA 4UU8A 4EZIA 1T2NA 3MPOA 2YVLA 3LZ6A 4GM4A 4UQOA 1P9WA 2IYAA 2VNSA 4ZQIA 4R1OA 3I1FA 1RWWA 4NVRA 5A9RA 5K0CA 3QXXA 1BE0A 4MRPA 1KFBB 4PLCA 3H2ZA 3S7ZA 3SZRA 5BURA 2HCBA 2V97A 1KNQA 4TMVA 5TGTA 4WQMA 3BM5A 5B58T 4I55A 3LXXA 2D8AA 1XVAA 4GPIB 5AM5A 1Q15A 2UYOA 4GMGA 3A9VA 4JR1A 1NVVQ 5FOQA 3HKBB 3RG8A 3K1YA 4IIUA 1QU2A 4RD4A 3PPXA 1SURA 4I2NA 4IIXA 2C57A 5EJEA 1E2IA 2BMEA 4GAEA 4UFNA 1TLTA 3QQPA 2WF5A 4IFTA 5LIRA 2X5KO 2GF0A 3VU3A 1G7TA 3NTLA 4PIPA 1W75A 1YD7A 2V9CA 2FWMX 4JSRA 1O54A 3VZBA 1U3DA 5A3VA 2VHWA 1KI6B 2V54A 3L2OB 4LG1A 5KX5B 5EUQB 5LWQA 1NN1A 1FDVA 1UC9A 1U2RA 1T9GS 3LY5A 4Z7NB 1J8QA 1R27A 2QRNA 3JZMA 2HA7A 3L7OA 4BFCA 5T4BA 2BDTA 2ZE8A 5BQ3A 3KSAC 4M36A 1S5PA 4IH1A 5KX5F 3AF0A 2AG5A 2IVZA 4BC1A 1ONBA 3I3OA 2QE7D 4BE4A 1WKVA 1UWKA 1PGOA 4WLEA 5KU1A 3HC7A 4JZKA 4BNTA 1JI0A 1GJRA 2Y0BA 2XMDA 3NUGA 1NW8A 2JCBA 3LYAA 1HZZA 4HQ6A 2ZT6A 2F1HA 1W25A 4C1BA 1IRXA 4QYWA 2IUTA 2BM9A 3JZFA 4M7OA 2BFEA 3K0KA 2NYVA 3ASZA 1JIUA 3L02A 4IFEA 3SC2A 1Y1RA 2Z8YA 1AIPA 3KJIA 1Z62A 2GZ3A 1UANA 3RJMA 4B5KA 1RS0A 3N74A 4WT7A 4LXUA 3EODA 2IOFK 2V6FA 5EPOA 2WFMA 5EAIA 1Q0UA 1TM3E 1HE3A 1UXJA 3B6KA 1S3SA 4LJ9A 5LNK1 1FVFA 1JILA 4Q24A 5LD2B 4CMBA 1CHNA 2VJPA 1VFPA 2NZUG 1LKZA 3NYIA 3IEPA 3IIIA 1A50B 1GZHB 3IGFA 3Q6IA 1MC8A 4DZZA 4W63A 3CRVA 3T7AA 3N2IA 5TJ9A 2X19A 4OBWA 5FTMA 2VFAA 4TKZA 3H04A 2LRHA 3L40A 4Q39A 4BNMA 4DWOA 3GFSA 1AKYA 4MI6A 4MI3A 4MUYA 3D6TB 4HNUA 3P4UA 4FD3A 4MW4A 1ULAA 3LBAA 3LWDA 4TWBA 5AQ1A 5I9IA 5JDIA 4DYHA 3NHPA 1E7YA 4OB7A 3ZBUA 3FUXA 3QW4B 1OC4A 2P35A 2YJ4A 3EH2A 5LP6B 2JLBA 1SC4A 4P33A 4X3PA 3JVVA 2IVFA 1BEZA 4KGZA 3SIWA 1OE0A 1HDOA 1G9XA 1KDZA 2XYQA 1QPBA 1A2KC 1XZLA 2OCGA 2XE6A 2NV0A 2CHQA 1GO2A 1QLJA 2B8TA 5BWOA 5HQ3B 4S05A 3UAGA 3FOEC 1F8YA 2ZDQA 4OL9A 2VT3A 4NX2A 3AZOA 3V34A 3AKCA 1N0IA 1O1YA 3WYFA 4JVLA 4TQAA 4EW6A 3KYDB 4Y9TA 3FGOA 4ZQEA 1YUNA 1GL3A 4IIEA 4E08A 5K3DA 1GDTA 1L7AA 3FTNA 3TJZA 4YJFB 5BOSA 1I2AA 3CVOA 3OPYI 4NARA 5FB3A 1UL1X 2XPCA 1S4QA 3DONA 5KPJA 4J0GA 5JLJA 2QRMA 3BF7A 1A9SA 5DSZA 4G0UA 2OV1A 4YAIA 1KSJA 1ZDMA 3NATA 5HIAA 2JJQA 5DOVA 3SSNA 4QU5A 1GR0A 3OD1A 3VRHA 3SBEA 5TS3A 1U8UA 3BWXA 4BP8A 5FUMA 3P9KA 2BGIA 4Q1FA 4U39A 2HKIA 1C7ZA 5MFZA 3K9GA 1F9EA 2JIMA 4DEXA 1P0FA 4OHXA 2O3TA 3F2IA 2RBGA 2QT1A 2JIOA 4Q3BA 1GY8A 3IQZA 4GM1A 3AFGA 3NAQA 4O6VA 3TR0A 4LGVA 1ZICA 4HNRA 4INAA 4MTCA 5G41A 2A8YA 4C0KA 1FYDA 4E3ZA 2H2FA 5C8DA 5JZVA 3ZJUA 4WY2A 2ODBA 4YA6A 4FHCA 3B7GA 3L6EA 3OU7A 4TLEA 5EVJA 5IKEA 4CIXA 5K8LA 3GDFA 4HK4A 5FJJA 2XYRA 4RD6A 4C2BA 1XNJA 2AG1A 1EFRA 4HRVA 2GCIA 2O3SA 3AW8A 2IPNA 2OILA 2Q0HA 3CZPA 3EZXA 3OE4A 1AB6A 3TDKA 1QK4A 4DYVA 1Y4DE 1HTBA 1LBIA 1V7QA 1YFKA 1M2WA 2JDIA 4UTZA 2P6NA 3OM8A 3GEBA 2O2ZA 3W8RA 3GPLA 1ZR2A 4G5HA 1QZXA 1YULA 4L28A 5DGCA 3NP9A 3ZGOA 1PV4A 1M5RA 3IRVA 1GGJA 4XZ3A 2XMGA 4BVEA 1N77A 1JHPA 3O38A 5FR2A 4KUHA 2KPOA 3RV4A 4I6EA 4QO8A 4CEJB 1EINA 4MHTA 1GZ4A 5F7ZA 4JP5A 2IYVA 3NASA 5TC4A 5TQVA 2EVWX 4OYLA 2YRXA 4JQSA 3IIMA 3R0JA 3U37A 1KI7A 4RHTA 1KFEB 1SCNE 3W9YA 2ZVQX 4V1CB 4ND1A 4CDMA 5H70A 1BKSB 1SQ0A 2PFKA 1F4LA 5IBQA 3GDGA 4CIBA 2IDZA 1K92A 3SEZA 3TQHA 1UOPA 4URHA 4YTEA 1P7PA 5FPQA 3EMBA 1M66A 3QY0A 2J3IA 4HB4A 4LTDA 4PWZA 3WL7A 4ARZA 5JS1A 2NQTA 3P9CA 2LCFA 4LYJA 4F5DA 2G5TA 1MAHA 1WULS 1B7GO 3V80A 3EIEA 5ESDA 1RHUA 3MJCA 5TXGA 2Z9CA 1OZAA 4YCNA 3ADBA 2B8JA 2ZQZA 5TNXA 1A2BA 4CT4B 1XP8A 2OB2A 5CXSA 3EQZA 5KX5A 1E2LA 1O89A 3ON5A 5DYIA 5IT4A 5IABA 3T1TA 3AGPA 5JYEA 3EOZA 5F5XA 1EE2A 5HXAA 1CRQA 3BUSA 3ZIDA 1GWNA 4AY2A 1SBYA 4UDXX 4RE5A 4HH4A 1WMAA 2OBXA 2J5BA 3HG7A 2QJWA 4I14A 1BJKA 1ULSA 2DG2A 5KOHA 4G01B 1YR9A 2P5UA 