2CNTA

Rimi - ribosomal s18 n-alpha-protein acetyltransferase in complex with coenzymea.
Total Genus 44
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
44
sequence length
151
structure length
151
Chain Sequence
b'MNTISILSTTDLPAAWQIEQRAHAFPWSEKTFFGNQGERYLNLKLTADDRMAAFAITQVVLDEATLFNIAVDPDFQRRGLGRMLLEHLIDELETRGVVTLWLEVRASNAAAIALYESLGFNEATIRRNYYPTAQGHEDAIIMALPISMKLH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MODIFICATION OF 30S RIBOSOMAL SUBUNIT PROTEIN S18
publication title Crystal Structure of Rimi from Salmonella Typhimurium Lt2, the Gnat Responsible for N{Alpha}- Acetylation of Ribosomal Protein S18.
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Transferase
total genus 44
structure length 151
sequence length 151
chains with identical sequence B, C, D
ec nomenclature ec 2.3.1.128: Transferred entry: 2.3.1.267.
pdb deposition date 2006-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00583 Acetyltransf_1 Acetyltransferase (GNAT) family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.630.30 Alpha Beta 3-Layer(aba) Sandwich Aminopeptidase Aminopeptidase 2cntA00
2CNMA 3G3SA 3DNSA 4H6ZA 4XPLA 4KLWA 4R87A 4BMHA 3R95A 3QB8A 2OZUA 4M3SA 3I9SA 2PSWA 2J8MA 3ZJ0A 3BLNA 2ATRA 5JQ4A 1Y7RA 2BEIA 1IYKA 2G0BA 1IIDA 4JXQA 4R3KA 1GHEA 2DXQA 2Q44A 4L8AA 4XNHC 3LD2A 4KUBA 4OLLA 2Q0YA 2BUEA 1PUAA 1NSLA 4ZBGA 1M4DA 3SHPA 4YFJA 2X7BA 2QMLA 1MJBA 1QSNA 4KOXA 4R9MA 3KKWA 2ZXVA 2PC1A 3BJ8A 4H6UA 2FCKA 2VZZA 3UY5A 4F0YA 4OAEA 1Z4RA 4L89A 1KUXA 2Q4YA 3B8GA 4KOTA 3DR8A 3CXPA 2RC4A 3D2PA 1NE9A 3TFYA 3P2HA 4KOUA 4IUSA 2P6EA 1IICA 3FIXA 4OADA 2O28A 2I79A 3PP9A 1J4JA 1YVOA 2REEA 3CXSA 1SQHA 4KUAA 2JLMA 3GY9A 5E96A 5FVJA 4AG9A 3S6HA 4KVME 4HNWB 1Q2DA 2G3AA 3D2MA 5J8CA 3EC4A 4U9ZA 3TOBA 2P6FA 4UA3A 2EVNA 3S6KA 1U6MA 4PV6A 1MK4A 4I49A 1LRZA 4KOYA 1Z9UA 3T90A 1QSMA 2I00A 3R96A 3FBUA 4II9A 3ZZIA 2P0WA 3FYNA 2ZW7A 4CRYB 4KZTA 4JLYA 4HNXB 2CNSA 2WPWA 1YVKA 4QBJA 4XNHB 3S6FA 3F0AA 3WR7A 4QC6A 5H84A 3EXNA 3DDDA 4KOVA 1R57A 4R3LA 2PR1A 1Q2CA 4CAVA 3DR6A 3W91A 3LODA 4QUSA 3TO6A 4B5PA 1B6BA 2OZHA 2VZYA 5EC4A 1Y9WA 2B4DA 4MBUA 2FT0A 4B5OA 4XPKA 4GS4A 2HV2A 3TO7A 3V8IA 4KORA 2ZW5A 2ZW4A 3SXNA 2OZGA 5GCNA 3OWCA 4JWPA 4RI1A 2R7HA 1CJWA 1ON0A 2B3UA 3PGPA 3C26A 2ZW6A 1S7NA 3GKRA 2A4NA 3EO4A 2Q7BA 4AVAA 2PDOA 4FD5A 2VQYA 2Z10A 2Y0MA 3FB3A 4IF5A 5C82A 4KLVA 1XF8A 4MI4A 2K5TA 3P2FA 1M4IA 1M44A 4KOSA 2R1IA 3F5BA 4Y49B 3FRMA 3TTHA 4KOWA 3FNCA 2FXFA 4MY0A 3G8WA 2Q04A 4MY3A 1P0HA 2Z11A 1V0CA 2OH1A 2WPXA 1I12A 1S7LA 3R9GA 4B5PB 5F49A 5JPHA 4EVYA 5EBVA 5F47A 1QSRA 4K30A 4XPDB 4DNCA 3BJ7A 2Z0ZA 1S7FA 5F46A 2B4DB 5C88A 1BOBA 5HMNA 3F8KA 5KTCA 2PQ8A 3H4QA 1Y9KA 3QAHA 3RYOA 5IB0A 5IV0A 4AVBA 2HQYA 1QSOA 2REFA 4HNYB 2IL4A 4KVOE 2HUZA 5CNPA 1K4JA 1M1DA 1XEBA 2Q4VA 2D4PA 3GYAA 5J8FA 1VKCA 3FXTA 4M85A 3K9UA 1YK3A 1WWZA 1MJAA 2VBQA 1I21A 1WK4A 1N71A 4QVTA 1S3ZA 4NSQA 2QECA 2CY2A 1S60A 2B58A 1IB1E 1I1DA 2VXKA 5I0CA 3IWGA 4JJXA 2KCWA 5HH1A 1KZFA 2JEVA 2GE3A 2B5GA 1YX0A 2FSRA 2B4BA 3E0KA 4JXRA 1YREA 4NF1A 2JDDA 1Z4EA 2PR8A 5ISVA 3W6SA 4AVCA 4AG7A 2C27A 2GANA 4YRHA 4CRZB 2EUIA 4H89A 1RXTA 5KTAA 4R57A 1S7KA 4E2AA 4PK2A 2FIAA 1KUYA 4CAWA 2D4OA 1M4GA 2H5MA 3N7ZA 4AB7A 2FIWA 2BL1A 3TO9A 3D8PA 4KVXA 4NXYA 2F5IA 4UWJA 1CM0A 1Q2YA 3JVNA 4PSWA 1S5KA 2OB0A 4JD6A 2AJ6A 3R1KA 3MGDA 3T9YA 2QIRA 1IYLA 2JDCA 3R9EA 4LUAA 2J8NA 4J3GA 3VWDA 3EFAA 2VI7A 3CXQA 5H86A 5IX3A 2B5GB 4PK3A 4NCZA 1MJ9A 4HKFA 3D3SA 4E8OA 1BO4A 3EY5A 4YGOA 2GIVA 1VHSA 1UFHA 3R9FA 2CNTA 3JUWA 2FL4A 3DSBA 2OU2A 1TIQA 1XMTA 2ARHA 1YLEA 3S6GA 4QB9A 5KTDA 1PU9A 3VWEA 2PRBA 3PZJA 4FD7A 5F48A 3TE4A 4ONUA 2G3TA 5DWMA 3TCVA 4CAXA 2VEZA 4MJ8A 4UBRA 1OZPA 4LX9A 1YGHA 4MHDA 2ZPAA 4UWIA 3TT2A 4FD6A 4RS2A 1NMTA 2NMTA 4Y49C 2B3VA 4U5YA 3IGRA 3TOAA 4X5KA 4F6AA 4E0AA 4FD4A 2P6GA 2FE7A 1RO5A 2R8VA 3I3GA 1YR0A 3NE7A 4PSXA 3SXOA 4ORFA 4U9YA 2FS5A 2BSWA 2J8RA 1QSTA 4XPDC 1L0CA 5DWNA 4NEXA 1B87A 1FY7A 1XIXA 4CS0B 1KUVA 2R98A 1XE4A 2AE6A 3W6XA 1P4NA
chains in the Genus database with same CATH superfamily
