2CNVA

Saicar-synthase from saccharomyces cerevisiae complexed saicar
Total Genus 100
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
100
sequence length
305
structure length
299
Chain Sequence
b'SITKTELDGILPLVARGKVRDIYEVDAGTLLFVATDRISAYDVIMENSIPEKGILLTKLSEFWFKFLSNDVRNHLVDIAPGKTIFDYLPAKLSEPKYKTQLEDRSLLVHKHKLIPLEVIVRGYITGSAWKEYVKTGTVHGLKQPQGLKESQEFPEPIFTPSTKDENISPAQAAELVGEDLSRRVAELAVKLYSKCKDYAKEKGIIIADTKFEFGIDEKTNEIILVDEVLTPDSSRFWNGASYKVGESQDSYDKQFLRDWLTANKLNGVNGVKMPQDIVDRTRAKYIEAYETLTGSKWSH'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PHOSPHORIBOSYLAMINOIMIDAZOLE-SUCCINOCARBOXAMIDE SYNTHASE
publication title X-Ray Diffraction Study of the Complex of the Enzyme Saicar Synthase with the Reaction Product
doi rcsb
molecule tags Ligase
total genus 100
structure length 299
sequence length 305
ec nomenclature ec 6.3.2.6: Phosphoribosylaminoimidazolesuccinocarboxamide synthase.
pdb deposition date 2006-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01259 SAICAR_synt SAICAR synthetase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 2cnvA01
3.30.470.20 Alpha Beta 2-Layer Sandwich D-amino Acid Aminotransferase; Chain A, domain 1 ATP-grasp fold, B domain 2cnvA02
2W9FB 5HBJA 3RV3A 5EDQA 2FVDA 4FUXA 5C27A 4V0GA 3LVPA 3DTWA 3Q2JA 3G6GA 3Q9YA 4IZOA 2AC5A 4B9DA 5AV2A 1ERKA 2H6DA 4YJQA 3T9TA 3O7LB 3JRXA 4ENYA 2QNJA 2DQ7X 4QO9A 5EHLA 2BZHB 5IQAA 3ZFMA 3DB6A 3V4ZA 3D5VA 4L53A 2BROA 4CCBA 4BDEA 3IECA 3QHWA 4N6YA 4TYHB 2CNQA 2XK6A 4W4WA 4XG6A 3OZ6A 5KBQA 3NMUF 4E6AA 4LUEA 3V6RA 4BDJA 5E8XA 3OT8A 4IZ7A 3E64A 5BYYA 1KJ8A 5EI2A 2ZM4A 3EKKA 5JKGA 3QZHA 3ENMA 2J90A 3UQFA 4C4EA 3GC7A 4B99A 3A60A 3QYZA 2W1CA 3V01A 3LQ5A 2Q83A 3K3IA 4IDVA 4ACCA 5A4LA 5I5ZA 3QD4A 1W7HA 4JRVA 4FNWA 4FV1A 4CFUA 4O7YA 5C8MA 2XZSA 4M84A 1WBSA 5C1QB 5CA0F 5GJGA 4A4XA 4FT5A 2BRGA 2J0IA 1QPCA 4JDJA 2UZEA 3DFAA 2JDVA 5EQPA 3K5VA 5KE0A 2R7BA 3ALNA 4RJ3A 2V5AA 4DAWA 2HZIA 4IZYA 4IWOA 4L3PA 2W05A 3DPKA 4M0ZA 4UWCA 5DYJA 3PJ2A 4JX3A 2W1IA 4XG9A 5CEQA 3PA4A 4LGHA 4O0YA 5B2LA 4MTAA 5IUIA 3VIDA 4A06A 2ETKA 5LVOA 3R5XA 2VO6A 2ZV9A 4FX3A 3OG7A 4XNEA 4J7BA 2WZJA 3BG5A 3R7YA 4M9UA 3D7ZA 4GK4A 3ID6C 2W1FA 3FMMA 2HW6A 4NKAA 3V5PA 5LMKC 3U8WA 5I9ZA 1JOWB 4BDIA 4EC8A 1Z2OX 5CAVA 4Y5HA 2ZV8A 4QMQA 4OTHA 4BCPA 2UVXA 4O6EA 4RBLA 3LKMA 2YDKA 1CKPA 4GT3A 1OL2A 4ZS0A 5FTOA 3DU8A 3TZ8A 4UY9A 1ZLTA 3CQWA 5ACBC 3GU7A 1M14A 3FLQA 2YZMA 3UNJA 4FYOA 2C0OA 4YAKB 4O0VA 2CJMA 3DK3A 4TL0A 4USDA 4WNOA 5EG3A 4FSZA 4OUCA 4IFGA 3E8DA 4FTRA 3G6HA 5CX9A 4WA9A 3U55A 1J3HA 4HGSA 3UOKA 5IMXA 2IJMA 3PFQA 5JN2A 4HNTA 5FUTA 2R2PA 3RPOA 2HGSA 4XH6A 4YTFA 1ZAOA 5TR6A 4TWPA 3AT4A 4CZUA 3CJGA 5DGZA 1YXXA 4LL0A 1BKXA 5G1XA 2O8YA 4XG7A 3NYXA 4M0YA 5AADA 4YTCA 3CLYA 4P5ZA 4C4HA 1O6LA 2RFSA 4I5CA 4BBFA 2R3IA 4IHPA 1Q62A 1MRVA 1TQIA 3U4WA 3FY0A 1Q8UA 4CRSA 2XEYA 5DT0A 5DR2A 2YIYA 1OECA 5EM7A 2XB7A 4C4FA 3TCPA 5C01A 4G9RA 4R6VA 2XNNA 5HZNA 2WQNA 2X0SA 4EK6A 5M08A 1OZ1A 3OUNB 4EHEA 2VTMA 4ZLYA 2YA9A 3W2PA 1W93A 3UIXA 3JYAA 4R7HA 1Q99A 3HB9A 2UVZA 3FPQA 1SZMA 4D4RA 3W16A 4BC6A 2BDFA 2GHMA 2VTQA 3C0HA 5HNIX 1I7LA 2VWIA 2RF9A 2GNFA 2OF4A 2YJSA 4FEVA 4AOJA 4QYEA 4ASXA 4CVAA 3ZO4A 4JQEA 5C03A 3ANQA 4APCA 1BUHA 2P55A 3GU5A 2F57A 2VRXA 3ACKA 2WTWA 2WTVA 4FV9A 3A8XA 2G2HA 3T3UA 5KNJA 5LVPA 4PDYA 3WZKA 4ZIMA 3ZRLA 1GLVA 1K9AA 4IWDA 2PSQA 3D83A 4FT7A 4YAJB 3WIKA 5ITAA 5IQCA 2JBOA 2Z7RA 4FKSA 4QYGA 4GSBA 4CEGA 3NIEA 2R7NA 4O4IF 3DKFA 3RM7A 3R22A 4F0GA 2B4SB 1YWNA 3QQJA 4Y95A 1R39A 3NRMA 3VC4A 3ATTA 1C3OA 4BCOA 4FSUA 2IO6A 3MVLA 1UU3A 4ZQIA 4C3PA 2OZAA 3DV3A 4R3CA 2SRCA 1QL6A 4X2FA 4LG4A 5E7RA 3RALA 4O6LA 4O7ZA 5A54A 2AYPA 4JXFA 2G1TA 3WZEA 4DFLA 4AT3A 3PIYA 4C38A 4EQMA 5IF1A 3CD8A 1IAHA 2A2AA 4RGJA 2QQ7A 4FV6A 3PJ1A 3PG3A 3TWJA 4K18A 1PMEA 2YCRA 1BI7A 4RQVA 4E5WA 5CF4A 3O17A 3Q04A 5CVGA 2WMAA 3C13A 2QHNA 5HG8A 4JX7A 4EH3A 2BTSA 2ZV2A 3RI1A 3OW4A 4IVBA 4KA3A 3WYYA 4E93A 4HNUA 3BV3A 2WQEA 4DEDA 2B9HA 3CGOA 3NUUA 2HXLA 4J97A 3F3VA 4RZWA 2ZB0A 3UC4A 3ZSGA 4I4EA 4C5CA 3AD4A 2C5NA 2CKOA 3ORIA 3Q9WA 1PX2A 1WFCA 2NU7B 4XLVA 2OLSA 4ZSJA 3IPHA 3BQRA 3CQEA 4PTCA 3WZDA 5DRDA 4RX8A 5BVDA 3NUAA 3NW6A 2GFCA 4DEHA 5ETFA 4QMYA 3O0GA 1AUXA 4I41A 1EUCB 1JLLB 3TIGA 3OWKA 2C47A 3ENHA 2PUNA 4WOVA 1B39A 3SA0A 3ZH8A 2XIXA 5CF8A 4N0SA 2WMTA 3UP7A 3S0OA 2BDJA 3QQKA 3E7OA 4EH6A 2YW2A 5A4CA 4MQ1A 2I0VA 4XX9A 1DV2A 2R3FA 3MB7A 3OT3A 2YWVA 3GFWA 5HE2A 4O7SA 3F61A 4OTWA 3BYUA 3R30A 1O6YA 5EDPA 3L8VA 5GIOE 1MUOA 3R8VA 2WMQA 3DZQA 5TF9A 4R78A 4EOKA 4FG8A 3FZOA 4QTBA 4MNFA 5IA1A 2ITXA 2XS0A 3P0MA 2DYLA 3BLHA 2WHBA 4ZAUA 4JLCA 4AU8A 2PVLA 3EWHA 4X3FB 4C4JA 3PRFA 4C2WA 1KE9A 1IRKA 4HZSA 5DT4A 4Q9SA 1PMUA 4FTMA 2XK7A 3R1NA 3FXZA 1R0EA 2E2BA 4GIHA 2XIYA 4PTGA 3VBYA 4XJ0A 3VS5A 4FTOA 4D5KA 4X3JA 4YTIA 2XNGA 5IH6A 3I6WA 4FV0A 1O9UA 3NVKI 4FV5A 3GBZA 2BZJA 2YYAA 5D9HA 4KKGA 5AUWA 2IW8A 3THBA 4OTGA 3NEWA 2QKWB 3COHA 4GT5A 4NSTA 5CXZA 1XQZA 2WPAA 1AQ1A 4IAIA 4O86A 4BCIA 4UALA 1YOMA 3IW8A 3KVWA 3KFAA 3PE2A 4K8AA 2VPQA 3U87A 1OBGA 1UWJA 2X7FA 3DT1A 4HCUA 3ZS5A 4C59A 4EOLA 1JQHA 3BHYA 2JEDA 2X8IA 4HPUE 1H25A 1OUKA 3QGYA 4O2AF 5L2TA 2X2KA 2O65A 2W71A 