2CNQA

Atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
301
Chain Sequence
b'SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
publication title Saicar Synthase: Substrate Recognition, Conformational Flexibility and Catalysis.
rcsb
molecule tags Ligase
total genus 106
structure length 301
sequence length 304
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cnqA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2cnqA02
2ITUA 4ZJIA 3UNZA 3VRZA 3WI6A 3PY3A 4E20A 4TZRA 2YWVA 3KC3A 3CQWA 4K8AA 1YI4A 3RMFA 4D2SA 3Q9WA 4CRLA 5I9WA 2YHVA 4YZ9A 4FNXA 4DG3E 3PDTA 3D15A 4TRLA 4U8ZA 4BCOA 3NS9A 3WF6A 1ZMWA 4E1ZA 3QTZA 1H26A 5KNJA 2ERKA 2UVYA 4F0GA 3QBNA 2VTSA 1OGUA 4TWOA 3L9NA 5CSVA 5TOZA 1XKKA 3NPCA 2R3QA 4YJVA 2PVJA 3S3IA 1ZLTA 4IJ9A 2J5FA 3UBDA 3PPJA 2XKFA 3MA6A 1KV1A 2EWAA 3P0MA 3PPZA 4FIFA 4RWIA 5AAEA 5M4IA 4S34A 5AUXA 3WARA 3DK6A 2XK3A 3BV3A 5KUPA 2HYYA 3KXXA 4PV0A 4O7NA 2R2PA 2R3JA 1PXPA 1CM8A 3P23A 4GKHA 4IM0A 4NTSA 3TM0A 4DN5A 2O2UA 2RL5A 3GIDA 5DR9A 3FXXA 4KBKA 5HNGA 4EYMA 1PXNA 3R83A 3HMOA 1YXVA 4IZ5A 4TYHA 5E91A 5KE0A 2FSMX 4F9BA 3HV4A 3GUBA 3DBQA 3E63A 3OG7A 4AZSA 1L8TA 3E8CA 3UO4A 4CGAA 3DAEA 2GDOA 4EWQA 3H0YA 2V58A 3NCGA 3PA4A 2PVMA 3EYGA 3FMHA 2B55A 3UMXA 4Q2AA 3RCDA 2XVDA 3BU5A 3N9XA 4RJ6A 4NFNA 5JGAA 4IAZA 4ITIA 2PU8A 2A1AB 4XP2A 1JVPP 1Q97A 3Q53A 3R04A 3ZXZA 2WU7A 3QRJA 3NUPA 4FEVA 3FC2A 5FXRA 5K4JA 1YDRE 3LFNA 4I6FA 5EDPA 4DLIA 2YDIA 3VBTA 3OD6X 3LM0A 5J2UF 4D58A 4K18A 3OXIA 4I6HA 5ANEA 4JQ7A 4AT3A 1TQIA 3DGKA 1ZAOA 2B53A 3GEQA 4IDVA 2IZSA 4QYYA 3RINA 2C68A 2WTJA 3FZ1A 4MQ2A 3NUYA 4X21A 2CGVA 2OF2A 4NFMA 3QQUA 3BPRA 2OSCA 5AP5A 4BB4A 3DKCA 3KQ7A 4Z55A 3QF9A 3E8DA 4A9SA 2I7QA 5C27A 5AFVA 2P33A 2VTTA 4TV8F 3RV4A 1SVHA 4U7ZA 5IMEA 3BHTA 2VZ6A 4MA0A 5BPHA 3ZRMA 5HE2A 2B54A 4I92A 2XD4A 3ALOA 2RFEA 3PXZA 2WTVA 4KUJA 4XV3A 3VPCA 1TQMA 3ETJA 2QOLA 3FQEA 4XP0A 5IQDA 1GNGA 5HICA 4IB3A 4DGGA 3C9WA 1GOLA 2PK9A 2X9EA 3L9PA 5J8IA 4IB0A 3V5QA 3WF5A 3CQUA 5A9UA 3QTXA 1SYKA 4I4EA 1W98A 4EI4A 5JN2A 2VR1A 5BVOA 3CEKA 3V5TA 3I7CA 5IQEA 3RALA 3ZTXA 3OW4A 3PTGA 5LCKA 1U5QA 3AMAA 4MH7A 4JNWA 3UYTA 5FUTA 4DLKA 4KIOA 5HVKA 1JKJB 2YERA 3CY2A 5DEWA 1V0BA 3AT4A 4FTJA 5IH5A 3AT2A 3OEZA 4PTCA 3DU8A 3KREA 4FZ7A 4Y5QA 4BI1A 3TG1A 1QPEA 2BILB 4C36A 3FXZA 2FYSA 1DIKA 3VPBA 4LRMA 2I8CA 3PVUA 4JI9A 3QGYA 1QPJA 1SNXA 1HOWA 5AEPA 2R5TA 1TQPA 4EOQA 4DGNA 2P2HA 3D14A 3AC3A 3P7AA 2B9IA 3IW5A 4IVAA 3OHTA 2IW6A 5HVYA 5I5ZA 2DYLA 2IN6A 4XRJA 4RZQA 4GEOA 5AP0A 3QXOA 4C2WA 3FLYA 1Z5MA 3CQEA 4ID7A 3POOA 2Z02A 2YA9A 4O0YA 2Q0NA 3G0FA 5H8GA 4HYSA 4J98A 3RAHA 5EW8A 5DEYA 3EQIA 3WE4A 4J97A 4OR5A 3TV4A 2O3PA 3G0EA 2GQRA 5IA0A 1EUCB 2YRXA 4ZY5A 4CG8A 3SXRA 5KBQA 2VQDA 3CC6A 2QHMA 1LR4A 1UNHA 5EK7A 1Z9XA 3FZSA 4TPTA 3VHEA 2J50A 2DWBA 2OIDA 2I6LA 1NA7A 1UU8A 2QG7A 4U3ZA 4DINA 3AX6A 3OUZA 4E4TA 5GHVA 3GQIA 3HAMA 5AWMA 4EK4A 3GENA 3ZFMA 3AD5A 4PP7A 4ANQA 4C38A 4GRBA 3WF8A 3JPVA 2PZPA 3N4UA 2UUEA 5IA3A 1NT2A 4FEUA 5LYJF 3PG1A 3GU5A 1SM2A 4MCVA 3R8VA 4G31A 2Z7QA 4FIEA 4D4VA 2JLDA 5GINE 5DT0A 2W70A 4J52A 2G2FA 4ERWA 2RFSA 4C35A 3UZPA 2NU7B 3DB8A 3NUSA 4KA3A 4WT6A 2W1DA 4EQCA 4JDKA 2XCHA 5CSXA 4JX3A 1YOJA 4C58A 3OWLA 4BDJA 1FQ1B 3MSSA 3O51A 3PP0A 4FTRA 1KJ9A 3MWEA 2XB7A 3MH0A 4X3FB 3THBA 4FNWA 3CGFA 2YFXA 3BHVA 2PVNA 4NH1A 4BGQA 4R78A 4FSMA 2OK1A 1YXTA 4BCJA 5I9ZA 2YITA 2BRNA 2X7GA 4O6EA 3UQGA 1VBGA 4FFRA 3DXNA 1WVXA 3WZKA 4EUTA 4A4OA 4LYNA 1FVVA 2BZJA 1X8BA 4FKJA 4OTWA 2C1BA 4E4MA 4G3EA 4BN1A 4BCIA 4EOLA 5I0BA 1B38A 4WNPA 3WYYA 1NY3A 5IG1A 4DTAA 2GNHA 3G33A 4IEBA 4MVFA 3A62A 2YYAA 5CWZA 2ZDHA 2QF7A 2ZAZA 1O6YA 3QCXA 3N51A 4OLIA 1JAMA 3E88A 4ZS0A 1OPKA 1QL6A 4LGGA 2X0SA 3NUAA 4YBKA 3ZXTA 4D0WA 1GLVA 2OU7A 3TKIA 3DF7A 4BZDA 3COIA 4O6LA 2QC6A 2X6DA 4IE9A 3PYYA 2V7AA 4O0SA 4QQJA 4X6QC 2XNMA 3KF7A 2VTNA 4FTTA 4ZP5A 2XBAA 4MV7A 1Q3WA 1Q8TA 3G6GA 5IU2A 3HDMA 4KRCA 4F09A 5DN3A 5CASA 4MV6A 1KSWA 1W0XC 4I23A 2PTKA 3MWUA 5EQEA 2PY3A 5HO7A 4UYAA 4DG0E 2WMXA 3C7QA 3BIZA 5EH0A 3DOGA 4FV2A 3W1FA 5KZ0A 1VKZA 4W4XA 4F6WA 2XK8A 2LGCA 2RF9A 2YCFA 4CFMA 4G2FA 2VO7A 5CF4A 3E7OA 4M84A 4PL3A 2BZKB 2YN8A 4QP1A 4AGWA 3PVWA 4IDTA 5D7AA 4L1KA 3JRWA 2CKQA 3F5PA 4FV9A 5DRDA 5J1VA 4USDA 5E8ZA 4WD5A 5A4EA 3OCGA 2C6EA 3JY9A 3GCUA 4GK4A 5FNVF 2IZUA 5DE2A 1DAWA 5GIOE 3O50A 4JG8A 2J4ZA 3FV8A 4PDYA 4FEQA 5CEQA 3O0GA 1G8AA 2W7XA 4FSYA 3U4UA 4KS7A 4V0GA 3OFMA 5BMSA 3LMHA 4G6LA 1IOWA 5C1QB 3RPOA 1MRVA 3DZQA 4BBEA 2O5KA 3HP5A 3KA0A 3DA6A 3ELJA 3G8CA 3GU8A 3AC5A 4FL3A 5CVGA 4UX9A 4HQ6A 4MHAA 3VHKA 5JEBA 4I22A 4YURA 2G1TA 3EN5A 2ZDUA 3GCQA 2J5EA 4JRVA 3NNWA 1NXKA 3LFAA 4IWPA 3GCSA 5ANGA 3SHEA 3UVQA 3ZZWA 4Y8VB 4RZVA 4QYGA 2P4IA 2IZRA 3AQVA 5ICPA 2YM3A 4N57A 4QMMA 2CSNA 2QLQA 5FBOA 3P4KA 4WNKA 3ZEWA 1WAKA 2X2LA 4FOBA 3E92A 4GFOA 3L9LA 3S0OA 3PPKA 3FYKX 3GC7A 4XG6A 5G1XA 3UC4A 3WIKA 2YJRA 4NJ3A 5J95A 1PXIA 1V1KA 2YZNA 5DWRA 4MV9A 4O7LA 1GZKA 4DT9A 1H1WA 4BBFA 4GYIA 2QODA 3TCPA 4A9UA 4L8MA 3DKOA 2WXVA 4LGHA 1KE6A 3SLSA 2GNGA 1UV5A 4ZZOA 2OJGA 4F6UA 5LMAA 4FFNA 4QPSA 3R30A 5L2SA 4MNEB 1ZRZA 2X1NA 