2CNQA

Atomic resolution structure of saicar-synthase from saccharomyces cerevisiae complexed with adp, aicar, succinate
Total Genus 106
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
106
sequence length
304
structure length
301
Chain Sequence
SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKAEHDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Saicar Synthase: Substrate Recognition, Conformational Flexibility and Catalysis.
rcsb
molecule tags Ligase
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
total genus 106
structure length 301
sequence length 304
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cnqA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2cnqA02
3PFQA 4NCTC 3FYKX 4O84A 3DTCA 4D1ZA 3UODA 4ACHA 4FFRA 4GK2A 2GQRA 4LYNA 5HICA 4AGUA 4PMPA 5M44A 4DINA 4WRSA 5FLFA 3ROYA 2DWCA 3NUSA 1OPJA 1FMKA 3CJGA 1ZARA 2ZAZA 2A4LA 4EUTA 4M15A 1CTPE 1K3AA 1UVRA 2YCFA 4F0IA 5CQUA 4FFLA 4I4EA 3TNPC 4BBEA 4X2GA 1F0QA 4F9CA 2BZKB 4CSVA 3L8SA 4AGDA 2CGXA 3KQ7A 2P2HA 1S9JA 5KX8A 1VYZA 1GIHA 4QMWA 5BYZA 4MEDA 5HNGA 4Y72A 5AP3A 5DR9A 4AOJA 5D12A 2R7NA 4D28A 3ZOSA 2B9IA 3OTUA 3KULA 3QTZA 3P7BA 1PX2A 5J1WA 2EB3A 3BLHA 2Z60A 4IAAA 4DEGA 2YIYA 4ITJA 3OXZA 2P55A 4U41A 4BGGA 3Q4TA 4NUSA 3HEGA 5EI2A 3QRIA 2R3QA 3R23A 5JRQA 5JFWA 3OCGA 4ZOGA 4O83A 2R3FA 2UZNA 3KMWA 4WG3A 3DBEA 3OBGA 4Y5QA 3KXMA 3OT8A 4FKSA 1LR4A 4FV6A 1JLLB 4FV0A 2QOHA 2QO7A 2CNQA 5LMBA 4QP7A 1LUFA 4I94A 4L3LA 4MWHA 3OY1A 3P7AA 3VS2A 3F2RA 2YIQA 2YISA 4AUAA 4L00A 4QMZA 1Z9XA 4FK6A 3CS9A 4O6LA 3NS9A 2PVNA 4OR5A 3MJ2A 3K54A 3R9DA 3W2SA 2LAVA 4YBZB 4X0MA 3TIIA 2I7QA 2HENA 5LOVF 2GS6A 3Q52A 3BLRA 4O27B 1Q8YA 4JQ8A 4ZZMA 5AA9A 3ZLXA 5A4CA 2RL5A 4KINA 1PXLA 4FSYA 4EHEA 2YW2A 1J1CA 3QLFA 4R3PA 3FZRA 3KXHA 2JBOA 3AC2A 3ORPA 4QMUA 3ANQA 1M0TA 3QF9A 3D5UA 3DXPA 2WTCA 5HE1A 2WMWA 2HY0A 4IW0A 5CYIA 2YABA 4M13A 3SXSA 5FP5A 2NNWB 3BHTA 4I3ZA 4FNZA 3I0OA 2IG7A 2R4BA 2EB2A 2X7OA 4QMSA 4S2ZA 2Z02A 1G3NA 2R2PA 1GZNA 2JEDA 3EKNA 3PSBA 5HCXA 3ZM9A 3CJFA 3KMMA 3WZDA 4BB4A 4DN5A 1MQ4A 2XD4A 3KCFA 2IZTA 5IU2A 1G5SA 1UKIA 3EFLA 5HBJA 4YBJA 4HZSA 2W0JA 4I21A 3VBVA 1KJ8A 1PMEA 3OWPA 4LV5A 3HECA 5DNRA 3ZC5A 3U55A 5K9IA 4JRNA 1JDBB 3W1FA 4DFBA 4G31A 3BIZA 2XB7A 4IC7A 4MA0A 2J2IB 3ZYAA 5H3QA 2R7IA 2W4KA 2BDJA 1A48A 2PZRA 4XG9A 1CS0A 1FBNA 4B6LA 2VPQA 4K9YA 3A4PA 4XG3A 5LMKC 5JVDF 2VV9A 4DFXE 4F4PA 2W5HA 3PPKA 4G6LA 4O7ZA 4PTGA 5FXSA 2GMXA 2DQ7X 3ZRMA 3P78A 5IUGA 4UN0C 2PZYA 4JX3A 1JDEA 3B2WA 4RJ4A 4F63A 3TXOA 3TKHA 4IANA 4O6EA 5JH6A 1KSWA 3KVXA 4MV8A 3ZFMA 3FMEA 2W1CA 3TTJA 2W1ZA 4EOJA 4UV0A 3ZZWA 5K5XA 1U5QA 5F9EA 5AV2A 2OFUA 3ZUUA 3KRRA 3CPBA 2QG5A 5EH0A 2GQSA 3HRCA 3AXWA 3H9FA 3QZIA 2C6LA 3PE2A 4PTCA 2VO3A 5CF8A 5ICPA 2W17A 5J7HA 3NCZA 4KS8A 3DLZA 3ZDUA 5JFSA 2ETRA 3V8TA 4ZS0A 4I23A 5IYZF 3T3VA 3OZ6A 2OI4X 4C7TA 5AMNA 3LJ2A 2GNHA 1T36A 1W84A 3SE7A 4WBOA 3RWQA 3RPRA 5J9YA 3MH3A 3KREA 4HGSA 3UBDA 1H4LA 3FC1X 4II5A 4IM0A 5LMKA 5LXTF 3IW7A 4J53A 2QG7A 1KV1A 3V6RA 3HNGA 2O5KA 3NYVA 3EIDA 3PLSA 3UDBA 1BNCA 3LOKA 3N9XA 4OTQA 2JAMA 2PWLA 4BTMA 3R5FA 4DH8A 3RUPA 3UMXA 5KUPA 2BAJA 2C5NA 3JVSA 5F94A 5GNKA 4F6SA 4EH2A 1DV1A 4N70A 3PY3A 3HBLA 2FUMA 3LJ0A 3ZRLA 2CKQA 3CY2A 4A9YA 3UC4A 3PJ3A 1FINA 4G1WA 4BI0A 4AE9A 1M6VA 3ENMA 3EQGA 5AIRA 2YM5A 3ORLA 5BPYA 2OBJA 4L7FA 4NTTA 5C8KA 4S34A 5DG5A 4O2AF 3V4ZA 1KJ9A 3BGPA 5B2KA 1MP8A 3NYOA 4F9WA 2YYAA 4ZTLA 4UXLA 2A19B 3BELA 4EH8A 3NZ0A 3K5HA 3RPYA 4XG4A 3HAVA 1EH4A 4RG0A 3K5VA 4EI4A 1URWA 5ANIA 2OIDA 4RWLA 3FDNA 2ZB1A 3UPXA 2V58A 4E4TA 1GY3A 2V7AA 2BFYA 4U0IA 3SAYA 1AGWA 3D83A 2R3JA 2VTMA 2WOUA 4BDCA 1Z5MA 3VHKA 3H3CA 2WTDA 1Q41A 2IJMA 3N4UA 5CSXA 1R1WA 4YJSA 4AOIA 4YJRA 4FKQA 4JAJA 2PMLX 4BI1A 2ZDHA 4QQ5A 2CCHA 1VKZA 2HOGA 4OUCA 3ELJA 4Y46A 4FTMA 3RAWA 4ENXA 4F9AA 2A2AA 3SGCA 3P79A 2I80A 3LQ5A 1TVOA 3KU2A 4W4XA 4QP2A 5CX9A 4Y85A 2J50A 1UU8A 4D5KA 3WO0A 3MH0A 3CQWA 3E8DA 4O81A 5FDXA 3QD2B 4XLIA 5C8YF 3A4OX 4FSWA 4FVPA 5ETIA 3IGGA 3F5PA 1V0OA 1BI7A 2YM4A 5EYDA 4MQ1A 2QONA 4CNHA 3UQFA 4X6QC 4RVMA 3DK3A 2XNEA 3RMFA 2F2UA 4ZJIA 2YWVA 3BKBA 3MGYA 4S32A 2F57A 5E8ZA 4AZEA 4BTFA 5LWNA 5JT2A 3OUNB 2XNGA 4MD7E 1YWRA 3RAKA 1C3OA 4MV3A 3VN9A 4I0SA 4OGRA 4L42A 1OB3A 3U87A 3WI6A 4O7TA 4D9UA 4TN6A 5C4KA 4MTAA 1AQ1A 4K18A 3S2PA 2ITYA 3EFWA 1XH6A 1B38A 3GXLA 4L3PA 3PLAE 3ORRA 1JAMA 3VF8A 3UOKA 1H25A 4YJVA 3R9NA 1OM1A 4YJUA 5FG8A 3QXOA 1CKJA 4F0GA 4WUAA 3GU7A 5CQWA 4L8MA 3ULZA 3DBFA 3RI1A 3SD0A 5HG5A 2WTKB 2RFNA 4QQJA 2GNFA 3LMIA 3PTGA 1ZYSA 3VS5A 2WMQA 4CQEA 5AUZA 5CI7A 5CAVA 2ITTA 1JOWB 1QPEA 4NW5A 1KC7A 3LFBA 4QMPA 4JG7A 4CFWA 4IHJF 3QQGA 1Z2OX 4I50F 3BQCA 5GJFA 4L1KA 3R7EA 5IA3A 2GNLA 4NCTA 2Z7LA 1S9IA 2UW5A 3RK5A 3ORNA 3LFFA 2YL2A 4IX4A 4EOLA 2QOBA 4LUEA 2JFLA 4I1ZA 3R2BA 4EL9A 3QBNA 4HCTA 3JRWA 2BMCA 5KMOA 3FSKA 3UIUA 4FTIA 3M42A 5CI6A 2Z2WA 3QKKA 4O96A 4QOXA 4GIHA 5CSHA 4YTHA 4LRMA 4Y8VB 1XH7A 4YJQA 4XX0B 3BI6A 5TT7A 3V01A 3GCQA 3FMHA 4DCAA 4FG7A 4EJ7A 4BDHA 1J7UA 4RJ5A 2J0KA 2AUHA 3FHRA 2UW8A 4K77A 4CFUA 4CGAA 2PVLA 3CC6A 3HP5A 4HNFA 5C9CA 5LYJF 3AMAA 3QZHA 5F95A 4ZSLA 4QRCA 3CP9A 