2CNMA 4C2YA 3G3SA 3DNSA 1ZG8A 5K8NA 4X3RA 1NSAA 4OIDA 2CIJA 4C68A 2AFSA 4H6ZA 3FJUA 3B3VA 4KSAA 4XPLA 2FVGA 4KLWA 4R87A 4BMHA 3R95A 3QB8A 3QNVA 1YMEA 4OC3A 2OZUA 1X10A 8CPAA 4M3SA 4P4FA 3PB8X 4UCMA 3I9SA 4F8ZA 2PSWA 2J8MA 3ZJ0A 4K3NA 4B6ZA 2PE3A 3D7DA 5CPAA 3BLNA 2ATRA 1VIXA 1Y7RA 5JQ4A 2YGWA 2BEIA 1IYKA 2G0BA 1IIDA 4JXQA 4MMOA 4R3KA 5K8OA 1CP7A 1GHEA 4WWVA 2DXQA 4CYPA 2CF4A 1ARLA 5LYFA 2ZEFA 3N5FA 2Q44A 4L8AA 4XNHC 3LD2A 2Q43A 4KUBA 2ZEEA 4OLLA 2C6CA 2Q0YA 2BUEA 1PUAA 3D67A 1NSLA 3RZAA 4ZBGA 5LRKA 4OC5A 3IWWA 3TX8A 2EWBA 1M4DA 4R6TA 1F2OA 2Z3NA 2DPTA 3SHPA 4MFQA 4YFJA 4X8IA 4ZGYB 2X7BA 2QMLA 1MJBA 1QSNA 2XEFA 4KOXA 3KHXA 4B11A 2PJAA 2Q51A 4R9MA 2XEIA 3KKWA 4MFJA 2ZXVA 3PFEA 2V8DA 1IOFA 2PC1A 3BJ8A 2IQ6A 2FCKA 4H6UA 2VZZA 4OP4A 3UY5A 4F0YA 4OAEA 1Z4RA 4L89A 3RO0A 1KUXA 2Q4YA 3B8GA 4KOTA 3DR8A 4NJQA 3CXPA 4PXBA 4CGOA 1Z8LA 2RC4A 3NH8A 1XBUA 2EBJA 4UFWA 2PJ2A 1F57A 1IU8A 2HB6A 2XEGA 1DTDA 3D2PA 3PB6X 2ZEDA 1NE9A 5G22A 3TFYA 5A28A 4UFXA 2ZEGA 3SI2A 2ZENA 3P2HA 2NYQA 2EO8A 1BPMA 2P6EA 1IICA 4IUSA 4KOUA 4A30A 3A9LA 4YWYA 3FIXA 4OADA 2O28A 2I79A 3PP9A 1TKHA 1J4JA 4KS9A 3RAMA 4F0XA 1Z5RA 4R76A 4A37A 1IY7A 1LCPA 1BPNA 1YVOA 4NGSA 4UFVA 4MFZA 2REEA 3CXSA 4TWEA 2YNCC 4EMEA 1DE4C 1SQHA 4KUAA 4MCPA 2JLMA 1HEEA 2CTCA 2OR4A 3GY9A 3K9TA 5E96A 5FVJA 2PJ4A 4AG9A 3KR4A 4R7MA 4FUUA 3S6HA 3RBUA 1LAMA 4KVME 4ZX8A 4HNWB 1Q2DA 5AGEA 1R3NA 2G3AA 4B10A 3I1UA 4ZY1A 3D2MA 3PB9X 1Q7LA 3EC4A 5J8CA 3CDXA 3D68A 1ZG9A 4U9ZA 3TOBA 1RTQA 2P6FA 2EVNA 4UA3A 3S6KA 2GLFA 1U6MA 5AG4A 4PV6A 2PIZA 4MCQA 1MK4A 4M6IA 3IU2A 4A38A 3ISZA 4HPSA 4I49A 3WABA 3VATA 4MHYA 1Z2LA 1LRZA 4KOYA 1Z9UA 1TF9A 2POKA 3SI1A 1ZLHA 3T90A 1QSMA 5D8NA 4A39A 2I00A 3R96A 3FBUA 4II9A 4A2ZA 3PBBA 3ZZIA 2P0WA 3PB7X 3FYNA 1Y7EA 2ZW7A 4H2KA 4MRIA 3FEEA 4CRYB 4KZTA 4JLYA 1AMPA 2CNSA 2O53A 3KL9A 2WPWA 4HNXB 3CPXA 1YVKA 4MHPA 4UEFA 2V8VA 1EE3P 2ZOGA 4B13A 4F9UA 4QBJA 1ELMP 3SJFA 4XNHB 3S6FA 3F0AA 4OC2A 2XEJA 3WR7A 4NFRA 4QC6A 2G9DA 5H84A 4CGLA 3EXNA 1IOIA 3DDDA 4KOVA 4PQAA 2WUUA 5D29A 4G1PA 3H8GA 3LACA 3PB4X 1R57A 2ZEPA 4R3LA 2PR1A 1Q2CA 1H8LA 1R43A 3IC1A 3DR6A 4CAVA 4UCPA 3SJEA 3LODA 4QUSA 3W91A 2WZNA 3TO6A 3KGQA 4B5PA 3S9NA 3RNZA 4Z65A 1B6BA 2OZHA 2BO9A 3LMSA 2VZYA 4KSIA 5EC4A 3GB0A 1Y9WA 2AFUA 3IFEA 2B4DA 2PJ1A 4MBUA 3WC7A 2FT0A 1ARMA 4B5OA 3GUXA 4PPZA 4XPKA 4GS4A 4A32A 2HV2A 3GLJA 4IHMA 1QMUA 3TO7A 3V8IA 4KORA 2JBJA 4X2TA 2ZW5A 2ZW4A 3SXNA 2OZGA 5GCNA 3LWUA 3OWCA 4JWPA 2RFHA 6CPAA 2PJ0A 2ZEMA 4RI1A 3IJ3A 4CAFA 2R7HA 3NA6A 2WYRA 5THWA 1CJWA 1TKFA 2PJ5A 3KASA 5ELYA 1ON0A 2B3UA 3PGPA 4PXDA 2CXAA 3C26A 2Z3OA 2ZW6A 1ELLP 3HUVA 4P4EA 1S7NA 4ZX9A 1KWMA 5LYIA 1M4LA 3GKRA 4P6YA 5AG6A 4CYOA 3D7FA 2A4NA 2CTBA 3EO4A 4OC4A 4R8FA 4C2ZA 5HXDA 2Q7BA 4AVAA 2O4HA 2PDOA 4FD5A 4NGNA 4CGMA 4PXEA 4BBHA 2VQYA 5BWAB 2Z10A 1YQEA 2Y0MA 3KI9A 4O23A 3FB3A 4IF5A 3QAYA 4UCNA 4ZY0A 5C82A 4KLVA 1XF8A 2PIYA 4MI4A 4NJRA 4UEEA 2PJ7A 4A95A 1CG2A 3WC5A 2K5TA 3P2FA 1M4IA 3D66A 1M44A 4KOSA 2Q4ZA 2R1IA 2BCOA 3F5BA 4NGQA 4UEZA 4Y49B 3FRMA 3TTHA 4KOWA 1VHEA 2FXFA 3FNCA 3H5ZA 2JEWA 4P10A 2DF5A 4A94A 1X12A 4MY0A 2PJBA 3SJGA 3G8WA 1CBXA 2PJ9A 2Q04A 2Z3MA 3D7HA 1P0HA 4MY3A 2Z11A 7CPAA 5HVHA 1V0CA 2OH1A 4CAEA 1Y0RA 3DGVA 1LANA 2WPXA 3FECA 1I12A 1S7LA 4EWTA 2PVVA 2RB7A 3R9GA 2F7VA 3V38A 4B5PB 5F49A 5JPHA 4EVYA 5EBVA 5F47A 4ZI6A 1QSRA 4BD9A 4K30A 4MHZA 4P4IA 2AFZA 4XPDB 4AXVA 4ZYQA 4DNCA 4NGTA 1HDQA 1LOKA 2Z0ZA 3BJ7A 1S7FA 5F46A 2B4DB 3IU1A 4ONWA 5C88A 1BOBA 4F9VA 2PJ8A 5HMNA 2YNEA 3F8KA 5KTCA 2PQ8A 2ODFA 4P45A 3H4QA 4DJLA 4IAVA 4RUHA 3KZWA 1Y9KA 3QAHA 3RYOA 5IB0A 5DS0A 2AFOA 5IV0A 4MFLA 4AVBA 2HQYA 4C7HA 3WT4A 1ZLIA 1QSOA 2REFA 4LQGA 4OIWA 3CPAA 4HNYB 4JYWA 2IL4A 4KVOE 1Y0YA 4PXCA 2I3CA 2YNCA 3MN8A 3FEDA 2HUZA 1ZG7A 5CNPA 1K4JA 1M1DA 1XEBA 1Z8WA 1XOVA 3B2YA 2Q4VA 2QYVA 4MXUA 2D4PA 2Z3KA 4FWUA 3GYAA 5G20A 5J8FA 1VKCA 1Z8XA 3FXTA 1XMBA 4M85A 3K9UA 1YK3A 1WWZA 1CPSA 3NH4A 1AUGA 2GLJA 3BI1A 2GFQA 3VH9A 1MJAA 2VBQA 4EFDA 1I21A 4MCRA 1WK4A 5JH9A 1N71A 4QVTA 1LFWA 1S3ZA 4OC1A 4NSQA 2QECA 3FH4A 2CY2A 1HDUA 5K8MA 3CZXA 1S60A 2B58A 1AYEA 1IB1E 3VARA 4B12A 5JGFA 1I1DA 1FT7A 2VXKA 5I0CA 3IWGA 4JJXA 1TKJA 4DUKA 2ZELA 5LRJA 1CP6A 3PFOA 2KCWA 