1OXUA 2C92A 3VPBA 2FOIA 2FPSA 4G5XA 4HC4A 1ABBA 3X1WA 5IKMA 1HNWB 1PNVA 3ENZA 4PFJA 1O08A 1DCTA 1TKAA 2IE8A 1YA4A 3HA2A 2VDUE 4RV9A 3S5UA 3H75A 1FFSA 1LSSA 1ZNYA 3OCZA 5BORA 3EZ2A 3W3AH 3O95A 2GXAA 2CJPA 2ZSAA 3D4IA 1YK1A 2H07A 2YV4A 1AOXA 4QOGA 3IALA 3IR6A 4ZJUA 2JFQA 1ZD9A 1L4FA 5ALGA 1TC2A 3EXIA 3H9BA 3PXBA 3AB7A 3OOHA 1T91A 2VNJA 4AW9A 1BDMA 4BBJA 1GL6A 1FF9A 1G291 2RAPA 1TMKA 4Z3KA 3LUFA 3NC0C 4O0MA 2VHCA 2C82A 3G8YA 5G3YA 4Y1GA 3LQ1A 4PQFA 4HWGA 4Y2GA 5GONB 5B64A 5BMVA 4XVHA 2ZBVA 3N8GA 4I4LA 4U0JA 2X0FA 2FRDA 3TMAA 1PR1A 5G0UA 1SO8A 1IM8A 2ZI6A 1RCTE 2PH1A 4RD2A 2WDZA 1DX6A 1EFKA 3NW9A 1V47A 3HJUA 3Q3IA 3T8YA 3FMFA 1IXZA 4DGQA 1SBTA 4QJ4A 4RH0A 5REQA 4C01A 2Z6VA 3CVUA 1RAIA 2C8KA 3MA0A 3BFPA 1NUUA 1VL5A 2A5JA 5GIOE 1C30B 1RZRA 1ZN2A 4RFVA 1V1MA 2P2CA 2JGAA 2QD5A 5D1HA 3TDNA 3UYLA 2P3QA 5D85A 4BMDA 1FZTA 1ODJA 3DDHA 4MR8B 4TMWA 4Z7QB 4HDMB 3BGDA 3NTUA 1JQKA 3PZBA 1OFGA 1WMDA 2F43A 5ALDA 3CPSA 3D4BA 1EIZA 2H18A 3V97A 5FXMA 1GGVA 3CMMA 4IOMA 5AIAA 3GYGA 5JXGA 1C9KA 2QX8A 3NC1C 1Q6ZA 5FEUA 4ZRNA 4PRLA 3EGDA 2PT7A 5MHTA 3AKYA 4WXHA 1ZD8A 4DR6B 4F72A 2NO1A 4DT1A 1RYZA 1FU7A 2Q3MA 3ETGA 4TTAA 1P44A 4DDUA 3T0FA 1VLMA 4AP5A 1KEUA 4RCYA 1LF5A 5GZ6A 4H27A 2GXSA 1CLEA 2QM7A 3H13A 1NBOA 4ARUA 1C3LA 3R76A 4MPJA 3H7AA 1X13A 4RZXA 2BGLA 1N2GA 3BIXA 1ZRNA 3O91A 1G0NA 3RREA 2Z43A 4KIJA 5AFSA 2EBFX 2P6OA 1SUFA 1JWAB 4DJTA 1SHKA 4U00A 2X76A 2YUIA 4KZKA 1K98A 2DHQA 3NI2A 3R2JA 4DN6A 2PGOA 3FW1A 5EJGA 4KQ9A 2O0HA 4OLFA 1OGYA 3W06A 1RPAA 4BE9A 4H6VA 4C4OA 3L4KA 3AR4A 4UUBA 1E2FA 1HM5A 2QR2A 2WIJA 3MTIA 3GR6A 4MDFA 3S7TA 3N8KA 4HLUC 4ZGGA 3Q8LA 3ELUA 4ZEMA 3ZOZA 2I2BA 5DYNA 3S44A 3QLUC 1FJXA 1G3QA 2ORVA 4CF7A 2PWAA 5CHEA 3ZD7A 1OF1A 3BRWA 4WFQA 5CT9A 3VVLA 3N2GB 3WGJA 1XWIA 3ZCXA 4DC9A 5JFOA 3V8EA 2ECOA 4Z9YA 5BWLA 3CM0A 1GZSA 1XU4A 2JDID 1KDTA 5BVGA 3TYXA 3LP6A 2JIZD 4YB8A 3E4CA 1EVEA 4H35A 5E4TA 1P17A 4ZV9A 2ZBRA 4Q9HA 1S2NA 3ZCRA 4YX9A 1E9AA 1P75A 1TCCA 3F96A 4S1OA 4YRKA 1O6FA 2FDRA 4GGPA 3HDVA 5F7JA 1KPGA 4W9NA 2GERA 3C3XA 4UHEA 3RWOA 5J2UF 3FWZA 2A33A 2JLUA 2NP7A 5L95A 1T5DX 4C3OB 3NU1A 5DK4A 2PKRA 5HMMA 3T0IA 4A5SA 1IMJA 4H1UA 1NGSA 3FYDA 3A32A 4UVDA 1R64A 3MD9A 1Z5NA 5B2EA 1XD2B 3MWDA 1U8ZA 1ENZA 2AC4A 3E23A 3K1AB 4FFPA 2BKAA 5DRTA 5I4IA 4DA4A 1DOZA 5B3JA 4YMGA 1NR5A 4KQJA 2KSQA 4POAA 3VDXA 3I2YX 5IT9A 1G4HA 3SQOA 2VJNA 4UM5A 5JMPA 5LKRA 4ARZB 2Q5HA 2I67A 3FCYA 4JJAA 4H31A 4PQYA 3WLOA 1REQB 4ND4A 4R16A 3C7TA 4XTCS 4DSUA 5CLJA 1JTVA 1YR3A 2PSEA 3QKRB 4NG5A 4X95A 4FFMA 4ZEOA 1VLLA 1VKHA 5J5CA 1F7VA 1QP4A 2AE1A 2CNWA 1E3WA 1OMOA 1W52X 2FJUA 2IYPA 2QYHA 3OI7A 4UULA 2JCSA 3CMCO 3T35A 2H1LA 4P5PA 4TROA 4EVRA 1RLOA 2Y76A 4UBJA 3QVTA 1WG8A 1UDXA 3JU3A 4RTNA 1IMOA 2HLDD 1GYRA 1Z8FA 2KX7A 1WHTA 3C5VA 4WNCA 3KQHA 1SXJE 4BKUA 2C7GA 2UYHA 3T1YB 5P8WA 2UUCB 4LJ8A 1Z5ZA 2GEJA 1AHIA 3S2IA 3I5AA 3FDFA 2OGWA 4JEHA 3FSGD 3AL0C 4JLOA 2YWXA 1V8ZA 3BD7A 2AF4C 3OY2A 4IQFA 4TTPA 4ZCPA 1V4NA 5K45A 4D26A 1SD5A 5CBKA 1KKLA 5DYTA 5JJCA 1R88A 1NVUQ 3OJFA 5JSHA 2A1TS 5CAEB 1NL3A 2GCEA 2ZUWA 2OAQ1 4IWNA 1E99A 1HMYA 2J3JA 2YBDA 2J3DA 1M10A 1EX7A 4Y2UA 3WXMA 1GIAA 4TTQA 5KMGA 2IS4A 4ZALA 1RI5A 2EATA 2QU8A 1SC3A 1RHRA 2ZBDA 3CLTD 3G5MA 2OXIA 2RE8A 2EZTA 1AC5A 1H22A 4LOAA 3VNVA 2PX0A 3GGOA 4RVDA 5GGXA 2R8OA 4CM9A 2WWGA 2MDTA 4EQ6A 5B7QA 2HH9A 3ZIAD 3ZNOA 4B1FA 4R2XA 1XV5A 4TV9B 3QNUA 4HLUA 2JGRA 1FTSA 2LUOA 4FYIA 4MR7A 5B37A 3PVZA 4MUGA 1C1DA 1I5RA 4I46A 4WK0B 5KC8A 5IM4F 2A4MA 1CJTC 4HGZA 5JZSA 1N4AA 5TQJA 2WVHA 2X15A 3B3AA 1LDNA 4EHAA 2HRZA 1O6GA 5KTPA 1DKUA 1ZBQA 1QP7A 4G4SO 1JJVA 2MMCA 5A06A 2WILA 3HU3A 1IYZA 2G08A 3L84A 