3LXLA 4YPDA 5AX3A 2O3PA 4IQ6A 5M56A 4ZY5A 3NUNA 3RHXA 1T45A 3QC9A 4Y83A 4FFPA 4P5QA 4JI9A 1EZ1A 3LFSA 1CMKE 2YFXA 3AD6A 5DN3A 4TNDA 2WFYA 1BL7A 2O8YA 3IGOA 3PXKA 2BPMA 3Q53A 4TWPA 3PP0A 1LPUA 4IB1A 4ACCA 4YZMA 3Q32A 2PZ5A 1WFCA 3BHYA 2QR7A 3NNWA 2UW0A 3Q04A 1V1KA 4TPTA 4TXCA 3VAPA 3VO3A 4IMYA 3ZXZA 4JRVA 3HV4A 3FJQE 3PXFA 4Y5HA 2QCSA 1CKIA 4UYNA 2AC3A 3IW5A 4HYUA 4DHFA 5E9EA 4E4LA 4UX9A 2FPGB 4RIOA 3A99A 2OO8X 4GSBA 4NZWB 4JNWA 4ANSA 5AP0A 5HE2A 4B99A 5I4NA 5K4IA 4D9TA 5L3AA 2GHLA 3FYJX 5AADA 2VNWA 1W98A 2JKOA 4K8AA 4O0SA 4U5JA 5D7VA 4ZIMA 3LE6A 3IONA 2GNJA 3Q2MA 4D1SA 3V04A 2PVRA 2WQEA 2O65A 2ONLC 1KOBA 3FE3A 2FB9A 2YWPA 4HJOA 1IA8A 1WBPA 5EM7A 4BGHA 3BYOA 4DG2E 2VWBA 4IAFA 1G8AA 1XH8A 1HOWA 3QCSA 3IS5A 3P5KA 5IDNA 5IQCA 4AZTA 2XK6A 2XJ0A 2FA2A 2W7XA 2XKDA 4UB7A 1UA2A 4QMTA 3UTOA 5CAQA 3I12A 5HZNA 2JIIA 4L9IA 3P1AA 2VX0A 3VJNA 2O63A 5H8GA 4DBXA 4RWIA 2J51A 4FSMA 4E5AX 1B6CB 1Q3WA 3SOAA 4AZWA 2QI8A 4E5WA 3Q6WA 1PYXA 2G2FA 4EOQA 1YI6A 4U44A 4C34A 2OSCA 3DLSA 3NEWA 5DVRA 3LPBA 4QQCA 4K2RA 2YRXA 3CY3A 1WAKA 3NWWA 1FGKA 2WO6A 3OWJA 5HLNA 3IW6A 3V8SA 4M84A 2J9GA 2I0VA 3R8ZA 1H1WA 3RAIA 4YTFA 1DAWA 4O7RA 1W83A 4IVCA 3TJCA 2CKOA 5CALA 2XRWA 1R78A 4LV8A 4FKOA 4QTCA 2EUFB 4BDGA 3Q2JA 5M4CA 4F7SA 1JSTA 4I5CA 4M0YA 5HGIA 4BR3A 2FO0A 5HD4A 3O8TA 4XX9A 3PWYA 5KKNB 3Q6UA 3UQCA 4KKEA 2VNYA 2OZAA 2XK9A 4EQMA 4GEOA 4DF3A 2NU7B 4M14A 4IIJF 3GVUA 3U6JA 3N4TA 3LWBA 2BDFA 3JVRA 3RWPA 2X0GA 3BU5A 3DJ6A 4KWPA 4QP1A 4X3FA 3HMIA 4QP4A 4R1VA 4XG6A 4YJNA 3W2CA 3E3BX 4M69B 3R71A 3WYXA 3EJ1A 1W96A 4RJ3A 2HYYA 5M55A 1IEPA 1MRYA 4FUYA 4RX9A 3G90X 3HV3A 3MI9A 5A3XA 2BRGA 4FTQA 2JDSA 1W7HA 3BWFA 3KXNA 1OI9A 4O4IF 2QLUA 4BYIA 3COIA 1OPKA 3E7OA 1L8TA 3Q9WA 4ZSJA 4AW2A 4E4NA 2PBZA 2GTMA 5CAOA 5HNBA 5IQBA 2W6PA 4OW8A 3E92A 2YS7A 5EKNA 2XNPA 4XG2A 4HVGA 5FTGA 4O0VA 4FNWA 4E73A 4J1RA 5AP4A 3WF6A 1NT2A 3DOGA 4ZQIA 4QMXA 4AACA 1PJKA 3F88A 3QKLA 1Q8ZA 3NLBA 3OCTA 4FV4A 3KN5A 4KRDA 4PDOA 4TYHA 3WF5A 4ZMFA 4WBNF 3TUBA 5AFVA 3QQUA 1DI8A 1U54A 2W5AA 1P2AA 5CEIA 3UJGA 2JGZA 4PL5A 3EZVA 4TWOA 3ZBFA 3DK6A 5E7RA 4YGAA 2WGJA 2XF0A 3ZBXA 3L9MA 3GFEA 1JKLA 2F7XE 2FVDA 3FZPA 2UZOA 3PE1A 4GG5A 1CE8A 3T8OA 4MV9A 3ORZA 3S95A 3NUAA 3EQRA 4D4YA 1GNGA 2ZOQA 4WOVA 3G6GA 3I7BA 4GG7A 4N57A 5AP7A 5TKDA 3DV3A 3EL7A 5CU3A 3N8DA 1CM8A 2ZVAA 4BDBA 3CE3A 2I0HA 1DM2A 4EBWA 3HL7A 4YC8A 3FMDA 4FIGA 4WA9A 1YXUA 5EYCA 2WMAA 3D5XA 4A4OA 3G8CA 2V62A 2VAGA 4O0RA 3BLQA 5AEPA 3KRLA 4RA4A 4NFMA 4IB0A 4CMUA 1YXSA 3D2KA 1KE5A 5CNNA 5ANEA 4J95A 4QMQA 3ETHA 2XM8A 2WMXA 4I6FA 3HVCA 3BEGA 2WU6A 1YKRA 1J1BA 2OF4A 2HZ4A 3I6UA 4AN3A 4EK5A 4DH5A 3UZPA 4IZ7A 2ETKA 5DIAA 2FPIB 4ZY6A 2Y4PA 4CCBA 4ZTQA 4Q9ZA 3AC8A 5L8JA 2RG6A 4O7LA 4I24A 3PVGA 1GZOA 2OF2A 4HGLA 4OTWA 4R1YA 1WZYA 4RX7A 3RHKA 3UVQA 5BVKA 4AW5A 3L9LA 3MVHA 4DGLC 5IH6A 5BYYA 1JSVA 2V7OA 4GYGA 1ZXEA 5CU2A 3DBQA 3QKMA 5IA1A 3IG7A 4Q5HA 4YJTA 5DMXA 5HE3A 1ATPE 5CNOA 4ZTHA 4XH6A 2YEXA 2ZJWA 3RPVA 5B7VA 5ANOA 3FQSA 3FLSA 3EOCA 3DKCA 4JT3A 1H24A 3D15A 3HMMA 4PF4A 4TY1A 3DS6A 5EQPA 4CTBA 3R1YA 4OT6A 3LAUA 3QTUA 4YO4A 3U6IA 3KGAA 4FKTA 2XYNA 1MQBA 2C0OA 3AT4A 1M14A 4E8AA 5ANDA 2JDRA 2QKWB 3IOPA 4C36A 3COKA 4IWQA 3NNUA 5AUVA 3FLYA 5EK7A 4OBPA 2V0DA 4BCHA 3FSFA 4EGJA 1OL7A 5HV6A 2DUVA 2YN8A 5CU6A 4IM2A 2B4SB 4YB8B 2NUAB 4FEXA 3SG8A 5LQFA 5GIPE 4EOKA 2P0AA 5CA1F 4XG8A 2P3GX 5J8IA 1P5EA 4MK0A 3ZO2A 4CMTA 3ROCA 3FQHA 3WE4A 3IPHA 5FD2A 2QR8A 4EHZA 1LEWA 5EQEA 2ETMA 2B9HA 3R0TA 4GVAA 1CQJB 2ACXA 3E63A 4TTHB 3MW1A 3QTIA 4H58A 4G3DA 2R7LA 3LCKA 3SOCA 5EDQA 5DT0A 4J8NA 2R7BA 3V5LA 4JS8A 5I9VA 4D0WA 2YM3A 3SHEA 4RZVA 3W8QA 3MTLA 3NVMB 4P7EA 3EN5A 1PMUA 2JDTA 3FZOA 3VS6A 3WF8A 3MJFA 3FAAA 3TNWA 1Q97A 4ZZOA 2WHBA 4IDVA 3NAXA 5DBXA 5FP6A 4YJPA 3TJDA 4AT3A 3KN6A 3F3TA 2ITNA 3I4BA 3R7VA 1Q24A 2X2MA 2JIUA 3VUDA 4F09A 5JZJA 2Y8OA 4ZJVA 3M1SA 3Q60A 3HYHA 3FC2A 3GOKA 4ACGA 4EYMA 5DWRA 5IQHA 3PIYA 3N6RA 3JY0A 2CNUA 2XUUA 4PY1A 5AUWA 2R3GA 3HLLA 5AUTA 1SVGA 4DFNA 4D4SA 1NVSA 4AGCA 3RM6A 2V22A 2YAKA 1VBGA 3R8PA 4KUJA 4UALA 4DT8A 5F4NA 4DT9A 1YI4A 3A62A 5TOZA 4GH2A 1I44A 5CENA 1F3MC 1M0WA 2XS0A 3DB6A 4O4LF 5KHXA 2QC6A 1XKKA 3KRWA 1OIYA 5IEXA 3C9WA 3UOJA 3PA3A 2QNJA 4RT7A 2JDOA 4W8EA 4YLJA 5HCYA 4O0WA 4CZTA 4OLIA 2QOCA 4RIXB 3VNTA 4EH7A 1ZMUA 4MV4A 4UZHA 2E9NA 2F9GA 4X6RA 2BROA 2QOKA 5CEPA 5CZIA 4HNTA 1PXKA 2QU5A 5G1XA 3AMBA 3VUIA 5HG8A 5CVHA 2Z8CA 4IDTA 3F6XA 4H3PA 2P0CA 4BVUA 1XHAA 2C6KA 1QPCA 4FKVA 4D1XA 1FVRA 1BLXA 3LW0A 3MYGA 4CD0A 2RIOA 3HUCA 3UE4A 2CMWA 4ERKA 4EYJA 2R7MA 1JWHA 3OC1A 4RJ6A 3RKBA 3ORQA 1JLUE 1KBLA 4GL9A 4MXCA 4QYEA 1YXVA 4C58A 3E5AA 1YDSE 4FKWA 2DS1A 2BRMA 5E90A 3UO4A 3V5JA 3EFKA 3FLNC 3ANRA 4IAKA 3FY0A 2WMBA 5CZHA 4WNPA 4DH3A 3M2WA 3WILA 3NNVA 4XG7A 5HTBA 4U42A 5HBRB 4ANBA 1WR2A 2FB8A 4DLIA 1WBOA 4M8TA 2OZAB 4IH8A 4XMOA 4D4VA 4DTBA 4FEUA 1Q4LA 3GI3A 4MH7A 2ZMCA 4F1TA 5A6NA 2E9OA 4RWKA 1E1VA 1NY3A 1URCA 3UZTA 4RVTA 1OKYA 3GCSA 3U4WA 4CT1A 1WBWA 3IK3A 4YR8A 3VBQA 2BRHA 4AU8A 4MQ2A 3R8MA 3WE8A 3SXRA 4FT3A 2W6QA 1OIRA 2C1BA 4CFMA 3NYNA 4FYNA 3ZC6A 2HGSA 4YC3A 2I6LA 3TWJA 4EQUA 2Q0NA 2B55A 