5HH1A 1KZFA 1PYTB 2AFMA 2PJ6A 2JEVA 2GE3A 2DPSA 2B5GA 1YX0A 3B35A 5AG7A 1IGBA 2FSRA 4C2XA 2IMOA 2B4BA 5AG5A 1BAVA 3E0KA 4JXRA 2NSMA 3HLPA 1YREA 1OBRA 2AFXA 4NF1A 1ZO0A 2JDDA 3B3CA 2ABZA 1Z4EA 1YW6A 2PR8A 4Q7AA 5ISVA 3W6SA 4AVCA 4AG7A 3FVLA 2DEAA 4TNUA 3PRTA 2C27A 2C1CA 4IK2A 2GANA 4YRHA 4JZ0A 3FF3A 2V8HA 4CRZB 5HVGA 2J9AA 2V8GA 2VL1A 5I4MA 3H8EA 2EUIA 3MRUA 4H89A 1RXTA 4CPAA 5KTAA 4R57A 4W9YA 1S7KA 3FMCA 1XJOA 4PK2A 4E2AA 5F09A 5LYLA 2FIAA 1KUYA 4MFPA 4CAWA 3B3WA 2D4OA 1M4GA 2H5MA 3DLJA 4BINA 3N7ZA 4C7IA 4NGMA 1YW4A 2QJ8A 2ZOFA 4UIAA 3CT9A 4AB7A 4CGNA 4MCSA 4GXHA 1JWQA 1GYTA 1TXRA 2FIWA 2YNDA 4P4BA 4UF4A 5G21A 2BL1A 1Z8TA 3TO9A 3D8PA 2WSAA 4KVXA 3B7IA 1A2ZA 2F5IA 4NXYA 4UWJA 5HVFA 4P4JA 1CM0A 1QQ9A 3FX6A 1VGYA 3D4UA 4OC0A 4WJBA 1Q2YA 3BXMA 3JVNA 4LQ6A 2Z3LA 4PSWA 1S5KA 3H8FA 3D7GA 4CGPA 2OB0A 5K8PA 4JD6A 2AJ6A 2PJCA 3R1KA 4A33A 3MGDA 3T9YA 1TF8A 2QIRA 1IYLA 2JDCA 2PVWA 3IEHA 3R9EA 4LUAA 2J8NA 4J3GA 3VWDA 3KHZA 4OMEA 2GU2A 3KQZA 4GM5A 1XRYA 2OOTA 1BLLE 3EFAA 3L2NA 2VI7A 4M6GA 3CXQA 5H86A 1YSJA 5IX3A 2B5GB 4PK3A 4NCZA 1MJ9A 4HKFA 3D3SA 4E8OA 1F2PA 4OKOA 3WC6A 2V77A 1BO4A 3EY5A 2Q7SA 4A31A 4CYNA 4YGOA 2GIVA 4M6HA 1VHSA 1UFHA 1VHOA 3R9FA 2CNTA 1JQGA 3JRUA 3JUWA 4UIBA 2FL4A 3DSBA 2OU2A 1TIQA 1XMTA 2ARHA 1CX8A 2C6GA 1PCAA 1YLEA 4FAIA 3S6GA 3BHXA 4QB9A 5KTDA 3S9LA 1PU9A 2EK9A 3B3SA 3VWEA 2PRBA 3PZJA 4FD7A 5F48A 3TE4A 4ONUA 2PRQA 2G3TA 5LYDA 5DWMA 3TCVA 3S9MA 4CAXA 1FNOA 1LAPA 5J1QA 2ZEOA 2C6PA 3IIBA 3PBEA 2VEZA 4MJ8A 4YU9A 2EK8A 1CPXA 4UBRA 5CBMA 4FBEA 5A27A 1OZPA 4LX9A 4Q36A 5LRGA 4Q38A 3SJXA 1YGHA 4MHDA 2ZEHA 3IWEA 2ZPAA 4UWIA 3TT2A 5G1ZA 4DYOA 4FD6A 2GREA 4RS2A 5JM6A 1UWYA 2QVPA 1NMTA 3JTKA 2NMTA 4Y49C 2B3VA 4U5YA 2IJZA 3IGRA 3K2KA 3TOAA 3NH5A 2PCUA 3TC8A 4X5KA 4F6AA 3KQXA 4NGPA 4E0AA 3KR5A 3ISXA 4FD4A 5EMIA 1YLOA 4CYQA 3SI0A 3GIUA 2P6GA 2FE7A 4ZY2A 4MHNA 1RO5A 1XFOA 2R8VA 3I3GA 3IO1A 4P44A 1YR0A 3NE7A 4PSXA 2F8HA 3B3TA 4NGRA 3SXOA 2Z3PA 4ORFA 3V7ZA 2BOAA 5IB9A 4U9YA 2FS5A 2BSWA 2J8RA 1QSTA 4XPDC 1L0CA 5DWNA 4NEXA 1B87A 4RN7A 1FY7A 1XIXA 3NE8A 4KSFA 4CS0B 4P4DA 1KUVA 3BI0A 3NFZA 2PJ3A 2JBKA 2ANPA 2R98A 4B14A 1XE4A 2AE6A 2HC9A 2AFWA 3W6XA 4MFKA 1P4NA 3T8WA 3PEIA
chains in the Genus database with same CATH topology
2CNMA 4C2YA 3G3SA 3DNSA 4C68A 4H6ZA 4XPLA 4KSAA 4KLWA 4R87A 4BMHA 3R95A 3QB8A 2OZUA 4M3SA 4UCMA 3I9SA 2PSWA 2J8MA 3ZJ0A 3BLNA 2ATRA 5JQ4A 1Y7RA 2YGWA 2BEIA 1IYKA 2G0BA 1IIDA 4JXQA 4R3KA 1GHEA 2DXQA 4CYPA 2Q44A 4L8AA 4XNHC 3LD2A 4KUBA 4OLLA 2Q0YA 2BUEA 1PUAA 1NSLA 4ZBGA 1M4DA 2Z3NA 2DPTA 3SHPA 4MFQA 4YFJA 4ZGYB 2X7BA 2QMLA 1MJBA 1QSNA 4KOXA 4B11A 4R9MA 3KKWA 4MFJA 2ZXVA 2PC1A 3BJ8A 4H6UA 2FCKA 2VZZA 3UY5A 4F0YA 4OAEA 1Z4RA 4L89A 1KUXA 2Q4YA 3B8GA 4KOTA 3DR8A 3CXPA 4CGOA 2RC4A 4UFWA 3D2PA 1NE9A 5G22A 3TFYA 5A28A 4UFXA 3P2HA 4A30A 4KOUA 4IUSA 2P6EA 1IICA 3A9LA 3FIXA 4OADA 2O28A 2I79A 3PP9A 4KS9A 1J4JA 4F0XA 1YVOA 4UFVA 4MFZA 2REEA 3CXSA 2YNCC 1SQHA 4KUAA 2JLMA 3GY9A 5E96A 5FVJA 4AG9A 3S6HA 4KVME 4HNWB 1Q2DA 5AGEA 2G3AA 4B10A 3D2MA 5J8CA 3EC4A 4U9ZA 3TOBA 2P6FA 4UA3A 2EVNA 3S6KA 1U6MA 5AG4A 4PV6A 1MK4A 3IU2A 4I49A 1LRZA 4KOYA 1Z9UA 3T90A 1QSMA 2I00A 3R96A 3FBUA 4II9A 4A2ZA 3ZZIA 2P0WA 3FYNA 2ZW7A 4CRYB 4KZTA 4JLYA 4HNXB 2CNSA 2WPWA 1YVKA 4B13A 4QBJA 4XNHB 3S6FA 3F0AA 3WR7A 4QC6A 5H84A 4CGLA 3EXNA 3DDDA 4KOVA 2WUUA 1R57A 4R3LA 2PR1A 1Q2CA 4CAVA 3DR6A 4UCPA 3W91A 3LODA 4QUSA 3TO6A 4B5PA 1B6BA 2OZHA 2VZYA 5EC4A 1Y9WA 2B4DA 4MBUA 2FT0A 4B5OA 4XPKA 4GS4A 4A32A 2HV2A 3TO7A 3V8IA 4KORA 2ZW5A 2ZW4A 3SXNA 2OZGA 5GCNA 3OWCA 4JWPA 4RI1A 4CAFA 2R7HA 1CJWA 1ON0A 2B3UA 3PGPA 2CXAA 3C26A 2Z3OA 2ZW6A 1S7NA 3GKRA 5AG6A 4CYOA 2A4NA 3EO4A 4C2ZA 2Q7BA 4AVAA 2PDOA 4FD5A 4CGMA 4BBHA 2VQYA 5BWAB 2Z10A 2Y0MA 3FB3A 4IF5A 4UCNA 5C82A 4KLVA 1XF8A 4MI4A 4A95A 2K5TA 3P2FA 1M4IA 1M44A 4KOSA 2R1IA 3F5BA 4Y49B 3FRMA 3TTHA 4KOWA 3FNCA 2FXFA 3H5ZA 4MY0A 3G8WA 2Q04A 4MY3A 2Z3MA 1P0HA 2Z11A 1V0CA 2OH1A 4CAEA 2WPXA 1I12A 1S7LA 3R9GA 4B5PB 5F49A 5JPHA 4EVYA 5EBVA 5F47A 1QSRA 4K30A 4XPDB 4DNCA 3BJ7A 2Z0ZA 1S7FA 5F46A 2B4DB 3IU1A 5C88A 1BOBA 5HMNA 2YNEA 3F8KA 5KTCA 2PQ8A 3H4QA 1Y9KA 3QAHA 