4EYKA 4WSOA 5BOVA 5CYOA 1GTSA 1A7JA 4H1VA 4IJQA 1FP4A 3AEKA 1NTOA 4LXXA 3H2HA 3O84A 1PD1A 2BFMA 3ZWCA 1F2TB 2XTNA 3PFHA 1B73A 1BE1A 3FOCA 4OK6A 2HJSA 1B0UA 4HJRA 2NN3C 4OFWA 1U0OC 3N3BC 1C1YA 2IZ5A 4PYRA 3DF9A 5K0LA 3RE1A 4G8CA 4EPRA 2FG7C 3JQEA 4BVLA 5FL7D 4QDUA 2X4IA 3UHFA 1RXYA 3GROA 5HIMA 3ISJA 2QORA 2FX5A 5H81A 3ZHXA 1DIAA 5I47A 4AN0A 4TRRA 1M1NA 3L6DA 4RJKA 1PR3A 2EG9A 2XUIA 4MZDA 4PLHA 4ZK2A 2BGKA 3PXUA 2AN9A 1T8YA 4NPCA 3BKXA 5I3CA 4HN4B 2VRNA 5FQNA 4D45A 3P1JA 1YZ3A 4IMPA 1LNQA 2WWWA 3DFMA 5KOJB 4MUHA 4WASA 2NSHA 1XU9A 2JAPA 3KQQA 2VSQA 5DBGA 2NU7A 3TZKA 4Z7OB 5EKTA 3ROZA 3T5TA 5A3RA 4QT4A 4BGIA 5C5DA 1KMIY 1CP3A 1Y9JA 2GM9A 3LLMA 1NJ8A 5EL0A 3FDZB 4PSDA 3RAEC 4WADA 1MJHA 3D0RA 4AY6A 3SM9A 5I7VA 1DAGA 4PSKA 2W6PA 2P6MA 4X93A 3GJ6A 1OX4A 5AQEA 4OJMX 4EO7A 1N6NA 3ICWA 1BEUB 1JB9A 2CHVA 2IP2A 4MB0A 4GMKA 1AKNA 1PG0A 2GPTA 2YH2A 4JBLA 4K6MA 3F73A 1PFUA 4JLSA 3NB0A 1OWPA 1GNTA 2V0NA 4LXTA 1TDJA 4AJPA 4AP6A 4E5MA 5KQSA 2VNIA 2F3QA 2IXTA 4NL4H 5CGQB 1P9OA 5ECGC 4G25A 4DVJA 2UXDB 1XFDA 3EEYA 2Q45A 2X0IA 3NV9A 3SC4A 1BKYA 1LPBB 2IIBA 2VP2A 3GEPA 5IXJA 2O8DA 2Z6AA 3L0YA 1P2BA 1ADBA 3H19A 2B4TO 1TUIA 4RXUA 5D5HA 2IHVA 1A5BB 3RJ5A 5LB4A 1XRRA 1H2YA 4A8PA 1E1CB 3MNFA 3JR7A 3RAJA 3MAAC 1DT5A 1U4SA 4LOJA 4DNOA 4LRUA 3NAMA 2OWEA 4ACBA 5KNDD 1KXJA 2HR1A 1D8TA 3ASVA 4EEXA 2XDQB 4KMSA 3X1XA 1XEWX 5D51S 1BN7A 2RGDA 4MYHA 1TI7A 1Z5PA 3EIXA 1WSWA 3H5LA 5AO9A 5FHRA 2ONKA 4EEZA 5J47A 4BQSA 3CF4G 1P4GA 3UK0A 4LK2A 1XDDA 1Y33E 3RIEA 1I94B 1EUCA 1R5NA 3HQ4O 2JGDB 4RCVA 4JOSA 4FFWA 4P6VF 5C1DA 4MPPA 1OI3A 2WIAA 3ROMA 2RHRA 1BH2A 1YCDA 3HLYA 5JQGA 2HB6A 1XF1A 1I3MA 5BRNA 2RJ3A 2QNRA 4P2GA 5IULC 1GLNA 4F2DA 4EY7A 3KUCA 4QLOA 1WQ3A 2W5UA 3RWBA 4EX6A 5KJCA 4KNYA 3OIVA 1NUAA 2G17A 3WX0A 4RPJA 1M2FA 2FUKA 5C46F 4HDCA 2BFWA 1CQZA 2BRUC 2XVYA 5AYVA 4IRUB 1SXHA 2C88A 3D2AA 5C0OE 4PRKA 1AV7A 2P4HX 3ADCA 1BSVA 2MJLA 4GDMA 1QO9A 1L8AA 1TVCA 3CS3A 3UJ7A 4ZDIA 3CEPB 1I1HA 3E7XA 3M5PA 2XA9A 5JBIA 1W44A 2CHEA 1CR2A 4J9VA 5FO0A 4WCDA 2JA2A 3GFRA 1TO1E 3OUTA 3PDHA 2A9FA 3PE6A 3KD3A 5AW6A 2JZCA 4M98A 2Q1TA 1YDHA 1E20A 3N1UA 3NYRA 4NCJA 4ILEA 4NFYA 4XIYA 5KZMB 2Q2OA 3K15A 4Y6RA 2M6KA 3W2EA 4ANFA 2PE5A 2YZ7A 5JEEA 5KTOA 1MZVA 1T5TA 4BQRA 1W30A 2OXCA 4R84A 2D1FA 3K2BA 4PCAA 4CLEA 3NRJA 4J3NA 1CUJA 3AIOA 1E59A 3WL8A 2YXEA 3DXXA 2O8BB 1SIUA 3CRW1 3HCRA 4O33A 2G70A 3BSYA 4DG8A 1ILEA 4COOA 2AYXA 3ZZNA 4BFTA 1G8KA 2Q3JA 3I2IA 4TMTA 5E6SA 1FXSA 1UODA 5IJ9A 2JLVA 3FYCA 3PHHA 3R75A 5BQFA 3O9VA 2AWNA 3DW1X 2ECKA 3RYFB 3LUPA 5GPBA 1NQ5A 4AUEA 1XZBA 2GKGA 3K09C 3RS9A 4B3IA 3GB9A 4FYKA 2H2IA 1IQUA 4YMIA 5DCYA 4NJOA 2ZTMA 2PUGA 3HRKA 3L0BA 1RYDA 1HWYA 4KQFA 1EVLA 1QV7A 4JUDX 1UKYA 1KO5A 4JA2A 1TKBA 4LC9A 2EWWA 4LWZA 4MW1A 4U3JA 4JYZA 4FOSA 3VNSA 2QP4A 2RKWA 3DXFA 4KXVA 1VCNA 3E5MA 2D13A 2CE2X 4PLVA 2FAXA 4W1PA 1KU6A 4LMAA 3A3OA 4TLBA 4TLMB 4P38A 5E0OA 5JSZB 4GGMX 5ALRA 3GJ8A 2BCJQ 1LTQA 5KI6A 4JLVA 2AJTA 5EQTA 4OU4A 4ZI3A 1XSEA 2UKDA 3KZCA 3MLEA 3IP7A 4N5DA 3OQOA 1ZL2A 3LPCA 2XBMA 1FJ2A 2CYCA 1JR3D 3JQ8A 4PS1A 3H9CA 5GWXA 1YB1A 2HF8A 1R0RE 2G4LA 2I33A 3I9V6 5BWCA 1Q0TA 1UM9B 5DTQA 2XF2A 1NNLA 1VGVA 1B3BA 2H51A 2NG1A 4P5EA 1WHSB 5FPHA 3AR9A 3UXMA 2QL7A 1H9AA 3OA2A 4LZWA 3LWNA 4YJKA 1H5NA 3E70C 4YJFA 5HS4A 2VF7A 4PO8A 4GPD1 4MEJA 3SVLA 1M1NB 1IFXA 2NADA 5KYNA 1QK5A 1DTEA 1RP1A 4H4EA 1S01A 4XB2A 4D25A 5AKYA 3PHGA 4BY9E 4DBVO 1L4BA 3PGXA 2VN8A 5HUJA 1NMSA 4GMHA 3I39X 4J1NA 1RJEA 4Q12A 3FVRA 3IOCA 4E32A 2GM5A 3RNOA 3VU9A 3LHFA 4YRAA 2I4RA 1M73E 4OK3A 3UAXA 1DKLA 1X15A 1MFZA 1ZKMA 1SUSA 2OYSA 3UVEA 3TNFA 2WLTA 3T5AA 4NRDA 1W8DA 3EH1A 3GA5A 