2XZSA 2BFYA 2WZJA 5M55A 2JKMA 5HZNA 4EOSA 3RNIA 2J9GA 3QC4A 4H3BA 2QNJA 4PMMA 3NZ0A 3CCNA 5BVFA 1XHAA 3UG2A 4RIXB 2DLNA 5L6PA 4RFYA 1DM2A 5B7VA 3LFEA 5DMXA 4ZZMA 1YDSE 1Q8WA 4O7SA 1XJDA 4BGHA 3CD8A 3QCSA 3AC8A 1K2PA 3ZMMA 4MK0A 5T3QA 5KX5F 2W71A 1ZWSA 2UV2A 3RWPA 4I3ZA 1KOAA 3MIAA 3KRJA 2QONA 3NSZA 4HZSA 4R1VA 5HG7A 5C4LA 3WZEA 5BNJA 5HORA 4R5SA 2R9SA 3TNWA 4FT0A 4JOAA 2AYPA 4BY9E 2BRGA 5CSHA 3NVMB 2HJWA 1XWSA 5JSMA 3R5FA 4GFGA 4FT9A 1PJKA 4AU8A 1CKIA 3VN9A 2J6MA 3QKKA 3PLSA 2FGIA 1Y6BA 3DJ5A 3EOCA 4IVDA 4F70A 5KX8A 3TIGA 3F3WA 3KXNA 5JT2A 2R3RA 4RC2A 3DNDA 4BYJA 4I1ZA 2OJIA 3EHAA 3PZEA 1Q41A 4X2NA 4BIBA 4FKRA 4UALA 4D4YA 1OUKA 2NO3A 1Z57A 5AV1A 3UVRA 1J1CA 4C4JA 3TJDA 3MY1A 5GONF 3JVSA 4H1MA 1REKA 4HVHA 1M0WA 2BRBA 2C6TA 1W82A 4FZAB 3CY3A 4O27B 4QPAA 3CJFA 4C61A 5GIPE 1M0TA 4W4WA 3TT0A 4DT8A 3RFCA 1VBHA 3FMDA 4E4XA 2C00A 2P0CA 2W1ZA 4LMNA 5DR6A 4P7EA 4RWKA 2CPKE 3UPXA 5LMKC 2WB8A 1OL5A 4OTDA 3QFFA 4M97A 1OUYA 2BRMA 2HOGA 4HGTA 4FOCA 4ZSLA 2YACA 3NDMA 4ZIMA 2NP8A 2V22A 3FMEA 1OL2A 4O83A 3CSVA 4C37A 2HZ4A 2GLTA 3EFWA 2PPQA 3Q4CA 5IQBA 4KD1A 3VUKA 4YTFA 3GNIB 3L1SA 2HW6A 1OVEA 4FSRA 3AD6A 2CN5A 4R7HA 4L3LA 3PXYA 3G15A 4B8LA 4C33A 3SE7A 3CE3A 4UBAA 3ZRKA 5BQ0A 5KHWA 4MAOA 3MY5A 4ZOGA 2UW3A 3W2OA 2UZBA 3QD0A 4HGSA 1ZARA 5AM7A 1YWNA 3PY1A 4U5JA 5DIAA 5BVWA 3TV6A 5HTBA 2HIWA 2PBZA 4NCTA 2UW9A 4I50F 3OXZA 3PA5A 4O7VA 1OL7A 1I7NA 3QYZA 2G2IA 3UP7A 1OPJA 2OXXA 1IASA 4E5AX 2X8IA 3OBJA 2XNOA 5BYLA 3EKKA 2QOKA 2RG5A 4IC7A 2IG7A 3NAYA 3ZUVA 3FY0A 4EK3A 5L2IA 3MFRA 4CTBA 4ACCA 5JK3A 4ITHA 2Z8CA 2YIYA 4FKOA 3PXKA 3ODZX 3HDNA 3RP9A 5EYKA 5IQFA 2QO2A 2VX0A 2EU9A 1RJBA 2ZDTA 3NYOA 1KWPA 5B2MA 4YJSA 4FT7A 4A7CA 4OTQA 4CVAA 3D5WA 1OMWA 4AW5A 3MWDA 4OBQA 2R3IA 3SD0A 2GHGA 2WOTA 1OKYA 4O38A 1PW2A 3C0IA 4EQUA 4RIWB 4AW2A 5IISA 1ZMUA 3QU0A 2XNEA 4DH3A 3F5UA 4M14A 4F63A 2XKEA 5HIEA 4U41A 3VWAA 4RVKA 5HE3A 3JXWA 4L53A 4KIQA 4LQMA 2PVPA 3QUEA 5FM2A 3ZFYA 4ZLOA 4RJ7A 2HCKA 4TNDA 2XIZA 4ZTLA 3WOWA 2C4GA 2JDTA 4EKKA 3SVVA 4QMOA 4Y46A 3QQLA 2WU6A 3DKGA 1E4EB 3HA8A 4LL0A 1L3RE 2RKUA 3TIYA 2QOOA 4AGUA 4FTMA 4FUYA 4PWNA 1ZYDA 4YJUA 4L9IA 3R8MA 1E1XA 3G8DA 3P78A 4FL2A 3TIZA 4BZOA 4ZI7F 1FOTA 4DTBA 1JOWB 2W1FA 3PXRA 3RM7A 2FP4B 3E3BX 3OY3A 5K9IA 3FQSA 4WRGA 3R1NA 2FB8A 4R1YA 3QTQA 2F4JA 4H3PA 1ND4A 4EGJA 1XBCA 4DCEA 4FKTA 2Y6OA 1ZOGA 5LQFA 3TTIA 4AFJA 2XUUA 3ZLSA 1JNKA 4YNEA 4CFUA 1OZ1A 5BMMA 1REJA 1W83A 1ZXEA 4AOIA 4AOJA 1CSNA 3FMNA 3R28A 3OCSA 1V0OA 1Q8YA 4P2KA 4XEYA 4TWNA 3C4XA 4LV5A 5KMNA 2VNWA 5FTOA 5M4CA 3P5KA 3JYAA 3AGMA 4IW0A 3QGWA 5I9YA 1ZY4A 3VAPA 2JDRA 3OTUA 3JVRA 1XO2B 3H30A 4D55A 5TR6A 4DGLC 4EZ7A 1CMKE 4R6VA 4UZDA 3FDNA 3QKMA 1M52A 3FI3A 3ORQA 3ZLWA 3K3PA 3FMLA 4QMVA 3U87A 4X3FC 4JJRA 4EKLA 3DQXA 2OH4A 3QA0A 4JRNA 4FIHA 4FV8A 4J71A 1R39A 5CY3A 3U8WA 2UVZA 4YLJA 3UJGA 1GZNA 2GS6A 4GV1A 1WVYA 3BKBA 5A4QA 4XYMB 1ZY5A 1JSVA 1UKHA 2YAAA 3EH9A 4ANMA 4FKGA 5H80A 3HV3A 4YHJA 4HGEA 4O22A 4WG5A 4GFMA 1JSUA 3ZSIA 1UNGA 2PVHA 5TO8A 1A9XA 2V55A 4M69B 3EQPA 5IH6A 3GC0A 3HB9A 3IGGA 1VR2A 4KKGA 3DK7A 5AP1A 3HRFA 3D2KA 4RQKA 1XQZA 4EC9A 3IOPA 5FDPA 5IEVA 1URWA 2JDSA 1PXJA 3NYNA 3RK7A 5ETFA 1WFCA 3WZUA 2PZYA 3KF4A 5H8BA 3TV7A 3WF7A 3I7BA 4IMYA 4RWLA 5CEKA 2QQ7A 1M2RA 1W84A 4G6NA 2PWLA 1YXXA 3VUHA 2IO6A 3R1YA 5HCXA 3TUDA 4BR3A 3LXNA 3R7YA 3FC1X 4ASDA 4YJ2F 2PVYA 3JUHA 2JIIA 1Q61A 2VTAA 2PUIA 4KIPA 2PVKA 4XG9A 2Y4PA 3VMMA 4BDBA 1WBPA 1M2QA 4EH8A 2P55A 4EK6A 3LQ5A 1VJYA 3RUPA 2Y6MA 5EQPA 4HZRA 4D1SA 2B1PA 3QZHA 5LMKA 2WQOA 2W1CA 2JEDA 5GJGA 2ITPA 3T9TA 2E9OA 2CZGA 1ULZA 2J0LA 3NUNA 3E93A 3ZONA 4XG2A 4WOVA 2B9HA 5DH3A 4IAFA 4CT1A 4Z7HA 5EKNA 1BYGA 2GCDA 2R3HA 4K11A 4NU1A 4ENXA 3BX5A 5D9HA 5FBNC 2YL2A 2NRUA 4FC0A 4U79A 3U51A 2IVVA 3EWHA 3HV5A 3VS5A 4AW1A 1PMVA 4BDHA 4BDFA 4GJ3A 1KE5A 3H9OA 1U54B 1XH4A 5KMMA 4B7TA 4S30A 3SW4A 3W8LA 3PJ3A 4IQ6A 4QP3A 3WILA 3IG7A 5KMOA 2V5AA 4QOXA 2XNNA 2V59A 3K5IA 3LJ0A 1G8SA 3MBLA 2VWXA 2NU8B 4NK9A 5M4UA 4WO5A 3TTJA 3CGOA 4FI1A 1YKRA 1BXRA 5KO1A 4X2JA 3F6XA 4X7QA 4TL0A 2WTIA 1PKDA 2UVXA 5HBEA 4GMYA 3QQGA 3BQCA 1K3AA 5L8KA 4E5WA 3VQUA 2ESMA 5AIKA 4DEHA 3HP2A 1KJJA 4KNBA 3JZIA 5KBRA 3OP5A 5IA5A 4RC4A 1JLLB 4H36A 5FRIA 3DBEA 4TV9F 3E8EA 3FQHA 4MYGA 2OH0E 4YB8B 3IO7A 3KVXA 3UFXB 5F20A 4DFYA 4NYEA 4YZMA 3EN4A 3OWJA 4NIFB 3R21A 3IDBA 3VRYA 3LIJA 4BI2A 5K4IA 1XH7A 2VWBA 3WF9A 2XP2A 3SG9A 4C4HA 4EOMA 4FR4A 4IAIA 4IVBA 3U9CA 3VQHA 4HCUA 3G9NA 3RAIA 2RFDA 2UZWE 3GBZA 3COHA 1T46A 3I81A 3OVVA 4HNIA 5CNOA 3KULA 5DPVA 5EKOA 5EM6A 5TF9A 4W8EA 4MKCA 4RIYB 1C3OA 4DE4A 3K2LA 5FTGA 4GVJA 1IR3A 3OWPA 2C3JA 2OBJA 3L8PA 3QWJA 3E87A 4NW5A 5HVJA 3R8UA 3RAWA 3OZ6A 3UC3A 3LFDA 3F3TA 5A3XA 4C34A 3IW4A 4F9CA 5HBJA 3KK9A 2ITXA 5T6KA 2IW9A 4YO6A 4C5BA 1KUTA 1B6CB 3RCJA 3QQJA 2Y4IB 3NCZA 3FE3A 4DEAA 4MXAA 4D2RA 4L42A 4EUUA 4K2RA 3KK8A 1H1PA 4FNYA 3ORRA 5JZNA 1JKKA 2NUAB 3IECA 3HV7A 4ZAUA 2XCKA 1UU7A 2XF0A 1PMUA 2F57A 2WIPA 3WZDA 3F69A 5EHYA 3EB0A 4Q5HA 5E8UA 2NNWB 5HHWA 4IM2A 1XR1A 4FEWA 4XLIA 3TDWA 4DH5A 4D28A 1BL6A 1R0EA 5A6NA 3R9HA 3FL5A 2VWIA 1KBLA 4WSYA 