2CPKE 1GZKA 4KS7A 3VUMA 2FH9A 1OPLA 4GVJA 5F20A 5KO1A 3SKCA 4HYHA 5IQDA 4G9RA 3UG2A 3W2OA 4DCEA 4MV6A 4KKHA 4RA5A 3C0GA 3ERKA 3GFWA 4ANMA 5EOBA 5HE0A 2QURA 4ZZNA 3HB9A 4RX8A 1FOTA 3IOKA 2XK3A 4QYGA 4J98A 3C0IA 1RJBA 3KXXA 5DPVA 3I60A 4XP2A 3B2TA 4WRGA 3RPOA 1WCCA 1XH5A 5EHLA 2BKKA 2XRUA 3R00A 4I0TA 3NUPA 2WB8A 4NTSA 4R3CA 4EEVA 2R5TA 5JQWA 2UVZA 3EQBA 2WEVA 3SV0A 3UP2A 2BZIB 5EHOA 5AV3A 5DR2A 3ZMMA 3TIGA 2Q83A 4G6OA 2C30A 5D10A 1ZWSA 2OH4A 4UY9A 4QMNA 5JRSA 3W55A 1J91A 3WIGA 2X1NA 3D0EA 4MXAA 2PSQA 1HCKA 4XHKB 4U9AA 2WPAA 3D5WA 3LIJA 3A7GA 2IPXA 4GUEA 3JZFA 4GKHA 5J5SA 2CGVA 4TV9F 4USFA 4JXFA 4QMMA 3OBJA 4Z7GA 2PE0A 3BQRA 4QYFA 2VWXA 1UWHA 1YOMA 2B0QA 3RV3A 3GQIA 5BUEA 3T9TA 4FNXA 4FKIA 2R85A 3A7FA 3E8CA 3QQHA 3MPAA 3KA0A 5E8SA 3G0EA 4F65A 3FZ1A 3LQ3A 4YZBA 3RJCA 4K6ZA 4C4IA 1PK8A 4DE4A 1EUDB 3R21A 2VWVA 1XO2B 3QFVA 2WTIA 5JMSA 5AIKA 3AD4A 3LKMA 5CY3A 4CRLA 4NSTA 4QP3A 3VVHA 4E6AA 5M07A 2Y7JA 4FTKA 3D9VA 2PU8A 4DA5A 3MWEA 2ITVA 2W1FA 2O2UA 2VTIA 3UYTA 4KABA 4YZDA 1JSUA 4P5ZA 4V05A 4AZVA 2R3HA 1QPDA 3EFJA 3P0MA 4QNAA 3AG9A 4WO5A 5LWMA 4FSNA 4P4CA 5IEYA 1M2QA 4FZ6A 1YOJA 1BUHA 4NH1A 4R7IA 3VHEA 4YNOA 4XEYA 4DTAA 5GONF 3PXYA 4EZ5A 5C1PA 1A06A 3FZTA 4U80A 4HPTE 3FI3A 4YZNA 1P4OA 1U46A 3A60A 3K3IA 1M7NA 4V0GB 4XBRA 2EXCX 4M12A 3W2QA 4ZOLF 4WUNA 3FUPA 3LXPA 4EQCA 1GAGA 4K33A 3L9PA 3Q9ZA 3FL5A 3QALE 4P2KA 5HLPA 2VR1A 3CKWA 2C6TA 5F1ZA 3EQIA 3FMMA 4PL3A 1YWNA 4F7NA 4RWJA 2EU9A 4GJ2A 2Y0AA 3FMJA 5D7AA 3VUGA 5CTPA 3ZO4A 5HG7A 2EWAA 2QD9A 1PMVA 3AC5A 3EQHA 3ETAA 4PL4A 3DPKA 5FEEA 3VS1A 4E5BA 4J96A 2X8DA 5BPFA 1BXRA 2QO2A 3DNEA 1M17A 1SVEA 2BDWA 4DLJA 3BRBA 4X7QA 4C5AA 4DAWA 4JQ7A 2BAKA 3F5GA 4C2WA 2W05A 4BCOA 4CLJA 2F7ZE 3I7CA 5E8XA 2ERKA 3DCVA 3TV4A 4I93A 1Y6BA 4H3BA 4AE6A 3HV6A 5K4JA 3FLZA 2H34A 1VR2A 2ITPA 4ARKA 4TYHB 5CU0A 3M11A 4C02A 1YRPA 3CPCA 4JDJA 3O2MA 3GU4A 2WMTA 3NR9A 3QQFA 1H1PA 2OJJA 4S30A 2XK8A 2RGPA 2UVYA 3DF7A 4DGNA 1KE7A 4G5PA 4IHPA 4A4LA 3RCJA 4EZ7A 2WU7A 4QYYA 3C7QA 3E87A 3U9TA 4E26A 4LRJA 3HA6A 3RALA 3U9SA 3P4KA 5CA0F 2R84A 3CTQA 4C59A 5TR6A 4JL9A 4ZSGA 3AX6A 3WOWA 3MBLA 4BHZA 3UOLA 5KE0A 1GSAA 3VBXA 4NL0A 4DG0E 5JFVA 2ZDQA 2I1MA 3O96A 5HESA 3A2CA 5AP5A 2GPHA 3MSSA 3KAJA 3OUKA 1U54B 3WZJA 3OMVA 2BFXA 3IQ7A 1JNKA 4F1MA 3CKXA 1P14A 4A07A 3WF7A 4JBOA 2GDOA 3TACA 5IZFA 4KD1A 3AGMA 3CGFA 2WEIA 4LG4A 4N6YA 4NYEA 4C2VA 5HIEA 5I5ZA 2OIBA 3VRYA 4EKKA 5FBNC 1E1XA 1KJIA 1PKDA 1CKPA 2YIWA 3MFSA 4L43A 5CANA 1SCUB 3FY2A 4LQMA 1WBVA 5A4LA 5GINE 4PUZA 2B7AA 2YDIA 4FBXA 3NGAA 4FZAB 4PDSA 3QA8A 3U54A 2PY3A 4HCVA 4BCIA 4TT7A 3QWKA 3QYZA 5AAEA 2UZDA 4N6ZA 3MY5A 3FXWA 5EDRA 2QF7A 3DQXA 1TQPA 1YHWA 2WOTA 3IO7A 4KB8A 4IB3A 2JC6A 1REKA 3GC9A 2GNIA 4M3QA 3KK9A 3MA3A 4G16A 2GFSA 4L45A 4O21A 4OTFA 3T9IA 3ZO3A 1KUTA 3MPMA 4K1BA 3V5QA 5DH3A 2PMNX 2ONLA 1EYZA 5DGZA 2BVAA 4XBUA 4MCVA 1OL1A 1QPJA 3POZA 5DR6A 1K9AA 2WNTA 4F9BA 3OCSA 3S3IA 1BYGA 3KRJA 2BALA 4HZRA 4LUDA 5IUIA 3LVPA 5HU9A 4BHNA 2JDVA 1OIQA 3PP1A 3GUBA 2HXLA 3KFAA 2V55A 3VS0A 2VGOA 2VZ6A 5AV0A 4DTKA 3K5IA 5AAGA 5CAEB 5IUHA 2ITUA 5J87A 4XRLA 2NU9B 4Y95A 5FXQA 4ASXA 3TZMA 5L6PA 1PMNA 2VN9A 2IWIA 5EFQA 4Q2AA 4CKJA 4BCGA 3C4CA 5CAPA 1E9HA 1H0WA 3JPVA 2W70A 5H2UA 2OICA 2F4JA 4FEVA 4U81A 4FTUA 2WMUA 4QMLA 3PJ8A 3QA0A 2CGUA 4V0GA 3VULA 3G51A 4A06A 3MVLA 3R1SA 4GV1A 5CF4A 3MDYA 4KKGA 1XJDA 3HRFA 3L8VA 4KAOA 4QYHA 3KL8A 2YITA 4CV9A 5DLSA 3WIKA 4GFGA 2QOIA 2J90A 5AUUA 2J4ZA 5G6VA 2IO6A 4ITHA 4IBMA 2BR1A 3R02A 2B9JA 5FM2A 2CSNA 4JG6A 1H08A 2I40A 2XH5A 4FZDB 4EWHA 4EH5A 5JQ5A 4A7CA 2XKFA 4O82A 3UNJA 3JRXA 4ZMEA 3TUCA 1G8SA 3UPZA 4LGGA 3ZS5A 1U4DA 5FQDC 3DZQA 5TF9A 5ACBC 3UOHA 4U3YA 3QX2A 3CD3A 2A1AB 4J7BA 4TYIA 4MD8E 3R5HA 3CBLA 3QU0A 3WARA 4MAMA 2QOOA 1OBDA 4EORA 4TV8F 5M4FA 2KTYA 1SVHA 2DIKA 4D5HA 4TYEA 3I5ZA 4WBBB 1JPAA 4ACDA 3II5A 5LVPA 3V5PA 2C6OA 5JN2A 3VBTA 3HDMA 4A9SA 3E8EA 3C4FA 4RIWA 3PDTA 4QMOA 5J9ZA 5FNVF 3TCPA 3BE9A 1H00A 2YS6A 5M08A 1OMWA 3U4UA 2YDJA 1GSHA 4BTKA 4CG8A 4EONA 4FFOA 3KULB 5K3YA 5IEVA 4EOMA 2NRYA 1FVVA 4AX8A 3KB7A 3LXKA 1KOAA 2AYPA 4QQTA 3MTFA 5IA0A 5J1VA 4FX3A 1JKTA 2XBAA 4ANLA 3DK7A 4O7NA 4BDDA 3PPJA 1V0BA 5HO8A 4FUXA 2FGIA 4CZUA 4E6CA 4BDEA 4J99A 3UIBA 2IN6A 4HPUE 3NVKI 1PXOA 4APPA 1RE8A 3MIAA 4EKLA 3MB7A 3LFDA 4MNFA 4RC3A 5CXHA 3JXWA 4RPVA 5CT7A 4JX7A 2PVMA 2W5BA 4NM5A 2B53A 4USDA 2IP4A 4MAOA 4DEIA 2XCLA 3D7ZA 2C5YA 4XV1A 3F2NA 4X2KA 4MXOA 4ENYA 4QPSA 4C37A 4O2ZA 3FQEA 3R63A 4M97A 5I9ZA 2X0SA 1W82A 5HVYA 1VBHA 1LEZA 1A9UA 3PA5A 4I5MA 4H36A 3HUBA 4AA0A 5A9UA 5KMIA 2VTOA 3PG1A 5JQ8A 3GU5A 2WD1A 5HKMA 4R77A 4BDKA 1APME 1O6LA 1YVJA 3FPMA 1W0XC 3NIZA 3QYWA 4JLCA 4PP9A 3V6SA 4EGQA 1OUKA 1FGIA 4AF3A 4YMJA 3QTXA 4I4FA 3NAYA 2X7FA 2YERA 3ORMA 4XRJA 2ZV2A 2VTLA 2XCHA 4USEA 3DZOA 2X2KA 5EW3A 4MXYA 3TN8A 5E8UA 3TM0A 3A8XA 4GW8A 2OG8A 3EN7A 3R1QA 1JQHA 5ANGA 5DE2A 1XH9A 4TW9A 4R3RA 2GTNA 3LQ8A 3PYYA 4FV8A 1TQIA 5DEWA 3CEKA 3K3PA 3EYGA 4TYGA 2YAAA 1BI8A 2ERZE 4ZTSA 2R3NA 4ZLYA 3MFRA 4FSQA 4IADA 2H6DA 4IVAA 3R7IA 2QOLA 3UG1A 4AT5A 5LVMA 1IR3A 2H8HA 2J5EA 5DA3A 1AUVA 4ZXTA 3QGYA 2QQ7A 1I7NA 4O7WA 3F5XA 5I9XA 