4ZAVA 2VTBB 2YTZA 1P5HA 2H4FA 1AF4A 4W9RA 5TX7A 3U4GA 4CTKA 4ZZ2A 2Y27A 4YHBA 5HUQA 5JMTA 1XTKA 2ACVA 2GO7A 5I51A 1UC8A 2QZSA 2GAJA 5LOVA 2BSQA 3FVTA 1R00A 4XQ9A 1FP1D 3OZEA 3R3YA 1PJ2A 2C59A 2PWZA 1LVHA 4BNLA 4ZQHA 5FQOA 4LF9B 4PU0A 3WJAA 5FRDA 4ND3A 1XG5A 1D4FA 4N5IX 2X1VA 5TV2A 2BMJA 3H6KA 3I09A 3PJGA 1GTRA 2O8CB 5C7IO 2IE0A 3OZXA 2G1KA 4QUIA 3ZZUA 4RWEA 2JI4A 4RA9A 4BNWA 5TGDA 1NURA 3G6KA 1Z0JA 4LQDA 4BOYA 2BF7A 2JBAA 1EFCA 3O7WA 3MM4A 4XSGA 3PBKA 1FTNA 3DYVA 4UHFA 2IFTA 1C3XA 2QLJA 2ZIAA 4TT3D 2D3WA 5ECYA 1WXDA 5ESRA 1XTIA 5FTJA 1WB6A 2XGGA 2NU6B 4HGPA 3HABA 1W8IA 3NWEA 2BGGA 2FK8A 3KWFA 3Q5GA 1I32A 3ZHUA 2C0PA 3HWRA 1D6MA 2R7NA 3IDFA 1YFLA 5E9WA 2ZFUA 3FWHA 5J4VA 3H4IA 2B8WA 3CBGA 2JIZA 4NAVA 2WM3A 2ZUVA 3EJWA 3EPRA 3FI9A 4CQLA 4R71A 5LLTA 3B9RA 3ER9A 2WD9A 2GASA 1K66A 2X4GA 2XWPA 4M83A 3L9XA 4X00A 1YIAA 2NXNA 4ZAXA 3RFUA 4ZJPA 1BMFD 1V45E 1ONPA 1XWFA 4B0PA 1CF9A 1VGQA 3GH3A 1OYOA 3LY7A 1NXXA 2H1IA 4IDCA 3NHAA 2BT4A 2YNMC 4BZQA 3IILA 1FP6A 4OYHA 4KE9A 1F6DA 2UVPB 1NQVA 2V7QA 3FHOA 2JAXA 1PFYA 3ZTWA 5KO2A 4RLHA 4DCVA 1TLFA 4X3OA 2FW6A 3QUSA 5T41A 1ACLA 1X7DA 2HO4A 3FI0A 3H99A 3ORQA 4A8TA 5ABPA 2QN9A 2Q9BA 1P6QA 4Q3AA 3WQHA 1UBJS 1RI2A 3O3NB 4PZLA 2ZJBA 4MUAA 4MHOA 3RRZA 3H16A 5AHKA 3ZC3A 2G1PA 3I45A 4FYHA 4ZOAA 1N7JA 4XFJA 4A0GA 1JQAA 3O3MB 2MWMA 1V8FA 3ONDA 4HYQA 1TT5A 3ZGYA 1ZN8A 1ZSYA 3FE2A 3NVAA 1U04A 4HAXA 3TB4A 2CNKA 2COKA 1R4AA 2NTEA 3J81k 1FVOA 3RHSA 5C4MA 3V6MA 5F7XA 4NNOA 3WVNA 5NLLA 5KOHB 1P1RA 3WLHA 1OAOA 1B2LA 3C6YA 1RWNA 5T6BA 3R40A 3V2UA 2JGJA 1QVWA 2GN1A 2QMOA 3IT1A 1XOIA 4GW3A 4PYMA 2FSVC 5I9BA 1AQUA 3JQAB 4JI4B 3T5MA 1FYFA 3WXBA 2ZJ7A 4NENB 1F0YA 2QD1A 1ZM3A 3LE8A 4NE2A 4ZAFA 4A36A 3EXFB 4BLWA 4ND2A 2RCYA 4H18A 1TC1A 2JNWA 3TN7A 2XCLA 2QQ5A 4GXQA 2C2GA 4HKTA 1ZCZA 5JT1A 1OREA 1ODKA 1P3DA 1U65A 3DEAA 5BRAA 1XO1A 5D7BA 5LXTB 1QP0A 4C6HA 2ENWA 5MGNA 3MYRA 4KN8A 4D79A 1T5LA 3IE0A 2QDKA 1NMXA 3BG5A 3MJRA 2IP1A 4H77A 3HPQA 5DM60 2WKPA 3OQPA 2M6SA 1TQHA 4RKFA 4OXIA 2A5LA 1JL3A 4CNQA 1JKXA 1QIMA 3R0XA 2EXXA 4RZUA 4BLSA 4PLGA 4QBIA 1J20A 1T4BA 2GJSA 3P0FA 3PGA1 5B6JA 3DDOA 2QE6A 2CL0X 3QU7A 2W2QA 1QMGA 4JJ4A 3EN0A 4S1TA 1K7YA 3IB3A 3W8FA 3FUVA 2PTHA 1MLDA 3BYZA 3CLUC 5ENDA 4EW2A 4V0ME 5LMCA 1XRSB 2QVBA 3IQDB 3HI4A 3LVQE 3VPHA 1COZA 3R3JA 4XASA 1UKAA 4UXHA 1XTSA 4EHNA 5LCXA 3GDHA 5KYGA 2W6IA 3TFOA 4CV1A 1AKTA 4G5RA 1JQEA 3ZDBA 4KGDA 3MT7A 3MTGA 4WVLA 1EQAA 3LDGA 3RO7A 3C3JA 1G3MA 1MJ5A 2VO1A 2WZQA 4O4LF 1OH6A 3DLBA 5C52B 4OMFG 1IOVA 1O9HA 2FMKA 5FORA 1E3EA 2II6A 5FADA 4RDXA 5B7GA 3LK7A 3BGOS 2CK3D 4WVFA 1U31A 3OLYA 5FOUA 3N28A 2NV2B 3RQIA 1T9AA 3GA7A 2AC7A 4IWYA 4JUAA 3GG2A 3G1TA 3DR5A 3MTJA 2ZJ5A 3G9ZA 4RVNA 3LVRE 2FB9A 4FZRA 1DX4A 4N6NA 3MCWA 3V1TC 5K3EA 4CWAA 5J58A 4C3ZA 3FZNA 3RDPA 2QVGA 2OZLB 1U7DA 2XDYA 2ZBPA 3CG0A 1T29A 3REQB 4AYTA 1IBCA 3DL0A 3E05A 1IUPA 4B33A 3WNBA 1VBNA 5K2OA 4OIFA 5CM9C 4X1IB 1PX0A 2HSDA 3OCUA 4XDGA 4J0CA 1Y98A 3P0RA 2PX5A 3E4DA 4AU1A 1A7AA 1I13A 3KX2A 1E66A 4LF7B 1ZAYA 1RZUA 4DR5B 4LMBA 1OVMA 4Y1RB 4JASB 1YR1A 4GLBA 4IW3B 4ENTA 5E6RB 2FPPB 4BZPA 1I3CA 1RFGE 3FHLA 1X7YA 1FX0B 1I4LD 4WCVA 1VJRA 3PPWA 4BNUA 1ORTA 1SUIA 4PX9A 5IMSA 1E1MA 1SD2A 4WHMA 5JVDF 3IP8A 1AM4D 2G5GX 4II7A 5EKSA 5AVUA 2ZYIA 1AU9A 1UBSB 3AEZA 1YZTA 2X4LA 3GLRA 5T8KA 3V8BA 2LIPA 3DDZX 4WZBA 3WWDA 3J80A 4MR9B 2OCYC 1RQ2A 4A0QA 1HL3A 1OD6A 2JRCA 3DYIA 3X1YA 2PAFA 1KA9H 4MVXA 5U9CA 4PQGA 3PGMA 5CX4A 1RQRA 2YL2A 2EJCA 3ANMA 4B09A 2G9VA 4TS3A 3B8EA 4N4AA 3O4GA 1H2BA 4XVCA 2EQ5A 3L8YA 2XCSB 621PA 1FFAA 4O2AB 1PWEA 5JTUA 5DDIP 4O4HA 3WMWA 3VH3A 2C8JA 3A9UA 2C9OA 2WAOA 4U7HA 1VMIA 