2OJFE 4BCNA 3BX5A 4WG5A 2VR1A 3NAXA 1OUYA 4FTNA 4PUZA 3N8DA 5BYLA 3ZSHA 5D8DA 3KXHA 4FKPA 4FTKA 5HCXA 3PA3A 2W1DA 1F5QA 3GCVA 4ITJA 2DS1A 4FIEA 4F9WA 3QU0A 3RV4A 4NL0A 2R3QA 3JVSA 4FL1A 4JG6A 3DKGA 3G9NA 4E20A 4QYHA 3KA0A 4WHZA 5J9ZA 5CAPA 2BFXA 5IU2A 4MEDA 1P14A 3DK7A 4AW0A 1GSAA 4IE9A 3Q96A 3OUUA 1ZYJA 3HKOA 4G5JA 4YZMA 5IDPA 2JFMA 2WELA 3IOPA 5IA4A 2CZGA 4CKJA 4XOYA 3NCGA 5D11A 4OTDA 4C5BA 4MXOA 4RFZA 2V22A 4CSVA 1KEEA 4MXAA 2CLXA 3W2SA 4B6LA 2I0HA 2OU7A 2QOKA 3SE7A 4F7JA 3KKVA 2OIQA 3Q2OA 4RQKA 1EYZA 4YZCA 2W6PA 3JVRA 1L8TA 5ANDA 5JT2A 3P78A 1KV1A 2H34A 4ANBA 5CEOA 2W5BA 3PLSA 2XYUA 4R5SA 3R73A 3AQVA 4ZMFA 3C4CA 4O84A 3MN3A 2ZOQA 3PY3A 4DF3A 4MV4A 2R3JA 3QWJA 4U7ZA 3VS2A 4KBKA 3JS2A 2IVTA 1SNUA 4IB0A 1M7NA 4TN6A 3QKKA 2CKPA 1ND4A 2DUVA 3AT2A 4C35A 3UO5A 4WNMA 5FTGA 2VNYA 2R7IA 5DEWA 3HAVA 1M7QA 2FA2A 4GFOA 1V0BA 3R63A 4G1WA 3I5NA 5JZJA 4LGGA 2GFSA 2V7OA 3FXWA 4RJ4A 4C37A 1GGOA 1Q8YA 4I20A 4BICA 1UKHA 4IB1A 4M8TA 3QHRA 3L8XA 4YTHA 4MA5A 3H9FA 5E4HA 2R3NA 4L6QA 2R3HA 4GFGA 1GJOA 2B9FA 2BRNA 2OIDA 3OHTA 5E1EA 3LP8A 5AFVA 2YITA 3QUPA 2BAJA 4YJUA 4R1YA 4W4XA 2P3GX 3MTFA 4I6QA 5HLPA 2BKZA 3DFCB 3O7LD 4FSWA 1OIRA 4QMVA 4I5MA 4MBLA 3VUIA 4BDAA 4RFMA 5GNKA 3WARA 5JQWA 4OLIA 4YZNA 4EQCA 5EFQA 2CGUA 2IN6A 5M51A 2YIQA 4G3DA 3E3PA 3A62A 3U6IA 3C4EA 4QQCA 1DAWA 2HELA 4GYGA 4IIRA 3UGCA 1KJ9A 4HQ6A 5EH0A 4S34A 4TYHA 4U43A 4YBKA 4FU0A 2QF7A 2HZ4A 5HGIA 3MA6A 4JBVA 5ANEA 1UU9A 3TZ9A 3UIMA 2YM4A 3W10A 2P0CA 4PTEA 4CG9A 1H1WA 2YACA 3KN6A 4OTRA 2YCFA 3QKMA 4IB5A 3U4UA 4BGHA 1PKGA 3IDBA 2F2CB 2IVUA 1RDQE 3AGLA 2VO3A 4EJNA 4WO5A 2X7GA 1KOAA 4QP8A 5EHOA 5HESA 1CQIB 3L9MA 4WG3A 4DG3E 4DGGA 4EH4A 4HVHA 2YN8A 2ZVAA 3UOJA 1T46A 3R8LA 3TNHA 4YJTA 4ZY5A 3Q1KA 4O0TA 1XH5A 2CN8A 3JXWA 4DEIA 1IAJA 3QC9A 5DE2A 2ZDHA 3LXKA 4XUFA 1EH4A 4FG7A 3ZDUA 3SOCA 2J7TA 5KKRC 3RK5A 5KX8A 2GNJA 4F6WA 3PXZA 1FBNA 3P7BA 3DJ7A 3R00A 3QRTA 5CT0A 5J87A 1UA2A 5IZFA 4MBIA 5TT7A 3O23A 5IQGA 4MV7A 2R64A 3Q5IA 2PL0A 4XP0A 4S33A 4AN2A 4CG8A 3P5KA 4K2RA 3QBNA 4MAMA 3VS0A 3B2WA 3OBJA 4QMXA 3VBTA 5C4KA 5AV4A 3WE8A 2HOGA 4QP1A 4MNEB 4RC3A 3VULA 4TV9F 4IM2A 4FVRA 4L00A 5DR6A 4IZ5A 3WYXA 4E26A 3AMYA 3DJ6A 3SQQA 1UNGA 3QWKA 2OH4A 5EQYA 2HZ0A 2WQBA 2ZM3A 2BIYA 3ZYAA 1IASA 4FSMA 1Q3DA 3AT3A 3QUEA 4RX5A 5CU2A 2E9OA 4I22A 1CKIA 2O0UA 4ZY4A 4LRJA 1RE8A 3SHEA 2F4JA 4Y5QA 3ZC6A 3PVUA 2QU6A 4D1ZA 5CXHA 3HDMA 3LMHA 3Q9XA 3CGFA 1JDBB 5H2UA 4I0SA 5D12A 4RT7A 3D4QA 5ETCA 3R2BA 1JWHA 5M4IA 4TV8F 3LFCA 4BHNA 3CBLA 1KBLA 2YM6A 2C4GA 3HMOA 3KXNA 2C0IA 4QP3A 4RSSA 4RA5A 2ZDGA 4MVFA 3EFJA 4FSYA 1Y6BA 1X8BA 3FMHA 2YDJA 4MKCA 4QMWA 3MY1A 2EB2A 5BVWA 4O7TA 2NPQA 4GU9A 4GV1A 4ASZA 3PP1A 5ANKA 2R3GA 2VU3A 1JLUE 1OM1A 3KF4A 4TYJA 2KULA 3QTIA 2ITOA 1UU7A 4AGWA 3GU4A 4FFLA 3W18A 4F1MA 4FVPA 1GZNA 3GU8A 3F7ZA 3R23A 3A61A 3QZGA 5HBRB 1YRPA 2ITUA 3FI8A 4IWPA 4F9YA 5DI1A 5HG5A 3NCZA 4I5PA 2FSOX 2ZB1A 3E92A 3MH2A 4Y8VB 4FFPA 5KBRA 5B2KA 1SM2A 4G6OA 2CGXA 4HCVA 2UW4A 4GJ3A 4B8MA 3ORKA 3TJDA 4N70A 4F0IA 2C3KA 4V04A 3S2PA 3JRWA 4TW9A 4M69B 4R7BA 2C6DA 3R21A 4IADA 2HJWA 3C4XA 3IGOA 3Q4UA 3C51A 4XZ3B 2QR8A 3HMPA 4N6ZA 4DEBA 4EG0A 4UX9A 3WF6A 2ITVA 3VS7A 4FKGA 3V04A 4EK5A 4C0TA 3ZRMA 2YHVA 3CKXA 4KINA 2XVDA 5CQWA 3P86A 3ORLA 3NS9A 2REIA 3KMUA 3D2IA 2YM5A 1FQ1B 3DY7A 3HL7A 4UWYA 1KE6A 3ATSA 5HE1A 4AT5A 5J9LA 3VS4A 5M07A 4X7QA 3DBFA 3OMVA 5DFPA 3DBEA 1OIYA 4FTAA 2XYNA 4XLIA 2RFNA 4QQ5A 4ZTRA 3GXLA 5CU6A 5J8IA 3KXXA 2ETRA 5LCKA 3NUNA 2FSLX 2P33A 4UV0A 4U80A 3L8SA 4KKHA 1QMZA 2OXYA 4HVSA 4ZHQF 1OI9A 2QVSE 3PPKA 2GPWA 3AW8A 2OXXA 3UOLA 4ZXTA 2PMOX 2W1EA 5ANIA 3ZUVA 3Q52A 2QLQA 2WMBA 2EU9A 4BDCA 3F5GA 3QL8A 2GPHA 4D9UA 2OLCA 2WXVA 2VWWA 2V62A 5A46A 5HIEA 4E4TA 3BRBA 3FBVA 2JBPA 3BLRA 4Y72A 1K2PA 3PIXA 3W2OA 1CMKE 3Q5ZA 3U54A 4FV3A 2WTIA 4FOBA 4M15A 4F99A 2I0EA 3SAYA 2WNTA 4FI1A 4G31A 5EZYF 3C0GA 3AD6A 3BPRA 2GS7A 3GENA 3KVXA 2J6MA 4ENXA 1ZMUA 3GU6A 4PWNA 1GIIA 3ETJA 4FFRA 2FB9A 2AC3A 2PZ5A 3ORZA 3MW1A 4KSPA 4IFCA 2I80A 4ZZOA 2VX1A 4NM5A 4KAOA 2UUEA 3DTCA 5CVHA 2C5XA 3FLYA 2PYWA 3W8QA 2PBZA 1RW8A 4AZEA 5I9VA 3B8RA 4ALWA 5FXQA 2XUUA 1PW2A 1EZ1A 1BMKA 3BYMA 4G3EA 3R9RA 4UBAA 2XCHA 5HEZA 3DXNA 4M68A 4PMSA 3DQXA 2OGVA 4I55F 4O82A 4AUAA 2CLQA 3BGZA 4L43A 2W06A 5GJFA 3VRZA 5JFWA 3PJ8A 3SLSA 1GOLA 5CYIA 2BIKB 3MFRA 1Q24A 2R9SA 3MJ1A 2PVPA 1BL6A 4JDIA 5CSHA 4IX5A 3ET7A 4CT1A 3TUCA 5HBEA 4ZTQA 5J95A 1XH9A 2C00A 4IVCA 5CF6A 2WMVA 2FGIA 1NA7A 4FVQA 2FSTX 4X0MA 2OWBA 4AZTA 1WBTA 3FJQE 3U6JA 4DE4A 3NUSA 4J98A 4RWKA 4FV8A 4OW8A 1ZMVA 5JSMA 4IACA 1OKWA 2JLDA 3MTLA 1LPUA 4IX6A 5HO8A 2QG5A 4RIXB 5KMIA 5J2TF 4PMPA 3N51A 3NAYA 2PVYA 4QMNA 3V5WA 2XKEA 2FO0A 2VTIA 1CKJA 2BKKA 4RG0A 4BCKA 3UO4A 5IPJA 1J7UA 4FGBA 4X3FA 4J96A 3LPBA 4C2VA 1BL7A 4XYFA 5BVKA 3WZUA 3S1HA 3KAKA 4OBQA 5BYZA 3S3IA 3OXTA 2C30A 4F1TA 1O6KA 4L3JA 3TIIA 4KBCA 4IDTA 4YLJA 2YZGA 4CFNA 4UB7A 1WAKA 3RPVA 3W8LA 3FQHA 4DBXA 4DITA 5CNNA 3JY0A 3V8TA 3FSKA 3EFWA 5FXRA 3BGQA 3G0EA 1Q97A 1ZY5A 5LVMA 4DGLC 4GCJA 5CASA 3EQDA 3ZLYA 3OVVA 4JG8A 1KE5A 3OP5A 1K3AA 1GZ8A 4FV7A 1YDRE 3BWFA 3VPBA 2W17A 3HV5A 4GK3A 2X1NA 4DN5A 4E5BA 3SX9A 4GVJA 4ANSA 2R86A 1DS5A 4X6QC 2EXCX 3NW7A 