3BBWA 3W16A 2W71A 4FMQA 1OKZA 4DEDA 4FT7A 2NU6B 4NIFB 5M57A 3DJ7A 3A61A 2C1AA 3JYAA 5I9YA 2W99B 4B4LA 1IAJA 3TNIA 2UZBA 3BCEA 3K3JA 3FI8A 4O0TA 2XM9A 4ZEGA 2VD5A 2G1TA 2ITWA 3POOA 4AG8A 3U9CA 3A7HA 4KIOA 4FYOA 4O0XA 5FUTA 4YBKA 3HKOA 3TZ8A 4AZFA 4DIMA 2PUPA 3KY2A 3KC3A 3VIDA 2XJ2A 2NU8B 4H3QA 3GT8A 3ATTA 5EW9A 4M9UA 2H96A 4FK3A 4HYIA 4FSRA 4YSMA 4NKAA 1ZYCA 4ME6A 5JGDA 4OT5A 3OF0A 2W96B 2B9FA 3LMGA 1XQZA 4G2FA 4RC2A 4YP8A 5E8WA 4RIYA 5DI1A 3MPTA 2PMIA 2ESMA 3TDVA 1BKXA 2GU8A 2OJGA 3DKGA 2QLQA 3W2RA 3PXZA 4XS2A 1R3CA 2CN8A 4IFGA 3QRJA 3C4ZA 2X9EA 3EYHA 5A4TA 3DU8A 4LRKA 4NU1A 4BBMA 1JBPE 3Q4UA 1U5RA 3O23A 1SM2A 2E2BA 2WMRA 3ULIA 4ORKA 4PDPA 3PZHA 5AX9A 4IWDA 4RX5A 4ZLZA 3DFAA 4FG9A 3ZO1A 3BE2A 2C3IB 1OKWA 4QPAA 4FICA 3QQLA 2C6MA 2BTRA 3BHHA 3MN3A 4KA3A 2OK1A 2YM8A 4JBQA 3S00A 3CQUA 3GCPA 3GP0A 4RQVA 3W8LA 4GK3A 1L3RE 2R3RA 2QO9A 3GNIB 4JOAA 1J7IA 4F7JA 4FC0A 2YZGA 3QL8A 2OFVA 2UW4A 5A4QA 2XKEA 4RIYB 2GQGA 2YIRA 5EI6A 5BMMA 5ACKA 4GKIA 4QP8A 4FIJA 4Q5EA 2J6MA 3R28A 2WMVA 4K0YA 1QL6A 2ZDGA 1IAHA 3DAEA 3UNZA 4BBFA 2UW6A 3R01A 2CHLA 2H9VA 3G2FA 3EN4A 3LFNA 4J97A 4FZ7A 3VPCA 3TUDA 2REIA 4NKSA 4ASEA 3A8WA 3ZSIA 4BCMA 4LMNA 4C38A 5M06A 4I4TF 2XNNA 3FLQA 3QHWA 4G6NA 4O0UA 4FA2A 5DFPA 4FGBA 5LOHA 3G8DA 2IZUA 2F2CB 2PVHA 3L9NA 3UIMA 2R3OA 2DYLA 3TKUA 4FTTA 2JKQA 3GC8A 4D4RA 5AV4A 4IAZA 3KCKA 3E93A 4MX9A 3UO5A 2I0EA 3KAKA 5L2WA 4ZHQF 3ORXA 4AQCA 4IVBA 4FIFA 1QCFA 1DAYA 4WNMA 3P08A 3BHVA 3QRUA 4R7HA 1KJQA 4CFFA 2GSFA 1ZOEA 1CDKA 2W1GA 2XCKA 1VZOA 2XNMA 1H26A 4CXAA 3F2AA 4UYAA 5FEDA 3FXZA 5B2LA 1IOWA 2GHMA 4BKJA 2PVJA 4FL2A 4E6DA 4L44A 1WVYA 5KKRB 3ACKA 4RFYA 5BUIA 2XIYA 2X81A 4GT4A 2ZM3A 2BTSA 3FMNA 3EQPA 3OCBA 4JG8A 2PZPA 3DTWA 4JVGA 4XOZA 1STCE 4XOYA 5C1OA 2JAVA 2PPQA 5EW8A 4BDIA 5CSWA 3QAME 5D9HA 4BGQA 4I6BA 2J0IA 4CRSA 1Q99A 4ZLOA 4RZQA 1UNGA 4CMOA 5JVLA 4FTAA 4DFUA 1ZYJA 2BKZA 1WBNA 3OWKA 4C3RA 3R7OA 5LVOA 4MXXA 3HZTA 4E1ZA 5A14A 4FL1A 5EYKA 1FPUA 4GJ3A 1KE6A 4W8DA 5KBQA 5D8DA 3AOXA 4XP0A 4NK9A 4BDFA 4PQNA 4Y8DA 3NCGA 2VWUA 3LCDA 4F6UA 4IJPA 4IM3A 4HNVA 2HAKA 5IMEA 5HX6A 4GIIA 3E5NA 3HO8A 4EHVA 3D94A 2UW9A 1B6RA 3VS4A 2XIKA 3O8UA 4EH4A 3VQHA 3HAMA 1ZYDA 3ZFYA 3EKKA 5ANKA 4DFZE 3V3VA 4U8ZA 3C4XA 3WO1A 2ZB0A 4ANQA 3CR0A 2X8EA 3QTQA 3R7YA 1E4EB 4BICA 4E93A 5DYJA 4KRCA 3R8UA 4IC8A 1EHIA 5GIOE 4KSQA 1Y57A 4IEBA 5E1EA 3U6HA 3MY0A 4LFIA 1UNLA 5ITAA 3KK8A 4X21A 2PE1A 3DAKA 3JR1A 4JR3A 2PMOX 3GU8A 4BZDA 2HXQA 3ZLSA 4GS6A 4BF2A 3OWLA 5BVEA 1GZ8A 2HWPA 4HNIA 4I5PA 3R7UA 3ZUVA 3ZLYA 4PMMA 3HMPA 4FIIA 4MBIA 4LOOA 4ZP5A 2NP8A 2X6EA 3SRVA 2HJWA 4ZAUA 2W6NA 4WG4A 3UQGA 4YHFA 4O0YA 1RDQE 2UV2A 1Z2NX 3CCNA 3EWHA 1IOVA 1R0PA 2OW3A 5CEKA 4XYMB 2W06A 1KE8A 3NRMA 5KBRA 3RVGA 3NUYA 4GUBA 1ZRZA 3PVBA 3PJ1A 2IZSA 4DGOA 1Q3DA 1PXIA 1YOLA 3H0YA 3ID6C 4NW6A 4U97A 2JBPA 4E4MA 3LHJA 3PIXA 1DI9A 4TWNA 2WTVA 5C03A 2WAJA 3O71A 3R22A 3QQJA 3IKAA 4BCKA 2GFCA 4XYLB 3PA4A 2VWYA 3I5NA 4IZ5A 3Q5ZA 3NPCA 2OZOA 3I1AA 5EYMA 3D2IA 4FVQA 3QWJA 3ITZA 4X2NA 2XVDA 1ZMVA 3CQEA 3BGQA 1GGOA 5CVFA 5BUJA 2OXXA 3E62A 2VX1A 2XEZA 2HZNA 3BU3A 3FPQA 3UIXA 4KBAA 2RFDA 2WQOA 4A4XA 4C4GA 4YUQA 4I22A 2R9SA 3FXXA 2QVSE 5CEMA 1AD5A 4ZSEA 5HG9A 3VOTA 3NW7A 3P7CA 3WZUA 3GBZA 2CLQA 3DDQA 2R86A 1R0EA 3BHUA 2VTHA 5AM7A 3VS3A 3R73A 4FODA 4F08A 4RSSA 2J5FA 1ZLTA 2OKRA 2HK5A 4HW7A 5IG1A 4MA5A 5GJDA 3QGWA 4FTNA 4L67A 2QK4A 1BMKA 3COMA 2PULA 3QUEA 2Y4IC 4BY9E 3GU6A 4JAIA 1Z57A 4JIKA 4DFYA 2EVAA 4IWOA 4U3ZA 1B6SA 2VWIA 4X3FC 2YJSA 2CNVA 5EM8A 3KALA 4FV3A 3JZIA 4H1JA 4XZ3B 4BDJA 4O86A 2OGVA 4DLKA 3QD3A 5IQIA 2C3JA 3GIDA 1PHKA 4EZ3A 4WD5A 4A9UA 2WQNA 3WYYA 4K11A 2ZM1A 4L7SA 3TV6A 3BYUA 3NX8A 3SDJA 5A6OA 4E6QA 2GPWA 4C3FA 4C4JA 3F9NA 2UW3A 1B39A 3C1XA 4H05A 3TL8A 4G5JA 1OUYA 3QQKA 3QUDA 4FKUA 3DB8A 4C62A 4TNBA 2YIXA 3ATSA 3ZU7A 3LFAA 4M68A 2GNGA 4PRJA 2J0JA 4FTCA 4DH7A 3F7WA 3HV7A 3IDPA 3W18A 1OVEA 5IH5A 3RAHA 3BYSA 4CFVA 1A9XA 2VQDA 4FG8A 4MNEA 2UZWE 3U8WA 2NO3A 3DXNA 3V5WA 3W10A 3BX5A 5KMMA 4I6QA 3W2PA 1Q8WA 2IW8A 4YZ9A 3FI4A 4BCFA 4W4WA 4TL0A 5KCVA 5T6KA 1PXJA 1J3HA 3Q9YA 2R7KA 2R87A 2UZUE 3I6WA 4O91A 3O51A 3R1NA 2BILB 3LMHA 4UWYA 3TIZA 3JY9A 4HOKA 4BCQA 5C1QB 3SVVA 3GQLA 4NJ3A 4EK8A 4X3FB 1TKIA 4DYMA 4F0FA 5CAUA 3DGKA 3R30A 2QODA 2G01A 4JBPA 5L2SA 5JGBA 4YLLA 5BVNA 2J0MB 4KNBA 3VS7A 3ZXTA 1H1RA 2UZEA 2OJIA 3QZGA 1UWJA 2HCKA 4CFXA 4B0GA 2RFSA 3CTJA 4MF1A 2RFEA 3BBTB 2YM6A 2OWBA 3TEIA 3F5UA 1DS5A 1ND4A 3VBYA 4J52A 4LMUA 4HGEA 3WNZA 4ZK5A 2YCRA 2CKEA 1OL5A 1P4FA 3FKNA 3HA8A 4Y73A 5L2IA 3QCXA 4QTEA 3MVMA 3PY0A 4FGRA 4NJDA 4TYJA 5EOLA 3U9NA 4FT5A 2XZSA 4MD9E 5CSVA 1OIUA 3RK9A 4KSPA 4CV8A 4F1OA 3GCUA 3HRBA 3LCTA 4C5CA 4CT2A 3RV4A 3G33A 3OUZA 1SNUA 1H07A 4P90A 2WQMA 5CT0A 3F66A 5HIDA 3RK7A 3LFQA 1ULZA 4R6VA 4RIWB 4AW0A 4B7TA 3DFCB 4EH3A 3CXWA 5L6OA 2PZIA 5K5NA 3S0OA 3MY1A 4Q9SA 5C8NA 5FDPA 1ZOHA 5B0XA 3EHAA 5ETCA 1H8FA 4F99A 5HD7A 3OTVA 3GC7A 4O2PA 4RVKA 5CLPA 4YJOA 4O4HF 3SQQA 3AC1A 5KZIA 2BZHB 4DH1A 3KF7A 1YWVA 2E9UA 5I0BA 1O9UA 5AP6A 3TDWA 4IACA 4DBNA 5IQFA 3MESA 4B8LA 1WVWA 2GCDA 4TZRA 4FFNA 2QHMA 4MWIA 3CIKA 4BTJA 1Y6AA 3R9RA 