5ALFA 3Q7QA 4G56A 5IT5A 1ECLA 4OQYA 1BWQA 1XQXA 3D5TA 4PGGA 4MB6A 1P8JA 4GICA 3LUCA 4Z4QA 1TJYA 2OCAA 4QTZA 2XYHA 4WFKA 3VYVA 3LX8A 1NJ1A 1XZDA 2PIAA 1Z2AA 4DLAA 2CV1A 4NXNB 2I6UA 2A0KA 2W6ZA 3H8SA 3PUWA 4QYTA 3BJZA 3S29A 5LQJA 2C99A 1QBKC 4CI0B 1U0NA 3LT1A 2FZEA 4LCBA 1KDPA 1PIWA 3LLVA 1W93A 1WXXA 4MMXB 4LJ7A 3GZ4A 3U4DA 4HDNB 2IRWA 2QZ9A 3IRUA 1PTKA 1ESEA 3AJ8A 5CFZA 4FGSA 1OTYA 4C4PA 1E3IA 1GN9A 2JVJA 3CIOA 2ZYVX 5AOCA 5ER9A 1JX6A 1Q1ZA 2I8AA 1ZSVA 5CA0A 1K8RA 4W7IA 3UW1A 2NAFA 3UMCA 4RABA 4I6JA 3EEIA 4QE3A 3C6QA 3PEEA 3SQMA 1KYZA 3D4LA 4AZWA 5CTAA 2J9FB 2WOJA 3H18A 1MXHA 1XDZA 4CG2A 2WF7A 2YXLA 4MDHA 5ITVA 4BU0A 5LN1A 1UMBB 3KTAA 1DUIA 2B3TA 2V7BA 4AURA 5AK6A 3DVLA 4YYZA 5J4HA 3SZMA 2QI9F 2XCIA 4NZNA 3VKUA 4G0ZA 2JLAA 3FMOB 1P2VA 2ASEA 2RIPA 2PT5A 4Z5XA 3NT2A 2GYUA 2G9RA 3M33A 3RVSA 3RRXA 2RGAA 1H2XA 4L4ZA 3KJHA 4G0OA 1QHNA 3O9ZA 1PT9A 4I8DA 4CU2A 4KI0A 2HJ9A 2O1EA 4A6PA 1ANKA 1V8BA 3HZZA 4LHSA 5C7LO 1P33A 5D00A 4GKJB 5JPIA 5GGYA 4BEVA 4EF6A 2YXPX 3RUIA 1IWOA 3TM4A 3ZWDA 5EHZA 3MCAA 2GJ8A 3OPQA 1NZDA 1P5FA 4TQUS 5DSTA 1P18A 3WMRA 5BSEA 4ZDKA 1KY3A 2JD2A 3A1EA 3CT6A 1U0FA 3T0GA 5I01A 2IELA 3AYXB 1OWMA 3A26A 4LQ4A 2Z83A 3KAKA 1ORVA 3P9YA 3R3HA 1ACMA 1I36A 1KPHA 1MX3A 5IF9A 1JEQA 3K6SB 4F85A 4UZFA 2X14A 3FB4A 1JYFA 4RAQA 2D1RA 1I5EA 1C1XB 1WJGA 3QVXA 4HX2A 1Q77A 2ZYHA 2DWCA 2AMVA 4PWYA 2OYRA 4EQ6B 1EYZA 2C4HA 5JMWA 3NH9A 5H59A 1NC3A 1QRRA 2H5EA 2PO7A 4RADA 1X9GA 4YECA 1BX0A 4C05A 1Y4AE 2C4VA 4MV7A 3UIEA 3LC0A 1YJ8A 4LVNA 4B6JA 5EPEA 4PONA 2RBKA 2VQDA 2GPSA 3C45A 3LECA 4QM7A 2ZRFA 1F0KA 1P2TA 1YFZA 1DC8A 2ZRKA 4GBED 4R9SA 5EZ5A 4Q1DA 3T7KA 3U3DA 4YRGA 2A30A 3OE5A 4EPTA 3ZHTA 4H60A 3URKA 3ZV4A 1IZ7A 3QA3E 3PTZA 1EP2B 3ECAA 3PFNA 1CJCA 2VBGA 4IDBA 4Y2SA 1E62A 4GEGA 3ETLA 2GK4A 4BB5A 2FW7A 1R4MB 2NYUA 2C7OA 4MV9A 3O31A 8ABPA 2FZVA 1ODIA 1EE1A 3G7UA 1PE0A 3WLPA 5K7SA 1DAMA 1ZUNA 3A4MA 1YB6A 3AHGA 3ENNA 3IHWA 3D6JA 4E2YA 1UOEA 4BNXA 2Y99A 3FA2A 4LKOA 1QBGA 2D3TA 3I9NA 3SY8A 2Z04A 2CVFA 2FSFA 2G80A 4CMKA 4WRRA 5EZQA 2AFIE 5IKPA 3B51X 3GZNA 4M8NE 2IC5A 1IPHA 3GCXA 4FN5A 3RKRA 4YIHA 2BZ1A 1KK0A 1RRPA 1X19A 1KIMA 4MIKA 4W8OA 3WHIA 1LLCA 4Y7DA 2YFQA 4EYQA 1DRWA 2I6QA 4F93B 2PZAA 2TMDA 3N75A 1LFAA 1LZLA 2DR3A 4LC1A 4BRUA 2HREA 2HMAA 4ER3A 3X1ZA 3KXDA 1JZTA 2ZXUA 4F96A 3DMTA 1GTJ1 1TAGA 1VECA 4W1QA 1E2EA 1E77A 1PZEA 4GIBA 3BT7A 2XB8A 2PRZA 3ZDFA 4FP9A 2W2LA 1G4AE 3N5CA 5IAGA 3S2SA 5HCNA 4DPKA 3EUFA 3KC2A 1NAHA 4XRRA 2R3SA 2VEOA 1RIIA 3B7PA 3PJDA 5LQUA 3U56A 2PGJA 2W98A 2QMZA 1KOFA 2NZYA 3CSUA 4OKNA 1U3WA 4YXWA 3ZWMA 5BYAA 3D4PA 3FPCA 2RI1A 4U5QA 1SCUA 4B45A 1SCIA 1JN0A 1N75A 3QWBA 4EKDA 3BJRA 1W2GA 2PL5A 2C4MA 4KQGA 5DNDA 4NCHA 3A9CA 4RD3A 4HYYA 4WFJA 1H42A 4BB0A 2QTGA 2I6GA 3DC2A 2A2ZA 3K72B 4PC1A 4RVHA 2AR7A 4UNSA 1B0ZA 3QU2A 2PK3A 3SPXA 1XJWA 3BFJA 1YJQA 3PFBA 4WGGA 1ADGA 4O2AA 1T8PA 3HY3A 3K1TA 3N6RA 4R1SA 3R8CA 3VC7A 2XNHA 1H2ZA 4UM8B 4AMUA 3JX9A 4HTFA 2BP7A 2REQA 1Y6QA 2P6RA 3U2QA 4C89A 1G8AA 5FNZA 1LC3A 3VA7A 2VNKA 1SQ5A 3BMXA 4R41A 2WZBA 4M8LA 2AQKA 4E46A 4M0LA 4P4TA 2BGRA 2H3HA 2E1PA 4F4UA 1MRZA 3B3JA 1JE1A 4RK5A 4AJ4A 2G88A 4KHPB 4MRVA 1XQVA 1K86A 2AFVA 5HJ5A 2C3PA 2FSSA 4DMCA 4TKUA 3WB1A 1U8TA 1NBAA 1Z8NA 4NDAA 3KQYA 4CIDA 1BXGB 2N1MA 1KU0A 4L4YA 1P9RA 1DKQA 2VJAA 3LY9A 1MH9A 5EIBD 3DHYA 3RK4A 1H65A 2QNIA 5DBFA 5HZHA 5JNRA 1CTQA 1N2XA 1K8YB 2QQGA 2I6SA 1KEWA 5JWRA 1AO3A 3Q0EA 2WSBA 3H3FA 5CA0B 2JFHA 3LGXA 3AONB 3CW2A 3LWZA 3M7IA 1NW5A 1OPRA 1S3FA 3B9QA 3L1UA 2DF8A 2HPAA 3QKUA 7REQA 4IWXA 3LBFA 1I2DA 4HB0A 4XX1A 3GG9A 2QRHA 4QASA 4JFAA 5D87A 2Z8YM 2W8BB 1J99A 1E7QA 4GL4A 3JAMA 3L7AA 