5AP4A 1YW2A 1JPAA 2GSFA 3GP0A 5HU9A 4XOZA 4P90A 1P14A 2ONLC 5EYDA 4A4XA 3QA8A 5LMBA 2ZDGA 3UOLA 3OY1A 3ZZEA 4F6SA 3PA3A 2R7NA 3R1SA 5CT7A 1H28A 2R7KA 3FHRA 3RK5A 3H3CA 3BHHA 3HLLA 4Y85A 1WBNA 1K9AA 4CLIA 4JBQA 4XUFA 4TW9A 2WTCA 3ZO2A 2QVSE 3LZBA 3Q9YA 3W18A 4FYOA 3KVWA 3TZ7A 4USEA 4XG4A 1FMKA 3CXWA 3QALE 4X3FA 3OS3A 4GG7A 5JQGF 3QWKA 2DS1A 1WVWA 3AC1A 2OZAB 3O8UA 2R7BA 3BLHA 5CU2A 3ZDIA 3W32A 4O0WA 5A14A 3ATTA 2OICA 4P4CA 3LJ2A 4AGDA 3TZ8A 4K0YA 4L45A 2CKPA 5HEZA 4UEUA 5LVLA 3R8LA 3VBVA 4FKPA 2J90A 4TTHB 1WCCA 3R2BA 2I40A 2UW5A 2XS0A 3H10A 2PMIA 1BKXA 3HKOA 3BE9A 2HXLA 2X8DA 4R77A 1DAYA 4QP9A 3NIZA 3A4OX 4AN9A 4BTJA 4CQEA 2X2MA 4BCQA 3BCEA 4F7SA 5BPFA 3EN6A 3SRVA 5LXTF 5C1PA 2EXMA 2H8HA 5M44A 2PZIA 2PN1A 3PRIA 5E92A 5BPYA 4M9UA 3FI2A 4I5PA 4TKSA 4ZLZA 2HW7A 3BYVA 4CMOA 4E8AA 3R23A 4HPUE 3MS9A 4L52A 3B2TA 3BHUA 2XK4A 3K5UA 4DFLA 4EOIA 3KXMA 4HW7A 5B2LA 2YRWA 5LWNA 3U55A 4UXQA 2VAGA 4ZY6A 4AA0A 3BU6A 4EONA 4O2AF 4ASXA 4DA5A 2NRYA 4E4LA 1MQ4A 5CX9A 1PY5A 1Y6AA 3SG8A 3DJ6A 4PL5A 3F7WA 2E2BA 4UY9A 5CT0A 3IW6A 3LE6A 3MI9A 3NX8A 5AAFA 4YSJA 5DT3A 3P79A 4XYFA 4E4NA 2GNIA 4G5JA 1YQJA 5D1JA 3IKAA 4KB8A 4UZHA 1ZOHA 2JFMA 4FVRA 5BVKA 3AC2A 4ACHA 4GK2A 3F3VA 2WIHA 4L67A 2G9XA 1GIIA 5E8XA 1OIUA 2J0JA 3SAYA 2OJFE 4NM5A 3RPVA 3ULIA 1KE9A 1XH6A 4IX3A 5EW9A 1A48A 4NKSA 3COMA 5DOSA 2UW7A 3HYHA 3OOGA 4ONAA 3FKLA 5EDQA 2NPQA 2HGSA 2CGWA 1WR2A 1KE7A 5AUZA 2QK4A 1OPLA 2EB3A 1PYXA 1U4DA 3BQRA 4P5QA 3MH3A 4YP8A 1TKIA 5LJJA 5KKRB 3JRXA 2UZLA 3C5IA 3ZFXA 1PXKA 1J91A 2W1IA 4LMUA 2R0UA 4WBOA 1T45A 3QLFA 1AUXA 3FKNA 3QUDA 2B0QA 3QTSA 1GSHA 4JLCA 1FBNA 4PNKA 4PY1A 3HGKA 4CMUA 4ZMEA 5AUUA 2WTKC 4F1MA 3FPMA 4I4TF 4MA5A 1U5RA 3F88A 2FUMA 3JR1A 4IANA 5JMSA 2JBOA 4HOKA 4D1ZA 4CRSA 2JKQA 3LP8A 2F7EE 3HMPA 3IGOA 3DXPA 2OGVA 2WELA 2Y8OA 3QRKA 3G2FA 5ETCA 4F1TA 3V4SA 1YHSA 3QCYA 4FV7A 5CAVA 2YCSA 1KJ8A 5M07A 1HCLA 1VYZA 3BYOA 4QQ5A 4G16A 4FUXA 5AUTA 4A07A 2OO8X 3ZU7A 2REIA 4ZQIA 5CSPA 4AP7A 4ZTMA 4E26A 3QL8A 5AADA 3VC4A 2BCJA 4F0FA 5EQYA 4NWMA 1WBTA 2BAJA 3TZMA 4KINA 3MVLA 4GKIA 1OIQA 3DY7A 4GU9A 4QT1A 4AZWA 4YJRA 4AGCA 4YMJA 4X2FA 1PF8A 1SMHA 2R3GA 3MA3A 1MRYA 4QMWA 2X9FA 2JAVA 4YZDA 1BL7A 1QPDA 2WGJA 3BWFA 3UP2A 3OUKA 3U9NA 3VJNA 3G5DA 4QMUA 2XKCA 4D5HA 2ETRA 4FNZA 5T68A 1H4LA 3Q5IA 4XYLB 2BKZA 2YDKA 1OBGA 2VTRA 5E8YA 2PE0A 3ZLYA 3B8QA 4TYHB 5IA4A 3C13A 3UNJA 3F2NA 5FEDA 4P5ZA 4RC3A 3TIIA 2C6IA 4QMZA 4IBMA 2JKKA 3D4QA 4U81A 3V8SA 5BUJA 3KCFA 5AMNA 5AA8A 3PJ8A 4ZZNA 3D5XA 3OUUA 3FHIA 2ETKA 2VN9A 3D5VA 5M09A 2GPSA 2H96A 4L44A 3TQTA 4XG8A 4B6LA 3VW6A 4FZDB 4YHTA 3UODA 3BGZA 3EQBA 3GCVA 4FKVA 3M1SA 3DAJA 3MPAA 2XEYA 1IA9A 2QCSA 4MNFA 4ZS4A 4AQCA 2EB2A 2PHKA 5KHXA 4O7RA 1RE8A 3P7CA 2ZV2A 3QLGA 5FXQA 1EHIA 5HBRB 2BIKB 2C3LA 4HYUA 2CLQA 4UV0A 4XX0B 5CU3A 1RW8A 5IA2A 3OT3A 2CJMA 4TYJA 4ZSEA 2PYWA 4XHKB 3LFQA 2R4BA 4FGRA 3LM5A 4EQMA 4FKQA 4C4EA 4FKWA 1H1QA 2YCRA 4OTFA 2W9ZB 3LXKA 3R5HA 2W17A 1BX6A 3BV2A 4CZUA 1LEWA 1UNLA 3KKVA 5DA3A 2O0UA 3C50A 5CANA 4ZOLF 2C6KA 5L3AA 2GU8A 2PZRA 4IVCA 3DLSA 2ITVA 3F66A 3ROYA 3DJ7A 4OUCA 3D7ZA 4C3RA 3I5ZA 3FZRA 4BCKA 3W2PA 1A9UA 4HR7A 4ZJJA 2C3KA 4BDIA 4JAJA 3ANRA 3RPYA 4HNFA 2HY81 2YM5A 4FYNA 4G9RA 3OBGA 4O82A 1VZOA 3Q2OA 3PLAE 3KXHA 4XG3A 1SVGA 4XV2A 5FD2A 4DAWA 5ETAA 2QD9A 2H9VA 3QUPA 3R71A 4JQ8A 2OIBA 1H07A 2RFNA 3K3IA 2ITQA 3LFCA 3OT8A 3W33A 1TVOA 1EH4A 1A06A 5IH4A 1M7QA 3IW8A 2XMYA 4UWYA 2ZV7A 3HRBA 4LM5A 3S95A 3A8WA 1SZMA 2ITOA 3P86A 4ALVA 3Q6WA 4G5PA 3Q4ZA 4AOTA 4I55F 3A7HA 4AN3A 5FGKA 4G34A 4MXYA 5EYCA 4TYGA 5FEQA 5A4CA 5DYJA 3MH2A 3O23A 4JG7A 2UW6A 3ORPA 3ZH8A 4AW0A 2OLSA 1AD5A 3FMKA 3QHRA 5LVPA 2OZOA 2JIUA 3FAAA 4EL9A 5JH6A 4RWJA 3LXLA 5J5SA 2GPWA 5HD4A 4AE9A 5HTCA 3K5HA 1V0PA 4F99A 2HELA 3QCQA 1G3NA 4V04A 3NYVA 4XBUA 4U43A 4IAYA 3UMWA 1YRPA 3AMYA 3EN9A 4N6ZA 5CENA 4I5HA 5I4NA 5C4KA 3LCSA 3DZOA 3ET7A 4ZSGA 3TKHA 4BICA 3EQCA 3I6UA 3KMUA 2R3KA 4NKAA 3D94A 4AT5A 1XH8A 3HVCA 5M51A 4LUEA 3S1HA 4L7FA 4MD9E 4PL4A 4X3JA 3VUDA 1FINA 3PXQA 4RIWA 4J8MA 2WTDA 5D11A 4AX8A 2E9PA 4PX6A 4I0RA 2C5OA 2X2KA 5CVHA 2A2AA 4FTLA 4KAOA 4O7WA 2OIQA 4BCGA 4FV0A 4FV6A 2IVUA 3CR0A 3G51A 5KKNB 3FY2A 5ITAA 4U97A 3EZRA 5C9CA 4FA2A 1GSAA 4IX6A 3HZTA 2Y4IC 3JY0A 2W6NA 2KULA 4C7TA 2WPAA 4EWHA 5C01A 2PUPA 3A99A 3R0TA 3BI6A 4R3RA 4C59A 2OKRA 5EW3A 2R7MA 4O2PA 5CLPA 1OECA 2QR7A 3KN6A 4LUDA 4YAKB 2I1MA 4ZTNA 4D9TA 1YOMA 3VUMA 1O9UA 2BROA 4XNEA 3D5UA 3D83A 3AMBA 3QQHA 5HG9A 2BHHA 3HMNA 1T36A 1UU9A 3E3PA 3G9LX 4CG9A 5CQWA 5IQIA 2YM4A 3UG1A 4YGAA 4LV8A 2ACXA 3EQGA 3W16A 2VX1A 2W5BA 3PSCA 4NM3A 4LI5A 3PVBA 1GZ8A 2DIKA 1M14A 3NIEA 5HV6A 4CKJA 2QU6A 2ETMA 4K9YA 3VUGA 4MD7E 3R7EA 1ZYJA 3EQDA 3VIDA 3ZBXA 4CCBA 4XOYA 4E6CA 3MB7A 4GCJA 1WMKA 3VS0A 4IIRA 5J9LA 2R3OA 2FB9A 4HNTA 1EZ1A 2NU6B 3FSFA 3COKA 3HAVA 2YZGA 2XEZA 5E4HA 1PXMA 4I5CA 2EXCX 1LEZA 2X8EA 4IAKA 3BLRA 5CXHA 4WBNF 3DXQA 3KU2A 4DLJA 2ITTA 3UO6A 3UVPA 3FLNC 4G9CA 4IFCA 3FYJX 2YIRA 3PJCA 2JFLA 3TNHA 4L01A 3I79A 3NAXA 3QTUA 5AP2A 1PKGA 4D4SA 1QCFA 4I20A 2W05A 4BDGA 4RX7A 5BMVF 2B52A 1Y57A 3EL7A 3EMGA 