1RQQA 3JUHA 3O50A 3LZBA 3R6XA 2G15A 4RJ8A 1UNHA 4XCUA 1X8BA 3G6HA 3KMUA 1ZY5A 5EM5A 1OZ1A 2NRUA 3HGKA 4AW1A 3I0QA 5DOSA 3LM5A 4ERWA 2ITXA 5C26A 4FV9A 3ETJA 4QNYA 2GS2A 2XP2A 2YZLA 4F9YA 5KX5F 4EWQA 4FOBA 3RFCA 4YLKA 3T3UA 5JKGA 5KHWA 3UVPA 3AGLA 4GMYA 4YNEA 3SW4A 5CWZA 2GHGA 3DJ5A 4IIRA 2C5VA 5IQAA 2VWWA 4MYGA 4F64A 3NNXA 5ANJA 4F6WA 3PXQA 3QTWA 4EOPA 4EOSA 3MH1A 2GLTA 1KEEA 5JFXA 3KRXA 3TTIA 2Y6OA 2O0UA 4RQKA 3OT3A 3WBLA 4GT3A 2R0IA 3FL4A 4QO9A 4GCJA 1Q8UA 4ITIA 1OL6A 3L8XA 3TZ7A 3DKOA 2FSOX 5H8BA 1XBCA 2OJFE 1OECA 3R9OA 1T46A 3BV3A 4XV2A 4L52A 3ZUTA 2VTRA 2YA9A 4BI2A 4O7VA 3HV5A 4H1MA 3IW8A 5HCZA 3H10A 4Z3VA 3V51A 5C01A 4DEEA 2W1EA 3OW3A 5KMKA 2CZGA 4NT4A 3HP2A 4YHJA 2I87A 4OTGA 3ZHPC 2CCIA 4C0TA 3C5IA 3D7TA 2PTKA 3D4QA 4YJ2F 3O7LD 4EH6A 4BCJA 4DC2A 5HBEA 5M4UA 5HO7A 3G0FA 5E92A 5EM6A 2HZIA 3TV7A 3Q2OA 1H01A 2XMYA 2WIPA 4ALUA 4R78A 1Q62A 5DEYA 4BZNA 4TUYF 2BRNA 2P4IA 4IE9A 2C47A 3FBVA 4I6HA 3OOMA 1Q8TA 3FKOA 1YXTA 4A9RA 4BIEA 1EUCB 2YACA 4UEUA 1SYKA 5IQEA 1GIIA 5HX8A 3NW6A 4ID7A 5BPHA 2YCSA 4EC8A 4O22A 2E9PA 1GOLA 4FV1A 1H28A 5LJJA 1OGUA 3VUKA 3ZSHA 3L1SA 1SZMA 4W4YA 3COHA 3F3UA 5LVLA 3G9NA 3QXPA 4G34A 5CU4A 4AS0A 4IX6A 2V5AA 3ZONA 5BQ0A 4HVIA 3TI1A 3BG5A 4LOPA 4E20A 1JKKA 4FV2A 1Z2PX 3MA6A 4EOIA 2E9VA 4JBVA 2VWZA 4LOQA 2UVXA 5L8KA 4OBQA 3UYSA 3F3ZA 2VUWA 3CLYA 2C5OA 4FTOA 2WKMA 4L6QA 4XV9A 4ZTRA 2BCJA 4EOOA 1PF8A 4WG5A 3Q96A 3FWQA 4YC6A 5AM6A 2V59A 1SMHA 4DGMA 3ORTA 4R5YA 2OXDA 2VTPA 2Y4IB 4EK3A 2CLXA 2W9ZB 3RPSA 1PW2A 3TT0A 4AP7A 3RGFA 2OLCA 1OBGA 2IW9A 3NSZA 2JKMA 4LI5A 4BCNA 5JGAA 2W6ZA 3ZTXA 1ZY4A 4AOTA 2IVUA 2BIKB 3R5XA 5IPJA 2YHVA 1UU9A 1DV2A 4FV7A 2C6EA 4XLVA 3B8RA 5EDPA 4YURA 4BRXA 4AN2A 4WIHA 2UZTA 4ZSAA 2W1IA 3VJOA 3TZ9A 3E3PA 5AWMA 4D0XA 4MV1A 4EHGA 2WELA 4DITA 5FTOA 2WQBA 3V5TA 2XKCA 4Z16A 3AMYA 3Q9XA 2NPQA 2VTQA 3IDBA 3VW8A 4C4FA 5I9WA 2C3LA 1Y8GA 3PXRA 5FRIA 3R83A 5HORA 4G3CA 2YRWA 1RW8A 2XBJA 3ZEWA 1KWPA 1XWSA 5H8EA 2CGWA 3LLAA 3RCDA 3PSDA 4EUUA 4CEGA 3UFXB 4M67A 2JFMA 4WKQA 1O6YA 2PL0A 4RLKA 2ZM4A 4U40A 4IWPA 4OTHA 5E4HA 4WNOA 4RIXA 3QD4A 4MKCA 2VU3A 3V8WA 3ZEPA 4XJ0A 1C30A 5T3QA 3VA7A 5HI2A 3UMWA 4LM5A 2B52A 4AGWA 4G3EA 3OD6X 3GOPA 3ORKA 4HR7A 4CCUA 3FI2A 2QU6A 5D11A 4U7ZA 4ALVA 2QOFA 3PIZA 3EQDA 3VRZA 2PUNA 2CN5A 3UO6A 3NMUF 4TWCA 1PY5A 3F3WA 1VJYA 4AZSA 4QT1A 4FKGA 3UZRA 4GRBA 3U51A 3SLSA 4V04A 5JZNA 3W33A 3G5DA 4APCA 4PNKA 4ZY4A 2OIQA 2RG5A 3DDPA 4FT9A 3PJ2A 1E4EA 3ZRKA 3H9OA 3AW8A 4U45A 2PVKA 3BZ3A 3DBCA 3K5UA 4L3JA 4MHAA 5BVWA 3EMGA 1OKVA 4PWNA 4NM3A 3Q3BA 1DIKA 4WSYA 5HIBA 2V5QA 3NW5A 3UGCA 1TQMA 3LM0A 5JH7F 1YDTE 3O17A 2G9XA 4U43A 2SCUB 1OL2A 1BX6A 3CTHA 3NDMA 2CJMA 3MH2A 3LXNA 1WVXA 2PYWA 2P2IA 3PUPA 3C13A 3PVWA 4BIBA 3GENA 1I7LA 5CVGA 3D7TB 1W93A 2C0IA 4R7BA 3P86A 2WIHA 2R3IA 3RINA 5AUXA 2A0CX 3PJCA 3FV8A 4AA5A 4ZJJA 1WMKA 2XK7A 2VO0A 2B54A 2JITA 2YZAA 3OW4A 2F7EE 2Z7QA 3KEXA 1ZZLA 1CQIB 1FMOE 3OXIA 4IFCA 5FEQA 1GSOA 1H1QA 4C61A 4M7IA 2G2IA 4BYJA 5E8TA 2C6IA 3W32A 2YDKA 3EN6A 4YU2A 3R04A 2PN1A 3VPBA 3ZFXA 5A4EA 1XH4A 4HVDA 1K2PA 3FEGA 4V01A 5DRBA 2DLNA 3F3VA 4XYFA 4YPSA 5CS6A 2X7GA 5L8LA 2XNOA 3EB0A 4Z9LA 2XNBA 5AAFA 4JDIA 3PRFA 1SNXA 4JDKA 4UBAA 3QRTA 4C4HA 3MVJA 1YW2A 2X6DA 4JQEA 3O8PA 4OTRA 3EN9A 2ZV7A 3NUXA 4FR4A 4U79A 3C4WA 5KMJA 5M09A 3KVWA 5CF6A 2I8CA 3LCOA 2VTJA 5EKOA 3QFFA 2JLDA 2HY81 5CF5A 3C51A 3H0ZA 3PG3A 5HHWA 3O7LB 5T68A 4JJRA 1IASA 4RVLA 3G9LX 2FSTX 3BU6A 4G9CA 5C27A 3QLGA 3P9JA 2BHHA 3MWDA 3IW4A 2IZRA 2LGCA 3BYVA 3PWDA 5IMXA 1PXNA 5J2TF 4IX5A 4PX6A 4IAYA 2R3KA 4YZCA 5AA8A 3FHIA 3NIEA 4X2JA 3LJ1A 4AT4A 2C0TA 2HW6A 3R2YA 5M4IA 2RF9A 2X9FA 5BX0A 3O0GA 3VW6A 3DA6A 4MXZA 3UC3A 4I55F 4XNEA 1M7QA 2BHEA 3LFCA 1MRUA 3PPZA 2OLSA 4TKSA 3SC1A 2ZV9A 5D1JA 3IECA 4HQ6A 3OUUA 4YHTA 3VWAA 4ASZA 4A9TA 5BVDA 3QCYA 3ZM4A 3K2LA 3VUHA 3EQCA 5IDPA 1GJOA 2HIWA 4BN1A 2VO7A 3KKVA 4AFEA 4D58A 3DQWA 4RBLA 3WF9A 1YDRE 2XA4A 3H4JA 4QMVA 5CXZA 4QSHA 3E8NA 2J7TA 4J8MA 1PRYA 4E7WA 4DEHA 1HCLA 3OVVA 4HCUA 4JIAA 4HVHA 4OTDA 5IH4A 3QRKA 4FKRA 4MVFA 4YTIA 4F70A 1M2PA 4AXAA 5IA4A 4GT5A 4LL5A 4PMSA 4HYSA 2OJ9A 2QOQA 4BZOA 3KF4A 3P23A 4FT0A 5ETFA 4FKPA 3SW7A 2Y9QA 2Q0BA 3OXTA 2WTWA 3H30A 4O7YA 4XV3A 1H27A 1YQJA 4AA4A 4EH9A 5A54A 5HNIX 2C4GA 4IZOA 2W6MA 4FOCA 4QTBA 3UP7A 5JQGF 4G17A 5DHJA 4YAKB 3OROA 3ZZEA 3I79A 3MJ1A 2ZYBA 5HLWA 3EH9A 4QTAA 5IISA 2PUUA 1ERKA 2QHNA 4MBLA 4L46A 4FU0A 4YJ3F 1O6KA 2FSLX 5HBHA 1IG1A 1W8CA 3HMOA 4KBKA 3Q4CA 5C8MA 1PKGA 1YXXA 4ZS4A 2VTTA 4G3FA 3FMKA 4S31A 2YZNA 3AQVA 2Z04A 3QCQA 5FM3A 3F69A 4O38A 3A7IA 5LARA 4DGGA 3UVRA 1F5QA 3BWJA 3QC4A 4XP3A 4C3PA 2VTSA 4HVSA 5BVFA 2Z7RA 3N51A 3Q5IA 2Y6MA 1U59A 4PV0A 2A27A 3OHTA 5JSMA 4ONAA 2R3MA 4FKJA 1BL6A 5FXRA 1LP4A 3DKFA 5EG3A 1JKJB 3Q1KA 2WTJA 4DEAA 4FFMA 4MV7A 2UW7A 3TIYA 4FTLA 4FV5A 3B8QA 4RZWA 5EHYA 3VBWA 4FEWA 2VTNA 5LVNA 1ZZ2A 1QMZA 3ODYX 4C4EA 4JR7A 1NW1A 3TNHA 3GB2A 3KXZA 1REJA 3OS3A 4WNKA 4FSUA 1M2RA 3QZFA 3ALOA 2X4FA 5JEBA 3DY7A 3OG7A 4EBVA 4D2RA 2XIXA 3DT1A 4O7SA 3QX4A 3C0HA 1IRKA 4IAIA 5C4LA 2JIVA 2P33A 5I9UA 5DRDA 4Z55A 3L8PA 1Q61A 2BZJA 2BIYA 4CKRA 3S1HA 2W9FB 5CEOA 