4G5YA 4CJXA 2DUWA 3I9KA 4AZ3A 1TJ3A 3O4RA 3VYTB 1K63A 3UC5A 5HIJA 4XW2A 1MHPA 5ENZA 2O8FA 1U5BA 3QYPA 4M53A 3RVPA 1QCCA 1VHJA 3VTKA 2PUDA 2C54A 1K89A 1H6BA 1MENA 3Q9SA 4ID9A 4PYNA 4U9HS 5DFAA 5G1OA 4JU9A 4Y8VA 1Z4IA 4RKRA 1JMYA 5DU2A 4W8HA 2ZVDA 1ZU4A 1FBTA 1P4AA 1W4ZA 3C97A 1WZEA 4M1SA 5AT1A 2J9RA 2K7ZA 3H05A 3CWQA 4YEDA 1Q7CA 1ZGGA 1XVVA 4BQOA 4CU5A 4H1HA 3CPHA 4U8HA 1R3DA 1RE1A 1Y48E 2XR1A 4K7JA 3VI3B 2FLKA 4BFLA 4R40A 1V26A 4GPAA 1JU9A 4JJ8A 3HB7A 3W6OA 4OMCA 4DIDA 1PK8A 3NEAA 1DFIA 4GZ5A 3LHKA 3PENA 4KXFB 4MXDA 5LB2A 3UMFA 2PGDA 3PWSA 5L4SA 4UASA 1ZJZA 2QXUA 1SR8A 1XD9A 16PKA 3HCBA 4X5OA 1WXGA 5IJAA 2E5FA 4DA9A 1GM5A 3ICQB 1NW7A 3BX1A 3S8YA 4AYXA 4J16C 4GZLA 1GPYA 2ODAA 1XCPA 1L5LA 1IRIA 3P0EA 4DREA 3GDWA 3PI6A 2O3RA 5F3RA 2AOUA 3UG6A 3CX3A 1JHZA 2FF7A 4EJMA 1NXWA 1SKYB 4PM4A 2GNAA 3U0VA 5CURA 4HLNA 4KREA 4QPNA 1Z06A 1L7OA 5JCXA 1C8KA 1U8CB 4DLUA 3RH0A 3WKDA 5I8ZA 1RJ9A 2V74B 1OKKD 1IVYA 2GS9A 1BMDA 3IAUA 1U6IA 4D8VA 2ZGVA 3BIWA 5LMZA 4GI1A 1OXTA 1GZ6A 2ZSEA 3KKMA 2JLZA 2DJ5A 2VCYA 4M7PA 4LDAA 4V39A 3R3VA 1J33A 5DNYB 3EGDB 1WHSA 1G55A 3JD2A 5KNCA 2CT8A 1YO6A 4U02A 1M8GA 2IOQA 2A35A 3FNRA 3PHJA 1WE2A 3CLRC 4X1KB 2H92A 2JD0A 4OMDA 5E1MA 2AV6A 3B85A 3IP1A 1NATA 2P0YA 1DQNA 2YZGA 1W5FA 3OLQA 4AO6A 3IAM6 3IBFA 2VHQA 2VF2A 1ML4A 1U7HA 3AM5A 3JSAA 1RRMA 2RCNA 2WWFA 3KCNA 3QTTA 4TTTS 4V38A 5E3IA 4Q3OA 3H11A 3UMGA 3HJRA 1U90A 5DMHA 5DTJA 1EQUA 3T61A 5HW0A 1WAMA 3B1VA 3ZDQA 4QG3A 3WFIA 3SKVA 4EO9A 3ZJ4A 1W48A 2AOVA 2EFYA 3W6UA 3BA6A 3NTQA 3GT7A 3SI7A 4CKWA 4K81B 5INTA 3DJYA 3UG7A 2H85A 5JO9A 4FYWA 2IHNA 1OXXK 2H1OA 5LSAA 1MDFA 4XWGA 1ZW6A 4EY8A 3C8ZA 2J33A 4Z8XA 1YVPA 1KTVA 4Q9IA 4WZAB 1RQ7A 4L1KA 2AXEA 2QJFA 1NI4B 2XWSA 4OL0A 2EWVA 5CCBA 2QX7A 4N9QA 4FB4A 3DVRX 3AP1A 3ZV5A 1P4SA 1Q19A 3BQNB 3RLFA 3TIIA 4B3BA 1MAAA 1CUIA 4IJUA 3T3GA 4C08A 1T1GA 4LBYA 4N0PA 4UBIA 2E85A 3L1KA 2WMNB 1EAMA 1J56A 4J7AA 2GBIA 3CNQS 3NHBA 3Q3CA 4KFRA 5GM2A 2J87A 3VZRA 2CC2A 1OYVA 1KEPA 3EGEA 2M9MA 1U02A 4C43A 1KVRA 3AFHA 2X8WA 4LNAA 4WL0A 2OC9A 5ALOA 3TCNA 1CB7A 3H2YA 1LDYA 4J8PA 3T7EA 2HWKA 2JANA 1MT0A 5DN6D 3V8VA 1M1XB 1VP9A 4OI2A 1QNLA 4WV3A 3BZWA 4KIWA 2AF3C 4HYTA 3HO6A 3LL4A 4DMKA 5E4FA 1PQ4A 3HUTA 2HCJB 3U6KA 1D6NA 2A9PA 4YLEA 2C00A 3E61A 2QY9A 2Z3WA 1TIPA 4ECEA 1I6MA 3JWIA 3TOXA 3WNZA 1QNFA 3BXEA 2Y9PB 1W4BA 2AMFA 3DZ8A 4Q37A 2NVOA 1WABA 3H2SA 4LC0A 1JFLA 1P1IA 1U1IA 2VDOB 4TKVA 3K8OE 4ER0A 2F3RA 4ZCMA 1JNXX 4OJNA 2RGGA 1Z2DA 4KEAA 5BRJA 2OHOA 3UWSA 4CM4B 1TA4A 2BI4A 3FKSA 3AF5A 4BUJA 1G21B 3NDRA 5LLDA 1AV6A 2D06A 3AL3A 2B5OA 3TG8A 3ERCA 2YMLA 5LA6A 2I99A 4XWAA 1ISRA 2P2ZA 4V02A 1EJBA 1CIJA 3EVGA 1JHVA 3WY9A 2IYEA 3L8HA 1VIDA 1ZWLA 3F74A 3QEJA 4FBMA 1OB5A 2XNDA 3TEMA 4NR0A 1DEXA 1ZN7A 4BO3A 3WIDA 3D1LA 4C0BA 4IJKA 3EVTA 3HWSA 1VBFA 2PZMA 3M5CA 3MIZA 3O3CA 3PQ4A 3QE0A 4G0YA 1IN6A 3EDOA 4JLMA 1A2OA 2B5WA 3FCEA 4QXQA 4R8VA 1KE1A 3TQQA 2PX6A 2QLTA 1G0OA 3EXFA 3HN7A 3TD9A 2R00A 3AF6A 3ZE1B 4YR9A 3GFTA 4IIJF 1J0DA 5JCJD 4UHCA 4LZNA 4E31A 4XWOA 1W88B 2AB0A 4MEAA 1XZNA 4RNCA 1H2EA 4P0TA 4CV0A 3LPAA 3RU9A 2PMDA 4CGYA 2AR9A 1W4RA 1L4KA 1UCFA 1XZMA 2J41A 1K9VF 3O82A 4QUBA 2C2KA 3E22A 4TV9A 1LBHA 4CTNA 1I9GA 1ZA1A 3FZEA 5IAEA 3KS9A 2XOXA 1TRHA 3WK5A 5M04A 4IDFA 5K0EA 1VGRA 1KZGB 1WKCA 2QDXA 1N5KA 3KKKA 1UM8A 3M2TA 3D43A 3Q10A 4DM4A 3V5NA 3N05A 3MZ0A 5FHQA 1R9JA 2SKCA 2ZUDA 4PBSA 3QMVA 3CRRA 1EVKA 5H9WA 5JANA 5EXTA 1WOYA 3BK1A 4WKGA 1HI9A 2H4WA 2ZR7A 4DC1A 4YFVA 13PKA 5U1PA 1Q17A 2V7GA 4Z0NA 1LVUA 1ZVQA 1K2VN 4ZYZA 2QTNA 5DSXA 5E1OA 3D0QA 1C3JA 4KNWA 3M83A 3AEKB 3SF8A 3D02A 2DUJA 3SQLA 4GPZA 1YR2A 4E0BA 4BQFA 1G9TA 