3RYOA 5IB0A 5IV0A 4MFLA 4AVBA 2HQYA 4C7HA 1QSOA 2REFA 4HNYB 2IL4A 4KVOE 2YNCA 2HUZA 5CNPA 1K4JA 1M1DA 1XEBA 2Q4VA 2D4PA 2Z3KA 3GYAA 5G20A 5J8FA 1VKCA 3FXTA 4M85A 3K9UA 1YK3A 1WWZA 1MJAA 2VBQA 1I21A 1WK4A 1N71A 4QVTA 1S3ZA 4NSQA 2QECA 2CY2A 1S60A 2B58A 1IB1E 4B12A 1I1DA 2VXKA 5I0CA 3IWGA 4JJXA 2KCWA 5HH1A 1KZFA 2JEVA 2GE3A 2DPSA 2B5GA 1YX0A 5AG7A 2FSRA 4C2XA 2B4BA 5AG5A 3E0KA 4JXRA 1YREA 4NF1A 1ZO0A 2JDDA 1Z4EA 2PR8A 5ISVA 3W6SA 4AVCA 4AG7A 2C27A 2GANA 4YRHA 4CRZB 2EUIA 4H89A 1RXTA 5KTAA 4R57A 1S7KA 4E2AA 4PK2A 2FIAA 1KUYA 4MFPA 4CAWA 2D4OA 1M4GA 2H5MA 3N7ZA 4C7IA 4AB7A 4CGNA 2YNDA 2FIWA 5G21A 2BL1A 3TO9A 3D8PA 2WSAA 4KVXA 4NXYA 2F5IA 4UWJA 1CM0A 1Q2YA 3JVNA 2Z3LA 4PSWA 1S5KA 4CGPA 2OB0A 4JD6A 2AJ6A 3R1KA 4A33A 3MGDA 3T9YA 2QIRA 1IYLA 2JDCA 3R9EA 4LUAA 2J8NA 4J3GA 3VWDA 3EFAA 2VI7A 3CXQA 5H86A 5IX3A 2B5GB 4PK3A 4NCZA 1MJ9A 4HKFA 3D3SA 4E8OA 1BO4A 3EY5A 4A31A 4CYNA 4YGOA 2GIVA 1VHSA 1UFHA 3R9FA 2CNTA 3JUWA 2FL4A 3DSBA 2OU2A 1TIQA 1XMTA 2ARHA 1YLEA 3S6GA 4QB9A 5KTDA 1PU9A 3VWEA 2PRBA 3PZJA 4FD7A 5F48A 3TE4A 4ONUA 2G3TA 5DWMA 3TCVA 4CAXA 2VEZA 4MJ8A 4UBRA 5A27A 1OZPA 4LX9A 4Q36A 4Q38A 1YGHA 4MHDA 3IWEA 2ZPAA 4UWIA 3TT2A 5G1ZA 4FD6A 4RS2A 1NMTA 3JTKA 2NMTA 4Y49C 2B3VA 4U5YA 3IGRA 3TOAA 4X5KA 4F6AA 4E0AA 4FD4A 4CYQA 2P6GA 2FE7A 1RO5A 2R8VA 3I3GA 1YR0A 3NE7A 4PSXA 3SXOA 2Z3PA 4ORFA 4U9YA 2FS5A 2BSWA 2J8RA 1QSTA 4XPDC 1L0CA 5DWNA 4NEXA 1B87A 1FY7A 1XIXA 4KSFA 4CS0B 1KUVA 2R98A 4B14A 1XE4A 2AE6A 3W6XA 4MFKA 1P4NA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CNM A;  3G3S A;  3DNS A;  4H6Z A;  4XPL A;  4KLW A;  4R87 A;  4BMH A;  3R95 A;  3QB8 A;  2OZU A;  4M3S A;  3I9S A;  2PSW A;  2J8M A;  3ZJ0 A;  3BLN A;  2ATR A;  5JQ4 A;  1Y7R A;  2BEI A;  1IYK A;  2G0B A;  1IID A;  4JXQ A;  4R3K A;  1GHE A;  2DXQ A;  2Q44 A;  4L8A A;  4XNH C;  3LD2 A;  4KUB A;  4OLL A;  2Q0Y A;  2BUE A;  1PUA A;  1NSL A;  4ZBG A;  1M4D A;  3SHP A;  4YFJ A;  2X7B A;  2QML A;  1MJB A;  1QSN A;  4KOX A;  4R9M A;  3KKW A;  2ZXV A;  2PC1 A;  3BJ8 A;  4H6U A;  2FCK A;  2VZZ A;  3UY5 A;  4F0Y A;  4OAE A;  1Z4R A;  4L89 A;  1KUX A;  2Q4Y A;  3B8G A;  4KOT A;  3DR8 A;  3CXP A;  2RC4 A;  3D2P A;  1NE9 A;  3TFY A;  3P2H A;  4KOU A;  4IUS A;  2P6E A;  1IIC A;  3FIX A;  4OAD A;  2O28 A;  2I79 A;  3PP9 A;  1J4J A;  1YVO A;  2REE A;  3CXS A;  1SQH A;  4KUA A;  2JLM A;  3GY9 A;  5E96 A;  5FVJ A;  4AG9 A;  3S6H A;  4KVM E;  4HNW B;  1Q2D A;  2G3A A;  3D2M A;  5J8C A;  3EC4 A;  4U9Z A;  3TOB A;  2P6F A;  4UA3 A;  2EVN A;  3S6K A;  1U6M A;  4PV6 A;  1MK4 A;  4I49 A;  1LRZ A;  4KOY A;  1Z9U A;  3T90 A;  1QSM A;  2I00 A;  3R96 A;  3FBU A;  4II9 A;  3ZZI A;  2P0W A;  3FYN A;  2ZW7 A;  4CRY B;  4KZT A;  4JLY A;  4HNX B;  2CNS A;  2WPW A;  1YVK A;  4QBJ A;  4XNH B;  3S6F A;  3F0A A;  3WR7 A;  4QC6 A;  5H84 A;  3EXN A;  3DDD A;  4KOV A;  1R57 A;  4R3L A;  2PR1 A;  1Q2C A;  4CAV A;  3DR6 A;  3W91 A;  3LOD A;  4QUS A;  3TO6 A;  4B5P A;  1B6B A;  2OZH A;  2VZY A;  5EC4 A;  1Y9W A;  2B4D A;  4MBU A;  2FT0 A;  4B5O A;  4XPK A;  4GS4 A;  2HV2 A;  3TO7 A;  3V8I A;  4KOR A;  2ZW5 A;  2ZW4 A;  3SXN A;  2OZG A;  5GCN A;  3OWC A;  4JWP A;  4RI1 A;  2R7H A;  1CJW A;  1ON0 A;  2B3U A;  3PGP A;  3C26 A;  2ZW6 A;  1S7N A;  3GKR A;  2A4N A;  3EO4 A;  2Q7B A;  4AVA A;  2PDO A;  4FD5 A;  2VQY A;  2Z10 A;  2Y0M A;  3FB3 A;  4IF5 A;  5C82 A;  4KLV A;  1XF8 A;  4MI4 A;  2K5T A;  3P2F A;  1M4I A;  1M44 A;  4KOS A;  2R1I A;  3F5B A;  4Y49 B;  3FRM A;  3TTH A;  4KOW A;  3FNC A;  2FXF A;  4MY0 A;  3G8W A;  2Q04 A;  4MY3 A;  1P0H A;  2Z11 A;  1V0C A;  2OH1 A;  2WPX A;  1I12 A;  1S7L A;  3R9G A;  4B5P B;  5F49 A;  5JPH A;  4EVY A;  5EBV A;  5F47 A;  1QSR A;  4K30 A;  4XPD B;  4DNC A;  3BJ7 A;  2Z0Z A;  1S7F A;  5F46 A;  2B4D B;  5C88 A;  1BOB A;  5HMN A;  3F8K A;  5KTC A;  2PQ8 A;  3H4Q A;  1Y9K A;  3QAH A;  3RYO A;  5IB0 A;  5IV0 A;  4AVB A;  2HQY A;  1QSO A;  2REF A;  4HNY B;  2IL4 A;  4KVO E;  2HUZ A;  5CNP A;  1K4J A;  1M1D A;  1XEB A;  2Q4V A;  2D4P A;  3GYA A;  5J8F A;  1VKC A;  3FXT A;  4M85 A;  3K9U A;  1YK3 A;  1WWZ A;  1MJA