2W6OA 3BPRA 1I09A 4FTRA 4X2FA 2PVYA 2QKRA 3TQTA 2YZMA 4L53A 1NA7A 2DWBA 3TG1A 1NVRA 2ZMDA 3VF9A 1AUXA 4NM0A 4DEBA 4CG9A 2PVFA 4UWBA 2J0LA 2FSMX 3OY3A 3ET7A 4LGHA 5IA5A 2IW6A 2R3PA 3ZH8A 4EK6A 1CSNA 3GC0A 5EQYA 3EZRA 5BMSA 2W4JA 5LP6F 3THBA 2C3KA 2YJRA 2O64A 2X39A 2ZDTA 5FBOA 4E4XA 3C50A 2HELA 4GU9A 1MUOA 4IZAA 4NWMA 4WHZA 5AJQA 3S4QA 3F61A 4CVAA 4LL0A 4ACMA 1H0VA 3BV2A 5CSPA 5D41A 4L68A 3CD8A 2JD5A 5E8YA 3TKIA 5HTCA 4RRVA 3DNDA 2ITQA 2I0YA 2VGPA 2G2HA 2R3LA 5CEQA 4AWIA 1FQ1B 4ASDA 3R9HA 5B2MA 3RZBA 3ZSGA 5L6WL 1UU7A 5JK3A 1WBTA 3HMNA 4QP6A 5BVOA 1MRVA 4R5SA 3D14A 2BRBA 2ITZA 4TRLA 4FKLA 2J9MA 2HW7A 4GFMA 3WZEA 4FSZA 4KBCA 5GHVA 5CASA 1Q5KA 2SRCA 2RKUA 3FMLA 2W4OA 3F7ZA 3D5VA 4C33A 3OOGA 5M53A 2YM7A 5HVKA 5L2TA 4BIDA 4Z7HA 3ACJA 3BEAA 2C69A 3E64A 3FLWA 4I5HA 4S33A 2IVSA 5KMLA 3BYMA 5AP1A 2XEYA 2ITOA 4OBOA 2HZ0A 3SG9A 5KKRC 3TINA 2C5XA 2R0UA 4I92A 3R8VA 3ZDIA 3LLTA 2IVTA 4FNYA 1Y91A 2W1HA 4W4VA 2WMSA 4PNIA 5DT4A 3AT3A 4I20A 4RC4A 4FZFB 1ZMWA 3SXFA 1H1SA 4IZYA 3AC4A 3QHRA 4EC9A 4M0ZA 5KZ0A 3A7JA 4IB5A 4ZTNA 3E7VA 1FVTA 3OP5A 4UXQA 4CFNA 5IQGA 2DZDA 4UZDA 3SRVB 3TNQB 3WZKA 4D55A 1M52A 4F7LA 3RTPA 3RNIA 2XJ1A 3MIYA 3RM7A 5AP2A 1JKSA 3LCSA 2UZVA 2VX3A 3ZCLA 4GYIA 1UV5A 4AAAA 5LA6F 2C6DA 2EXMA 4QMYA 4KIPA 2BAQA 3GEQA 2X4ZA 3AC3A 3I81A 5J2UF 5E8VA 3V4SA 4I0RA 4QP9A 3Q4ZA 4IVDA 3G15A 3NUUA 4FEQA 4FVRA 1V0PA 2VTAA 2UZLA 2CKPA 1PXMA 5LCKA 3AD5A 3OEZA 3OFMA 4UWCA 4WT6A 3REPA 2PE2A 5HU3A 3SA0A 4C5BA 2OU7A 4ZTMA 2GPSA 2C00A 4J71A 3QTRA 4FIHA 4RJ7A 4C35A 5ETAA 2VRXA 3QTSA 2VO6A 4RMZA 5E1SA 5CB4F 5E91A 4OTIA 5H9BA 5LMAA 3HX4A 4IX3A 5A46A 1XBBA 2ZV8A 3ENHA 4U6RA 1PXPA 2X8IA 4CKIA 2FYSA 2W1DA 3NYXA 3QD0A 1VEBA 3E88A 2HWOA 4FTJA 4FL3A 4FSTA 4IJ9A 3FZSA 3VQUA 2FP4B 2FPPB 4EK4A 5BNJA 4X3JA 3MWUA 2OH0E 3LFEA 2IVVA 3AT2A 1OITA 4AFJA 1ZOGA 3EL8A 5H80A 2PK9A 2WXVA 3ZLWA 3OEFX 2YCQA 5IA2A 5KNJA 4NFNA 5HVJA 4BC6A 1GIJA 4DG3E 5IF1A 4EG0A 2BUJA 2UUEA 4B8MA 2WTKC 2F49A 4GK4A 2XIZA 4PTEA 3CGOA 1UKHA 5LCJA 2KULA 5EZYF 5M51A 2ZDUA 4PP7A 5BYLA 5LXMA 3PSCA 2PHKA 3ORIA 5DT3A 4O2BF 5FTQA 1NXKA 2R64A 4NM7A 4G3GA 4PDYA 5J9LA 3F82A 5HQ0A 3PY1A 4CTCA 3EQFA 3MV5A 1KE9A 2WYOA 4YAJB 5AV1A 2XYUA 3FKLA 3SX9A 4GU6A 1VYWA 4I41A 5HEZA 1YHSA 4H39A 3GCVA 2B1PA 4D2SA 2C68A 5AUYA 1R39A 5J95A 4AN9A 4O4JF 1WBSA 1XBAA 3DXQA 4MNEB 4FI1A 4N0SA 2X2LA 5FGKA 4EJNA 3C5UA 1J7LA 3PVUA 4ZI7F 3C4EA 4PMTA 3GLKA 4L01A 4BDAA 1JVPP 1KV2A 1GLVA 2JKKA 4ALWA 1NVQA 4BCPA 1YI3A 2Z7SA 3JS2A 1KJJA 2PVPA 4DFLA 3MFTA 2XK4A 4FE2A 4CLIA 2OXYA 2WZJA 4FIEA 5KMNA 3RP9A 3VMMA 2CDZA 3KXGA 4QTDA 4RFZA 5TO8A 3H9RA 1ZAOA 5GJGA 5EI8A 3ALNA 1YHVA 4N4SA 5BMVF 3GGFA 2XIRA 4RFMA 3BGZA 4GFOA 3PZEA 3LP8A 3R8LA 4MBJA 4YTCA 3DAJA 1UU3A 2PUIA 3MFUA 1Y8YA 3ODZX 3PRIA 4RGJA 3HDNA 4JDHA 1XR1A 4HNUA 3DBDA 4XUFA 3IDCA 3CSVA 4YSJA 3TW6A 2R82A 1PYEA 3N4VA 4RLLA 4HGTA 3QUPA 3MS9A 3VC4A 4YO6A 3MB6A 3UNKA 2GS7A 4B9DA 1IA9A 2AC5A 4KIQA
chains in the Genus database with same CATH superfamily
3PFQA 4NCTC 3FYKX 4O84A 3DTCA 4D1ZA 3UODA 4ACHA 4FFRA 4GK2A 2GQRA 4LYNA 5HICA 4AGUA 4PMPA 5M44A 4DINA 4WRSA 5FLFA 3ROYA 2DWCA 3NUSA 1OPJA 1FMKA 3CJGA 1ZARA 2ZAZA 2A4LA 4EUTA 4M15A 1CTPE 1K3AA 1UVRA 2YCFA 4F0IA 5CQUA 4FFLA 4I4EA 3TNPC 5BWRA 4BBEA 4X2GA 1F0QA 4F9CA 2BZKB 4CSVA 3L8SA 4AGDA 2CGXA 3KQ7A 2P2HA 3KIOC 1S9JA 5KX8A 3UDSA 1VYZA 1GIHA 4QMWA 5BYZA 4MEDA 5HNGA 1V9PA 4Y72A 5AP3A 5DR9A 4AOJA 5D12A 2R7NA 4D28A 3ZOSA 2B9IA 3OTUA 3KULA 3QTZA 3P7BA 1PX2A 5J1WA 2EB3A 3BLHA 2Z60A 4IAAA 4DEGA 2YIYA 4ITJA 3OXZA 2P55A 4U41A 4BGGA 3Q4TA 4NUSA 3HEGA 5EI2A 3QRIA 2R3QA 3PUFC 5JRQA 5JFWA 3OCGA 3R23A 4ZOGA 4O83A 2R3FA 2UZNA 3KMWA 4WG3A 3DBEA 3OBGA 1XMLA 4Y5QA 3KXMA 3OT8A 4FKSA 1LR4A 4FV6A 1JLLB 4FV0A 2QOHA 2QO7A 2CNQA 5LMBA 4QP7A 1LUFA 4I94A 4L3LA 4MWHA 3OY1A 3P7AA 3VS2A 3F2RA 2YIQA 2YISA 4AUAA 4L00A 4QMZA 1Z9XA 4FK6A 3CS9A 4O6LA 3NS9A 2PVNA 4OR5A 3MJ2A 3K54A 2XARA 3R9DA 3W2SA 2LAVA 4YBZB 4X0MA 3TIIA 2I7QA 2HENA 5LOVF 2GS6A 3Q52A 3BLRA 4O27B 1Q8YA 4JQ8A 4ZZMA 5AA9A 3ZLXA 5A4CA 2RL5A 4KINA 1PXLA 4FSYA 4EHEA 2YW2A 1J1CA 3QLFA 4R3PA 3FZRA 3KXHA 2JBOA 3AC2A 3ORPA 4QMUA 3ANQA 1M0TA 3QF9A 3D5UA 3DXPA 2WTCA 5HE1A 2WMWA 2HY0A 4IW0A 5CYIA 2ABJA 5I5YA 2YABA 4M13A 3SXSA 5FP5A 2NNWB 3BHTA 4I3ZA 4FNZA 2VUGA 3I0OA 2IG7A 2R4BA 4F78A 2HDKA 2EB2A 2X7OA 4QMSA 4S2ZA 2Z02A 1G3NA 2R2PA 1GZNA 2JEDA 3EKNA 3PSBA 5HCXA 3ZM9A 3CJFA 3KMMA 3WZDA 4BB4A 4DN5A 1MQ4A 1CKNA 3KCFA 2IZTA 2XD4A 5IU2A 4NZMA 5FR9A 1G5SA 1UKIA 3EFLA 5HBJA 4YBJA 4HZSA 2W0JA 4I21A 3VBVA 1KJ8A 1PMEA 3OWPA 4LV5A 3HECA 5DNRA 3ZC5A 3U55A 5K9IA 4JRNA 1JDBB 3W1FA 4DFBA 4G31A 3BIZA 2XB7A 4IC7A 4MA0A 2J2IB 3ZYAA 5H3QA 3TYKA 2R7IA 2W4KA 2BDJA 1A48A 2PZRA 4XG9A 1CS0A 1FBNA 4B6LA 2VPQA 4K9YA 3A4PA 4XG3A 5LMKC 5JVDF 2VV9A 4DFXE 4F4PA 2W5HA 3PPKA 4G6LA 4O7ZA 4PTGA 5FXSA 2GMXA 2DQ7X 3ZRMA 3P78A 5IUGA 4UN0C 2PZYA 4JX3A 3UDZA 1JDEA 3B2WA 4RJ4A 4F63A 3TXOA 1VS0A 3TKHA 4IANA 4O6EA 5JH6A 1KSWA 3KVXA 4MV8A 3ZFMA 3FMEA 2W1CA 3TTJA 2W1ZA 4EOJA 4UV0A 3ZZWA 5K5XA 1U5QA 5F9EA 5AV2A 2OFUA 3ZUUA 3KRRA 1VLRA 3CPBA 1I2LA 2QG5A 5EH0A 2GQSA 3HRCA 3AXWA 3H9FA 3QZIA 2C6LA 