3E7VA 5CVFA 2BVAA 4H05A 3V8TA 5E1EA 5FM3A 1OIYA 1P5EA 2BMCA 4FKSA 4S2ZA 4FG9A 4FT3A 5M06A 3DT1A 4QNAA 4M8TA 2FPPB 3FLSA 1OB3A 3DLZA 3OCBA 4L3JA 3KAJA 4IADA 4AA4A 1IAJA 4QNYA 5EOLA 1PHKA 3R02A 2E9VA 4EOPA 3TKUA 3V5PA 4F65A 3RI1A 3W2SA 1F5QA 4QP6A 5M4FA 3RJCA 5JFVA 3MJFA 2OG8A 3UE4A 3NNUA 2BKKA 1R3CA 3NW6A 3UIUA 5I9VA 3TNPC 5DVRA 2I0HA 5DRBA 4YLLA 4PMPA 3C0GA 3HX4A 3P08A 1ZMVA 2EUFB 3FUPA 3PY0A 2Q83A 1CKJA 4MWHA 4NL0A 2YS7A 3VBWA 3F3UA 4I5MA 2QOBA 5LARA 2C0OA 2GS7A 5A54A 5CALA 4DFUA 4MQ1A 3IQ7A 2VWVA 3MH1A 1KE8A 3R8ZA 1PXOA 4W4YA 3Q60A 4ZSAA 3QKLA 4Z9LA 3R5XA 2IWIA 4O86A 5J1WA 3UOKA 5J2TF 4QYHA 4QTDA 4EH6A 3W55A 4FTAA 3R9OA 5CF8A 4DIMA 3VA7A 1YVJA 1KJIA 4V0GB 3QQKA 3QHWA 4C4IA 4DITA 2IVTA 1F3MC 3P1AA 1WBSA 2XJ0A 2KTYA 3EFJA 3NRMA 5G6VA 5EYMA 4TN6A 4AT4A 5AAGA 3IW7A 4O21A 2WMRA 2XK6A 1Q5KA 4O0TA 3RM6A 5C26A 3QXPA 3QZGA 1M7NA 1YXSA 2QG5A 2W4KA 4MXCA 5CYIA 4ZEGA 3ZCLA 4RX5A 3HMMA 4W4VA 5IUIA 1FVRA 3LFBA 4K77A 4KWPA 1OIRA 4YBZB 3LOKA 3V5WA 3ENHA 4AWIA 4F08A 2Y7JA 5F94A 4IACA 2ZM1A 3WBLA 5J7HA 5D12A 5JQ5A 2VV9A 4MV4A 3TUCA 4ENYA 4II5A 2NU9B 4QRCA 4IZ7A 1DV1A 3MYGA 1KV2A 3U4WA 1URCA 2BFXA 3A61A 4FEXA 4AZVA 4JS8A 2FSOX 5B2KA 2FVDA 3BEAA 4D1XA 2XRWA 3AOXA 4ITJA 4Q9ZA 4XLVA 3CIKA 4CFNA 4DHFA 4QQTA 2VTLA 4O2BF 5C8YF 4M0ZA 3O7LB 2C5VA 3HO8A 3ACKA 2E9UA 4X0MA 4B99A 4EGQA 3MV5A 1YHWA 5DR2A 3TL8A 4EZ5A 1GIHA 2GS2A 3EQRA 4H1JA 3VF8A 1IG1A 2PUNA 3RAKA 5JVDF 4C5AA 4YBJA 2R64A 3F9NA 2R3MA 2C3IB 3PIZA 2WHBA 4OGRA 2XK7A 3M11A 4FFLA 4YPDA 3JS2A 4M0YA 2C6OA 5KMKA 4MD8E 3WNZA 4FSUA 3ZC5A 3POZA 4BC6A 3SKCA 2PMLX 2QHNA 3O8PA 4RLKA 1Z2OX 2OFVA 4G3GA 4HYHA 2IW8A 3A4PA 1YI3A 3BYSA 3ENMA 3R63A 3UQFA 3S4QA 3ZO3A 3D7TA 4FTQA 1Q3DA 4QYFA 4ASZA 1P4OA 1FGKA 4C5CA 4EYJA 3ROCA 1OI9A 2UZOA 3DV3A 4RQVA 1PMNA 2UZNA 1F0QA 5BYYA 4XH6A 1GIJA 2WOUA 2FSTX 2JAMA 1XH5A 3CTJA 3B2WA 3BGQA 1UWHA 2Z60A 3MTLA 3ORLA 4N6YA 5HKMA 5KZIA 4WG3A 5LCJA 2YZMA 2O63A 4CKRA 1CQJB 4KKHA 4O7TA 5CEOA 3GGFA 5F95A 2W1EA 4BDCA 3PSBA 2XIXA 1IEPA 2F49A 3OWKA 3PJ2A 3QZIA 1UA2A 3KMMA 2R7IA 5C03A 2YEXA 4RG0A 4L68A 4CKIA 3R7OA 4QTCA 4EEVA 3TWJA 3VS7A 4HVSA 2SCUB 2BDFA 3B8RA 2YM6A 4GUEA 3VS2A 3AT3A 3ZC6A 4AE6A 2VO0A 3VNTA 3ATSA 2XIYA 3R01A 5HI2A 3F2RA 4ASEA 3QTIA 2GMXA 1YHVA 4JR3A 2WMAA 3H0ZA 4NT4A 4O7ZA 4CTCA 1PK8A 4EJ7A 3VBYA 5AP3A 2HWOA 2W5HA 3A2CA 1Y8YA 3A7GA 2JDVA 3QD3A 2VTIA 5HIDA 5EHLA 4Y83A 3V8WA 3ZDUA 3ZBFA 4U42A 1JBPE 4AXAA 4L46A 4F9WA 4D9UA 1H1SA 4XCUA 3GU4A 3TUBA 4RZWA 3ANQA 3NR9A 5IDNA 3ORMA 4LOQA 4XJ0A 4DEDA 3CKXA 4BGGA 3NUUA 2WNTA 1KOBA 3DTWA 3ID6C 4O84A 4RMZA 3ZRLA 4BIEA 3FZPA 5DI1A 4M15A 2PVLA 1GAGA 4YNOA 3R9DA 4NM0A 3M2WA 5IYZF 4RIOA 4J95A 2UZUE 5AUVA 1MQBA 2J0MB 1ATPE 4GH2A 4PDSA 5H2UA 3KL8A 4PDPA 2YISA 2CKEA 3AG9A 3LLAA 3WIGA 5CQUA 2UZEA 5EI8A 3UPZA 4FKIA 4FFMA 3I0OA 4RA4A 3EN7A 2VTQA 3BG5A 3WO1A 2OXDA 4LFIA 4V05A 4W8DA 4I93A 4R5YA 4FODA 4QMLA 5CNNA 2WMWA 4FK6A 1ERKA 4M13A 5C1OA 2ZJWA 3SC1A 4IM3A 4AZFA 3W2QA 3UOJA 3PRFA 1Z2NX 5BVNA 3WE8A 3TN8A 3CPCA 4BCPA 1H0VA 4RFMA 3E64A 4IJPA 4HCTA 2VO3A 4YJNA 4ALUA 1R78A 4BDKA 3PFQA 5CA1F 5ANDA 5BUIA 1VYWA 3FPQA 1W7HA 2FO0A 1WBVA 2C6DA 4OW8A 4D5KA 4UWBA 2PULA 3A7IA 5AP6A 4ALWA 1IAHA 4MV8A 4IX4A 1S9JA 2WAJA 4QO9A 3BHYA 4GUBA 5K5NA 2VTMA 2R3NA 3DDPA 4N70A 2Z04A 4WRSA 5CXZA 5BX0A 4XP3A 3HBLA 1Y91A 3PIYA 4WA9A 3NWWA 5EI6A 3UO5A 4FU0A 2CKOA 4XV1A 4EHEA 4WNOA 2VNYA 3VW8A 4U80A 4YU2A 2J0IA 4RRVA 3KFAA 2I0VA 2BALA 4RX8A 4TNBA 2XM9A 2ZMCA 2UZDA 3FMJA 3GFWA 4DFNA 4J7BA 5LP6F 1RQQA 3Q4TA 3VULA 4DF3A 5JZJA 3MVMA 2GQGA 3ERKA 4O4JF 3FI8A 3VF9A 3R73A 2BTRA 3MIYA 3SOCA 4RJ5A 3QTRA 4J53A 5HNBA 3ITZA 3S2PA 3REPA 1RDQE 4Z7GA 5EI2A 1KC7A 4N4SA 5KCVA 4H58A 3Q5ZA 3PWDA 3PIXA 4OBOA 3TJCA 2UW8A 3L8VA 4EOKA 2WQBA 3KRXA 5AUYA 4LRKA 2PL0A 3CKWA 3O71A 2JDOA 5TT7A 5LXMA 3QD2B 3PE2A 4GW8A 5KMLA 2YJSA 4IHJF 4DFXE 3R7UA 5H9BA 1I7LA 2OJ9A 4L43A 2BUJA 3LVPA 2YIQA 4ZMFA 4QYEA 4XV9A 3UIMA 1EUDB 1JQHA 3AC4A 1BLXA 1NVSA 3M42A 3IK3A 2RIOA 4DEEA 3C0HA 3NLBA 3FZTA 4AA5A 3KRRA 2W1GA 2PMNX 3DKFA 4QMSA 2CCIA 1JKTA 2OLCA 2YIXA 1E1VA 2JBPA 2I0EA 4KS8A 1BNCA 1H08A 2Q0BA 4M12A 4HJOA 4NUSA 4YSMA 3LW0A 2B9FA 4FKLA 2YIWA 5CEIA 4BTFA 4WHZA 4FTIA 4QMPA 5FG8A 2R84A 3KALA 3NUXA 4ARKA 2O64A 4O81A 3W8QA 3OXTA 4G3DA 2XK9A 4F1OA 3DDQA 4KSQA 4WUAA 4WIHA 4ZTQA 4RVTA 3FZOA 4IAAA 4AFEA 2GNLA 2VUWA 4YR8A 4FV5A 4K33A 5C8KA 3DPKA 3LFSA 3SV0A 4RX9A 4FBXA 1DV2A 3DFCB 4E6DA 3CTHA 4MF1A 4EG0A 2GFCA 1ZYSA 2W9FB 3OUNB 3RPSA 1P4FA 5HE1A 1UKIA 3MFUA 2VTJA 2W1HA 4AN2A 2R86A 3BE2A 3R7IA 4YTHA 2C5YA 3VBXA 1J7UA 3T3VA 3W10A 3V3VA 5A46A 2VGOA 5EM5A 3R9NA 5HBHA 3H4JA 5IQCA 3DBFA 5D8DA 4EH4A 3MN3A 5CEMA 5HNIX 3R9RA 4EHVA 4KABA 4L7SA 2EVAA 4BF2A 1J7LA 3IDPA 4MXZA 4UXLA 4IFGA 3MTFA 4Y72A 5LVNA 3TZ9A 5LOVF 1J7IA 3EJ1A 1IOVA 2XCLA 4GYGA 2WMQA 2CCHA 2F7XE 3DBDA 5JQWA 3OMVA 3VBQA 2W4JA 4DGMA 4AF3A 5B0XA 3GC8A 4GG5A 5JH7F 3Q96A 3I5NA 3HL7A 3NNVA 4FGBA 3EFLA 4PMTA 3ZUTA 5HCYA 2Z2WA 4FV1A 4XZ3B 5AJQA 4NJDA 3ZYAA 3BLQA 3L8XA 5D41A 3RVGA 5KMIA 1Q62A 2QOCA 4MBIA 4DCAA 3BWJA 1KJQA 3V4ZA 1XBAA 3MY0A 3AGLA 3GOKA 3QC9A 3O2MA 4ACGA 