A;  2VBQ A;  1I21 A;  1WK4 A;  1N71 A;  4QVT A;  1S3Z A;  4NSQ A;  2QEC A;  2CY2 A;  1S60 A;  2B58 A;  1IB1 E;  1I1D A;  2VXK A;  5I0C A;  3IWG A;  4JJX A;  2KCW A;  5HH1 A;  1KZF A;  2JEV A;  2GE3 A;  2B5G A;  1YX0 A;  2FSR A;  2B4B A;  3E0K A;  4JXR A;  1YRE A;  4NF1 A;  2JDD A;  1Z4E A;  2PR8 A;  5ISV A;  3W6S A;  4AVC A;  4AG7 A;  2C27 A;  2GAN A;  4YRH A;  4CRZ B;  2EUI A;  4H89 A;  1RXT A;  5KTA A;  4R57 A;  1S7K A;  4E2A A;  4PK2 A;  2FIA A;  1KUY A;  4CAW A;  2D4O A;  1M4G A;  2H5M A;  3N7Z A;  4AB7 A;  2FIW A;  2BL1 A;  3TO9 A;  3D8P A;  4KVX A;  4NXY A;  2F5I A;  4UWJ A;  1CM0 A;  1Q2Y A;  3JVN A;  4PSW A;  1S5K A;  2OB0 A;  4JD6 A;  2AJ6 A;  3R1K A;  3MGD A;  3T9Y A;  2QIR A;  1IYL A;  2JDC A;  3R9E A;  4LUA A;  2J8N A;  4J3G A;  3VWD A;  3EFA A;  2VI7 A;  3CXQ A;  5H86 A;  5IX3 A;  2B5G B;  4PK3 A;  4NCZ A;  1MJ9 A;  4HKF A;  3D3S A;  4E8O A;  1BO4 A;  3EY5 A;  4YGO A;  2GIV A;  1VHS A;  1UFH A;  3R9F A;  2CNT A;  3JUW A;  2FL4 A;  3DSB A;  2OU2 A;  1TIQ A;  1XMT A;  2ARH A;  1YLE A;  3S6G A;  4QB9 A;  5KTD A;  1PU9 A;  3VWE A;  2PRB A;  3PZJ A;  4FD7 A;  5F48 A;  3TE4 A;  4ONU A;  2G3T A;  5DWM A;  3TCV A;  4CAX A;  2VEZ A;  4MJ8 A;  4UBR A;  1OZP A;  4LX9 A;  1YGH A;  4MHD A;  2ZPA A;  4UWI A;  3TT2 A;  4FD6 A;  4RS2 A;  1NMT A;  2NMT A;  4Y49 C;  2B3V A;  4U5Y A;  3IGR A;  3TOA A;  4X5K A;  4F6A A;  4E0A A;  4FD4 A;  2P6G A;  2FE7 A;  1RO5 A;  2R8V A;  3I3G A;  1YR0 A;  3NE7 A;  4PSX A;  3SXO A;  4ORF A;  4U9Y A;  2FS5 A;  2BSW A;  2J8R A;  1QST A;  4XPD C;  1L0C A;  5DWN A;  4NEX A;  1B87 A;  1FY7 A;  1XIX A;  4CS0 B;  1KUV A;  2R98 A;  1XE4 A;  2AE6 A;  3W6X A;  1P4N A; 
#chains in the Genus database with same CATH topology
 2CNM A;  4C2Y A;  3G3S A;  3DNS A;  1ZG8 A;  5K8N A;  4X3R A;  1NSA A;  4OID A;  2CIJ A;  4C68 A;  2AFS A;  4H6Z A;  3FJU A;  3B3V A;  4KSA A;  4XPL A;  2FVG A;  4KLW A;  4R87 A;  4BMH A;  3R95 A;  3QB8 A;  3QNV A;  1YME A;  4OC3 A;  2OZU A;  1X10 A;  8CPA A;  4M3S A;  4P4F A;  3PB8 X;  4UCM A;  3I9S A;  4F8Z A;  2PSW A;  2J8M A;  3ZJ0 A;  4K3N A;  4B6Z A;  2PE3 A;  3D7D A;  5CPA A;  3BLN A;  2ATR A;  1VIX A;  1Y7R A;  5JQ4 A;  2YGW A;  2BEI A;  1IYK A;  2G0B A;  1IID A;  4JXQ A;  4MMO A;  4R3K A;  5K8O A;  1CP7 A;  1GHE A;  4WWV A;  2DXQ A;  4CYP A;  2CF4 A;  1ARL A;  5LYF A;  2ZEF A;  3N5F A;  2Q44 A;  4L8A A;  4XNH C;  3LD2 A;  2Q43 A;  4KUB A;  2ZEE A;  4OLL A;  2C6C A;  2Q0Y A;  2BUE A;  1PUA A;  3D67 A;  1NSL A;  3RZA A;  4ZBG A;  5LRK A;  4OC5 A;  3IWW A;  3TX8 A;  2EWB A;  1M4D A;  4R6T A;  1F2O A;  2Z3N A;  2DPT A;  3SHP A;  4MFQ A;  4YFJ A;  4X8I A;  4ZGY B;  2X7B A;  2QML A;  1MJB A;  1QSN A;  2XEF A;  4KOX A;  3KHX A;  4B11 A;  2PJA A;  2Q51 A;  4R9M A;  2XEI A;  3KKW A;  4MFJ A;  2ZXV A;  3PFE A;  2V8D A;  1IOF A;  2PC1 A;  3BJ8 A;  2IQ6 A;  2FCK A;  4H6U A;  2VZZ A;  4OP4 A;  3UY5 A;  4F0Y A;  4OAE A;  1Z4R A;  4L89 A;  3RO0 A;  1KUX A;  2Q4Y A;  3B8G A;  4KOT A;  3DR8 A;  4NJQ A;  3CXP A;  4PXB A;  4CGO A;  1Z8L A;  2RC4 A;  3NH8 A;  1XBU A;  2EBJ A;  4UFW A;  2PJ2 A;  1F57 A;  1IU8 A;  2HB6 A;  2XEG A;  1DTD A;  3D2P A;  3PB6 X;  2ZED A;  1NE9 A;  5G22 A;  3TFY A;  5A28 A;  4UFX A;  2ZEG A;  3SI2 A;  2ZEN A;  3P2H A;  2NYQ A;  2EO8 A;  1BPM A;  2P6E A;  1IIC A;  4IUS A;  4KOU A;  4A30 A;  3A9L A;  4YWY A;  3FIX A;  4OAD A;  2O28 A;  2I79 A;  3PP9 A;  1TKH A;  1J4J A;  4KS9 A;  3RAM A;  4F0X A;  1Z5R A;  4R76 A;  4A37 A;  1IY7 A;  1LCP A;  1BPN A;  1YVO A;  4NGS A;  4UFV A;  4MFZ A;  2REE A;  3CXS A;  4TWE A;  2YNC C;  4EME A;  1DE4 C;  1SQH A;  4KUA A;  4MCP A;  2JLM A;  1HEE A;  2CTC A;  2OR4 A;  3GY9 A;  3K9T A;  5E96 A;  5FVJ A;  2PJ4 A;  4AG9 A;  3KR4 A;  4R7M A;  4FUU A;  3S6H A;  3RBU A;  1LAM A;  4KVM E;  4ZX8 A;  4HNW B;  1Q2D A;  5AGE A;  1R3N A;  2G3A A;  4B10 A;  3I1U A;  4ZY1 A;  3D2M A;  3PB9 X;  1Q7L A;  3EC4 A;  5J8C A;  3CDX A;  3D68 A;  1ZG9 A;  4U9Z A;  3TOB A;  1RTQ A;  2P6F A;  2EVN A;  4UA3 A;  3S6K A;  2GLF A;  1U6M A;  5AG4 A;  4PV6 A;  2PIZ A;  4MCQ A;  1MK4 A;  4M6I A;  3IU2 