3PE2A 4PTCA 2VO3A 5CF8A 5ICPA 2W17A 5J7HA 3NCZA 4KS8A 3DLZA 3ZDUA 5JFSA 2ETRA 3V8TA 4ZS0A 4I23A 5IYZF 3T3VA 3OZ6A 2OI4X 4C7TA 5AMNA 3LJ2A 2GNHA 1T36A 1W84A 3SE7A 4WBOA 3RWQA 5DAAA 3RPRA 5J9YA 3MH3A 3KREA 4HGSA 3UBDA 1H4LA 3FC1X 4II5A 4IM0A 5LMKA 5LXTF 3IW7A 4J53A 2QG7A 1KV1A 3V6RA 3HNGA 2O5KA 3NYVA 3EIDA 3PLSA 3UDBA 1BNCA 3LOKA 3N9XA 4OTQA 2JAMA 2PWLA 4BTMA 3R5FA 4DH8A 3RUPA 3UMXA 5KUPA 2BAJA 2C5NA 3JVSA 4DRFA 5F94A 5GNKA 4F6SA 4EH2A 1DV1A 4N70A 3PY3A 3HBLA 2FUMA 3LJ0A 3ZRLA 2CKQA 3CY2A 4A9YA 3UC4A 3PJ3A 1FINA 4G1WA 4BI0A 4AE9A 1M6VA 3ENMA 3EQGA 5AIRA 2YM5A 3ORLA 5BPYA 2OBJA 4L7FA 4NTTA 5C8KA 4S34A 5DG5A 4O2AF 3V4ZA 1KJ9A 3BGPA 5B2KA 1MP8A 3NYOA 4F9WA 2YYAA 3CEBA 4ZTLA 4UXLA 2A19B 3BELA 4EH8A 3NZ0A 3K5HA 3RPYA 4XG4A 3HAVA 1EH4A 4RG0A 4AQKA 3K5VA 4DQNA 4EI4A 1URWA 5ANIA 4UCVA 2OIDA 4RWLA 3FDNA 2ZB1A 3UPXA 2V58A 4E4TA 1GY3A 2V7AA 2BFYA 4U0IA 3SAYA 1AGWA 3D83A 2R3JA 2VTMA 2WOUA 4BDCA 1Z5MA 3VHKA 3H3CA 2WTDA 1Q41A 2IJMA 3N4UA 5CSXA 1R1WA 4YJSA 4AOIA 4YJRA 4FKQA 4JAJA 2PMLX 4BI1A 2ZDHA 4QQ5A 2CCHA 1VKZA 2HOGA 4OUCA 3ELJA 4Y46A 4FTMA 3RAWA 4ENXA 4F9AA 2A2AA 3SGCA 3P79A 2I80A 3LQ5A 1TVOA 3KU2A 4W4XA 4QP2A 5CX9A 4Y85A 2J50A 1UU8A 4D5KA 3WO0A 3MH0A 3CQWA 3E8DA 4O81A 5FDXA 3QD2B 4XLIA 5C8YF 3A4OX 4FSWA 4FVPA 5ETIA 4M0JA 3IGGA 3F5PA 1V0OA 1BI7A 2YM4A 5EYDA 1IYDA 4MQ1A 2QONA 4CNHA 3UQFA 3LULA 4X6QC 4RVMA 3DK3A 2XNEA 3RMFA 2F2UA 4ZJIA 2YWVA 3BKBA 3MGYA 4S32A 2F57A 5E8ZA 4AZEA 4BTFA 5LWNA 5JT2A 3OUNB 2XNGA 4MD7E 1YWRA 3RAKA 1C3OA 4MV3A 3VN9A 4I0SA 3T99A 4OGRA 4L42A 1OB3A 3U87A 2COJA 3WI6A 4O7TA 4D9UA 4TN6A 5C4KA 4MTAA 1AQ1A 4K18A 3S2PA 2ITYA 3EFWA 1XH6A 1B38A 3GXLA 3ML1A 4L3PA 3PLAE 1JAMA 3VF8A 3UOKA 1H25A 4YJVA 3R9NA 1OM1A 4YJUA 5FG8A 2HVQA 3QXOA 1CKJA 4F0GA 1CKMA 4WUAA 3GU7A 5CQWA 4L8MA 3ULZA 3DBFA 3RI1A 3SD0A 5HG5A 2WTKB 2RFNA 4QQJA 2GNFA 3LMIA 3PTGA 1ZYSA 3VS5A 2WMQA 4CQEA 5AUZA 5CI7A 5CAVA 5D1OB 2ITTA 1JOWB 1QPEA 4NW5A 1KC7A 3LFBA 4QMPA 4JG7A 4CFWA 4IHJF 3QQGA 1Z2OX 4I50F 3BQCA 5GJFA 4L1KA 3R7EA 5IA3A 2GNLA 4NCTA 2Z7LA 1S9IA 2UW5A 3RK5A 3ORNA 3LFFA 2YL2A 4IX4A 4EOLA 2QOBA 4LUEA 2JFLA 4I1ZA 3R2BA 4EL9A 3LQSA 3QBNA 4HCTA 4AXCA 3JRWA 2BMCA 5KMOA 3FSKA 3UIUA 4FTIA 3M42A 5CI6A 2Z2WA 3QKKA 4O96A 4QOXA 4GIHA 5CSHA 4YTHA 4LRMA 4Y8VB 1XH7A 4YJQA 4XX0B 3BI6A 5TT7A 3V01A 3GCQA 3FMHA 4DCAA 4FG7A 4EJ7A 4BDHA 1J7UA 4RJ5A 2J0KA 2AUHA 2HG8A 3FHRA 2UW8A 4K77A 4CFUA 4CGAA 2PVLA 3CC6A 3HP5A 4HNFA 5C9CA 5LYJF 3AMAA 3QZHA 5F95A 4ZSLA 4QRCA 3CP9A 3LXLA 4YPDA 5AX3A 3BA9A 2O3PA 4IQ6A 5M56A 4ZY5A 3NUNA 3RHXA 1T45A 3QC9A 4Y83A 4FFPA 4P5QA 4JI9A 1EZ1A 3LFSA 1CMKE 2YFXA 3AD6A 5DN3A 4TNDA 2WFYA 1BL7A 2O8YA 3IGOA 3PXKA 2BPMA 3Q53A 4TWPA 3PP0A 1LPUA 2EJ0A 4IB1A 4ACCA 4YZMA 3Q32A 2PZ5A 1WFCA 3BHYA 2QR7A 3NNWA 2UW0A 3Q04A 1V1KA 4TPTA 4TXCA 3VAPA 3VO3A 2HHFA 4IMYA 3ZXZA 4JRVA 3HV4A 3FJQE 3PXFA 4Y5HA 2QCSA 1CKIA 4UYNA 2AC3A 3IW5A 4HYUA 4DHFA 5E9EA 4E4LA 4UX9A 2FPGB 4RIOA 2HHFB 3TY9A 3A99A 2OO8X 4GSBA 4NZWB 4JNWA 4ANSA 5AP0A 5HE2A 4B99A 5I4NA 5K4IA 4D9TA 5L3AA 2GHLA 3FYJX 3O5AA 5AADA 2VNWA 1W98A 2JKOA 4K8AA 4O0SA 4U5JA 5D7VA 4ZIMA 3LE6A 3IONA 2GNJA 3Q2MA 4D1SA 3DAAA 3V04A 2PVRA 2WQEA 2O65A 2ONLC 1KOBA 3FE3A 2FB9A 2YWPA 4HJOA 4DAAA 1IA8A 1WBPA 5EM7A 3U0GA 4BGHA 3BYOA 4DG2E 2VWBA 4JXUA 4IAFA 1G8AA 1XH8A 1HOWA 3QCSA 3IS5A 3P5KA 5IDNA 5IQCA 4AZTA 2XK6A 2XJ0A 2FA2A 2W7XA 2XKDA 4UB7A 1UA2A 4QMTA 3UTOA 5CAQA 3I12A 5HZNA 2JIIA 4L9IA 3P1AA 2VX0A 3VJNA 2O63A 5H8GA 4DBXA 4RWIA 2J51A 4FSMA 4DHZA 4E5AX 1B6CB 1Q3WA 3SOAA 1KTAA 4AZWA 2QI8A 4E5WA 3Q6WA 1PYXA 2G2FA 4EOQA 1YI6A 4U44A 4C34A 3T9EA 2OSCA 3DLSA 3NEWA 5DVRA 3LPBA 4QQCA 4K2RA 2YRXA 3CY3A 1WAKA 3NWWA 1FGKA 2WO6A 3OWJA 5HLNA 3IW6A 3V8SA 3T9FA 4M84A 2J9GA 2I0VA 3R8ZA 1H1WA 3RAIA 4YTFA 1DAWA 4O7RA 1W83A 4IVCA 2COIA 3TJCA 2CKOA 3RR5A 5CALA 2XRWA 1R78A 4LV8A 4FKOA 4QDEA 4QTCA 2EUFB 4BDGA 3Q2JA 5M4CA 4F7SA 1JSTA 4I5CA 4M0YA 5HGIA 4BR3A 2FO0A 5HD4A 3O8TA 4XX9A 3PWYA 5KKNB 3Q6UA 3UQCA 4KKEA 2VNYA 2OZAA 2XK9A 4EQMA 4GEOA 4DF3A 1I1MA 2NU7B 4M14A 4IIJF 3GVUA 3U6JA 3N4TA 3LWBA 2BDFA 3JVRA 3RWPA 3BU5A 2X0GA 3DJ6A 4KWPA 4QP1A 4X3FA 3HMIA 4QP4A 4R1VA 4XG6A 4YJNA 3W2CA 3E3BX 4M69B 3R71A 3WYXA 3EJ1A 1W96A 1EKPA 4RJ3A 2HYYA 5M55A 1IEPA 1MRYA 4FUYA 4RX9A 3G90X 3HV3A 3MI9A 5A3XA 2BRGA 4FTQA 2JDSA 1W7HA 3BWFA 3KXNA 1OI9A 4O4IF 2QLUA 4BYIA 5CR5A 4QEBA 3COIA 1OPKA 3E7OA 1L8TA 3Q9WA 4ZSJA 4AW2A 4E4NA 2PBZA 2GTMA 5CAOA 5HNBA 5IQBA 2W6PA 4OW8A 3E92A 4LDTA 2YS7A 5EKNA 2XNPA 4XG2A 4HVGA 5FTGA 4O0VA 4FNWA 4E73A 4J1RA 5AP4A 3WF6A 1NT2A 3DOGA 4ZQIA 4QMXA 4AACA 1PJKA 3F88A 3QKLA 1Q8ZA 3NLBA 3OCTA 4FV4A 3KN5A 4KRDA 4PDOA 4TYHA 3WF5A 4ZMFA 4WBNF 3TUBA 5AFVA 4CKCA 3QQUA 1DI8A 1U54A 2W5AA 1P2AA 5CEIA 3UJGA 2JGZA 4PL5A 3EZVA 4TWOA 3ZBFA 3DK6A 5E7RA 4YGAA 2WGJA 2XF0A 3ZBXA 3L9MA 3GFEA 1JKLA 2F7XE 2FVDA 3FZPA 2UZOA 3PE1A 4GG5A 1CE8A 3T8OA 4MV9A 3ORZA 3S95A 3NUAA 3EQRA 4D4YA 1GNGA 2ZOQA 4WOVA 3G6GA 2X5RA 3I7BA 4GG7A 4N57A 5AP7A 5TKDA 3DV3A 3EL7A 5CU3A 3N8DA 1CM8A 2ZVAA 4BDBA 3CE3A 2I0HA 1DM2A 4EBWA 3HL7A 4YC8A 3FMDA 4FIGA 4WA9A 1YXUA 5EYCA 2WMAA 3D5XA 4A4OA 3G8CA 2V62A 2VAGA 4O0RA 3BLQA 