2XBJA 5DLSA 4EZ3A 2UW0A 3CTQA 4JG6A 3F7ZA 3F2AA 2E9NA 4C2VA 2GFSA 2ZVAA 4U44A 2X81A 5DNRA 4L3PA 1B39A 4K1BA 2HWPA 4C3PA 4E93A 5IUGA 3NEWA 2IJMA 3LMIA 1FGIA 3WO0A 3ZO1A 2VRXA 3MVJA 2CNVA 4QTEA 5AA9A 3OOMA 4EH7A 5D7VA 4QP2A 3QFVA 5M56A 1OKVA 4FL1A 3LAUA 1M6VA 2G15A 4RJ3A 5CAUA 4KKEA 4O96A 1LUFA 4OTIA 3FMMA 1JSTA 3KCKA 3OF0A 1Y8GA 3OW3A 4C3FA 5CEPA 3LWBA 4FG7A 4L6QA 4Y95A 4BIDA 2C1AA 3I60A 4ORKA 4UYNA 2X7FA 4QP4A 3ZLXA 1NW1A 2VTHA 5EZYF 3RWQA 3GB2A 4FSWA 4ZHQF 1APME 1LP4A 2JITA 4FZ6A 1WBOA 4A4LA 3HRCA 3ACJA 1SVEA 3CBLA 3KRLA 3N4VA 4GT5A 2G01A 2HZIA 4EH9A 2R7LA 1XBBA 3EYHA 3HUBA 4DGOA 5BVDA 2YWPA 3BYMA 4GIIA 3QRUA 4J1RA 4MX9A 4CT2A 4DC2A 2IZTA 3RHXA 4O2ZA 4U45A 1WBWA 4BRXA 3ALNA 2A0CX 2UZTA 4Y5HA 3V51A 3F61A 4ZSJA 3KULB 2IPXA 4ZTSA 1YWVA 3I1AA 4IWOA 5J87A 3GLKA 3N8DA 4YPSA 4FVQA 4U40A 5E8TA 3UIBA 3BZ3A 4EH3A 3O7LD 2C30A 4FKUA 5AUWA 3Q52A 5EOBA 3G6HA 4YC6A 5AX9A 2Y9QA 4F4PA 4KSPA 2JC6A 4JR7A 2PE1A 2XKDA 3Q9XA 5CTPA 4E73A 5JKGA 5CU0A 3IONA 5HIBA 3EKNA 2JIVA 3MDYA 3QD4A 1BI7A 4FK3A 5BYZA 4F7JA 2IP4A 2XIRA 3SA0A 2C5XA 3K3JA 2QKWB 4PTEA 2XRUA 4DH8A 4AAAA 4C4GA 1OITA 5IDPA 4MNEA 3SXSA 2WMUA 3FKOA 3MPMA 4QMYA 4DG2E 4CFFA 4R7IA 1JLUE 3AXWA 1R1WA 4YZBA 2V5QA 5GJFA 2R0IA 3EIDA 4O4IF 2B7AA 5CF5A 5E90A 2FSLX 3ORKA 5LA6F 3G90X 2WQEA 4MAMA 3EZVA 4RIXA 5CB4F 1YXUA 4I94A 2G2HA 5L8JA 4YZCA 5IQAA 1DS5A 3NMUF 4EK8A 5EDRA 3P9JA 2BRHA 5I9XA 3PUPA 3MB6A 5HU3A 4H39A 1OL6A 5IPJA 4CV9A 1STCE 2C0TA 2CLXA 2H34A 2VWWA 5CS6A 3C5UA 2CDZA 5GNKA 4MBLA 3ZM4A 4QMNA 4PF4A 4FTNA 4G3CA 3W2CA 4CEGA 4AS0A 5HD7A 4CD0A 3FEGA 4QMTA 5JFWA 1VEBA 3QQFA 4RLLA 3V6SA 5BVEA 4Q5EA 2XA4A 3Q32A 1ZZ2A 2J51A 3GT8A 4FTCA 4U6RA 3R22A 2QR8A 4TY1A 3FSKA 3ETAA 3NYXA 3UDBA 1H1RA 3LQ8A 4PMSA 5EFQA 3DCVA 3HEGA 4C4FA 2ONLA 1I44A 4R3PA 5EM8A 1JDBB 2BPMA 4GK3A 4ZK5A 3NW5A 2CGXA 2LAVA 1FVTA 4FTKA 5E7RA 4GIHA 2R3PA 3C4ZA 4I6QA 4OTGA 5CU6A 5H3QA 5IUHA 3VS6A 4KRDA 4YJPA 4RBLA 1H27A 1NVRA 3QRIA 3VS3A 3MGYA 4LOPA 5HX8A 3A7JA 3BBWA 4LL5A 2QOHA 2BZHB 2ZB1A 2OF4A 2V7OA 2JD5A 5CAOA 2WYOA 4FE2A 3CLYA 3C4WA 2W0JA 4J99A 4JBOA 5F1ZA 1YOLA 4M68A 4Y8DA 3ODYX 2HXQA 2XIKA 2Z7SA 4XG7A 2VO6A 5KMJA 3SRVB 1QMZA 2JGZA 4B0GA 5JFSA 3O8TA 4B9DA 4Z16A 2FH9A 4DEIA 1W93A 3CS9A 4RVLA 3R7VA 4BHZA 3FI4A 4IWDA 4F9YA 3BELA 4E7WA 3V01A 2BTSA 2WMSA 5IMXA 2P2IA 2I0YA 4NCTC 5AP7A 5E8WA 5LVOA 3IS5A 3LFFA 2PZ5A 3U6JA 1JWHA 1PMEA 4FV3A 4O4HF 3DBCA 4QQCA 3LQ3A 1YI6A 2QURA 3PG3A 3C1XA 2OJJA 1BI8A 4RPVA 4TWPA 4JDHA 4PNIA 2C47A 4KBAA 3C4EA 4USFA 5DHJA 1YDTE 4YJ3F 5HG8A 4A9YA 4MXOA 2ITNA 3BRBA 4EC8A 5JQ8A 2YZAA 5EHOA 4IZAA 3Q9ZA 3H9RA 3UZRA 2X39A 3MJ1A 4AZTA 3AD4A 5CZHA 4O0XA 3GOPA 2R87A 2GHMA 1CKPA 2Z7LA 4ERKA 4RT7A 3D9VA 5M53A 4ME6A 1OBDA 2AC5A 3CPBA 3ORTA 4A06A 2W99B 2CNUA 1ZYCA 4HNVA 3MPTA 3TDVA 4YJOA 3UOHA 2Z7RA 2XH5A 5JRSA 5L6OA 4YJTA 2J7TA 3R6XA 5HG5A 3A60A 4TUYF 2BHEA 2XJ1A 3MFTA 4HPTE 4FFPA 4EHZA 5L8LA 3E5NA 4WG4A 4KBCA 5ANKA 4BCMA 1Z2PX 2C6LA 3LCKA 4X6RA 3PSDA 2QOIA 4BCNA 3OTVA 1H00A 4QTAA 1G5SA 2VWZA 3T8OA 5ANOA 4AACA 5ANIA 4ZLYA 4YAJB 4AZEA 2QI8A 3KY2A 1OL1A 2HAKA 4FIIA 4H3QA 4IB5A 4RVMA 3HUCA 5E8VA 1J1BA 4IHPA 4G17A 3K54A 1GSOA 4FT5A 5HLNA 5AV0A 4L00A 3KRWA 4HYIA 2GQSA 2FA2A 2R3FA 4I4FA 4R3CA 1MRUA 2GNFA 4WBBB 1JKLA 4JBPA 2WFYA 5DBXA 2HZ0A 4U0IA 1E4EA 4BYIA 3F5XA 2A4LA 1Q8ZA 2ITYA 5DG5A 4OBPA 4PTGA 3UIXA 4EK5A 5AV4A 4DTKA 1B6SA 2VU3A 4JDIA 4IIJF 3LLTA 3I0QA 3R1QA 1YWRA 4DEBA 3KMWA 4M3QA 3DS6A 4TWCA 4CLJA 3O17A 3QAME 4MV1A 1CS0A 3GU7A 2FPIB 3CJGA 1M2PA 1NVQA 3UZTA 4NSTA 4DEGA 3A7FA 4MXXA 1PXLA 2BAKA 4FMQA 2X4ZA 3FLZA 4PUZA 4BHNA 3VO3A 2O65A 2GTMA 3JZFA 2BDWA 4FZFB 2QO7A 3EQFA 2WMTA 3ZHPC 3TACA 1Q4LA 2AUHA 3HECA 3NNXA 3DAKA 2ITZA 2ZM4A 3RPRA 2GPHA 2I87A 2P0AA 4BKJA 4FSZA 4X2KA 4NW6A 3IDCA 2YM8A 3Q2JA 3Q6UA 5C8MA 2XNPA 4DH7A 2CNQA 3LCTA 3KAKA 4PP9A 3UTOA 1OKZA 3ETHA 2W6PA 1O6LA 4EH2A 4RFZA 2BIYA 2QOQA 3QYWA 3RHKA 4I41A 1P2AA 5GJDA 2XNGA 2A19B 2F9GA 5FEEA 5A6OA 5CI7A 4X2GA 4I21A 4QP8A 2ZYBA 4EBWA 1JKSA 4ZJVA 2UZVA 2W4OA 3VOTA 4AG8A 3KXGA 4B4LA 2QOFA 1CTPE 2H6DA 4OT5A 5L2WA 3UYSA 2WMVA 4O4LF 1SNUA 2ZOQA 3LJ1A 3PVGA 2I80A 4XRLA 5DGZA 5FLFA 1DI9A 3ORZA 2J2IB 5JRQA 1Q8UA 5FTQA 5LWMA 1IA8A 2UW4A 3I12A 4D0XA 3VUIA 3SQQA 3KEXA 3WZJA 5EG3A 5CAQA 3TNIA 5HLPA 2ZV9A 4RJ8A 4I24A 2DZDA 3Q4UA 5AM6A 5CZIA 5FP6A 4FIJA 4LOOA 3U54A 4G1WA 3F82A 3PJ1A 2ITWA 3FXWA 3N4TA 4FIGA 2F7ZE 3E62A 3BBTB 2SRCA 1GGOA 4FICA 2X4FA 5CU4A 3OC1A 2WQMA 3EFKA 3LHJA 4DH1A 4EBVA 5A4LA 2GHLA 4TXCA 5K5XA 2V62A 3W2RA 3HA6A 4O91A 4ZTRA 4ZY4A 2WKMA 4I0TA 1Q99A 5HGIA 5LOHA 5IF1A 3LXPA 1UWJA 5L6WL 1H8FA 3NVKI 4BCHA 5IQGA 4S32A 3ZS5A 5C8NA 1MP8A 3S00A 4FSQA 4E5BA 3GVUA 2VPQA 2F2UA 2VTPA 3F3ZA 3PXFA 4DYMA 3QTWA 4XS2A 3ORIA 4JBVA 4CSVA 5J9YA 2OW3A 1QPCA 4G6OA 4YZNA 4F9AA 2PVFA 4J8NA 2XYNA 5M08A 3Q2MA 1U59A 2PVRA 3TW6A 4JXFA 5TKDA 1GZOA 2WO6A 1O6KA 2WMBA 2WTWA 3DNEA 4FV4A 4MBJA 5HO8A 5HE0A 4E6AA 1J3HA 1ZOEA 4EOOA 1ZZLA 4U9AA 4QMQA 4Z3VA 5DFPA 1U54A 5EM7A 4J96A 3A8XA 3C4FA 3F5GA 5AIRA 4M67A 5KKRC 4CFVA 4UWCA 4N0SA 4FVPA 4APCA 2GTNA 4BVUA 2CN8A 4BDAA 4EORA 2DUVA 4BCFA 3AW8A 