A;  4A38 A;  3ISZ A;  4HPS A;  4I49 A;  3WAB A;  3VAT A;  4MHY A;  1Z2L A;  1LRZ A;  4KOY A;  1Z9U A;  1TF9 A;  2POK A;  3SI1 A;  1ZLH A;  3T90 A;  1QSM A;  5D8N A;  4A39 A;  2I00 A;  3R96 A;  3FBU A;  4II9 A;  4A2Z A;  3PBB A;  3ZZI A;  2P0W A;  3PB7 X;  3FYN A;  1Y7E A;  2ZW7 A;  4H2K A;  4MRI A;  3FEE A;  4CRY B;  4KZT A;  4JLY A;  1AMP A;  2CNS A;  2O53 A;  3KL9 A;  2WPW A;  4HNX B;  3CPX A;  1YVK A;  4MHP A;  4UEF A;  2V8V A;  1EE3 P;  2ZOG A;  4B13 A;  4F9U A;  4QBJ A;  1ELM P;  3SJF A;  4XNH B;  3S6F A;  3F0A A;  4OC2 A;  2XEJ A;  3WR7 A;  4NFR A;  4QC6 A;  2G9D A;  5H84 A;  4CGL A;  3EXN A;  1IOI A;  3DDD A;  4KOV A;  4PQA A;  2WUU A;  5D29 A;  4G1P A;  3H8G A;  3LAC A;  3PB4 X;  1R57 A;  2ZEP A;  4R3L A;  2PR1 A;  1Q2C A;  1H8L A;  1R43 A;  3IC1 A;  3DR6 A;  4CAV A;  4UCP A;  3SJE A;  3LOD A;  4QUS A;  3W91 A;  2WZN A;  3TO6 A;  3KGQ A;  4B5P A;  3S9N A;  3RNZ A;  4Z65 A;  1B6B A;  2OZH A;  2BO9 A;  3LMS A;  2VZY A;  4KSI A;  5EC4 A;  3GB0 A;  1Y9W A;  2AFU A;  3IFE A;  2B4D A;  2PJ1 A;  4MBU A;  3WC7 A;  2FT0 A;  1ARM A;  4B5O A;  3GUX A;  4PPZ A;  4XPK A;  4GS4 A;  4A32 A;  2HV2 A;  3GLJ A;  4IHM A;  1QMU A;  3TO7 A;  3V8I A;  4KOR A;  2JBJ A;  4X2T A;  2ZW5 A;  2ZW4 A;  3SXN A;  2OZG A;  5GCN A;  3LWU A;  3OWC A;  4JWP A;  2RFH A;  6CPA A;  2PJ0 A;  2ZEM A;  4RI1 A;  3IJ3 A;  4CAF A;  2R7H A;  3NA6 A;  2WYR A;  5THW A;  1CJW A;  1TKF A;  2PJ5 A;  3KAS A;  5ELY A;  1ON0 A;  2B3U A;  3PGP A;  4PXD A;  2CXA A;  3C26 A;  2Z3O A;  2ZW6 A;  1ELL P;  3HUV A;  4P4E A;  1S7N A;  4ZX9 A;  1KWM A;  5LYI A;  1M4L A;  3GKR A;  4P6Y A;  5AG6 A;  4CYO A;  3D7F A;  2A4N A;  2CTB A;  3EO4 A;  4OC4 A;  4R8F A;  4C2Z A;  5HXD A;  2Q7B A;  4AVA A;  2O4H A;  2PDO A;  4FD5 A;  4NGN A;  4CGM A;  4PXE A;  4BBH A;  2VQY A;  5BWA B;  2Z10 A;  1YQE A;  2Y0M A;  3KI9 A;  4O23 A;  3FB3 A;  4IF5 A;  3QAY A;  4UCN A;  4ZY0 A;  5C82 A;  4KLV A;  1XF8 A;  2PIY A;  4MI4 A;  4NJR A;  4UEE A;  2PJ7 A;  4A95 A;  1CG2 A;  3WC5 A;  2K5T A;  3P2F A;  1M4I A;  3D66 A;  1M44 A;  4KOS A;  2Q4Z A;  2R1I A;  2BCO A;  3F5B A;  4NGQ A;  4UEZ A;  4Y49 B;  3FRM A;  3TTH A;  4KOW A;  1VHE A;  2FXF A;  3FNC A;  3H5Z A;  2JEW A;  4P10 A;  2DF5 A;  4A94 A;  1X12 A;  4MY0 A;  2PJB A;  3SJG A;  3G8W A;  1CBX A;  2PJ9 A;  2Q04 A;  2Z3M A;  3D7H A;  1P0H A;  4MY3 A;  2Z11 A;  7CPA A;  5HVH A;  1V0C A;  2OH1 A;  4CAE A;  1Y0R A;  3DGV A;  1LAN A;  2WPX A;  3FEC A;  1I12 A;  1S7L A;  4EWT A;  2PVV A;  2RB7 A;  3R9G A;  2F7V A;  3V38 A;  4B5P B;  5F49 A;  5JPH A;  4EVY A;  5EBV A;  5F47 A;  4ZI6 A;  1QSR A;  4BD9 A;  4K30 A;  4MHZ A;  4P4I A;  2AFZ A;  4XPD B;  4AXV A;  4ZYQ A;  4DNC A;  4NGT A;  1HDQ A;  1LOK A;  2Z0Z A;  3BJ7 A;  1S7F A;  5F46 A;  2B4D B;  3IU1 A;  4ONW A;  5C88 A;  1BOB A;  4F9V A;  2PJ8 A;  5HMN A;  2YNE A;  3F8K A;  5KTC A;  2PQ8 A;  2ODF A;  4P45 A;  3H4Q A;  4DJL A;  4IAV A;  4RUH A;  3KZW A;  1Y9K A;  3QAH A;  3RYO A;  5IB0 A;  5DS0 A;  2AFO A;  5IV0 A;  4MFL A;  4AVB A;  2HQY A;  4C7H A;  3WT4 A;  1ZLI A;  1QSO A;  2REF A;  4LQG A;  4OIW A;  3CPA A;  4HNY B;  4JYW A;  2IL4 A;  4KVO E;  1Y0Y A;  4PXC A;  2I3C A;  2YNC A;  3MN8 A;  3FED A;  2HUZ A;  1ZG7 A;  5CNP A;  1K4J A;  1M1D A;  1XEB A;  1Z8W A;  1XOV A;  3B2Y A;  2Q4V A;  2QYV A;  4MXU A;  2D4P A;  2Z3K A;  4FWU A;  3GYA A;  5G20 A;  5J8F A;  1VKC A;  1Z8X A;  3FXT A;  1XMB A;  4M85 A;  3K9U A;  1YK3 A;  1WWZ A;  1CPS A;  3NH4 A;  1AUG A;  2GLJ A;  3BI1 A;  2GFQ A;  3VH9 A;  1MJA A;  2VBQ A;  4EFD A;  1I21 A;  4MCR A;  1WK4 A;  5JH9 A;  1N71 A;  4QVT A;  1LFW A;  1S3Z A;  4OC1 A;  4NSQ A;  2QEC A;  3FH4 A;  2CY2 A;  1HDU A;  5K8M A;  3CZX A;  1S60 A;  2B58 A;  1AYE A;  1IB1 E;  3VAR A;  4B12 A;  5JGF A;  1I1D A;  1FT7 A;  2VXK A;  5I0C A;  3IWG A;  4JJX A;  1TKJ A;  4DUK A;  2ZEL A;  5LRJ A;  1CP6 A;  3PFO A;  2KCW A;  5HH1 A;  1KZF A;  1PYT B;  2AFM A;  2PJ6 A;  2JEV A;  2GE3 A;  2DPS A;  2B5G A;  1YX0 A;  3B35 A;  5AG7 A;  1IGB A;  2FSR A;  4C2X A;  2IMO A;  2B4B A;  5AG5 A;  1BAV A;  3E0K A;  4JXR A;  2NSM A;  3HLP A;  