5I4NA 3TINA 1NW1A 2YZLA 2OJJA 2J0JA 3KXZA 4ZSAA 4ZTHA 2PUUA 5AUXA 3DS6A 1R78A 2X0GA 2G9XA 3HDNA 4BHZA 5AP6A 4LV8A 5ANGA 4Y46A 3HA8A 3IKAA 3BYSA 2DIKA 4WG4A 3NIZA 3EYHA 4RVMA 5DBXA 1WMKA 1U5QA 4NU1A 4KUJA 5HVKA 2OO8X 4RJ6A 2IPXA 4P5QA 4CCUA 2X9EA 2Y8OA 4E6DA 3FZ1A 2QHMA 2R5TA 3OTUA 3JUHA 4DEGA 5C4LA 2QOBA 1JSTA 3DLZA 3JZFA 4DH5A 1PMVA 3LFEA 2W1HA 3QA8A 4FKUA 5FBOA 4E4NA 4PDOA 5KKNB 2UW8A 3RVGA 4WUNA 4IIJF 4LV5A 4NZWB 1DM2A 3W33A 2OICA 3B2TA 3QCSA 4HYUA 2ITZA 2X8DA 5KMOA 5D41A 1SMHA 4DBNA 1V0PA 3C1XA 5EKNA 2O2UA 4ZY6A 5BMSA 2XRWA 3QTWA 3P7AA 4RLLA 1ZMWA 4FT3A 3SOAA 4AOTA 4AA4A 2RG5A 4DINA 5KMJA 2B9IA 4XV3A 5EKOA 4R7IA 3P9JA 5HO7A 1G8SA 2CHLA 3CY3A 4GFMA 5B0XA 5AUYA 4EH7A 3I5ZA 3PIZA 1JSVA 3LJ2A 4O7VA 1JSUA 4L42A 4BI0A 5F1ZA 2UW3A 3FXXA 3TV4A 4KS7A 2H96A 5C8NA 3VO3A 2W5AA 5FDPA 2XF0A 4FKJA 2VGPA 4D5HA 2GPSA 2YIRA 1GAGA 2PVNA 2C6LA 3UFXB 3NZ0A 4MYGA 5C26A 4H3PA 3JZIA 2X6DA 2H9VA 4FT0A 2QI8A 2RL5A 5IYZF 3VUKA 3HA6A 2XJ1A 3BYOA 2VTAA 1XJDA 3O8PA 4AGUA 3U9CA 4L3LA 3A7JA 5C8KA 2DZDA 4FODA 5DHJA 4QTEA 3UMWA 2IP4A 4IHJF 2RFEA 5DMXA 2GHLA 4LRKA 2XNPA 3DNEA 3TNQB 2J5EA 2JC6A 1ZZ2A 1M2PA 1Q4LA 2XNMA 4LOQA 2C1BA 3VHEA 4JRNA 3P4KA 5AV1A 3TIZA 1ULZA 3DZOA 5LVNA 4HVIA 3EFLA 2HXQA 3D5WA 4G3GA 2G2FA 4XYLB 4DGMA 2Z02A 4TWCA 4II5A 5HVJA 3D5XA 3FI3A 4AGDA 1VKZA 2NU8B 3EQCA 1P4OA 1GSOA 1B38A 3UDBA 3H30A 4YJVA 3ORRA 5IH5A 2UZTA 1PRYA 2WFYA 4QP2A 2G2IA 3FV8A 2X4ZA 4ID7A 4TYEA 1FGKA 4BY9E 3DF7A 3SKCA 5JRQA 5DA3A 5E92A 3DBQA 4EKLA 4J53A 5BVFA 3BCEA 2OSCA 2PWLA 3KMMA 3PJ3A 4HYHA 4LM5A 3ZZWA 5IUHA 4O4HF 4Q5EA 4FNXA 2UW0A 5EYKA 3FLZA 3QTSA 4I5HA 4EK4A 5DEYA 5BQ0A 4DCAA 2C5VA 3NNWA 4ZOGA 1H27A 3RPYA 3C50A 5FEEA 2GTMA 3FMLA 4DFXE 2A4LA 4G5PA 3ORTA 3FLWA 4XOZA 1XBAA 4IW0A 4CT2A 1WVXA 3IDCA 3KRJA 5CZIA 2ONLC 3QLGA 1M52A 2BPMA 4BDGA 4DEAA 5KCVA 3RMFA 4EOOA 2GDOA 4F08A 3DAKA 3UZRA 2B0QA 2XEZA 3ORMA 1UVRA 3TKUA 3UG1A 2RGPA 2XK8A 1WR2A 3RKBA 5CEPA 4DLKA 2BRHA 4A4LA 3I6UA 3SG8A 1M2RA 2PE2A 4K11A 4UXQA 1A9UA 1OKYA 2GNHA 5L2WA 1CSNA 2RKUA 4MNEA 2YM3A 5FP5A 2XP2A 3KRWA 1DIKA 2IW9A 3TTIA 2WQOA 4QOXA 4DG2E 3D0EA 5LWMA 1FINA 2B54A 1R0PA 3ORXA 5BMVF 3EHAA 4CV9A 4ZLOA 1TKIA 4FTJA 4XRJA 3COIA 3FMNA 3IQ7A 4ACHA 3OROA 2BHEA 3C0IA 1SNXA 4U9AA 1Q5KA 2UW7A 4XG4A 3Q9ZA 5FBNC 3TL8A 3E7VA 3OXIA 4QNAA 4G6LA 5E91A 4RX9A 2WMXA 3LM0A 3QTZA 2J51A 5HTCA 3K3PA 4ERKA 3OCBA 3VQUA 1FMOE 4ZZMA 2P2IA 2P4IA 1NVSA 3ZBXA 2C69A 1IG1A 4QPSA 4B0GA 1KJIA 4QRCA 2PHKA 3ELJA 5CZHA 5I9UA 5FNVF 4OBPA 4HOKA 5CY3A 1Q61A 5FD2A 3V4SA 2IZUA 3UIUA 3NW5A 5HCYA 3LFNA 1Q8WA 2PMNX 3FZSA 3O50A 5G6VA 5M4UA 4YC3A 4F9CA 4RIOA 1AUVA 4YJ3F 3B8QA 3E8CA 3V3VA 1VZOA 2OXDA 2Y4PA 2PK9A 4ZSEA 4EQUA 5EW9A 4IJ9A 4FNYA 4EWHA 4FKTA 5F9EA 5GJDA 3U9SA 3LCKA 4DLJA 5KKRB 2PN1A 3MIYA 1H8FA 2DWCA 4QSHA 1YXSA 3LLAA 1FVTA 4O7NA 4HZRA 3HO8A 3RZBA 1YXUA 4U97A 4GT4A 1OL6A 3F82A 2NP8A 2YAAA 3DA6A 3UOHA 1TVOA 1GZKA 4GKIA 2X39A 3FI4A 4FEUA 4RVKA 3GC0A 4CTCA 2Z04A 4QTAA 2JDRA 4KS8A 3S4QA 3SRVB 2B53A 2WOTA 3G2FA 3LXPA 3BV2A 2PULA 4L1KA 2PVJA 2W9ZB 3BE9A 3IOKA 3M11A 1KSWA 3P79A 3G0FA 3PE1A 3O96A 4RJ8A 5LMKA 2FB8A 4QMSA 5E8SA 5HKMA 1OGUA 1G5SA 4AZFA 2ESMA 5K4JA 3KL8A 4JI9A 4N57A 3L8PA 2R0IA 1G8AA 3RJCA 4EZ5A 4DT9A 4Z9LA 5BUEA 1H0WA 4BYJA 4D4YA 4YBZB 3PXYA 4LL5A 4F1OA 4FEQA 3KU2A 4FTQA 1HOWA 2NU9B 3FMDA 1OPJA 3C4ZA 3NNVA 4A9RA 2PVHA 1PXLA 3VPCA 4MD9E 2VX3A 2FPGB 4PMMA 4BZNA 2QOHA 4H36A 3DJ5A 5I9WA 3MWUA 4TT7A 3QD2B 1H01A 5H9BA 2XM8A 4AS0A 2Y4IB 2ZJWA 5AAGA 3MJ2A 2J50A 3RAWA 5B7VA 5J1VA 2X7OA 2WTDA 3LFQA 3R02A 3QRUA 3KQ7A 5IEVA 4DTAA 3W1FA 2O3PA 4WIHA 2BAQA 2R7KA 2VUWA 4DTBA 5KMNA 2W70A 2C6KA 4P90A 4EONA 4ZTMA 2GS6A 2IZTA 5A4QA 4RWJA 3CCNA 5DN3A 3G8CA 4S32A 4Y73A 2HZNA 2YS7A 1OVEA 1Q41A 3QQGA 4AT4A 3M42A 1BNCA 2YM8A 5ACKA 3A8WA 3CTJA 4ZK5A 1WBNA 1ZZLA 1HCLA 4PP9A 5BMMA 5CQUA 2E9PA 2JKMA 1EUDB 4IAAA 3LHJA 2VWZA 1OL7A 3MESA 4K1BA 2W0JA 2WMSA 3PJCA 2XKCA 2X2MA 4D1SA 4EHVA 2C68A 5DG5A 2J0MB 4RMZA 3VUHA 3RAKA 3IS5A 1IOWA 1SYKA 1PJKA 3QXOA 3VF9A 4TTHB 2C6OA 3R83A 4MCVA 3RCDA 4BZOA 3NSZA 3COMA 3A7HA 5CU4A 3UYSA 4HVDA 1URCA 3SW4A 3WF5A 3LFDA 4JR7A 4EZ3A 4YMJA 1A9XA 5FDXA 3ORPA 5EK7A 2QOOA 4MXYA 5CENA 3ZXZA 2QG7A 4O91A 4BI1A 5KHXA 1PXOA 3EL7A 1PXJA 4F0FA 3ZMMA 4FA2A 2QURA 3OUZA 4Q5HA 2YCQA 2J9GA 3ZBFA 1H1SA 4HYSA 4K77A 5DLSA 2VTRA 2VAGA 3U51A 4PX6A 3QQUA 3ITZA 2QOIA 3KB7A 3UJGA 1SCUB 2F49A 1PKDA 4RZVA 3CTQA 3TNPC 5CU0A 5IH4A 5JEBA 2VV9A 2V58A 3E93A 4PL5A 4YPDA 5HNGA 5F95A 3RAIA 2W6QA 3MB6A 4FGRA 4W8EA 4O0WA 3NUYA 3QCXA 5HLNA 5LJJA 4L7FA 3VS1A 4I21A 5HTBA 5JFVA 3KCFA 5BX0A 5ANOA 2X4FA 5LOHA 4RIXA 4YB8B 1PXNA 4K33A 3ULZA 4H1JA 3DBDA 1NY3A 4UZHA 1VBHA 5EYCA 5HHWA 2W4KA 4O83A 1OBDA 2OI4X 4PF4A 2QLUA 4MK0A 4GW8A 4S30A 3R8MA 4FFNA 3GOPA 3IW4A 3KULB 2J9MA 3IDPA 2UZNA 3HV3A 3VRYA 4EZ7A 5JH6A 3NYOA 4AOIA 2I8CA 5H8GA 2VTNA 2YCSA 2YZNA 4ITIA 4J71A 4EJ7A 1ZYCA 1H26A 3AD5A 4TNDA 3LCSA 4W8DA 2OFUA 3GCUA 4M13A 2NRYA 3Q6WA 2YERA 5D10A 2XJ0A 5GIPE 3UPXA 3FYKX 4XP3A 3VA7A 2GTNA 4N4SA 4OBOA 3FWQA 3TIYA 2C6IA 2XIZA 3BIZA 1U4DA 3EYGA 3I4BA 3PPZA 5L6WL 2FSMX 4CFFA 4G9CA 3EN7A 4IVAA 5JQ5A 3ORQA 5E9EA 1CDKA 4QYFA 3ZO1A 2QK4A 1PYEA 4F7LA 5AP0A 2VTTA 4L68A 2GNLA 3G90X 