1Z26A 3WA6A 3KLMX 2FRVA 4JSYA 3A4TA 1NF2A 4XB6B 1EZZA 1PFGA 4CCYB 2AZXA 3K9FC 4IUDS 4C03A 4IJVA 1AUVA 2Y68A 1U2ZA 2D5IA 3MINA 4QEZA 5ALSA 2VPIA 5FBLB 1XPRA 5FTNA 1CY8A 2C2YA 5KNCD 3WNVA 2GXQA 3GQBB 3NETA 1OA0A 3M6XA 3EMKA 1FYVA 4H1TA 1U0HC 3EOAI 4KWEA 4S35A 2HYIC 4H0CA 4EF4A 1KJ9A 3A8TA 1IY0A 4C21A 2PWBA 3P7MA 4MYTA 2BN4A 1DS6A 5DCWA 4DQXA 2VHYA 5KU7A 3I4CA 3DTNA 4QGBA 2ERYA 4B3HA 3GLFA 4ZT3A 3AFIA 1ZG3A 4AX4A 5BW8A 1NN0A 1P1CA 3AXSA 5A0TA 4B47A 4IDOA 4GHWA 4IEIA 5BYBA 4IFIA 5AESA 1B6GA 3NKLA 3CX8A 2CZGA 1FMTA 4ITRC 3T3HA 3VDMA 2XMQA 1HNZB 1QQ5A 4EB6B 2PFSA 1HT2E 1EK6A 5FUWA 1XXHB 5F77A 5B6IA 3AU9A 1XZQA 1W34A 1QDUA 4WNYA 2B0JA 3FF4A 3GBSA 3GLHA 3BZBA 1XRNA 3LBIA 5M7EA 1U63A 3RG2A 5BV2P 1OBHA 4JGGA 2IEGA 4V0RA 3ZY6A 2AKEA 3CZ4A 2NO5A 2FFBA 1F1BA 1TYBE 4R3NA 3EIFA 3TLZA 4WBNF 4B8YA 3HU2A 4YK7A 1D6JA 2H16A 4IX1A 1CUFA 3RSCA 1TTHA 2HC9A 2PX8A 2V9ZA 1LDEA 1BQ3A 1SUEA 2ZT7A 3EFHA 4R4JA 3TSOA 2NO6A 2GJKA 3QUBA 4QSHA 1CC1S 2WKRA 1ZGJA 2B4YA 3TLYA 1FNSA 1M6YA 4FYVA 2RKOA 3GAZA 1CZNA 4P54A 5EYPB 1J9EA 3JYHA 3UOAB 1UBCA 4C4ZA 1T9GR 3B1FA 3TGWA 1LWNA 4EG3A 5FPPA 3VR1A 2FPGA 2IW3A 4M0MA 1BGWA 2ZI4A 1M8JA 5F2EA 1GPKA 3SJBA 3HJHA 3ZKWA 5FDFA 1PYGA 3ACDA 3GVCA 1U6JA 2ZE6A 2ORYA 2P7IA 3IAAA 4IKPA 1WCYA 4Z4HA 5LP6F 1JIKA 4JS0A 2CNLA 4RL4A 4MA4A 1X1QA 4O5AA 5HUHA 3WB2A 1AKWA 5J2TF 4D02A 3UJHA 1N1DA 3VPDA 4YRMA 4EHFA 2DRIA 1I4DD 2ZSBA 1M0SA 1YJAA 1R0SA 2FUG1 4TS9A 2XQGA 4ZHQA 5F4ZA 2QF7A 3S55A 5IC4A 1O5IA 4JKIA 2MYUA 1MJFA 3KPWA 3C98A 3ZDDA 5JCOA 4LRSB 2ZS8A 1T9BA 4G1VA 2NWQA 1XRJA 3EX7C 2XMBA 3LOUA 5KJ1A 2O2GA 3PI7A 4D3DA 3OETA 4WGFA 2VTVA 4BLVA 1XMSA 2IXFA 3T4XA 4KYTA 2C83A 2NUAA 4AZ0A 1W6UA 2QMQA 2J5RA 4IOLA 2W43A 3WIEA 4FE7A 3OZTA 5FWYA 2J09A 4IYJA 4Q1VA 1IOLA 1YJCA 3K53A 2J46A 2ASVA 3OJOA 6AT1A 2Z2JA 3O2NA 4OD0A 3BZUA 2AXNA 1K0UA 3MG9A 5IXSA 2C4UA 2C9ZA 3E9ZA 3D2CA 3LX6A 4HXGA 4WOKA 4PQEA 3NGLA 1VYUA 2HRBA 4HNQA 3FCSB 1FU8A 5BSMA 2J6CA 3FIJA 3NHMA 5AM3A 3TL6A 1P91A 1Y8AA 3U48A 3KEFA 3D7NA 5G40A 2QL6A 2ZANA 1GNPA 1CSEE 4QQFA 5TPWB 1D8AA 3ESAA 3ZI4A 1JA1A 1M6NA 3I5UA 3MUFA 1O96B 3AERA 3GRZA 2EBHX 3A36A 1JXAA 3PJFA 4X94A 5E4JA 3TZHA 3UH1A 3ZWYA 3B48A 2GO1A 1E9SA 4KQHA 3TD6A 2CHFA 4H7IA 1ZMTA 3R7NA 1JLSA 3LX5A 4NKRA 5IYZA 5T57A 4O4JF 1GUDA 3SGLA 5KHOC 2ZRHA 1OI4A 4Z6KA 2CLCX 2Q3EA 3BXOA 1RCUA 1MGOA 3B5EA 1CHDA 1G6Q1 2ZUBA 1CS0B 3AF1A 1QIIA 3F5SA 3HBMA 1NNI1 2H1SA 3IEUA 3QXCA 4XD7D 5ULLA 3SOPA 4FOLA 2GYYA 2FHPA 3N86A 5THKA 4BMCA 3ORSA 1NXOA 2J48A 2J85A 1IM2A 2F8LA 1WD7A 2E3JA 3TB6A 1Q50A 2WLSA 1GPMA 2JJ8A 1ADJA 1VLZA 3OSUA 5ICSA 3WNCA 5BQOA 3QVKA 3KOOA 3K30A 4JVMA 4OHYA 1ZITA 5IAJA 5FI1B 5B36A 3OX2A 2DMRA 2PY6A 4WOJA 5AUNB 3VO1A 5A02A 2VSOA 3PWTA 3WGTA 4RORA 1IEQA 1DTSA 1MJGA 2YMPA 5JCZA 4JEUA 1T1IA 4LJSA 1YQXA 2JAWA 3VKHA 3IA7A 3DG9A 1QMPA 1JU4A 1ZIPA 2OLJA 3G2OA 5JUWA 1CRWG 3JQ8B 4NMXB 4LUCA 1K5DA 2PXAA 1SXJB 2D0DA 4P3XA 4FJ0A 5JTTA 1JDZA 3AEYA 1VE1A 4F9GA 3QPVA 2MCFA 2R7LA 2JPDA 3DBLA 5ALQA 1HE8B 4AXBA 3A05A 3ZW7A 1FTWA 1Q1AA 1V8PA 5E7IA 3E2MA 1W0KA 1KZ6A 3CZRA 3VU8A 1SVIA 1T35A 1B74A 2VXOA 1L5YA 4WCFC 3DWFA 4B3FX 3O74A 1L7XA 1PHPA 3KSDO 4XQ0A 5TR9A 4W5RA 1D4OA 1TADA 3N7UA 1ZM9A 4DCOA 4CKXA 4KR6A 1UF9A 4EW3A 2RGXA 2V96A 4H7DA 4L4XA 4RL6A 3LWBA 4XFDA 1BS1A 3DQPA 3CNNA 3WL3A 4B32A 1UZMA 4ZAYA 1HNNA 3JQ7A 4ZVSA 2WFLB 1M83A 4GVXA 3ZE0B 2REBA 1UQUA 2OG1A 2PXHA 4H3KB 4E4YA 2BW0A 5BYJA 1KZYC 4UUAA 3CRQA 5FPTA 2A94A 3ICCA 3WQBA 2ZM5A 1QU3A 3HBFA 5BUZA 2Z2YA 4M46A 4E14A 3EXHA 5ALZA 3USCS 1CUXA 4GPBA 2JAQA 5CNJA 5I7OA 4I3HA 2HK8A 1QHFA 3H2JA 4TYMA 3W5SA 4RMIA 1RQPA 1P19A 3QEKA 4NYJR 2PXXA 2CYAA 2OCXA 3EAGA 