3T3UA 1CE8A 4FSNA 3V5JA 2OXYA 2GNJA 4UB7A 2J9MA 3MW1A 2WQNA 1OM1A 4YC3A 2R85A 4O0RA 4E6QA 2PSQA 2QO9A 3RKBA 4MEDA 1WZYA 1GJOA 2ZB0A 3GC9A 2BDJA 3V04A 4C62A 3ORNA 4I6BA 3LCDA 4EJNA 4MV3A 3N6RA 3MESA 2C0IA 3D0EA 4M7IA 4Q9SA 2R3LA 3KN5A 4JIKA 3ZM9A 3BU3A 4CFWA 5HQ0A 3RK9A 3R8PA 5IA1A 1FMOE 5M57A 3LKMA 2YM7A 3VS4A 2FPGB 4FTUA 4TYEA 2W6QA 2XYUA 2HK5A 3FLWA 2J0KA 4JVGA 4YTIA 1IRKA 1H01A 4C0TA 3WYXA 4CFXA 4EOJA 4IX5A 3SX9A 2W06A 4BI0A 3I6WA 4DFZE 2JKOA 4ACMA 3HNGA 4D4RA 2OFUA 3NGAA 4JT3A 2WTKB 2A27A 3SW7A 2V0DA 3LCOA 3V5LA 4RIYA 5H8EA 2QKRA 3ZSGA 4HCVA 3ZSHA 5AX3A 4WKQA 2XM8A 5ACKA 2W6ZA 4BDDA 4NZWB 3VJOA 5CI6A 3Q04A 3RGFA 3SXFA 4HGLA 3MVHA 2YDJA 3RTPA 3DTCA 4JAIA 3PZHA 3TNQB 5F9EA 4O0UA 2X6EA 3GCPA 3R00A 3L8SA 4S31A 3II5A 2HZNA 1Q24A 4IWQA 2CGUA 2VTOA 2VWYA 1M17A 4CCUA 5HX6A 1H25A 2R82A 3U6IA 3NW7A 3O96A 4GU6A 4JL9A 4PRJA 5HLWA 2ERZE 3CD3A 1HCKA 3MFSA 4GT3A 4RJ4A 3DK3A 3FBVA 3SGCA 2X7OA 5AV2A 4IH8A 5JGBA 3GFEA 3FLQA 3BYUA 2XNBA 4F7NA 3H9FA 5IEXA 4YUQA 3E8NA 4IB1A 4FX3A 4O7YA 1S9IA 4QP7A 4GL9A 4V01A 4XMOA 4AUAA 2OWBA 4DFBA 5L2TA 1DI8A 3ULZA 4BBMA 4WNMA 5JFXA 3UNKA 5F4NA 3GU6A 3IPHA 4TT7A 5DT4A 2W5AA 2F2CB 3PE1A 4GSBA 1SCUB 1OKWA 2C6MA 3V6RA 4ZTHA 2YABA 4LG4A 4XBRA 5JVLA 2WEVA 3DFAA 4ANBA 2ZMDA 4F7LA 3C51A 5CAPA 4CZTA 2PMOX 1W8CA 2XJ2A 3TXOA 4A9TA 4F0IA 1C30A 3SDJA 5BUEA 2OI4X 3PWYA 3ZOSA 3LPBA 1FPUA 4JDJA 4BTMA 1BMKA 4MTAA 4MWIA 2CMWA 5E9EA 2C69A 5CF6A 2OZAA 3GQLA 2VD5A 2QU5A 4WUNA 4IC8A 3DB6A 3PP1A 4QSHA 4PQNA 4B8MA 2VX3A 4PDOA 4C02A 3QX4A 3CP9A 3EQHA 2O8YA 4IZOA 4OTHA 3RZBA 4BZNA 1U46A 3GXLA 5CSWA 2X0GA 5ANJA 3EL8A 3QRTA 2IVSA 3Q1KA 2RGPA 5FP5A 4F64A 1W96A 3I4BA 1AQ1A 4APPA 3LMGA 3KGAA 4JQEA 3TINA 4YLKA 3SOAA 5IEYA 5IZFA 2CHLA 2RG6A 3DQWA 4Y73A 1B6RA 4ANLA 2ZV8A 3FL4A 4FFOA 3VVHA 4BDEA 3Q3BA 3TEIA 4FSTA 3D2IA 2DWCA 3R2YA 3UQCA 2WEIA 4IZYA 2W6MA 3RV3A 1CQIB 3FWQA 2W96B 1PYEA 3ZUUA 3QX2A 3UGCA 4HVIA 1PRYA 1I09A 2PUUA 4O0VA 5LVMA 4ZXTA 2HY0A 3VS1A 3BEGA 2B9JA 4GT4A 4RSSA 4GJ2A 2HENA 2YCQA 3OROA 3ORXA 4QMXA 3U9SA 3U9TA 4HNUA 3FJQE 4JIAA 4UN0C 1AGWA 2P3GX 4OTRA 3OEFX 4RA5A 4LRJA 4RGJA 5E1SA 2AC3A 1BUHA 5ETIA 3BGPA 1JDEA 4G3FA 3ZO4A 5JGDA 2YS6A 2B4SB 5I9UA 4DBNA 3E5AA 5D10A 1AUVA 1UVRA 2BAQA 4S33A 2YZLA 5ACBC 1LPUA 3K5VA 3OCTA 2YAKA 4ANSA 5FXSA 4NTTA 2ZDQA 1H24A 4ACDA 1UU3A 4NM7A 2BR1A 4YJQA 3T9IA 1H0WA 2DQ7X 4R7BA 4EH5A 2W6OA 4A9RA 5CAEB 2WD1A 4HVDA 4CMTA 4YC8A 1EYZA 4CNHA 3QZFA 3U6HA 1XH9A 2C5NA 4XX9A 5K3YA 1KEEA 1R0PA 4FTOA 4U3YA 3HMIA 4QTBA 4CV8A 4EHGA 4HVGA 4BTKA 5J9ZA 5HESA 3L9MA 4YTCA 2ZM3A 3IOKA 5CA0F 4GS6A 4FG8A 1CDKA 4YO4A 1GY3A 3C4CA 5IQHA 1MUOA 1PX2A 2Y0AA 4OT6A 2BZIB 5E8SA 2VWUA 1E9HA 4K6ZA 3ZEPA 4GVAA 5FQDC 4CXAA 3KXZA 5FDXA 4TYIA 5AV3A 3D7TB 3KB7A 3GI3A 5HCZA 3P7BA 2VGPA 3HV6A 4I0SA 3MJ2A 2PE2A 4JX7A 4YHFA 3TI1A 2QLUA 4DBXA 2YW2A 5A4TA
chains in the Genus database with same CATH superfamily
2ITUA 4ZJIA 3UNZA 3VRZA 3WI6A 3PY3A 4E20A 3VNNA 4TZRA 4EFEA 2YWVA 3KC3A 3CQWA 4K8AA 1YI4A 3RMFA 4D2SA 2HDKA 3Q9WA 4CRLA 5I9WA 2YHVA 4YZ9A 4FNXA 4DG3E 3PDTA 3D15A 4TRLA 4U8ZA 4BCOA 3NS9A 3WF6A 1ZMWA 4E1ZA 3QTZA 1P16A 1H26A 5KNJA 2ERKA 2UVYA 4F0GA 5CM0A 3QBNA 2VTSA 1OGUA 4I6LA 4TWOA 3L9NA 5CSVA 5TOZA 2HG8A 1XKKA 3NPCA 2R3QA 4YJVA 2PVJA 3S3IA 1ZLTA 4IJ9A 2J5FA 3UBDA 3PPJA 2XKFA 3MA6A 1KV1A 2EWAA 3P0MA 3PPZA 4FIFA 4RWIA 5AAEA 5M4IA 4S34A 5AUXA 3WARA 2DABA 3DK6A 2XK3A 3BV3A 5KUPA 2HYYA 3KXXA 4PV0A 4O7NA 2R2PA 2R3JA 1PXPA 1CM8A 3P23A 4GKHA 4IM0A 4NTSA 3TM0A 4DN5A 2O2UA 2RL5A 3GIDA 3TY8A 1DAAA 5DR9A 3FXXA 4KBKA 5HNGA 4EYMA 1PXNA 3R83A 3HMOA 1YXVA 4IZ5A 4TYHA 5E91A 5KE0A 2FSMX 4F9BA 3HV4A 3GUBA 3DBQA 3E63A 3OG7A 4AZSA 1L8TA 3E8CA 3UO4A 4CGAA 3DAEA 2GDOA 4EWQA 3H0YA 2V58A 3NCGA 3PA4A 2PVMA 3L2PA 3EYGA 1OGYA 3FMHA 2B55A 3UMXA 4Q2AA 3RCDA 2XVDA 3BU5A 3N9XA 4RJ6A 4NFNA 5JGAA 4IAZA 4ITIA 2PU8A 2A1AB 4XP2A 1JVPP 1Q97A 3Q53A 3R04A 3ZXZA 2WU7A 3QRJA 3NUPA 4FEVA 3FC2A 5FXRA 5K4JA 1YDRE 3LFNA 4I6FA 5EDPA 4DLIA 2YDIA 3VBTA 3OD6X 3LM0A 5J2UF 4D58A 4K18A 3OXIA 4I6HA 5ANEA 4JQ7A 4AT3A 1TQIA 3DGKA 1ZAOA 2B53A 3GEQA 2DAAA 4IDVA 2IZSA 4QYYA 3RINA 2C68A 2WTJA 3FZ1A 4MQ2A 3NUYA 4X21A 2CGVA 2OF2A 4NFMA 3QQUA 3BPRA 2OSCA 5AP5A 4BB4A 3DKCA 3KQ7A 4Z55A 3QF9A 3E8DA 4A9SA 2I7QA 5C27A 5AFVA 2P33A 2VTTA 4TV8F 3RV4A 1SVHA 4U7ZA 5IMEA 3BHTA 2VZ6A 4MA0A 5BPHA 3ZRMA 5HE2A 2B54A 4I92A 2XD4A 3ALOA 2RFEA 3PXZA 3JZ6A 2WTVA 4KUJA 4XV3A 3VPCA 1TQMA 3ETJA 2QOLA 3FQEA 4XP0A 5IQDA 1GNGA 5HICA 4IB3A 4DGGA 3C9WA 1GOLA 2PK9A 2X9EA 3L9PA 5J8IA 4IB0A 3V5QA 3WF5A 3CQUA 5A9UA 3QTXA 1SYKA 4I4EA 1W98A 4EI4A 5JN2A 2VR1A 5BVOA 3CEKA 3V5TA 3I7CA 5IQEA 3RALA 3ZTXA 3OW4A 3PTGA 5LCKA 1U5QA 3AMAA 4MH7A 4JNWA 3UYTA 5FUTA 4DLKA 4KIOA 5HVKA 1JKJB 2YERA 3CY2A 5DEWA 1V0BA 3AT4A 4FTJA 5IH5A 3AT2A 3OEZA 4PTCA 2XARA 3DU8A 3KREA 4FZ7A 4Y5QA 3TG1A 1QPEA 2BILB 4BI1A 3FXZA 2FYSA 4C36A 1DIKA 3VPBA 4LRMA 2I8CA 3PVUA 4JI9A 3QGYA 1QPJA 1SNXA 1HOWA 5AEPA 2R5TA 1TQPA 4EOQA 4DGNA 2P2HA 3D14A 3AC3A 3P7AA 2B9IA 3IW5A 4IVAA 3OHTA 2IW6A 5HVYA 5I5ZA 2DYLA 2IN6A 4XRJA 4RZQA 4GEOA 5AP0A 3QXOA 4C2WA 3FLYA 1Z5MA 3CQEA 