4RC2A 3I81A 2RIOA 4IWQA 3G9LX 2JDTA 3AMBA 3HZTA 4Z55A 4RX7A 3RWPA 5IUGA 2CNUA 2W4OA 3F3UA 5M53A 5CSWA 3C4WA 3I12A 4HNVA 1OKZA 5M4FA 3GNIB 4FV2A 3FKLA 4KIOA 3IW5A 2WIPA 3UE4A 4KRCA 4XV9A 3MI9A 5IMEA 4EL9A 1Z5MA 4FZ6A 4EEVA 4ZP5A 4AGCA 2Y6MA 3H10A 3UVQA 1S9IA 3DB8A 4EH5A 5AUTA 1H00A 3DAEA 1C30A 5CF5A 5AJQA 2VWXA 5CT7A 5L3AA 2E9VA 1IEPA 4NJ3A 4AA0A 3PXFA 3F3TA 3OCSA 1CS0A 5E8VA 5JGDA 4MBJA 5IISA 3QQLA 1IR3A 4I92A 3FYJX 4BGQA 1BX6A 5DOSA 2XK9A 4XBRA 3T8OA 4USFA 5E8UA 4EI4A 3R9HA 4LOOA 5ANJA 3DQWA 3NNXA 4CQEA 3ZEPA 5CANA 3IK3A 2A27A 2FYSA 3NUXA 4YC8A 3ZM4A 3REPA 3BEGA 4BI2A 4F7SA 4AQCA 2XMYA 3U9TA 3TKIA 2KTYA 4FSNA 3SC1A 5BVOA 3GCSA 4ASEA 1RJBA 2J2IB 4YC6A 2PZRA 3I60A 4I4FA 2VD5A 3FLNC 4TY1A 1YW2A 4E7WA 3ZLSA 4JS8A 4YP8A 3MDYA 3VJNA 4D0XA 5HD4A 3H3CA 3MPAA 3R7OA 3MH3A 4QMZA 2CCHA 5FGKA 2GLTA 4RWLA 3V5TA 1REJA 4OT6A 4LFIA 2PY3A 3TZ7A 2LGCA 3QZIA 2PUPA 4DFYA 3LFFA 4NCTC 4C4GA 4TNBA 4GEOA 4BDHA 1S9JA 4AG8A 4EOMA 2B52A 2B55A 2Q0BA 2VWBA 3HEGA 3TW6A 3MFSA 2NRUA 1URWA 5D7AA 4WRSA 2OJGA 3LFAA 3PZHA 4XRLA 5CEKA 3PY1A 3SD0A 1W84A 4NJDA 4WRGA 1PXKA 4IBMA 1Y6AA 4I1ZA 3ZC5A 4OR5A 1E4EB 5CA1F 2XM9A 4D0WA 4FE2A 2ERKA 3KGAA 4RA4A 5FQDC 1ZOHA 3SG9A 1YWVA 4JBOA 3A2CA 4K9YA 4FEXA 4ORKA 3VUMA 5CAOA 4S31A 4YHTA 4FICA 4QP9A 1KWPA 5AM7A 4ALUA 4FBXA 2BTRA 3VS6A 5GONF 3VOTA 2JITA 2YM7A 4IZAA 5TOZA 3RPRA 2F2UA 3H4JA 4ZTLA 5HD7A 4YUQA 3QF9A 3VJOA 2IZRA 5CWZA 4O4LF 4EYJA 4ME6A 4J8NA 2WYOA 1WCCA 1UNLA 1U5RA 1BYGA 2CKQA 2XNEA 1J1BA 2V5QA 2W96B 4L9IA 4JAIA 4TYGA 3ETAA 3WF7A 3VUDA 2CNVA 5FM2A 2JKOA 3AC5A 3FZPA 2WTCA 3AXWA 2G15A 3FKOA 5AX3A 4FNZA 3ZFXA 1FGIA 2G01A 3EL8A 2ZYBA 2J4ZA 1DI8A 4AACA 3ACJA 3Q4TA 5AV3A 4ZJJA 5JK3A 4G34A 4G16A 2W6ZA 3WNZA 1H07A 2BUJA 5LMAA 4R3RA 1M0WA 5DH3A 5CAQA 3LJ0A 4CKRA 4FIIA 1Q8TA 3EQRA 3LJ1A 3LFSA 4FZ7A 4RC4A 2XNBA 3II5A 5M57A 5CNOA 4HGEA 2GS2A 5FEQA 3KMWA 5IQDA 1PK8A 3OY1A 4RVTA 1PXPA 3DNDA 3PG1A 3N9XA 4A9SA 2FPPB 1OMWA 3CTHA 4FIHA 1J1CA 3H0YA 2HY0A 3MPTA 3GCQA 3LFBA 5EYMA 5FP6A 4YJSA 3BHTA 4C36A 4M3QA 3LAUA 2JAMA 2PPQA 3JR1A 1Y8YA 1Z9XA 3PVGA 4RJ5A 5LARA 2VWVA 4CMUA 5K4IA 4DCEA 4EHZA 3UC3A 4EHGA 3BEAA 4IM3A 3RGFA 3UO6A 2V0DA 1YHWA 3W55A 5LVLA 4ZTNA 3TKHA 2ACXA 5HX8A 4GJ2A 3KK9A 2UVYA 3MS9A 3TXOA 2W4JA 3R1QA 4CRLA 3VAPA 3ODYX 4MWHA 4O0SA 3VN9A 4RWIA 4E6QA 1UWHA 3OWPA 2XD4A 4EUUA 3SDJA 4AZWA 4ITHA 2WU6A 4H3QA 4BN1A 4GUEA 4TXCA 4TYIA 2ZDQA 4UN0C 2P0AA 1XH8A 3UQCA 3TG1A 4IB3A 1YDTE 2I40A 3OF0A 4NW5A 5CU3A 3V51A 3NPCA 4H1MA 5IQBA 4BKJA 3BU3A 4XG8A 3F7WA 1LR4A 5DIAA 4JVGA 4D9TA 4FMQA 4KIQA 4MAOA 2QOQA 4CMTA 4RFYA 3HGKA 3C7QA 2W6MA 3E3BX 5I9XA 3ZO2A 5LP6F 4Z7HA 1PXIA 4EGJA 3CXWA 2ITWA 4GKHA 5J5SA 3VUGA 3L9NA 4MD8E 3HV7A 4AX8A 4A4OA 3LCTA 1ZOGA 3GC8A 1GSHA 3A4PA 4O7LA 3PDTA 3AC1A 3MWEA 1R3CA 2C5YA 2FH9A 3NYVA 4HGLA 4JG7A 3D14A 4OGRA 4D58A 4DFNA 5CALA 4GUBA 5ICPA 2I7QA 1MRYA 2WKMA 4FFMA 5CEIA 2HYYA 2C6MA 3QRKA 1H4LA 4HCTA 1WVWA 4WNPA 4D55A 4LMNA 1JBPE 1W82A 3E87A 3EJ1A 3EQHA 5HVYA 1CE8A 4HNFA 1T36A 1DAYA 1H1QA 1JVPP 4FZDB 4ZS4A 2XCLA 3QLFA 3SRVA 3R9DA 2C6EA 3ZTXA 4HVGA 4TZRA 4BCQA 3VMMA 3D94A 4EOIA 2I6LA 5TKDA 1YQJA 2CGWA 2UZVA 4BYIA 3FHIA 1ZY4A 2YAKA 2HCKA 3FMEA 5BVEA 3VBQA 4BIDA 3F6XA 4IC8A 3R7VA 4DFZE 4KWPA 2YISA 4MA0A 3FZTA 3LXNA 4FZAB 3FI2A 4XBUA 2Z7SA 3CR0A 3R1YA 2PVFA 3F2RA 4YO6A 2GSFA 3UZTA 5BVNA 2CDZA 4DH3A 4A9TA 3HBLA 2GHGA 3EN5A 4FUYA 3DKCA 2HY81 4FYNA 5KMLA 1F0QA 3PXQA 2YRXA 1XR1A 2PVKA 3HRBA 2WB8A 3FQSA 3NLBA 4CMOA 5IEXA 1YDSE 3G8DA 1ZARA 3POZA 3MY5A 5DR9A 3A7GA 1HCKA 3F5PA 3N4UA 1GIJA 4U81A 5F20A 1CM8A 3HRCA 3RHXA 4F64A 5J1WA 4MX9A 5HCZA 2IG7A 3QFVA 5E8YA 4AN9A 2WEIA 4IVDA 5BUJA 3HUBA 5T3QA 1T45A 3WI6A 4F9BA 2CPKE 4X6RA 2C6TA 3MPMA 1STCE 4ZLZA 1XH7A 4F6UA 5HV6A 4NUSA 3I0OA 4FT9A 1H24A 3QTQA 5AMNA 4V05A 4O7RA 2J0KA 4TRLA 3V5QA 3F2AA 2BRBA 2C3LA 2JAVA 4FR4A 4B8LA 4I24A 3KC3A 3UPZA 4C7TA 2WEVA 4BTFA 3WO1A 3FC1X 2E9NA 4YJPA 3GEQA 4XMOA 3LCOA 3U9NA 3FDNA 2JDOA 1FVRA 4GRBA 5CSVA 1VYZA 2ERZE 4DH8A 3TQTA 3BELA 4DHFA 3VS3A 2F7EE 3ANRA 4ONAA 4J52A 5JQ8A 4OTFA 4CLJA 4O0UA 3SXSA 2GU8A 3OWJA 5DWRA 4RJ7A 3QTRA 4YNEA 4IANA 4X2KA 4JDKA 3R2YA 3MFUA 2WD1A 3LE6A 4ZJIA 2JFLA 3NUPA 3PTGA 3ZUUA 4BTKA 5L6PA 2HIWA 1FOTA 2PZYA 3IW7A 3S00A 2ITYA 3ZFYA 3K5IA 1MQBA 3BZ3A 4USEA 3R7IA 1H08A 4ZOLF 3ZDIA 4MV3A 2VZ6A 4ACMA 3ZONA 1KUTA 2WTKC 3AOXA 2PUIA 3Q3BA 2JDSA 1XBBA 4IEBA 2J0LA 4PDPA 3QA0A 5K5XA 4JQ8A 2YIWA 2X81A 5A9UA 2CGVA 2VNWA 3HMIA 1M17A 3LLTA 4QPAA 2R4BA 3VHKA 3ZM9A 4CGAA 1V1KA 4X2GA 2BILB 5IQFA 4QT1A 5CB4F 4JJRA 4NIFB 2R3PA 3QKLA 2XNOA 3DOGA 3JY9A 5BUIA 4PQNA 4YPSA 2XA4A 4L46A 5M44A 2GNGA 3VBXA 5H8EA 2R87A 3L9PA 3E5AA 2BFYA 3TV7A 5BNJA 4X2NA 5AV0A 2CMWA 3VW8A 4L8MA 4RVLA 4AF3A 4NM0A 4X2JA 2JIIA 4AA5A 1AGWA 3HMNA 1WBWA 4YO4A 5M4CA 3ETHA 3VWAA 4FTUA 3HP5A 1LP4A 2OIBA 4Y85A 3RNIA 4L44A 4YU2A 5KZ0A 4FKRA 2RFDA 4A9UA 3OY3A 4JBQA 2O63A 3NX8A 3QTUA 3RCJA 3R7UA 3ERKA 4JBPA 3FL4A 3EFKA 5EM8A 3LOKA 3ZXTA 4DFBA 2I0YA 3KULA 3LQ3A 5CSPA 4E73A 3BHUA 2XK3A 1XBCA 3Q4ZA 3UTOA 2QO9A 4EH9A 3P1AA 4Z7GA 5KMMA 3MVJA 4IAZA 1WBVA 5AIRA 2B7AA 3FHRA 3TUBA 4JNWA 2IVSA 3OW3A 4FIFA 2F7XE 3Q4CA 5C9CA 4YLKA 4QMPA 1L3RE 1B6CB 2VTPA 1KV2A 3CE3A 3EZRA 4K0YA 