3ID6C 4MGYR 3PCRB 4E70A 2FRDC 5E95A 3GELA 2UYQA 3BB4A 1JDTA 1MQAA 4JOBA 2GDJA 3ZEIA 1GN8A 1ZMOA 1FDSA 3OJCA 4F91B 5LP6A 5DM70 2W90A 3NUZA 1H4SA 1OTXA 3LKZA 2BH9A 1UZLA 1VG8A 2B37A 2DFPA 1BIFA 1M5UA 2R79A 4IAOA 4UMFA 4UPEA 1KH3A 4PAOA 4OLJA 3VO2A 1LI4A 5JARA 3P32A 3WIOA 3QE4A 4LWQA 4N3BA 4C4SA 3M1AA 1RBYA 1RHJA 4XLLA 1UH5A 4A8HA 5BVGB 3ROXA 1N33B 5IC6A 2O7NA 2HMYB 4MEBA 4N47A 3H3XA 4DLVA 4HNTA 1MO6A 2XMPA 1NU8A 1D0VA 1ML3A 1QO0A 1QVZA 1QXSA 2Z08A 3I30X 1YOVB 1GQQA 4KG7A 4RETA 5F76A 2CXTA 3KOUA 2BI8A 4KN9S 3LC7O 3D3KA 4P7FA 4M8IA 3QFCA 4PRYA 4BLOA 3DVQX 3G1UA 4I1IA 2PO5A 4AZ0B 4AZVA 2BUBA 2HO5A 3GAAA 5KDOA 3REOA 3ZDCA 1PJTA 5AJYA 3P26A 1XRPA 3OX1A 1ZI8A 2JK1A 2VPZA 3HBNA 2AI3A 1LTHR 3RRJA 4E2FA 5J5AA 4C7BA 4JI1B 1AY0A 2XBLA 3CUKA 3GRKA 1T0HB 3COWA 2E89A 3QG1A 4Q9AA 4F5EA 1WMEA 1GAXA 1V9LA 4MGEA 5DISB 3UHJA 3WK4A 1T1EA 4FE4A 2P9FA 2EAUA 5TEWA 5DLYA 3V3TA 3UMRA 1CQIB 4CDGA 5B1YA 3DT9A 3FUCA 3A1SA 3COSA 2F3TA 1UBUS 1V25A 4NOMA 3R3UA 4XAQA 5HKAA 1BFKA 1ZKDA 1J97A 2Q4OA 2XXJA 2H0RA 1CJUC 2IPOA 1OX4B 1LI5A 1HPLA 1E3WB 1XVUA 1KMMA 2R1VA 3CHYA 3EA4A 3GUHA 3ITNA 3Q2IA 3AX6A 4C0XA 2C0CA 4DCPA 1SUBA 2RGBA 1FDIA 1OLOA 3NBKA 4X45A 2HJHA 4EAQA 4WDRA 3FOZA 2P9YA 5EE0A 3ZQUA 4C5BA 5KBYA 1WMFA 4C22A 5JNVA 2FEKA 4O4IF 3OBIA 5DM4A 4ZVKA 3O7MA 3RS8A 1QIHA 6LDHA 3MWJA 1XZIA 4HAYA 1UT5A 3WDSA 1BAPA 3E53A 1FFCA 2J32A 3QZUA 3KDAA 2XEXA 4RK7A 2IZZA 3OIUA 2V3WA 4HDKB 3IMFA 3UAZA 3ENVA 3SLGA 4HFNA 1CVIA 2MIIA 2RJOA 3AM1A 1KK2A 5MN5A 4B6QA 5AVKA 1HT0A 1EP3B 1CIPA 2YS7A 1VPWA 5IYZF 1VB3A 5IJ0B 4HLQB 2EEPA 4G1FA 1M3SA 1K7EB 5I5EA 1H1LB 4AD8A 1QRUA 3MAJA 1GR1A 4DY6A 4IH9A 5I4CA 1P9LA 1RQNA 1N2EA 2B9VA 2AFHE 3TRKA 2BBOA 3CLSD 3T7CA 2GK6A 1WMSA 2GD6A 1E32A 3TL3A 1KTIA 2CYBA 4QUDA 2CUNA 2JIQA 4IDAA 4R7GA 5SZIA 4KHZA 3THWB 3BEDA 5IKOA 4XIJA 4CPDA 5CYPA 4BMOB 3UGQA 3P5SA 3X1MA 1W85B 3TBFA 4TTJA 3G5AA 1JV2B 1XHLA 1BGVA 1UP6A 4QBGB 5AXDA 4GMXA 4KPYA 4Q3DA 4LCEA 1NU6A 1T8SA 3QHQA 1M2GA 3DL7A 4AB1A 1YB2A 3MCTA 1KRWA 1ELOA 3U7HB 4JLNA 5I45A 3TECE 1GSHA 1NT4A 4JSTA 4C7JA 4BNJA 4YMUA 2QYOA 5LP6C 1RVV1 3RVOA 4M8KA 2J0EA 3ABRB 1JHXA 3D1JA 5CNKA 1V6AA 4I1YA 3WV5A 4JL5A 5KKAA 1SA0A 1T6XA 2B83A 1MO4A 3ET5A 4WX2B 1CFJA 3KKLA 3MEQA 4MKIA 2VHZA 5AOBA 5L7YA 1SBCA 2HU2A 5IFLA 1QIJA 1Z4MA 5JADA 3FLMA 4GU5A 2G72A 4DADA 1TUBB 4WTOA 6YASA 3NORA 4ZKEA 2X8LA 4HDRA 3KXPA 2OPBA 3D3WB 4KK3A 4Z51A 2O1XA 1A9XA 3I5YA 1IJKA 1L5MA 1NQXA 1X77A 2NX2A 3DBLB 1D4AA 4MUXA 3DAOA 3LCUA 3TPCA 2F55A 2PKCA 2PX2A 2YASA 3DHVA 4MB2A 4U5XA 3D8BA 5BN3A 2LBPA 1PWHA 4RVSA 1PX2A 2HJGA 3CF0A 4OXYA 2ZI7A 2GKSA 4BV9A 4IGKA 4E5SA 3L49A 2GRJA 3BVPA 3IX7A 4LF4B 1L7QA 1RYEA 2OZLA 2EIHA 4RGQA 3JXEA 3REQA 5BY2A 1JJ7A 4MI9A 4E4RA 2GXUA 2I3DA 3LYHA 2BR4A 2PNFA 3ORRA 4QAJA 2VDPB 5FP0A 4W9MC 1L6IA 2B7BA 4LI0A 3V7FA 2AEMA 3WC4A 1OQAA 1RCFA 1Y5NA 2N75A 4HB3A 3GL9A 4IOKA 4KQEA 5ICFA 1JFTA 1IBKB 1U2PA 4BGDA 1ECGA 2OL4A 5G4KA 4E88A 2PS3A 2HLDA 4EDHA 4F4IA 3B7WA 1A5ZA 1JIXA 2XKAA 2LIVA 3PIDA 4HUJA 1BXZA 2ZITA 3JQRA 2FVXA 4N8EA 5EERA 3UV3A 3ZCPA 4JHXA 1JDSA 1QR2A 3DWEX 1EG2A 3N5KA 2ZBGA 4UE3S 5B6PA 1PW5A 3N7TA 1KKMA 3VOTA 2XE7A 2ICAA 1Q44A 3WLTA 3F90A 3GWZA 4L0CA 5EINA 1DP4A 4ZTBA 2GESA 1MV8A 1MO2A 2JATA 2JW5A 4Q4AA 3F5QA 3FR7A 1U2DA 3K70C 4DIKA 3A7EA 3IYLW 3ONEA 3MWKA 2NZJA 2NNWB 2C8LA 4NK5A 4U7GA 4L6AA 3AKDA 2JK0A 4D5EA 1N8KA 1OT3A 4GOOD 5I7FA 4A4DA 1UM9A 1OV4A 2QUAA 3L7MA 4OLAA 4Q00A 1VSBA 1U7XA 2FZGA 2VZEA 3PKIA 4FDUA 4HD8A 4M86A 4OQEA 3UCEA 2PJUA 2FPOA 3JATB 2QG4A 4IVQA 2IEIA 3DDNA 3K32A 5EMLA 2ZSHA 2JAUA 4YUAA 5DLQC 3MILA 4ARVA 1QO7A 1YL5A 2X1HA 4ZV7A 3NT4A 4M1QA 4RKYA 3IOBA 3QV