4ID7A 3POOA 2Z02A 2YA9A 4O0YA 2Q0NA 3G0FA 5H8GA 4HYSA 4J98A 4AXDA 1CKMA 3RAHA 5EW8A 5DEYA 3EQIA 3WE4A 4J97A 4OR5A 3TV4A 2O3PA 3G0EA 2GQRA 5IA0A 1EUCB 2YRXA 4ZY5A 4CG8A 3SXRA 5KBQA 2VQDA 3CC6A 2QHMA 5BWTA 1LR4A 1UNHA 5EK7A 1XMLA 1EKPA 4DQNA 1Z9XA 3FZSA 4TPTA 3VHEA 2J50A 2DWBA 2OIDA 2I6LA 1NA7A 1UU8A 2QG7A 4U3ZA 4DINA 2COJA 3AX6A 3OUZA 4E4TA 5GHVA 3GQIA 3HAMA 5AWMA 4EK4A 3GENA 3ZFMA 3AD5A 4PP7A 4ANQA 4C38A 4GRBA 3WF8A 3JPVA 2PZPA 3N4UA 2UUEA 5IA3A 1NT2A 4FEUA 5LYJF 3PG1A 3GU5A 1SM2A 4MCVA 3R8VA 4G31A 2Z7QA 4FIEA 4D4VA 2JLDA 5GINE 5DT0A 2W70A 4J52A 2G2FA 4ERWA 2RFSA 4C35A 3UZPA 2NU7B 3DB8A 3NUSA 4KA3A 4WT6A 2W1DA 4EQCA 4JDKA 2XCHA 5CSXA 4JX3A 1YOJA 4C58A 3OWLA 4BDJA 1FQ1B 3MSSA 3O51A 3PP0A 4FTRA 3KIOC 1KJ9A 3MWEA 2XB7A 3MH0A 4X3FB 3THBA 4FNWA 3RR5A 3CGFA 2YFXA 3BHVA 2PVNA 4NH1A 4BGQA 4R78A 4FSMA 2OK1A 1YXTA 4BCJA 5I9ZA 2YITA 2BRNA 2X7GA 4O6EA 3UQGA 1VBGA 4FFRA 3DXNA 1WVXA 3WZKA 4EUTA 1VS0A 4A4OA 4LYNA 1FVVA 2BZJA 1X8BA 4FKJA 4OTWA 2C1BA 4E4MA 4G3EA 4BN1A 4BCIA 4EOLA 5I0BA 1B38A 4WNPA 3WYYA 5I5YA 1NY3A 5IG1A 4DTAA 2GNHA 3G33A 4IEBA 4MVFA 3A62A 2YYAA 4UCRA 5CWZA 2ZDHA 2QF7A 2ZAZA 1O6YA 3QCXA 3N51A 4OLIA 1JAMA 3E88A 4ZS0A 1OPKA 1QL6A 4LGGA 1I1KA 2X0SA 3NUAA 4YBKA 3ZXTA 4D0WA 1GLVA 2OU7A 3TKIA 3DF7A 4BZDA 3COIA 4O6LA 2QC6A 2X6DA 4IE9A 3PYYA 2V7AA 4O0SA 4QQJA 4X6QC 2XNMA 3KF7A 2VTNA 4FTTA 4ZP5A 2XBAA 4MV7A 1Q3WA 1Q8TA 3G6GA 5IU2A 3HDMA 4KRCA 4GLXA 4F09A 5DN3A 5CASA 4MV6A 1KSWA 1W0XC 4I23A 2PTKA 3MWUA 5EQEA 2PY3A 5HO7A 5KS8A 4UYAA 4DG0E 2WMXA 3C7QA 3BIZA 5EH0A 3DOGA 4FV2A 3W1FA 5KZ0A 1VKZA 2EIYA 4W4XA 4F6WA 2XK8A 2LGCA 2RF9A 2YCFA 4CFMA 4G2FA 2VO7A 5CF4A 3E7OA 4M84A 4PL3A 2BZKB 2YN8A 4QP1A 4AGWA 3PVWA 4IDTA 5D7AA 4L1KA 3JRWA 2CKQA 3F5PA 4FV9A 5DRDA 5J1VA 4USDA 5E8ZA 4WD5A 5A4EA 3OCGA 2C6EA 3JY9A 3GCUA 4GK4A 5FNVF 2IZUA 5DE2A 1DAWA 3W0RA 5GIOE 3O50A 4JG8A 2J4ZA 3FV8A 4PDYA 4FEQA 5CEQA 3O0GA 1G8AA 2W7XA 4FSYA 3U4UA 4KS7A 4V0GA 3OFMA 5BMSA 3LMHA 4G6LA 1IOWA 5C1QB 3RPOA 1MRVA 3DZQA 4BBEA 2O5KA 3HP5A 3KA0A 3DA6A 3ELJA 4MUQA 3GU8A 3G8CA 3AC5A 4FL3A 5CVGA 4UX9A 3KYHC 4HQ6A 4MHAA 3VHKA 5JEBA 4I22A 3QQMA 5BWVA 4YURA 2G1TA 3EN5A 2ZDUA 3GCQA 2J5EA 4JRVA 3NNWA 1NXKA 3LFAA 4IWPA 3GCSA 5ANGA 3SHEA 3UVQA 3ZZWA 4Y8VB 4RZVA 4QYGA 2P4IA 2IZRA 3AQVA 5ICPA 2YM3A 4N57A 4QMMA 2CSNA 2QLQA 5FBOA 3P4KA 4WNKA 3ZEWA 1WAKA 2X2LA 4FOBA 3E92A 4GFOA 3L9LA 3S0OA 3PPKA 3FYKX 3GC7A 4XG6A 5G1XA 3UC4A 3WIKA 2YJRA 4NJ3A 5J95A 1PXIA 1V1KA 2YZNA 5DWRA 4MV9A 4O7LA 1GZKA 4DT9A 1H1WA 5HNEA 4BBFA 4GYIA 2QODA 3TCPA 4A9UA 4L8MA 3DKOA 4K6NA 2WXVA 4LGHA 1KE6A 3SLSA 2GNGA 1UV5A 4ZZOA 2OJGA 4F6UA 1ST4A 5LMAA 4FFNA 4QPSA 3R30A 5L2SA 4MNEB 1ZRZA 2X1NA 2XZSA 2BFYA 2WZJA 5M55A 2JKMA 5HZNA 4EOSA 3RNIA 2J9GA 3QC4A 4H3BA 2QNJA 4PMMA 3NZ0A 3CCNA 5BVFA 1XHAA 3UG2A 4RIXB 2DLNA 5L6PA 4RFYA 1DM2A 5B7VA 3LFEA 5DMXA 4ZZMA 1YDSE 1Q8WA 4O7SA 1XJDA 4BGHA 3CD8A 3QCSA 3AC8A 1K2PA 3ZMMA 4MK0A 5T3QA 3W1BA 2W71A 5KX5F 1ZWSA 2UV2A 3RWPA 4I3ZA 1KOAA 3MIAA 3KRJA 2QONA 3NSZA 4HZSA 4R1VA 5HG7A 5C4LA 3WZEA 5BNJA 5HORA 4R5SA 2R9SA 3TNWA 4FT0A 4JOAA 2AYPA 5FPOA 4BY9E 2BRGA 5CSHA 1ST0A 3NVMB 2HJWA 1XWSA 5JSMA 3R5FA 4GFGA 4FT9A 1PJKA 4AU8A 1CKIA 3VN9A 2J6MA 3QKKA 3PLSA 2FGIA 1Y6BA 3DJ5A 3EOCA 4IVDA 4F70A 5KX8A 3TIGA 3F3WA 3KXNA 5JT2A 2R3RA 4RC2A 3DNDA 4BYJA 1I2KA 4I1ZA 2OJIA 3EHAA 3PZEA 1Q41A 4X2NA 4BIBA 4FKRA 4UALA 4D4YA 4M0JA 1OUKA 2NO3A 1Z57A 5AV1A 3UVRA 3GJXB 1J1CA 4C4JA 3TJDA 3MY1A 5GONF 3JVSA 4H1MA 1REKA 4HVHA 1M0WA 2BRBA 2C6TA 1W82A 4FZAB 3CY3A 4O27B 4QPAA 3CJFA 4C61A 5GIPE 1M0TA 4W4WA 3TT0A 4DT8A 3RFCA 1VBHA 3FMDA 4E4XA 2C00A 2P0CA 2W1ZA 4LMNA 5DR6A 4P7EA 4RWKA 2CPKE 3UPXA 5LMKC 2WB8A 1OL5A 4OTDA 3QFFA 4M97A 1OUYA 2BRMA 2HOGA 4HGTA 4FOCA 4ZSLA 2YACA 3NDMA 4ZIMA 2NP8A 2V22A 3FMEA 1OL2A 4O83A 3CSVA 4C37A 2HZ4A 2EJ2A 2GLTA 3EFWA 2PPQA 3Q4CA 5IQBA 4KD1A 3VUKA 4YTFA 3GNIB 3L1SA 2HW6A 1OVEA 5D1OB 4FSRA 3AD6A 2CN5A 4R7HA 4LH6A 4L3LA 3PXYA 3G15A 4B8LA 4C33A 3SE7A 3CE3A 4UBAA 3ZRKA 5BQ0A 5KHWA 4MAOA 3MY5A 4ZOGA 2UW3A 3BAAA 3W2OA 2UZBA 3QD0A 4HGSA 1ZARA 5AM7A 1YWNA 3PY1A 4U5JA 5DIAA 5BVWA 3TV6A 5HTBA 2HIWA 2PBZA 4NCTA 2UW9A 4I50F 3OXZA 3PA5A 4O7VA 1OL7A 1I7NA 3QYZA 2G2IA 3UP7A 1OPJA 2OXXA 1IASA 4E5AX 2X8IA 3OBJA 2XNOA 5BYLA 3PN1A 3EKKA 2QOKA 2RG5A 4IC7A 2IG7A 3NAYA 3ZUVA 3FY0A 4EK3A 5L2IA 3MFRA 1A3GA 4CTBA 4ACCA 5JK3A 4ITHA 2Z8CA 2YIYA 4FKOA 3PXKA 3GDEA 3ODZX 3HDNA 3RP9A 5EYKA 5IQFA 2QO2A 2VX0A 2EU9A 1RJBA 2ZDTA 3NYOA 1KWPA 5B2MA 4YJSA 3BL7A 4FT7A 4A7CA 4OTQA 4CVAA 3D5WA 1OMWA 4AW5A 3MWDA 4OBQA 2R3IA 3SD0A 2GHGA 2WOTA 3HT5A 1OKYA 4O38A 1PW2A 1UC8A 3C0IA 4EQUA 4RIWB 4AW2A 5IISA 1ZMUA 3QU0A 2XNEA 4DH3A 3F5UA 4M14A 4F63A 2XKEA 5HIEA 4U41A 3VWAA 4RVKA 5HE3A 3JXWA 4L53A 4KIQA 4LQMA 2PVPA 2Q2TA 3QUEA 5FM2A 3ZFYA 4ZLOA 4RJ7A 2HCKA 4TNDA 2XIZA 4ZTLA 3WOWA 2C4GA 2JDTA 4EKKA 3SVVA 4QMOA 4Y46A 3QQLA 5I47A 2WU6A 3DKGA 1E4EB 3HA8A 4LL0A 1L3RE 2RKUA 3TIYA 2QOOA 4AGUA 4FTMA 4FUYA 4PWNA 1ZYDA 3UYYA 4YJUA 4L9IA 3R8MA 1E1XA 3G8DA 3P78A 1VLRA 4FL2A 3TIZA 4BZOA 4ZI7F 1FOTA 4DTBA 1JOWB 2W1FA 3PXRA 3RM7A 2FP4B 3E3BX 3OY3A 5K9IA 