1KE7A 4IJPA 4KD1A 4LOPA 5CAEB 3F69A 2R82A 1DI9A 3G15A 1H1RA 3LZBA 3KK8A 2VTJA 4O21A 3AX6A 5F94A 3FMKA 4R5YA 3I79A 3GGFA 2ITTA 3K5UA 5HBHA 4I50F 3BKBA 1XH6A 1ZRZA 5FRIA 3M2WA 1VJYA 3DXQA 4I6BA 2NNWB 2J5FA 2PE1A 3PUPA 1YI3A 3MIAA 3EH9A 4NT4A 4EK8A 4AE6A 3QUDA 4I6HA 2GQSA 2YWPA 4UYAA 3R5FA 3QQHA 1A06A 4OTIA 4D2SA 3HUCA 1OB3A 3GP0A 3KXGA 4J99A 3G33A 2OJ9A 2HW7A 2UZOA 4IM0A 3P7CA 3EN6A 3CPCA 4KB8A 2FP4B 2W6OA 4QP4A 3K54A 4PRJA 2QO7A 1H28A 1I44A 3VBWA 1UU8A 3FMJA 4FIJA 4EYMA 5A4TA 3GQIA 1WVYA 4EOJA 3MH1A 3QCYA 1YWRA 5KX5F 2YABA 3NVMB 4O38A 4RRVA 5EOLA 2VWUA 4W4YA 4CLIA 1YHSA 4KNBA 5DNRA 4XX0B 3DBCA 5JMSA 2OW3A 3N4TA 4Z16A 4NFNA 3QX4A 3NGAA 3HV6A 2I87A 4DLIA 4F9AA 4QNYA 4U44A 2WOUA 4MXZA 4AXAA 2CKEA 2H8HA 2IW6A 3O8TA 2UZWE 3CEKA 3D7TA 4JDHA 4ANMA 3RUPA 4NM7A 2HK5A 3KRXA 4FKOA 4YR8A 2QC6A 4ACDA 1Y57A 5H80A 2BDWA 2WGJA 4AE9A 5LYJF 1NT2A 5E8TA 1ZYSA 2AUHA 3MA3A 3QRIA 3PVBA 5I0BA 4C4IA 3TACA 1JDEA 4WBNF 3BBWA 4WBOA 3PSCA 2BMCA 2ITQA 1CTPE 4C58A 4WT6A 3F2NA 3C4FA 3LW0A 4BGGA 1ZWSA 2R3KA 4WNKA 1QCFA 5HNBA 3H0ZA 2FUMA 2VTSA 3E62A 3FL5A 4EOSA 3TUDA 5CSXA 1EHIA 1JKSA 2UZLA 2PVMA 1J91A 1Q3WA 5TO8A 1MRUA 3TM0A 2Y9QA 2W1ZA 2YFXA 2UZDA 3ALOA 4C3FA 2B9JA 3WIGA 4MXXA 3ZEWA 4ZMEA 3R9NA 3C5UA 4HJOA 4AW1A 5GHVA 3AC2A 4CNHA 1OIUA 3TI1A 3CP9A 3Q2MA 4IH8A 5JGBA 2C3IB 1E4EA 3SGCA 1W98A 1OIQA 5L6OA 4XHKB 3UVRA 3CY2A 2NO3A 3IW6A 1MP8A 4Y83A 3RAHA 3GIDA 3UNKA 2R7LA 1M2QA 4IQ6A 3OS3A 3M1SA 2OF2A 2R84A 5BPFA 4UEUA 1Y8GA 5F4NA 1G3NA 3UMXA 3ZO3A 1Q8ZA 3OCGA 2V55A 4PY1A 2R7MA 5ETIA 4BB4A 4JIAA 3QAME 4QQTA 4QMUA 3ZHPC 4Z3VA 5EI6A 2WQMA 3RHKA 3ZRKA 4BTMA 3ULIA 4I6FA 4MV8A 4GIIA 4EBWA 4WSYA 5AA9A 4CZTA 1QPDA 2X6EA 4F09A 3PRIA 5HIBA 5IA2A 3EMGA 3LCDA 3DXPA 4NFMA 3OOGA 4F7NA 4U8ZA 3PLAE 4G6NA 3I1AA 4M12A 4E4MA 5LXMA 3MJFA 2W6NA 4HGTA 5H8BA 3BWJA 5HIDA 1PXMA 3PZEA 4O22A 1JKTA 4BDFA 4HR7A 4DG0E 3HX4A 4IC7A 2BR1A 5KZIA 2UV2A 3CC6A 3OD6X 3OOMA 5IQHA 2BZKB 1TQPA 3RINA 4ACGA 5KUPA 3R5HA 3QX2A 4O96A 2A1AB 2BRMA 4G3CA 4OTQA 2BAKA 4I3ZA 4JOAA 2BALA 5FLFA 1FPUA 3EIDA 4O7WA 3OEFX 1YI4A 3A7IA 3QTXA 4L67A 4QTDA 5HU3A 4C5AA 1KOBA 3H9RA 4RIYB 2PZIA 1Z57A 2R85A 4A07A 3ZSIA 4A9YA 5LMBA 4YURA 5IA3A 3TV6A 2DWBA 4G17A 2YDIA 2EUFB 5JRSA 2V7AA 4YJOA 4ZSGA 3R28A 3FY2A 4IX4A 4PL3A 4C34A 4CKIA 4C61A 2NUAB 5IG1A 3R7EA 2R0UA 3RP9A 4FTTA 3DGKA 4E4XA 5EHYA 4A7CA 4QTCA 2PMIA 4ALVA 3D9VA 2ETMA 1JKKA 3T3VA 4B7TA 1YOLA 4QQJA 4FKVA 5EM5A 3QD3A 4FKIA 2OZOA 5HG9A 3TJCA 1XWSA 5EQEA 4ASDA 4U3ZA 4PL4A 2F7ZE 1V0OA 5IEYA 4O4JF 1P2AA 2YZAA 3D5UA 3ZZEA 5L8KA 3KAJA 2C3JA 2HWOA 5EM6A 1YOJA 4MV1A 3EQIA 1A48A 4CD0A 4U79A 3PWDA 3E88A 4IAYA 3AC4A 5L8LA 1TQMA 1R1WA 3HV4A 5FM3A 3SW7A 2ZDUA 3FKNA 5LOVF 2R3OA 3DDPA 3E8NA 1JKLA 4FK6A 3A4OX 3CPBA 1W8CA 5CTPA 2OFVA 5LQFA 4G2FA 2OK1A 5K9IA 1J7IA 4NYEA 5CI7A 1KE8A 4EBVA 3F5XA 4V0GB 3EQGA 4BCMA 2X2LA 3OXZA 3BU6A 1M6VA 4EGQA 2BCJA 4EOQA 1Z2NX 4FIGA 5EW8A 4MV6A 4BR3A 4F6SA 5M09A 2Q0NA 4P4CA 5L2IA 1CQJB 4C02A 4R1VA 5E8WA 5A3XA 4ZI7F 3GI3A 2YL2A 2W1GA 1OPLA 2GCDA 2CN5A 3QXPA 3TN8A 4BTJA 3PPJA 1YHVA 2XRUA 4DGNA 4P2KA 4S2ZA 1YXTA 2HENA 3FE3A 4C62A 5A6OA 5GINE 1WBPA 5EYDA 3NR9A 1PF8A 2QOFA 2ONLA 4HNIA 3CSVA 4LQMA 4EC9A 5K3YA 3MV5A 3FPMA 1IA9A 4I94A 4F63A 5IA5A 2Y6OA 4AP7A 1JPAA 2EWAA 1E9HA 3CS9A 5DRBA 4OT5A 3R01A 4XP2A 2HWPA 4GVAA 5E8ZA 3WF9A 5JVLA 2XIKA 4JAJA 5K5NA 1ATPE 5LWNA 3T9IA 1XHAA 3W32A 2RG6A 2X8EA 5C8YF 1E1VA 3QALE 4PV0A 2VO0A 2R3RA 3EQPA 1U54A 4FSQA 4M97A 4NTTA 3QGWA 4U5JA 2CSNA 1M0TA 3BBTB 1FVVA 1IOVA 2EB3A 2QCSA 4FV4A 2XBAA 3RPSA 4YBJA 4XYMB 2E9UA 1UV5A 3TZMA 1E1XA 3VW6A 2PMLX 3LXLA 4U42A 4E6CA 1U59A 2F9GA 1KJQA 4CFWA 3VBVA 5IA0A 5KHWA 4EWQA 5JQGF 3QC4A 4U41A 5HU9A 2I1MA 1OL5A 3ROYA 2UW9A 4HYIA 4DGOA 3P23A 3K2LA 2O5KA 1NVQA 3HP2A 4O0RA 4ZEGA 5IQIA 4AN3A 1RQQA 3FSFA 2QODA 3LMGA 2ITPA 2BZIB 4KIPA 3SV0A 3TNIA 5H3QA 3R71A 3PY0A 4ZZNA 2Z60A 3UVPA 4YJNA 5CI6A 4NKSA 5JVDF 5AWMA 5DPVA 3P08A 3MGYA 5M55A 5AAEA 3AGMA 3KRRA 2QU5A 4L52A 4O2ZA 3R8ZA 4BBMA 4I0TA 1PMNA 2ZM1A 4ZJVA 3DK6A 4D4SA 2BHHA 4GU6A 4EOPA 4YJ2F 3BLQA 4O27B 4TPTA 5B2MA 2QO2A 3GUBA 3SVVA 4EH2A 4FZFB 3QQFA 5JH7F 4JIKA 5DVRA 3GLKA 5LA6F 1LEZA 4O0XA 4XV2A 3ORNA 1W96A 4NH1A 5J7HA 4GL9A 4JQ7A 2WAJA 4U6RA 1XKKA 3IG7A 4GH2A 3TTJA 3ZCLA 1Y91A 2QKRA 5IQEA 3F3ZA 2R3MA 2Y0AA 4L45A 4LRMA 4YHFA 3VNTA 2QOCA 3ZOSA 4RIWA 3VF8A 3GQLA 5L2SA 5AP1A 2BVAA 3GT8A 5AM6A 2FPIB 1VEBA 4GG5A 2IVVA 5D1JA 5AP4A 3QFFA 3KREA 3Q60A 1KC7A 4LYNA 3OCTA 5A14A 4D4VA 3BGPA 3HAMA 1B6SA 4DA5A 3GC9A 2X9FA 2WU7A 2JGZA 3PVWA 4V01A 2PTKA 1WZYA 3F5UA 3V8SA 4BCFA 4CXAA 5HLWA 5JFXA 5AUUA 5JGAA 3HECA 4DYMA 4UWBA 4QMOA 2XBJA 3L9LA 4LI5A 4PMTA 5EDRA 3SXFA 2EXMA 1F3MC 4MWIA 4BDKA 3N4VA 4CFVA 2Y7JA 3NWWA 2C0TA 3GB2A 1GY3A 4UZDA 3L1SA 4ANQA 3MBLA 3S95A 2W7XA 3IO7A 4O2BF 1J7LA 1LEWA 3E5NA 2XKDA 2O64A 2XKFA 4H58A 3RWQA 3TEIA 4K6ZA 3H9OA 3W2QA 4EH8A 1JAMA 3KN5A 3TT0A 4X21A 3NDMA 4H05A 3UP2A 4M7IA 5AAFA 3MVMA 4C3RA 3MSSA 4JT3A 5FXSA 5AP5A 3E8EA 3KCKA 4AFJA 4EK3A 2VQDA 4NM3A 4BCJA 3EOCA 2YEXA 3GOKA 3HYHA 1FMKA 5CLPA 1UKIA 2JKQA 5AP3A 3R9OA 3D7TB 1W83A 4DT8A 3OTVA 5IDNA 5AA8A 3EN4A 3UG2A 4KSQA 2VX0A 3BYVA 3DDQA 3RTPA 3WE4A 3KRLA 2GNIA 3F88A 3QD0A 3RK9A 2QR7A 