1YRE A;  1OBR A;  2AFX A;  4NF1 A;  1ZO0 A;  2JDD A;  3B3C A;  2ABZ A;  1Z4E A;  1YW6 A;  2PR8 A;  4Q7A A;  5ISV A;  3W6S A;  4AVC A;  4AG7 A;  3FVL A;  2DEA A;  4TNU A;  3PRT A;  2C27 A;  2C1C A;  4IK2 A;  2GAN A;  4YRH A;  4JZ0 A;  3FF3 A;  2V8H A;  4CRZ B;  5HVG A;  2J9A A;  2V8G A;  2VL1 A;  5I4M A;  3H8E A;  2EUI A;  3MRU A;  4H89 A;  1RXT A;  4CPA A;  5KTA A;  4R57 A;  4W9Y A;  1S7K A;  3FMC A;  1XJO A;  4PK2 A;  4E2A A;  5F09 A;  5LYL A;  2FIA A;  1KUY A;  4MFP A;  4CAW A;  3B3W A;  2D4O A;  1M4G A;  2H5M A;  3DLJ A;  4BIN A;  3N7Z A;  4C7I A;  4NGM A;  1YW4 A;  2QJ8 A;  2ZOF A;  4UIA A;  3CT9 A;  4AB7 A;  4CGN A;  4MCS A;  4GXH A;  1JWQ A;  1GYT A;  1TXR A;  2FIW A;  2YND A;  4P4B A;  4UF4 A;  5G21 A;  2BL1 A;  1Z8T A;  3TO9 A;  3D8P A;  2WSA A;  4KVX A;  3B7I A;  1A2Z A;  2F5I A;  4NXY A;  4UWJ A;  5HVF A;  4P4J A;  1CM0 A;  1QQ9 A;  3FX6 A;  1VGY A;  3D4U A;  4OC0 A;  4WJB A;  1Q2Y A;  3BXM A;  3JVN A;  4LQ6 A;  2Z3L A;  4PSW A;  1S5K A;  3H8F A;  3D7G A;  4CGP A;  2OB0 A;  5K8P A;  4JD6 A;  2AJ6 A;  2PJC A;  3R1K A;  4A33 A;  3MGD A;  3T9Y A;  1TF8 A;  2QIR A;  1IYL A;  2JDC A;  2PVW A;  3IEH A;  3R9E A;  4LUA A;  2J8N A;  4J3G A;  3VWD A;  3KHZ A;  4OME A;  2GU2 A;  3KQZ A;  4GM5 A;  1XRY A;  2OOT A;  1BLL E;  3EFA A;  3L2N A;  2VI7 A;  4M6G A;  3CXQ A;  5H86 A;  1YSJ A;  5IX3 A;  2B5G B;  4PK3 A;  4NCZ A;  1MJ9 A;  4HKF A;  3D3S A;  4E8O A;  1F2P A;  4OKO A;  3WC6 A;  2V77 A;  1BO4 A;  3EY5 A;  2Q7S A;  4A31 A;  4CYN A;  4YGO A;  2GIV A;  4M6H A;  1VHS A;  1UFH A;  1VHO A;  3R9F A;  2CNT A;  1JQG A;  3JRU A;  3JUW A;  4UIB A;  2FL4 A;  3DSB A;  2OU2 A;  1TIQ A;  1XMT A;  2ARH A;  1CX8 A;  2C6G A;  1PCA A;  1YLE A;  4FAI A;  3S6G A;  3BHX A;  4QB9 A;  5KTD A;  3S9L A;  1PU9 A;  2EK9 A;  3B3S A;  3VWE A;  2PRB A;  3PZJ A;  4FD7 A;  5F48 A;  3TE4 A;  4ONU A;  2PRQ A;  2G3T A;  5LYD A;  5DWM A;  3TCV A;  3S9M A;  4CAX A;  1FNO A;  1LAP A;  5J1Q A;  2ZEO A;  2C6P A;  3IIB A;  3PBE A;  2VEZ A;  4MJ8 A;  4YU9 A;  2EK8 A;  1CPX A;  4UBR A;  5CBM A;  4FBE A;  5A27 A;  1OZP A;  4LX9 A;  4Q36 A;  5LRG A;  4Q38 A;  3SJX A;  1YGH A;  4MHD A;  2ZEH A;  3IWE A;  2ZPA A;  4UWI A;  3TT2 A;  5G1Z A;  4DYO A;  4FD6 A;  2GRE A;  4RS2 A;  5JM6 A;  1UWY A;  2QVP A;  1NMT A;  3JTK A;  2NMT A;  4Y49 C;  2B3V A;  4U5Y A;  2IJZ A;  3IGR A;  3K2K A;  3TOA A;  3NH5 A;  2PCU A;  3TC8 A;  4X5K A;  4F6A A;  3KQX A;  4NGP A;  4E0A A;  3KR5 A;  3ISX A;  4FD4 A;  5EMI A;  1YLO A;  4CYQ A;  3SI0 A;  3GIU A;  2P6G A;  2FE7 A;  4ZY2 A;  4MHN A;  1RO5 A;  1XFO A;  2R8V A;  3I3G A;  3IO1 A;  4P44 A;  1YR0 A;  3NE7 A;  4PSX A;  2F8H A;  3B3T A;  4NGR A;  3SXO A;  2Z3P A;  4ORF A;  3V7Z A;  2BOA A;  5IB9 A;  4U9Y A;  2FS5 A;  2BSW A;  2J8R A;  1QST A;  4XPD C;  1L0C A;  5DWN A;  4NEX A;  1B87 A;  4RN7 A;  1FY7 A;  1XIX A;  3NE8 A;  4KSF A;  4CS0 B;  4P4D A;  1KUV A;  3BI0 A;  3NFZ A;  2PJ3 A;  2JBK A;  2ANP A;  2R98 A;  4B14 A;  1XE4 A;  2AE6 A;  2HC9 A;  2AFW A;  3W6X A;  4MFK A;  1P4N A;  3T8W A;  3PEI A; 
#chains in the Genus database with same CATH homology
 2CNM A;  4C2Y A;  3G3S A;  3DNS A;  4C68 A;  4H6Z A;  4XPL A;  4KSA A;  4KLW A;  4R87 A;  4BMH A;  3R95 A;  3QB8 A;  2OZU A;  4M3S A;  4UCM A;  3I9S A;  2PSW A;  2J8M A;  3ZJ0 A;  3BLN A;  2ATR A;  5JQ4 A;  1Y7R A;  2YGW A;  2BEI A;  1IYK A;  2G0B A;  1IID A;  4JXQ A;  4R3K A;  1GHE A;  2DXQ A;  4CYP A;  2Q44 A;  4L8A A;  4XNH C;  3LD2 A;  4KUB A;  4OLL A;  2Q0Y A;  2BUE A;  1PUA A;  1NSL A;  4ZBG A;  1M4D A;  2Z3N A;  2DPT A;  3SHP A;  4MFQ A;  4YFJ A;  4ZGY B;  2X7B A;  2QML A;  1MJB A;  1QSN A;  4KOX A;  4B11 A;  4R9M A;  3KKW A;  4MFJ A;  2ZXV A;  2PC1 A;  3BJ8 A;  4H6U A;  2FCK A;  2VZZ A;  3UY5 A;  4F0Y A;  4OAE A;  1Z4R A;  4L89 A;  1KUX A;  2Q4Y A;  3B8G A;  4KOT A;  3DR8 A;  3CXP A;  4CGO A;  2RC4 A;  4UFW A;  3D2P A;  1NE9 A;  5G22 A;  3TFY A;  5A28 A;  4UFX A;  3P2H A;  4A30 A;  4KOU A;  4IUS A;  2P6E A;  1IIC A;  3A9L A;  3FIX A;  4OAD A;  2O28 A;  2I79 A;  3PP9 A;  4KS9 A;  1J4J A;  4F0X A;  1YVO A;  4UFV A;  