2CO1A

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (f17a mutant)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
b'DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
total genus 26
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2co1A00
5D55A 2CO7A 2CNZA 2CO6A 2CO1A 2CO3A 2CO4A 3UIZA 4OR1A 2FVNA 3UIYA 2CO2A 4PHXA 2IXQA 2AXWA 2CNYA
chains in the Genus database with same CATH superfamily
3BGAA 4P2RB 1WYJA 4PCTA 5TH2A 1KCRH 3TF4A 3HI1A 1J18A 3HVNA 4ZPTA 2NZ1A 4LSVL 2ATKB 2X9ZA 1MHPL 3QBTB 1AR1B 1MVUA 4PGDA 4QIRA 3WFBH 1P4UA 4AYMC 3PWVB 5TDOB 3VFSA 4J27A 3STBA 3ZTNL 4RA0C 1M57B 3FYIB 3OR7B 4R96A 3ZKMC 4AX3A 3BP6A 1FVCB 3WI9A 1M1XB 4OGXL 4UV4H 5D93C 3RDTD 1YEIL 5JR1L 1LO2H 3PJSB 1U95A 3LQAL 4MWFA 2EDBA 3BIBX 1MJJA 3FT1A 4NQSA 3QCUL 1NCWH 1CFMA 3U0WH 3P77B 1IE5A 2CKBA 5TD4A 2J4WH 5JW4M 3HG0A 3WNOA 2Z3FA 1IIKA 1CK0L 1D7BA 4AG4L 3MFFB 1PG7H 1VEMA 2BWDA 5CN1A 3APCA 3IPFA 2BIOA 3AXHA 1YNLL 3K91A 3QARA 5C2BL 3C2AL 3K4ZA 3U36B 4XVSH 4R7XA 5FECB 4OTXL 4HEPG 3MACL 4HULB 2G4EA 1QUNB 2NT0A 3W11C 3Q2LA 5C07E 3UAEA 3H56A 1XH1A 3QJTB 4HMDA 4Z8FL 5E9DD 3ETTA 4XMKL 5HJGA 4ANVA 3KPOA 3KL0A 5I8OL 2F7IA 4LB8A 4XPAL 1MREL 2BVQA 2DYPD 2X4OA 3P2TA 5DVKA 5BPPA 2UZPA 3LPGA 3RHWK 1NMBH 3KPQA 2ZUSA 5I1LA 2MNJB 3U0TA 3UACA 1IJNA 1GYVA 1LMIA 4I0KA 3B3IB 1X5KA 4TLKA 3MI6A 5AAWC 1Q72H 3N50A 1F90L 2HT3D 5T3ZD 5EEZA 3QQ4A 1A8ZA 3MOBH 3OWEA 1XIWD 3WCYA 4LEBA 2PP8A 3IFLL 4PWJA 2NY6C 4JE4B 2N7AA 4LHQB 3FRPA 2EVGA 4X6DA 3ARXA 4O4YH 2A6KB 4LCCB 4TVPH 1LP9F 3SO3B 1M56B 3V79C 3FQRB 3S34H 4Y4HD 6TAAA 1JDDA 3BUQA 3C75A 5EG6C 2DIJA 3Q5OA 4M43L 3T6XA 3MMEA 1TYJA 4ONHB 4OZIA 1RZKC 4M5YH 4PJHE 1OARL 2G9HB 2NLJA 4AXWA 2CGZA 4LSVH 4NO0A 4NC1C 3O41A 1BD2B 3Q6GL 3ZHLA 3OKEB 5D1QB 3C8HA 1U93A 3IGFA 3OG4B 3B6SB 1NMAL 4PJDA 3MV9B 4ZNEE 2VLME 3BP5B 4UQBA 1T22B 5JMRA 1BEXA 1A2YA 2DY2A 2NOYA 3IJHA 5JR1H 5E2WL 1X9QA 2GSIB 3SKOA 2CO4A 3HC3L 4X0KA 3GJFH 3LKNA 2JJSC 3QJQB 1RJLB 3SPHA 