4E5AX 4FKQA 1OPKA 2XCKA 4W4VA 2C1AA 3HRFA 3UZPA 4ERWA 2Z7LA 4M67A 4AFEA 3UNZA 5AP2A 3MFTA 1APME 3OWLA 3O51A 4FTCA 1QPJA 4IAFA 5JZNA 3IGGA 5C1PA 2GQRA 4Y8DA 1OITA 2XIRA 4DC2A 1I7NA 4FEWA 3WBLA 3DKOA 1KJJA 4FK3A 4DFUA 3DCVA 4FSRA 3HLLA 3I7BA 4YZDA 3MH0A 2QOLA 1GNGA 2R3LA 4PNKA 5EOBA 4CFMA 3ZLWA 2OZAB 3FC2A 3BQCA 2OG8A 2Z2WA 3K5HA 3O2MA 4NWMA 4CV8A 3TDVA 5HICA 3E63A 3MVHA 2PE0A 3BHHA 3D2KA 3AC3A 3ROCA 1BXRA 3AC8A 3LWBA 3COKA 2OBJA 2B1PA 2WTKB 3I7CA 4D1XA 3V8WA 1SVGA 1ZOEA 5T6KA 3FQEA 3RK7A 1XO2B 3DLSA 4D28A 3FAAA 3ODZX 4UXLA 4CTBA 1BI8A 4ANLA 3R8PA 4ARKA 5J2UF 4GG7A 1YXVA 4H39A 5AX9A 4X3FC 3RFCA 4R3PA 2P2HA 2PVRA 3PYYA 1REKA 5AUZA 1MQ4A 2WMWA 3FUPA 2Y4IC 3LMIA 3OC1A 3SXRA 4C33A 3PA5A 2EVAA 3TNWA 4BDBA 4HW7A 2A0CX 3NYNA 3ZUTA 4AWIA 3CJFA 4Q9ZA 4I23A 1DV1A 4YJRA 2VWYA 4BF2A 2XK4A 3RM6A 1VR2A 4BIBA 4U3YA 4YSJA 3QCQA 1VYWA 3W2CA 4FOCA 4E4LA 5LXTF 5BPHA 3BU5A 4F70A 3BE2A 2WIHA 3IONA 2VTHA 4FTLA 3LQ8A 2UZUE 4MD7E 3F3WA 1PYXA 1YKRA 2XH5A 3G5DA 3UODA 3MWDA 3HMMA 3U6HA 5D7VA 4NW6A 3UQGA 1QPEA 4AAAA 4TWNA 2SCUB 3Q6UA 4E1ZA 4I93A 4AZSA 3GVUA 4XCUA 3PWYA 4GS6A 4MHAA 1BLXA 4J95A 3F66A 4LUDA 4XS2A 1GIHA 4MV9A 3AMAA 5EI8A 1NXKA 3PP0A 2JIUA 3UYTA 2JKKA 3VVHA 4Q2AA 3PXRA 4MF1A 3CKWA 4XEYA 5E1SA 4KBAA 4BBEA 4BCHA 3PSBA 5HE0A 2WO6A 4DIMA 3UBDA 1IA8A 3KF7A 4FC0A 4IAKA 3EN9A 4J1RA 1W0XC 3LIJA 1NVRA 4FL3A 4GK2A 3NNUA 4XG2A 5E90A 4RPVA 5M56A 2YIXA 5BPYA 2DLNA 4JL9A 3W2RA 3KEXA 5DT3A 3V6SA 4P7EA 2NU6B 3EZVA 1YI6A 3O8UA 1WBOA 4J8MA 3WILA 2JIVA 2PZPA 5M06A 4WUAA 2ZV7A 1YVJA 4EUTA 5AUVA 2W5HA 3I0QA 1ZXEA 2A19B 4WD5A 2ITNA 5FEDA 2XJ2A 4O2PA 4B4LA 3OUKA 3EQBA 4TKSA 1XH4A 1JKJB 3UIBA 3OFMA 4NTSA 2YS6A 3N6RA 5CS6A 3G51A 4PDSA 3DAJA 1PHKA 2QD9A 5AIKA 5L8JA 3D15A 2CCIA 4R77A 3VQHA 4WKQA 3OEZA 3GCPA 4EKKA 4TWOA 3WZJA 3FEGA 3KALA 3R04A 3TDWA 2YJRA 4JR3A 5T68A 4MH7A 4YSMA 3CD3A 5CEMA 4QP7A 4PNIA 5A4EA 3EKNA 2HAKA 5CVFA 2VO7A 5KO1A 2UZBA 4FFOA 1GZOA 1I09A 3V5JA 4IX3A 3V5LA 4BIEA 5FG8A 2VTLA 4RLKA 5J9YA 5EW3A 5KMKA 2IZSA 4G3FA 2Z7QA 4KABA 1Z2PX 1OKVA 5HQ0A 4RZQA 2W99B 2ZMDA 4UYNA 1UNHA 3R0TA 3F9NA 2LAVA 3EQFA 2VGOA 3O71A 4I0RA 4FSTA 4YHJA 1PY5A 1U54B 2ZDTA 3Q32A 4FL2A 3CQUA 3KY2A 4U0IA 4WBBB 2YRWA 2IWIA 4I4TF 3KXMA 4FTIA 3PSDA 2VTOA 4YLLA 1B6RA 4YZBA 1H0VA 1U46A 3BI6A 5A6NA 5HORA 3OBGA 5FTQA 4U40A 3HVCA 4KKEA 4ZSLA 2OKRA 3EB0A 4ZTSA 3WO0A 1H1PA 4DH1A 2VN9A 2C5OA 4TUYF 3C9WA 2JD5A 4EORA 4H3BA 3K3JA 2OH0E 5JFSA 5C1OA 4DH7A 1AD5A 3CIKA 4NCTA 3R8UA 4LMUA 4F4PA 4FG9A 4QMTA 3HNGA 4BRXA 3R1SA 4XV1A 3MYGA 4APPA 4RIYA 4L01A 1SVEA 4BCGA 5HG7A 1P5EA 4DTKA 4NK9A 4PP7A 4KRDA 4YGAA 4QYYA 1P4FA 4AW2A 4M14A 4E8AA 2QONA 4FKWA 2GQGA 5AP7A 4BZDA 1OL1A 2PU8A 4YNOA 4FKLA 4QMMA 2ZMCA 4YZ9A 3AG9A 5CAUA 2WTJA 4DEEA 2ZAZA 3GFEA 3LM5A 4HPTE 3FZRA 3WOWA 4U45A 5LCJA 5HX6A 4CFXA 3MY0A 3FLSA 4MQ2A 4BDDA 3QRJA 3QYWA 3A99A 4AZVA 2UW6A 3Q53A 4GMYA 3PXKA 5I9YA 3C5IA 2OJIA 3R6XA 4AW5A 3ZU7A 5AEPA 2V59A 1JNKA 4MXCA 3WF8A 4RIWB 2GMXA 4L7SA 4BVUA 2Z8CA 5HI2A 3POOA 5ETAA 1SVHA 4QP6A 4QMLA 1VBGA 3BHVA 5HE3A 4D2RA 3A7FA 3JPVA 2UW5A 4IMYA 1ZYDA 4O81A 2WMRA 3QZFA 4F65A 4GYIA 3ZLXA 1LUFA 4XG3A 2WMUA
chains in the Genus database with same CATH superfamily
2W9FB 5HBJA 3RV3A 5EDQA 2FVDA 4FUXA 5C27A 4V0GA 3CSWA 3LVPA 3DTWA 2HDKA 3Q2JA 3G6GA 2COGA 3Q9YA 4IZOA 2AC5A 4B9DA 3W0QA 5AV2A 1ERKA 2H6DA 4YJQA 3T9TA 3O7LB 3JRXA 4ENYA 2QNJA 2DQ7X 4QO9A 5EHLA 4CKCA 2BZHB 5IQAA 3ZFMA 3DB6A 3V4ZA 3D5VA 4L53A 5BWUA 2BROA 4CCBA 4BDEA 3IECA 3QHWA 4N6YA 4TYHB 2CNQA 2XK6A 4W4WA 4XG6A 3OZ6A 5KBQA 3NMUF 4E6AA 4K6NA 4LUEA 3V6RA 4BDJA 5E8XA 3OT8A 4IZ7A 1ST4A 3E64A 5BYYA 1KJ8A 5EI2A 2ZM4A 3EKKA 5JKGA 3QZHA 3ENMA 2J90A 4NZOA 3UQFA 4C4EA 3GC7A 4B99A 3A60A 3QYZA 2W1CA 3V01A 3LQ5A 2Q83A 3K3IA 4IDVA 4ACCA 5A4LA 5I5ZA 3QD4A 1W7HA 4JRVA 3BAAA 4FNWA 4FV1A 4CFUA 4O7YA 1I1LA 3KYHC 5C8MA 2XZSA 4M84A 1WBSA 5C1QB 5CA0F 5GJGA 4CE5A 4A4XA 4FT5A 2BRGA 2J0IA 1QPCA 4JDJA 2UZEA 3DFAA 2JDVA 5EQPA 3K5VA 5KE0A 2R7BA 3ALNA 4RJ3A 2V5AA 4DAWA 2HZIA 4IZYA 4IWOA 4L3PA 2W05A 3DPKA 4M0ZA 4UWCA 5DYJA 3W1GA 3PJ2A 4JX3A 2W1IA 4XG9A 5CEQA 3PA4A 4LGHA 4O0YA 5B2LA 4MTAA 5IUIA 3VIDA 4A06A 2ETKA 5LVOA 3R5XA 2VO6A 2ZV9A 4FX3A 3OG7A 4XNEA 4J7BA 2WZJA 3PN1A 3BG5A 3R7YA 4M9UA 3D7ZA 4GK4A 3ID6C 2W1FA 3FMMA 2HW6A 4NKAA 3V5PA 5LMKC 3U8WA 5I9ZA 1JOWB 4BDIA 3NBYB 4EC8A 1Z2OX 5CAVA 4Y5HA 2ZV8A 4QMQA 4OTHA 3S24A 4BCPA 2UVXA 4O6EA 4RBLA 3LKMA 2YDKA 1CKPA 4GT3A 1OL2A 4ZS0A 5FTOA 3DU8A 3TZ8A 4UY9A 1ZLTA 3CQWA 5ACBC 3GU7A 1M14A 3FLQA 2YZMA 3UNJA 2HHFA 4FYOA 2C0OA 4YAKB 4O0VA 2CJMA 3DK3A 4TL0A 4USDA 4WNOA 5EG3A 4FSZA 4OUCA 4IFGA 3E8DA 5I5XA 4FTRA 3G6HA 5CX9A 4WA9A 3U55A 1J3HA 4HGSA 3UOKA 5IMXA 2IJMA 3PFQA 5JN2A 5BYAA 4HNTA 5FUTA 2R2PA 3RPOA 2HGSA 4XH6A 4YTFA 1ZAOA 5TR6A 4TWPA 4PZ8A 3AT4A 4CZUA 3CJGA 5DGZA 1YXXA 4LL0A 1BKXA 5G1XA 3T9FA 2O8YA 4XG7A 3NYXA 4M0YA 5AADA 4YTCA 3CLYA 4P5ZA 4C4HA 5I5YA 1O6LA 2RFSA 4I5CA 4BBFA 2R3IA 4IHPA 1Q62A 1MRVA 1TQIA 3U4WA 3FY0A 1Q8UA 4I6LA 2XEYA 5DT0A 5DR2A 2YIYA 4CRSA 1ZYLA 1OECA 5EM7A 2XB7A 4C4FA 3TCPA 5C01A 4G9RA 4R6VA 2XNNA 5HZNA 2WQNA 2X0SA 4EK6A 5M08A 1OZ1A 3OUNB 4EHEA 2VTMA 4ZLYA 2YA9A 3W2PA 1W93A 3UIXA 3JYAA 4R7HA 1Q99A 3HB9A 2UVZA 