5AEPA 3KRLA 4RA4A 4NFMA 4IB0A 4CMUA 1YXSA 3D2KA 1KE5A 5CNNA 5ANEA 4J95A 4QMQA 1TA8A 2XM8A 2WMXA 4I6FA 3HVCA 3BEGA 2WU6A 1YKRA 1J1BA 2OF4A 2HZ4A 3I6UA 4AN3A 4EK5A 4DH5A 3UZPA 4IZ7A 2ETKA 5DIAA 2FPIB 4ZY6A 2Y4PA 4CCBA 4ZTQA 4Q9ZA 3AC8A 5L8JA 2RG6A 4O7LA 4I24A 3PVGA 2HVSA 1GZOA 2OF2A 4HGLA 4OTWA 4R1YA 1G8JA 1WZYA 4RX7A 3RHKA 5BVKA 3UVQA 4AW5A 3L9LA 3MVHA 3W0QA 4DGLC 5I5SA 5IH6A 5BYYA 1JSVA 5K2MA 1XK5A 2V7OA 4GYGA 1ZXEA 5CU2A 3DBQA 3QKMA 5IA1A 3IG7A 4Q5HA 4YJTA 5DMXA 5HE3A 1ATPE 5CNOA 4ZTHA 4XH6A 2YEXA 2ZJWA 3RPVA 5B7VA 5ANOA 3FQSA 3FLSA 3EOCA 3DKCA 3JZ6A 4JT3A 1H24A 3D15A 3HMMA 4PF4A 4TY1A 3DS6A 5EQPA 4CTBA 3R1YA 4OT6A 3LAUA 3QTUA 4YO4A 3U6IA 3KGAA 4FKTA 2XYNA 1MQBA 2C0OA 3VONA 3AT4A 1M14A 4E8AA 5ANDA 2JDRA 2QKWB 3IOPA 4C36A 5I5VA 3COKA 4IWQA 3NNUA 5AUVA 3FLYA 5EK7A 4OBPA 2V0DA 4BCHA 3FSFA 4EGJA 1OL7A 5HV6A 2DUVA 2YN8A 5CU6A 4IM2A 2B4SB 4YB8B 2NUAB 4FEXA 3SG8A 5LQFA 5GIPE 4EOKA 2P0AA 5CA1F 4XG8A 2P3GX 5J8IA 1P5EA 4MK0A 3ZO2A 4CMTA 3ROCA 3FQHA 3WE4A 3IPHA 5FD2A 2QR8A 4EHZA 1LEWA 5EQEA 2ETMA 2B9HA 3R0TA 4GVAA 1CQJB 4EEQA 2ACXA 3PN1A 3E63A 4TTHB 3MW1A 3QTIA 4H58A 4G3DA 2R7LA 3LCKA 1ZAUA 3SOCA 5EDQA 5DT0A 4J8NA 2R7BA 3V5LA 3BABA 4JS8A 5I9VA 4D0WA 2YM3A 3SHEA 4RZVA 3W8QA 3MTLA 3NVMB 4P7EA 3EN5A 1PMUA 2JDTA 3FZOA 3VS6A 3WF8A 3MJFA 3FAAA 3TNWA 1Q97A 4ZZOA 2WHBA 4IWXA 4IDVA 3NAXA 5DBXA 5FP6A 4YJPA 3TJDA 4AT3A 3KN6A 3F3TA 2ITNA 3I4BA 3R7VA 1Q24A 3T9CA 2X2MA 5D1PA 2JIUA 3VUDA 4F09A 5JZJA 2Y8OA 4ZJVA 3M1SA 3Q60A 1A3GA 1EKVA 3HYHA 3FC2A 3GOKA 5CM0A 4ACGA 4EYMA 5DWRA 5IQHA 3PIYA 3N6RA 3JY0A 2CNUA 2XUUA 4PY1A 5AUWA 5CE8A 2R3GA 3HLLA 5AUTA 1SVGA 4DFNA 4D4SA 1NVSA 4AGCA 3RM6A 1A0GA 2V22A 2YAKA 1VBGA 1WRVA 3R8PA 4KUJA 4UALA 4DT8A 5F4NA 4DT9A 1YI4A 3A62A 5TOZA 4GH2A 1I44A 3PFFA 5CENA 1F3MC 1M0WA 2XS0A 3DB6A 4O4LF 5KHXA 2QC6A 1XKKA 3KRWA 1OIYA 5IEXA 3C9WA 3UOJA 3PA3A 2QNJA 4RT7A 2JDOA 4W8EA 4YLJA 5HCYA 4O0WA 4CZTA 4OLIA 2QOCA 4RIXB 3VNTA 4DDIA 1ZMUA 4EH7A 4MV4A 4UZHA 2E9NA 2F9GA 4X6RA 2BROA 2QOKA 4MUQA 3W0NA 5CEPA 5CZIA 4HNTA 1PXKA 2QU5A 5G1XA 3AMBA 3VUIA 5HG8A 5CVHA 2Z8CA 4IDTA 3F6XA 4H3PA 2P0CA 4BVUA 1XHAA 2C6KA 1QPCA 4FKVA 4D1XA 1FVRA 3W0MA 1BLXA 3LW0A 3MYGA 3RNYA 4CD0A 2RIOA 3HUCA 3UE4A 2CMWA 4ERKA 4EYJA 2R7MA 1JWHA 3OC1A 4RJ6A 3RKBA 3ORQA 2HVRA 1JLUE 1KBLA 4GL9A 4MXCA 4QYEA 3DTFA 1YXVA 4C58A 3E5AA 1YDSE 4FKWA 2DS1A 2BRMA 5E90A 3UO4A 3V5JA 3EFKA 3FLNC 3ANRA 4IAKA 3FY0A 2WMBA 2EIYA 5CZHA 4WNPA 4DH3A 3M2WA 3WILA 3NNVA 4XG7A 5HTBA 4U42A 5HBRB 4ANBA 4AXDA 1WR2A 2FB8A 4DLIA 1WBOA 4M8TA 2OZAB 4IH8A 4XMOA 4D4VA 4DTBA 4FEUA 1Q4LA 3GI3A 4MH7A 2ZMCA 4F1TA 5A6NA 2E9OA 4RWKA 1E1VA 1NY3A 1URCA 3UZTA 4CKBA 4RVTA 1OKYA 3GCSA 3U4WA 4CT1A 1WBWA 3IK3A 4YR8A 3VBQA 2BRHA 4AU8A 4MQ2A 3R8MA 3WE8A 4LV7A 3NBZB 3SXRA 4FT3A 5KS8A 2W6QA 1OIRA 2C1BA 4CFMA 3NYNA 4FYNA 3ZC6A 2HGSA 4YC3A 2I6LA 3TWJA 4EQUA 1FVIA 2Q0NA 2B55A 1P16A 2CPKE 1GZKA 4KS7A 3VUMA 2FH9A 1OPLA 4GVJA 5F20A 5KO1A 3SKCA 4HYHA 5IQDA 4G9RA 3UG2A 3W2OA 5E25A 4DCEA 4MV6A 4KKHA 4RA5A 3C0GA 3ERKA 3GFWA 4ANMA 5EOBA 5HE0A 2QURA 4ZZNA 3HB9A 4RX8A 1FOTA 3IOKA 2XK3A 4QYGA 4LH6A 3RTXA 4J98A 3C0IA 1RJBA 3DTGA 3KXXA 5DPVA 3I60A 4XP2A 3B2TA 4WRGA 3RPOA 1WCCA 1XH5A 5EHLA 2BKKA 2XRUA 3R00A 4I0TA 3NUPA 2WB8A 4NTSA 4R3CA 4EEVA 2R5TA 5JQWA 2UVZA 3EQBA 2WEVA 3SV0A 3UP2A 2BZIB 5EHOA 5AV3A 5DR2A 3ZMMA 3TIGA 2Q83A 2XANA 4G6OA 2C30A 5D10A 1ZWSA 2OH4A 4UY9A 4QMNA 5JRSA 3W55A 1J91A 3WIGA 2X1NA 3D0EA 4MXAA 2PSQA 1HCKA 4XHKB 3WWIA 4U9AA 2WPAA 3D5WA 3LIJA 4TVIA 3A7GA 2IPXA 4GUEA 3JZFA 4GKHA 5J5SA 2CGVA 4TV9F 4USFA 4JXFA 4QMMA 3OBJA 4Z7GA 3NFFB 2PE0A 3BQRA 4QYFA 2VWXA 1UWHA 1YOMA 2B0QA 3RV3A 3GQIA 5BUEA 3T9TA 4FNXA 4FKIA 2R85A 3A7FA 3E8CA 3QQHA 3MPAA 3KA0A 5E8SA 4CHIA 2OWOA 3G0EA 4F65A 3FZ1A 3LQ3A 4YZBA 3RJCA 4K6ZA 4C4IA 1PK8A 4DE4A 1EUDB 3R21A 2VWVA 1XO2B 3QFVA 2WTIA 5JMSA 5AIKA 3AD4A 3LKMA 5CY3A 4CRLA 4NSTA 4QP3A 3VVHA 4E6AA 5M07A 2Y7JA 4FTKA 3D9VA 2PU8A 4DA5A 3MWEA 2ITVA 2W1FA 2O2UA 2DABA 2VTIA 3UYTA 4KABA 4YZDA 1JSUA 4P5ZA 2ZFYA 4V05A 4AZVA 2R3HA 1QPDA 3EFJA 3P0MA 4QNAA 4EFBA 3AG9A 4WO5A 5LWMA 4FSNA 4P4CA 5IEYA 1M2QA 4FZ6A 1YOJA 1BUHA 4NH1A 4R7IA 3VHEA 4YNOA 4XEYA 4DTAA 5GONF 3PXYA 4EZ5A 5C1PA 1A06A 3FZTA 4U80A 4HPTE 3VNNA 3FI3A 4YZNA 1P4OA 1U46A 3A60A 3K3IA 1M7NA 4V0GB 4XBRA 2EXCX 4M12A 3W2QA 4ZOLF 4WUNA 3FUPA 3LXPA 4EQCA 1GAGA 4K33A 3L9PA 3Q9ZA 3FL5A 3QALE 4P2KA 5HLPA 4AXEA 2VR1A 3CKWA 1I2KA 2C6TA 5F1ZA 3EQIA 3FMMA 4PL3A 5BV3A 1YWNA 1I1KA 4F7NA 4RWJA 5I5UA 2EU9A 4GJ2A 2Y0AA 3FMJA 5D7AA 3VUGA 5CTPA 3ZO4A 5HG7A 2EWAA 2QD9A 1PMVA 3AC5A 3EQHA 3ETAA 4PL4A 3DPKA 5FEEA 3VS1A 4E5BA 4J96A 2X8DA 5BPFA 1BXRA 2QO2A 3DNEA 1M17A 1SVEA 2BDWA 4DLJA 3BRBA 4X7QA 4C5AA 4DAWA 4JQ7A 2BAKA 3F5GA 4C2WA 2W05A 4BCOA 4CLJA 2F7ZE 3I7CA 5E8XA 2ERKA 3DCVA 3TV4A 4I93A 1CKNB 4RCNA 1Y6BA 4H3BA 4AE6A 3HV6A 5K4JA 3FLZA 2H34A 1VR2A 2ITPA 4ARKA 4TYHB 5CU0A 3M11A 4C02A 1YRPA 3CPCA 4JDJA 3O2MA 3GU4A 2WMTA 3NR9A 3QQFA 1H1PA 2OJJA 4S30A 2XK8A 2RGPA 2UVYA 3DF7A 4DGNA 1KE7A 4G5PA 4IHPA 4A4LA 3RCJA 4EZ7A 2WU7A 4QYYA 3C7QA 3E87A 3U9TA 4E26A 4LRJA 3HA6A 3RALA 3U9SA 3P4KA 5CA0F 2R84A 3CTQA 4C59A 5TR6A