4MFZ A;  2REE A;  3CXS A;  2YNC C;  1SQH A;  4KUA A;  2JLM A;  3GY9 A;  5E96 A;  5FVJ A;  4AG9 A;  3S6H A;  4KVM E;  4HNW B;  1Q2D A;  5AGE A;  2G3A A;  4B10 A;  3D2M A;  5J8C A;  3EC4 A;  4U9Z A;  3TOB A;  2P6F A;  4UA3 A;  2EVN A;  3S6K A;  1U6M A;  5AG4 A;  4PV6 A;  1MK4 A;  3IU2 A;  4I49 A;  1LRZ A;  4KOY A;  1Z9U A;  3T90 A;  1QSM A;  2I00 A;  3R96 A;  3FBU A;  4II9 A;  4A2Z A;  3ZZI A;  2P0W A;  3FYN A;  2ZW7 A;  4CRY B;  4KZT A;  4JLY A;  4HNX B;  2CNS A;  2WPW A;  1YVK A;  4B13 A;  4QBJ A;  4XNH B;  3S6F A;  3F0A A;  3WR7 A;  4QC6 A;  5H84 A;  4CGL A;  3EXN A;  3DDD A;  4KOV A;  2WUU A;  1R57 A;  4R3L A;  2PR1 A;  1Q2C A;  4CAV A;  3DR6 A;  4UCP A;  3W91 A;  3LOD A;  4QUS A;  3TO6 A;  4B5P A;  1B6B A;  2OZH A;  2VZY A;  5EC4 A;  1Y9W A;  2B4D A;  4MBU A;  2FT0 A;  4B5O A;  4XPK A;  4GS4 A;  4A32 A;  2HV2 A;  3TO7 A;  3V8I A;  4KOR A;  2ZW5 A;  2ZW4 A;  3SXN A;  2OZG A;  5GCN A;  3OWC A;  4JWP A;  4RI1 A;  4CAF A;  2R7H A;  1CJW A;  1ON0 A;  2B3U A;  3PGP A;  2CXA A;  3C26 A;  2Z3O A;  2ZW6 A;  1S7N A;  3GKR A;  5AG6 A;  4CYO A;  2A4N A;  3EO4 A;  4C2Z A;  2Q7B A;  4AVA A;  2PDO A;  4FD5 A;  4CGM A;  4BBH A;  2VQY A;  5BWA B;  2Z10 A;  2Y0M A;  3FB3 A;  4IF5 A;  4UCN A;  5C82 A;  4KLV A;  1XF8 A;  4MI4 A;  4A95 A;  2K5T A;  3P2F A;  1M4I A;  1M44 A;  4KOS A;  2R1I A;  3F5B A;  4Y49 B;  3FRM A;  3TTH A;  4KOW A;  3FNC A;  2FXF A;  3H5Z A;  4MY0 A;  3G8W A;  2Q04 A;  4MY3 A;  2Z3M A;  1P0H A;  2Z11 A;  1V0C A;  2OH1 A;  4CAE A;  2WPX A;  1I12 A;  1S7L A;  3R9G A;  4B5P B;  5F49 A;  5JPH A;  4EVY A;  5EBV A;  5F47 A;  1QSR A;  4K30 A;  4XPD B;  4DNC A;  3BJ7 A;  2Z0Z A;  1S7F A;  5F46 A;  2B4D B;  3IU1 A;  5C88 A;  1BOB A;  5HMN A;  2YNE A;  3F8K A;  5KTC A;  2PQ8 A;  3H4Q A;  1Y9K A;  3QAH A;  3RYO A;  5IB0 A;  5IV0 A;  4MFL A;  4AVB A;  2HQY A;  4C7H A;  1QSO A;  2REF A;  4HNY B;  2IL4 A;  4KVO E;  2YNC A;  2HUZ A;  5CNP A;  1K4J A;  1M1D A;  1XEB A;  2Q4V A;  2D4P A;  2Z3K A;  3GYA A;  5G20 A;  5J8F A;  1VKC A;  3FXT A;  4M85 A;  3K9U A;  1YK3 A;  1WWZ A;  1MJA A;  2VBQ A;  1I21 A;  1WK4 A;  1N71 A;  4QVT A;  1S3Z A;  4NSQ A;  2QEC A;  2CY2 A;  1S60 A;  2B58 A;  1IB1 E;  4B12 A;  1I1D A;  2VXK A;  5I0C A;  3IWG A;  4JJX A;  2KCW A;  5HH1 A;  1KZF A;  2JEV A;  2GE3 A;  2DPS A;  2B5G A;  1YX0 A;  5AG7 A;  2FSR A;  4C2X A;  2B4B A;  5AG5 A;  3E0K A;  4JXR A;  1YRE A;  4NF1 A;  1ZO0 A;  2JDD A;  1Z4E A;  2PR8 A;  5ISV A;  3W6S A;  4AVC A;  4AG7 A;  2C27 A;  2GAN A;  4YRH A;  4CRZ B;  2EUI A;  4H89 A;  1RXT A;  5KTA A;  4R57 A;  1S7K A;  4E2A A;  4PK2 A;  2FIA A;  1KUY A;  4MFP A;  4CAW A;  2D4O A;  1M4G A;  2H5M A;  3N7Z A;  4C7I A;  4AB7 A;  4CGN A;  2YND A;  2FIW A;  5G21 A;  2BL1 A;  3TO9 A;  3D8P A;  2WSA A;  4KVX A;  4NXY A;  2F5I A;  4UWJ A;  1CM0 A;  1Q2Y A;  3JVN A;  2Z3L A;  4PSW A;  1S5K A;  4CGP A;  2OB0 A;  4JD6 A;  2AJ6 A;  3R1K A;  4A33 A;  3MGD A;  3T9Y A;  2QIR A;  1IYL A;  2JDC A;  3R9E A;  4LUA A;  2J8N A;  4J3G A;  3VWD A;  3EFA A;  2VI7 A;  3CXQ A;  5H86 A;  5IX3 A;  2B5G B;  4PK3 A;  4NCZ A;  1MJ9 A;  4HKF A;  3D3S A;  4E8O A;  1BO4 A;  3EY5 A;  4A31 A;  4CYN A;  4YGO A;  2GIV A;  1VHS A;  1UFH A;  3R9F A;  2CNT A;  3JUW A;  2FL4 A;  3DSB A;  2OU2 A;  1TIQ A;  1XMT A;  2ARH A;  1YLE A;  3S6G A;  4QB9 A;  5KTD A;  1PU9 A;  3VWE A;  2PRB A;  3PZJ A;  4FD7 A;  5F48 A;  3TE4 A;  4ONU A;  2G3T A;  5DWM A;  3TCV A;  4CAX A;  2VEZ A;  4MJ8 A;  4UBR A;  5A27 A;  1OZP A;  4LX9 A;  4Q36 A;  4Q38 A;  1YGH A;  4MHD A;  3IWE A;  2ZPA A;  4UWI A;  3TT2 A;  5G1Z A;  4FD6 A;  4RS2 A;  1NMT A;  3JTK A;  2NMT A;  4Y49 C;  2B3V A;  4U5Y A;  3IGR A;  3TOA A;  4X5K A;  4F6A A;  4E0A A;  4FD4 A;  4CYQ A;  2P6G A;  2FE7 A;  1RO5 A;  2R8V A;  3I3G A;  1YR0 A;  3NE7 A;  4PSX A;  3SXO A;  2Z3P A;  4ORF A;  4U9Y A;  2FS5 A;  2BSW A;  2J8R A;  1QST A;  4XPD C;  1L0C A;  5DWN A;  4NEX A;  1B87 A;  1FY7 A;  1XIX A;  4KSF A;  4CS0 B;  1KUV A;  2R98 A;  4B14 A;  1XE4 A;  2AE6 A;  3W6X A;  4MFK A;  1P4N A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...