3FQSA 4WRGA 3R1NA 2FB8A 4R1YA 3QTQA 2F4JA 4H3PA 1ND4A 4EGJA 1XBCA 4DCEA 4FKTA 2Y6OA 1ZOGA 5LQFA 3TTIA 4AFJA 2XUUA 3ZLSA 1JNKA 4YNEA 4CFUA 5BYAA 1OZ1A 5BMMA 1REJA 1W83A 1ZXEA 4AOIA 4AOJA 1CSNA 3FMNA 3R28A 3OCSA 1V0OA 1Q8YA 4P2KA 4XEYA 4TWNA 3C4XA 4LV5A 5KMNA 2VNWA 5FTOA 5M4CA 3P5KA 3JYAA 3AGMA 4IW0A 3QGWA 5I9YA 1ZY4A 3VAPA 3DTGA 2JDRA 3OTUA 3JVRA 1XO2B 3H30A 4D55A 5TR6A 4DGLC 4EZ7A 1CMKE 4R6VA 4UZDA 3FDNA 3QKMA 1M52A 3FI3A 3ORQA 3ZLWA 3K3PA 3FMLA 4QMVA 3U87A 4X3FC 4JJRA 4EKLA 3DQXA 2OH4A 3QA0A 4JRNA 4FIHA 4FV8A 4J71A 1R39A 5CY3A 3U8WA 2UVZA 4YLJA 3UJGA 1GZNA 5FR9A 2GS6A 4GV1A 1WVYA 3BKBA 5A4QA 4XYMB 1ZY5A 1JSVA 1UKHA 2YAAA 3EH9A 4ANMA 4TM5A 4FKGA 5H80A 3HV3A 2Y4RA 4YHJA 3GB8B 4HGEA 4O22A 4WG5A 4GFMA 1JSUA 3ZSIA 1UNGA 2PVHA 5TO8A 1A9XA 2V55A 4M69B 1EKFA 3EQPA 5IH6A 3GC0A 3HB9A 3IGGA 1VR2A 4KKGA 1ET0A 3DK7A 5AP1A 3HRFA 3D2KA 4RQKA 1XQZA 4EC9A 3IOPA 5FDPA 5IEVA 1URWA 2JDSA 1PXJA 3NYNA 3RK7A 5ETFA 1WFCA 3WZUA 2PZYA 3KF4A 5H8BA 3TV7A 3WF7A 3I7BA 4IMYA 4RWLA 5CEKA 2QQ7A 1M2RA 1W84A 4G6NA 2PWLA 1YXXA 3VUHA 2IO6A 3R1YA 5HCXA 3TUDA 4BR3A 3LXNA 3R7YA 3FC1X 4ASDA 4YJ2F 2PVYA 3JUHA 2JIIA 1Q61A 2VTAA 2PUIA 4KIPA 2PVKA 4XG9A 2Y4PA 3VMMA 4BDBA 1WBPA 1M2QA 4EH8A 2P55A 4EK6A 3LQ5A 1VJYA 3RUPA 5BV3A 2Y6MA 5EQPA 4HZRA 4D1SA 2B1PA 3QZHA 5LMKA 2WQOA 2W1CA 2JEDA 5GJGA 2ITPA 3T9TA 2E9OA 2CZGA 1ULZA 2J0LA 3NUNA 1V9PA 3E93A 3ZONA 4XG2A 4WOVA 2B9HA 5DH3A 4IAFA 4CT1A 4Z7HA 4DHZA 5EKNA 1BYGA 2GCDA 2R3HA 4K11A 4NU1A 4ENXA 3BX5A 5D9HA 5FBNC 2YL2A 3T99A 2NRUA 4FC0A 4U79A 3U51A 2IVVA 3EWHA 3HV5A 3VS5A 4AW1A 1PMVA 4BDHA 4BDFA 4GJ3A 1KE5A 3H9OA 1U54B 1XH4A 5KMMA 4B7TA 4S30A 3SW4A 3W8LA 3PJ3A 4IQ6A 4QP3A 3WILA 3IG7A 5KMOA 2V5AA 4QOXA 2XNNA 2V59A 3K5IA 3LJ0A 1G8SA 3MBLA 2VWXA 2NU8B 4NK9A 5M4UA 4WO5A 3TTJA 3CGOA 4FI1A 1YKRA 1BXRA 5KO1A 4X2JA 3F6XA 4X7QA 4TL0A 2WTIA 1PKDA 2UVXA 5HBEA 4GMYA 3QQGA 3BQCA 3W0PA 1K3AA 5L8KA 4E5WA 3VQUA 2ESMA 5AIKA 4DEHA 3HP2A 1KJJA 4KNBA 3JZIA 5KBRA 3OP5A 5IA5A 1CKNB 4RC4A 2HVQA 1JLLB 4H36A 5FRIA 3DBEA 4TV9F 3E8EA 3FQHA 4MYGA 2OH0E 4YB8B 3IO7A 3KVXA 5I5SA 3UFXB 5F20A 4DFYA 4NYEA 4YZMA 3EN4A 3OWJA 4NIFB 3R21A 3IDBA 2HHFA 3W1GA 3VRYA 3LIJA 4BI2A 5K4IA 1XH7A 2VWBA 3WF9A 2XP2A 3SG9A 4C4HA 4EOMA 4FR4A 4IAIA 4IVBA 3U9CA 3VQHA 4HCUA 3G9NA 3RAIA 2RFDA 2UZWE 3GBZA 3COHA 1T46A 3I81A 3OVVA 4HNIA 5CNOA 3KULA 5DPVA 5EKOA 5EM6A 3ML1A 5TF9A 4W8EA 4MKCA 4RIYB 1C3OA 1TA8A 4DE4A 3K2LA 5FTGA 3O5AA 1IR3A 4GVJA 4IWYA 3OWPA 2C3JA 2OBJA 3L8PA 3QWJA 3E87A 4NW5A 5HVJA 3R8UA 3RAWA 3OZ6A 3UC3A 3LFDA 3F3TA 5A3XA 4C34A 3IW4A 4F9CA 5HBJA 3KK9A 2ITXA 5T6KA 2IW9A 4YO6A 4C5BA 1KUTA 1B6CB 3RCJA 3QQJA 2Y4IB 3NCZA 3FE3A 4DEAA 4MXAA 4D2RA 4L42A 4EUUA 4K2RA 5E25A 3KK8A 1H1PA 3TY9A 4FNYA 3ORRA 4UCUA 5JZNA 1JKKA 2NUAB 3IECA 3RNYA 3HV7A 4ZAUA 2XCKA 1UU7A 2XF0A 1PMUA 2F57A 2WIPA 3WZDA 3F69A 5EHYA 3EB0A 4Q5HA 5E8UA 2NNWB 5HHWA 4IM2A 1XR1A 4FEWA 4XLIA 3TDWA 4DH5A 4D28A 1BL6A 1R0EA 5A6NA 3R9HA 3FL5A 2VWIA 1KBLA 4WSYA 5AP4A 1YW2A 1JPAA 3BA9A 2GSFA 3GP0A 5HU9A 4XOZA 4P90A 1P14A 2ONLC 5EYDA 4A4XA 3QA8A 5LMBA 2ZDGA 3UOLA 3BABA 3OY1A 3ZZEA 4F6SA 3PA3A 2HIVA 3R1SA 2R7NA 5CT7A 1H28A 2R7KA 3FHRA 3RK5A 3H3CA 3BHHA 3HLLA 4Y85A 1WBNA 3DAAA 1K9AA 4CLIA 4JBQA 4XUFA 4TW9A 2WTCA 3ZO2A 4FJVA 2QVSE 3LZBA 3Q9YA 3W18A 4FYOA 3KVWA 3TZ7A 4USEA 4XG4A 1FMKA 3CXWA 3QALE 4X3FA 3OS3A 4GG7A 5JQGF 3QWKA 2DS1A 1WVWA 3AC1A 2OZAB 3O8UA 3TW7A 2R7BA 3BLHA 5CU2A 3ZDIA 3W32A 4O0WA 5A14A 3ATTA 2OICA 4P4CA 3LJ2A 4AGDA 3TZ8A 4K0YA 4L45A 2CKPA 5HEZA 4UEUA 5LVLA 3R8LA 3VBVA 4FKPA 2J90A 4TTHB 1WCCA 3R2BA 2I40A 2UW5A 2XS0A 3H10A 2PMIA 1BKXA 3HKOA 3BE9A 2HXLA 2X8DA 4R77A 1DAYA 4QP9A 3NIZA 3A4OX 4AN9A 4BTJA 4CQEA 2X2MA 4BCQA 1IYDA 3BCEA 4F7SA 5BPFA 3EN6A 3SRVA 5LXTF 5C1PA 2EXMA 2H8HA 5M44A 2PZIA 2PN1A 3PRIA 5E92A 5BPYA 4M9UA 2XANA 3FI2A 4I5PA 4TKSA 2HW7A 3BYVA 4CMOA 4E8AA 4ZLZA 3R23A 4HPUE 3MS9A 4L52A 3B2TA 3BHUA 2XK4A 3K5UA 5F1ZA 4DFLA 3KXMA 4EOIA 4HW7A 5B2LA 5LWNA 2YRWA 3U55A 4UXQA 2VAGA 4ZY6A 4AA0A 3BU6A 4EONA 4O2AF 4ASXA 4DA5A 2NRYA 4E4LA 1MQ4A 5CX9A 1PY5A 1Y6AA 3SG8A 3DJ6A 4PL5A 3F7WA 2E2BA 4UY9A 5CT0A 3IW6A 2AEGA 3LE6A 3MI9A 3NX8A 5AAFA 5DT3A 3P79A 4YSJA 4XYFA 4E4NA 2GNIA 4G5JA 4AQKA 1YQJA 5D1JA 3IKAA 4KB8A 4UZHA 1ZOHA 2JFMA 4FVRA 5BVKA 3AC2A 4ACHA 4GK2A 2ZGIA 3F3VA 3UZBA 2WIHA 4BJJB 4L67A 2G9XA 1GIIA 5E8XA 1OIUA 2J0JA 3SAYA 2OJFE 4NM5A 3RPVA 3ULIA 1KE9A 1XH6A 4IX3A 5EW9A 4PZ6A 1A48A 4NKSA 3COMA 5DOSA 2UW7A 3HYHA 3OOGA 4ONAA 3FKLA 5EDQA 2NPQA 2HGSA 2CGWA 1WR2A 4Q4DA 1KE7A 5AUZA 2QK4A 1OPLA 2EB3A 1PYXA 1U4DA 3BQRA 4P5QA 3MH3A 4YP8A 1TKIA 5LJJA 5KKRB 3JRXA 2UZLA 3C5IA 3ZFXA 1PXKA 1J91A 2W1IA 4LMUA 2R0UA 4WBOA 1T45A 3QLFA 1AUXA 3FKNA 3QUDA 2B0QA 3QTSA 1GSHA 4JLCA 1FBNA 4PNKA 4PY1A 3HGKA 4CMUA 4ZMEA 5AUUA 2WTKC 1IYEA 4F1MA 3FPMA 4I4TF 4MA5A 1U5RA 3F88A 2FUMA 3JR1A 4IANA 5JMSA 2JBOA 4HOKA 4D1ZA 4CRSA 2JKQA 3LP8A 2F7EE 3HMPA 3IGOA 3DXPA 2OGVA 2WELA 2Y8OA 3QRKA 3G2FA 5ETCA 4F1TA 3V4SA 1YHSA 3QCYA 4FV7A 5CAVA 2YCSA 1KJ8A 5M07A 1HCLA 1A0IA 1VYZA 3BYOA 4QQ5A 4G16A 4FUXA 5AUTA 4A07A 2OO8X 3ZU7A 2REIA 4ZQIA 5CSPA 4AP7A