3FPQA 1SZMA 4D4RA 3W16A 4BC6A 2BDFA 2GHMA 2VTQA 3C0HA 5HNIX 1I7LA 5I5VA 2VWIA 2RF9A 2GNFA 2OF4A 2YJSA 4FEVA 4AOJA 4QYEA 4ASXA 4CVAA 3L2PA 3ZO4A 4JQEA 5C03A 3ANQA 4APCA 1BUHA 2P55A 3GU5A 2F57A 2VRXA 3ACKA 2WTWA 1A0GA 2WTVA 4FV9A 3A8XA 2G2HA 3T3UA 5KNJA 5LVPA 4PDYA 4Q4CA 3WZKA 4ZIMA 3ZRLA 1GLVA 1K9AA 4IWDA 4DAAA 2PSQA 3D83A 4FT7A 4YAJB 3WIKA 5ITAA 5IQCA 2JBOA 2Z7RA 4FKSA 4QYGA 4GSBA 4CEGA 3NIEA 2R7NA 4O4IF 3DKFA 3RM7A 3R22A 4F0GA 2B4SB 1YWNA 3QQJA 4Y95A 3GJXB 1R39A 1XK5A 3NRMA 3VC4A 3ATTA 1C3OA 4BCOA 4FSUA 2IO6A 3MVLA 1UU3A 4ZQIA 4C3PA 3T9AA 2OZAA 3DV3A 4R3CA 2SRCA 1QL6A 4X2FA 4LG4A 5E7RA 3RALA 4O6LA 4O7ZA 5A54A 2AYPA 4JXFA 2G1TA 3WZEA 4DFLA 4AT3A 4DHIB 3PIYA 4C38A 4EQMA 5IF1A 3CD8A 1IAHA 2A2AA 4RGJA 2QQ7A 4FV6A 3PJ1A 3PG3A 1CKMA 1I1MA 3TWJA 4K18A 1PMEA 2YCRA 1BI7A 4RQVA 4E5WA 5CF4A 4TVIA 3O17A 3Q04A 5CVGA 2WMAA 3C13A 2QHNA 5HG8A 4JX7A 4EH3A 2BTSA 2ZV2A 3RI1A 3OW4A 4IVBA 4KA3A 3WYYA 4E93A 4HNUA 3BV3A 2WQEA 4DEDA 2B9HA 3CGOA 3NUUA 2HXLA 4J97A 3F3VA 4RZWA 2ZB0A 3UC4A 3ZSGA 4I4EA 2EIYA 3AD4A 4C5CA 2C5NA 4EFBA 2CKOA 3ORIA 3UZOA 1FVIA 3Q9WA 1PX2A 1WFCA 4MUQA 2NU7B 4XLVA 2OLSA 4ZSJA 1ZAUA 3IPHA 3BQRA 3CQEA 4PTCA 3WZDA 5DRDA 3SGIA 4RX8A 3PFYA 5BVDA 3NUAA 3NW6A 2GFCA 4DEHA 5ETFA 4QMYA 3O0GA 1AUXA 4I41A 1EUCB 1JLLB 3TIGA 3OWKA 2C47A 3ENHA 2PUNA 4WOVA 1UC8A 1B39A 3SA0A 3ZH8A 2XIXA 5CF8A 4N0SA 2WMTA 3UP7A 3S0OA 2BDJA 3QQKA 3E7OA 5CE8A 4EH6A 2YW2A 5A4CA 4MQ1A 2I0VA 4XX9A 1DV2A 2R3FA 3MB7A 3OT3A 2YWVA 3GFWA 5HE2A 4O7SA 3F61A 4OTWA 3BYUA 3R30A 1O6YA 5EDPA 3W5OA 3L8VA 5GIOE 1MUOA 3R8VA 2WMQA 3DZQA 5TF9A 4R78A 4AXEA 4EOKA 4FG8A 3FZOA 4QTBA 4MNFA 5IA1A 2ITXA 2XS0A 3P0MA 2DYLA 3BLHA 2WHBA 4ZAUA 4JLCA 4AU8A 2PVLA 3EWHA 4X3FB 4C4JA 3PRFA 4C2WA 1KE9A 1IRKA 4HZSA 5DT4A 4Q9SA 1PMUA 4FTMA 2XK7A 3R1NA 3FXZA 1R0EA 2E2BA 2DABA 4GIHA 2XIYA 4PTGA 3VBYA 4XJ0A 3VS5A 4FTOA 4D5KA 4X3JA 4YTIA 2XNGA 5IH6A 3I6WA 4FV0A 1O9UA 3NVKI 4FV5A 3GBZA 2BZJA 2YYAA 5D9HA 4KKGA 5AUWA 2IW8A 3THBA 4OTGA 3NEWA 2QKWB 3COHA 4GT5A 4NSTA 5CXZA 1XQZA 2WPAA 1AQ1A 4IAIA 4O86A 4BCIA 4UALA 1YOMA 3IW8A 3KVWA 3KFAA 3PE2A 4K8AA 2VPQA 3U87A 5FPOA 1OBGA 1UWJA 2X7FA 3DT1A 4HCUA 3ZS5A 3GB8B 4C59A 4EOLA 1JQHA 3BHYA 2JEDA 2X8IA 4HPUE 1H25A 1OUKA 3QGYA 4O2AF 5L2TA 2X2KA 2O65A 3TYKA 2OJFE 4BCNA 3BX5A 2W71A 4WG5A 2VR1A 5KS8A 3NAXA 1OUYA 4FTNA 4PUZA 3N8DA 5BYLA 3ZSHA 5D8DA 3KXHA 4FKPA 4FTKA 5HCXA 3PA3A 2W1DA 1F5QA 3GCVA 4ITJA 2DS1A 4FIEA 4F9WA 3QU0A 3RV4A 4NL0A 2R3QA 3JVSA 4FL1A 4JG6A 3DKGA 3G9NA 4E20A 2XARA 4QYHA 3KA0A 4WHZA 5J9ZA 5CAPA 2BFXA 5IU2A 4MEDA 1P14A 3DK7A 4AW0A 1GSAA 4IE9A 3Q96A 3OUUA 1ZYJA 3HKOA 4G5JA 4YZMA 5IDPA 4CMFA 2JFMA 2WELA 3IOPA 3W0PA 5IA4A 2CZGA 5I60A 4CKJA 4XOYA 3NCGA 5D11A 4OTDA 4C5BA 4MXOA 4RFZA 2V22A 4CSVA 1KEEA 4MXAA 4UCVA 2CLXA 3W2SA 4B6LA 2I0HA 2OU7A 2QOKA 3SE7A 4F7JA 3KKVA 2OIQA 3Q2OA 4RQKA 1EYZA 4YZCA 2W6PA 3JVRA 1L8TA 5ANDA 5JT2A 3P78A 1KV1A 2H34A 3W0NA 4ANBA 2W5BA 5CEOA 3PLSA 2XYUA 5BUJA 1G8JA 4R5SA 3R73A 3AQVA 4ZMFA 3C4CA 3TW7A 4O84A 3MN3A 2ZOQA 3PY3A 4DF3A 4MV4A 3NBZB 2R3JA 3QWJA 4U7ZA 3VS2A 4KBKA 3JS2A 2IVTA 1SNUA 4IB0A 1M7NA 4TN6A 3QKKA 2CKPA 1ND4A 2DUVA 3AT2A 4C35A 3UO5A 4WNMA 5FTGA 2VNYA 2R7IA 5DEWA 3HAVA 1M7QA 2FA2A 4GFOA 1V0BA 4IWYA 3R63A 4G1WA 3I5NA 5JZJA 4LGGA 2GFSA 2V7OA 3FXWA 4RJ4A 4C37A 1GGOA 1Q8YA 4I20A 4BICA 1UKHA 4IB1A 4M8TA 3QHRA 3L8XA 4YTHA 4MA5A 3H9FA 1OGYA 2R3NA 4L6QA 5E4HA 2R3HA 4GFGA 1GJOA 2B9FA 2BRNA 2OIDA 3OHTA 5D1OA 5E1EA 3LP8A 5AFVA 2YITA 3QUPA 2BAJA 4YJUA 4R1YA 4W4XA 2P3GX 3MTFA 4I6QA 5HLPA 2BKZA 3DFCB 3O7LD 4FSWA 1OIRA 4QMVA 4I5MA 4MBLA 3VUIA 4BDAA 4RFMA 5GNKA 3WARA 5JQWA 4OLIA 4YZNA 4EQCA 5EFQA 2CGUA 2IN6A 5M51A 2YIQA 4G3DA 3E3PA 3A62A 3U6IA 3C4EA 4QQCA 1DAWA 2HELA 4GYGA 4IIRA 3UGCA 1KJ9A 4PZ6A 4HQ6A 5EH0A 4S34A 4TYHA 4U43A 4YBKA 4FU0A 2QF7A 2HZ4A 2COIA 5HGIA 3MA6A 4JBVA 5ANEA 1UU9A 3TZ9A 3UIMA 2YM4A 3W10A 2P0CA 4PTEA 4CG9A 1H1WA 2YACA 3KN6A 4OTRA 2YCFA 3QKMA 3BL9A 4IB5A 3U4UA 1PKGA 3IDBA 2F2CB 2IVUA 1RDQE 3AGLA 2VO3A 4EJNA 3JSNA 4WO5A 2X7GA 1KOAA 4QP8A 5EHOA 5HESA 1CQIB 3L9MA 4WG3A 4DG3E 4DGGA 4EH4A 4HVHA 2YN8A 2ZVAA 3UOJA 1T46A 3R8LA 3TNHA 4YJTA 4ZY5A 3Q1KA 4O0TA 1XH5A 2CN8A 3JXWA 4DEIA 1IAJA 3QC9A 5DE2A 2AEGA 2ZDHA 3LXKA 4XUFA 1EH4A 4FG7A 3ZDUA 3SOCA 2J7TA 5KKRC 3RK5A 5KX8A 2GNJA 4F6WA 3PXZA 5I5UA 1FBNA 3P7BA 3DJ7A 3R00A 3QRTA 5CT0A 5J87A 1UA2A 5IZFA 4MBIA 4CHIA 5TT7A 3O23A 5IQGA 4MV7A 2R64A 3Q5IA 2PL0A 4XP0A 4S33A 4AN2A 4CG8A 3P5KA 4K2RA 3QBNA 4MAMA 3VS0A 3B2WA 3OBJA 4QMXA 3VBTA 1A0IA 5C4KA 5AV4A 3WE8A 2HOGA 4QP1A 4MNEB 1XMMA 4RC3A 3VULA 4UCUA 4TV9F 4IM2A 4FVRA 4L00A 5DR6A 4IZ5A 3WYXA 4E26A 3AMYA 3DJ6A 3SQQA 1UNGA 3QWKA 2OH4A 5EQYA 2HZ0A 2ZM3A 2WQBA 2BIYA 3ZYAA 1IASA 1ST0A 4FSMA 1Q3DA 3AT3A 3QUEA 4RX5A 5CU2A 2E9OA 4I22A 1CKIA 2O0UA 4ZY4A 4LRJA 1RE8A 3SHEA 2F4JA 4Y5QA 3ZC6A 3PVUA 2QU6A 4D1ZA 5CXHA 3HDMA 3LMHA 3Q9XA 3CGFA 1JDBB 5H2UA 4I0SA 5D12A 4RT7A 3D4QA 5ETCA 3R2BA 1JWHA 5M4IA 4TV8F 3LFCA 4BHNA 3CBLA 4AXFA 1KBLA 2YM6A 2C4GA 3HMOA 3KXNA 2C0IA 4QP3A 4RSSA 4RA5A 2ZDGA 4MVFA 3EFJA 4FSYA 1Y6BA 5BWVA 1X8BA 3FMHA 5K2MA 2YDJA 4MKCA 4QMWA 3MY1A 2EB2A 5BVWA 4O7TA 2NPQA 4GU9A 4GV1A 4ASZA 3PP1A 5ANKA 2R3GA 2VU3A 1JLUE 1OM1A 3KF4A 1XDNA 4TYJA 2KULA 3QTIA 2ITOA 1UU7A 4AGWA 3GU4A 4FFLA 3W18A 4F1MA 4FVPA 1GZNA 3GU8A 3F7ZA 3R23A 3A61A 3QZGA 5HBRB 1YRPA 2ITUA 3FI8A 4IWPA 4F9YA 5DI1A 5HG5A 3NCZA 4I5PA 2FSOX 2ZB1A 3E92A 3MH2A 4Y8VB 4FFPA 5KBRA 5B2KA 1SM2A 2X5RA 5BWWA 4G6OA 2CGXA 4HCVA 2UW4A 4GJ3A 4B8MA 3ORKA 3TJDA 4N70A 4F0IA 2C3KA 4V04A 3S2PA 3JRWA 4TW9A 4M69B 4R7BA 2C6DA 3R21A 4IADA 2HJWA 3C4XA 3IGOA 3Q4UA 3C51A 4XZ3B 2QR8A 3HMPA 4N6ZA 4DEBA 4EG0A 4UX9A 3WF6A 2ITVA 3VS7A 4FKGA 3V04A 4EK5A 4C0TA 3ZRMA 4NZNA 2YHVA 3CKXA 4KINA 2XVDA 4QDEA 5CQWA 3P86A 3ORLA 2EJ2A 3NS9A 2REIA 3KMUA 3D2IA 1I2KA 2YM5A 1FQ1B 3DY7A 3HL7A 4UWYA 1KE6A 3ATSA 5HE1A 4AT5A 5J9LA 3VS4A 5M07A 4X7QA 3DBFA 3OMVA 5DFPA 2Q7DA 3U0GA 3DBEA 1OIYA 4FTAA 2XYNA 4XLIA 2RFNA 4QQ5A 4ZTRA 3GXLA 5CU6A 5J8IA 3KXXA 2ETRA 5LCKA 3NUNA 2FSLX 2P33A 4UV0A 4U80A 3L8SA 4KKHA 1QMZA 2OXYA 4HVSA 4ZHQF 1OI9A 2QVSE 3PPKA 2GPWA 3AW8A 2OXXA 3UOLA 4ZXTA 2PMOX 2W1EA 5ANIA 3ZUVA 1P16A 3Q52A 2QLQA 2WMBA 2EU9A 4BDCA 3T9BA 3F5GA 3QL8A 2GPHA 4D9UA 2OLCA 2WXVA 2VWWA 2V62A 5A46A 5HIEA 4E4TA 3BRBA 3FBVA 2JBPA 3BLRA 4Y72A 1K2PA 3PIXA 3W2OA 1S68A 1CMKE 3Q5ZA 3U54A 4FV3A 2WTIA 4FOBA 4M15A 4F99A 2I0EA 3SAYA 2WNTA 4FI1A 4G31A 5EZYF 3C0GA 3AD6A 3BPRA 2GS7A 3GENA 3KVXA 2J6MA 4ENXA 1ZMUA 3GU6A 4PWNA 1GIIA 3ETJA 4FFRA 4JXUA 2FB9A 2AC3A 2PZ5A 3ORZA 3MW1A 4KSPA 4IFCA 1P8LA 2I80A 4ZZOA 2VX1A 4NM5A 4KAOA 4EEQA 2UUEA 3DTCA 5CVHA 2C5XA 3FLYA 2PYWA 3W8QA 2PBZA 1RW8A 4AZEA 5I9VA 3B8RA 4ALWA 5FXQA 2XUUA 1PW2A 1EZ1A 1BMKA 3BYMA 4G3EA 3R9RA 4UBAA 2XCHA 5HEZA 3DXNA 4M68A 4PMSA 3DQXA 2OGVA 4I55F 4O82A 4AUAA 2CLQA 3BGZA 4L43A 2W06A 5GJFA 3VRZA 5JFWA 3PJ8A 3SLSA 1GOLA 5CYIA 2BIKB 3MFRA 1Q24A 2R9SA 3MJ1A 5I47A 2PVPA 3RNYA 1BL6A 4JDIA 5CSHA 4IX5A 3ET7A 4CT1A 3TUCA 5HBEA 4ZTQA 5J95A 1XH9A 2C00A 4IVCA 5CF6A 2WMVA 2FGIA 1NA7A 4FVQA 3TMOA 2FSTX 4X0MA 2OWBA 4AZTA 5FPRA 1WBTA 3FJQE 3U6JA 4DE4A 3NUSA 4J98A 4RWKA 4FV8A 4OW8A 1ZMVA 5JSMA 4IACA 1OKWA 2JLDA 3MTLA 1LPUA 4IX6A 4DDIA 5HO8A 2QG5A 4EFEA 4RIXB 5KMIA 5J2TF 4PMPA 3N51A 3NAYA 2PVYA 4QMNA 3V5WA 2XKEA 2FO0A 2VTIA 1CKJA 2BKKA 4RG0A 4BCKA 3UO4A 5IPJA 1J7UA 4FGBA 4X3FA 4J96A 3LPBA 4C2VA 1BL7A 4XYFA 5BVKA 3WZUA 2HIXA 5D1OB 3S1HA 3KAKA 4OBQA 5BYZA 3S3IA 3OXTA 2C30A 4F1TA 1O6KA 4L3JA 3TIIA 4KBCA 4IDTA 4YLJA 2YZGA 3BA8A 4CFNA 4UB7A 1WAKA 3RPVA 3W8LA 3FQHA 4DBXA 4DITA 5CNNA 3JY0A 3V8TA 3FSKA 3EFWA 5FXRA 4UUGA 3BGQA 3G0EA 1Q97A 1ZY5A 5LVMA 4DGLC 4GCJA 5CASA 3EQDA 3ZLYA 3OVVA 4JG8A 1KE5A 3OP5A 1K3AA 1GZ8A 4FV7A 1YDRE 3BWFA 3VPBA 2W17A 3HV5A 4GK3A 2X1NA 4DN5A 4E5BA 3SX9A 4GVJA 3UDTA 4ANSA 2R86A 1DS5A 4X6QC 2EXCX 3NW7A 5I4NA 3TINA 1NW1A 2YZLA 2OJJA 2J0JA 3KXZA 4ZSAA 2XAOA 4ZTHA 3QWUA 2PUUA 5AUXA 3DS6A 1R78A 2X0GA 2G9XA 3HDNA 4BHZA 5AP6A 4LV8A 5ANGA 4Y46A 3HA8A 3IKAA 3BYSA 2DIKA 4WG4A 3NIZA 3EYHA 4RVMA 5DBXA 1WMKA 1U5QA 4NU1A 4KUJA 5HVKA 2OO8X 4RJ6A 2IPXA 4P5QA 4CCUA 2X9EA 2Y8OA 4E6DA 3FZ1A 2QHMA 2R5TA 3OTUA 3JUHA 4DEGA 5C4LA 2QOBA 1JSTA 3DLZA 3JZFA 4DH5A 1PMVA 3LFEA 2W1HA 3QA8A 4FKUA 5FBOA 4E4NA 4PDOA 2QB5A 4Q4DA 5KKNB 2UW8A 2A1HA 3RVGA 4WUNA 4IIJF 4LV5A 4NZWB 1DM2A 3W33A 2OICA 4UCTA 3B2TA 3QCSA 4HYUA 2ITZA 2X8DA 5KMOA 2ODTX 5D41A 1SMHA 4DBNA 1V0PA 3C1XA 5EKNA 2O2UA 4ZY6A 3TY5A 5BMSA 3WWHA 2XRWA 3QTWA 3P7AA 4RLLA 1ZMWA 4FT3A 3SOAA 4AOTA 4AA4A 2RG5A 4DINA 5KMJA 4UFZA 2B9IA 4XV3A 4LDTA 5EKOA 4R7IA 3P9JA 5HO7A 1G8SA 2CHLA 3CY3A 4GFMA 5B0XA 5AUYA 4EH7A 3I5ZA 3PIZA 1JSVA 3LJ2A 4O7VA 1JSUA 4L42A 4BI0A 5F1ZA 2UW3A 3FXXA 3TV4A 5DISC 4KS7A 2H96A 5C8NA 3VO3A 2W5AA 5FDPA 2XF0A 4FKJA 2VGPA 4D5HA 2GPSA 2YIRA 1GAGA 2PVNA 2C6LA 3UFXB 3NZ0A 4MYGA 5C26A 4H3PA 3JZIA 2X6DA 2H9VA 4FT0A 2QI8A 2RL5A 5IYZF 3VUKA 3HA6A 3TY9A 2XJ1A 3BYOA 2VTAA 1XJDA 3O8PA 4HN2A 4AGUA 3U9CA 4L3LA 3A7JA 5C8KA 2DZDA 4FODA 5DHJA 4QTEA 3UMWA 2IP4A 4IHJF 2RFEA 5DMXA 2GHLA 4LRKA 2XNPA 3DNEA 3TNQB 2J5EA 2JC6A 1ZZ2A 1M2PA 1Q4LA 2XNMA 4LOQA 2C1BA 3VHEA 4JRNA 3P4KA 5AV1A 3TIZA 1ULZA 3DZOA 5LVNA 4HVIA 3EFLA 2HXQA 3D5WA 4G3GA 2G2FA 4XYLB 4DGMA 5K3WA 2Z02A 4TWCA 4II5A 5HVJA 3D5XA 3FI3A 4AGDA 1I1KA 1VKZA 2NU8B 3EQCA 1P4OA 1GSOA 2HG8A 1B38A 3UDBA 3H30A 4YJVA 3ORRA 5IH5A 2UZTA 1PRYA 2WFYA 4QP2A 2G2IA 1EKFA 3FV8A 2X4ZA 4ID7A 4TYEA 1FGKA 4BY9E 3DF7A 3SKCA 3JSLA 5JRQA 5DA3A 3PFFA 5E92A 3DBQA 4EKLA 4J53A 5BVFA 3BCEA 2OSCA 2PWLA 3KMMA 3PJ3A 4HYHA 4LM5A 3ZZWA 5IUHA 4O4HF 4Q5EA 4FNXA 2UW0A 5EYKA 3FLZA 3QTSA 4I5HA 4EK4A 5DEYA 5BQ0A 4DCAA 2C5VA 3NNWA 4ZOGA 1H27A 3RPYA 3C50A 5FEEA 2GTMA 3FMLA 4DFXE 2A4LA 4G5PA 3ORTA 3FLWA 4XOZA 1XBAA 4IW0A 4CT2A 1WVXA 3IDCA 3KRJA 5CZIA 2ONLC 3QLGA 1M52A 2BPMA 4BDGA 4DEAA 5KCVA 3RMFA 4EOOA 2GDOA 4F08A 3DAKA 3UZRA 2B0QA 2XEZA 3ORMA 1UVRA 3TKUA 3UG1A 2RGPA 2XK8A 1WR2A 3RKBA 5CEPA 4DLKA 2BRHA 4A4LA 3I6UA 3SG8A 5BWXA 1M2RA 2PE2A 4K11A 4UXQA 1A9UA 1OKYA 2GNHA 5L2WA 3DAAA 1CSNA 2RKUA 3W0MA 2CFMA 4MNEA 2YM3A 5FP5A 2XP2A 3KRWA 1DIKA 2IW9A 3TTIA 2WQOA 4QOXA 3UDSA 4DG2E 3D0EA 5LWMA 1FINA 2B54A 1R0PA 3ORXA 5BMVF 3EHAA 4CV9A 4ZLOA 1TKIA 4FTJA 4XRJA 3COIA 3FMNA 3IQ7A 4ACHA 3OROA 2BHEA 3C0IA 1SNXA 4U9AA 1Q5KA 2UW7A 4XG4A 3Q9ZA 5FBNC 3TL8A 3E7VA 2ZFYA 3OXIA 4QNAA 4G6LA 5E91A 4RX9A 2WMXA 3LM0A 3QTZA 2J51A 5HTCA 3K3PA 4ERKA 5FR9A 3OCBA 3VQUA 1FMOE 4ZZMA