1BQUA 3L9EA 1TTCA 3QCUH 3ZZSA 1FH5L 5D5MB 1URIA 4ABUA 1YEKH 2VDQB 4MX7B 2JMRA 2JB5L 1CYGA 4PUBH 3IF1B 4CMMA 4KC3B 4JJ5B 5DS2A 3ES6B 4PLKD 1CK0H 3GHBH 4KK6D 1OPGH 5DDHB 1HWWA 3V8OA 4AG4H 3VRJB 1LO5A 2YQBA 4QJ3B 4V2CB 3NIDB 3C2AH 5F9JB 3ESVF 5IHLB 4WGWB 1PAMA 4HDIA 2UWEE 4OTXH 3DMMA 1TTFA 1U33A 5EN2A 4B7LA 4Q6KA 3OJDA 5DC9B 1MFCL 2DIAA 3GIZH 3MBEA 4KKLD 3FQXB 4XMKH 5CZVH 1R4XA 2ZKXA 5F89B 3VD7A 4P3WA 4F3FB 5I8OH 3QYNA 4HWUA 4IK6A 1MREH 4NQDB 1OK8A 1UJ3A 4PY8J 2OMTA 4E9LA 3KVDD 1DBKH 3QIUC 5C0BE 1RFDL 2CNYA 3DVIA 1B4LA 1WITA 1CDIA 3OGCB 4ZUUA 3KS0H 3TP4A 1YO4A 1DBBH 3V95A 4BA8A 3KJ4C 3K6DA 4R5VA 2YAQA 1OGAE 1P1ZB 1J5OL 3VU1A 4YXLL 4J28A 4W4OC 3CVBA 1EJFA 4KROB 4XCNA 2OSLB 2KDYA 3C9NA 3V6ZA 3KYAA 2FX9L 3NJXA 4ZUSA 4UTAH 1EGJL 3X2QB 4Z5RA 4HZLA 4PR5A 5FKAA 2B7DT 4I9XA 2DMCA 5IB3B 1MLCB 4MQXD 5EN3A 3TBCA 5HI4D 4RESB 4ELME 4N25A 2NCEA 4O02H 3SKUD 3QIWB 5BVJB 3OGOE 1FQ9C 5C0EA 3RUGE 4R83A 1UWXH 5FYJH 2FZ3B 4YSRA 5IROA 2WVUA 3UYPA 4WENB 1ORSA 1IEAA 1B88A 2K1MA 3RBSA 1PFCA 2D3NA 2EDHA 2ZX8A 4NEHB 5KBPA 2VERA 3N41F 4YH6A 3T71A 4G6FB 3VSQA 1P2CB 4H2AA 3MLVL 4M48L 3P11L 4RNRA 4AUYA 4QYOB 3KZ8A 2Z31D 5C07A 4BH7B 2AABL 4F37F 2EDJA 1NMAH 4OQTL 5JOFB 1FAKT 1Q9WB 2GUYA 5FW7A 2EDNA 3U46A 1BZ8A 4E41B 3N6YA 3I3BA 5IK3B 4AV4A 1E5CA 3HE7C 2FJUB 3L95B 4AW4A 2PXYB 3KXFB 4AT6A 1YVLA 2NY1C 3BHBB 3KPMA 5EV7A 3PJNA 3KPRD 1T5WB 4DFHA 1CLYH 3HHSA 4EJ1C 3ZYIA 3EO0A 4DUWA 4GKZB 2ZXBA 3RVUD 2ZOKB 2QT6A 4JZOB 5C70A 2G2RA 4QRRB 2X05A 3FBKA 4CA4A 3L4VA 3GTTA 2WCGA 1U6AL 2Z7UA 1KCKA 1P7HL 1QFWL 1L7IH 3VQMA 3GMOB 3HG1E 3S88H 2VR7A 4PYHA 4Z23A 5I2IB 2EDXA 1FDLL 1INQB 1W91A 3M1CA 1FZOA 5KVGE 5LGJA 3CDCA 2OMVA 2HCZX 4UNUA 1P7QD 2AJYL 4CUCA 2B77A 5CZXD 4KXZH 4PJHA 3ALWA 1I85C 3PGDA 4RGND 4ZFZB 3IKCA 5KS9F 5E1QA 3HR6A 5C6TL 1I75A 1HHIB 1ZVSA 4RGOL 1PIGA 3JSSA 4G7VL 4Y2OA 4LIQE 1JPFA 2WPGA 4LDCA 1JMXA 1YNTB 3KW7A 1LK2B 4Z76B 4ZNEA 3VXMB 4B7IA 2F61A 3FSZA 2EH8H 4KAQL 5DK3A 3AJ7A 5DYOB 4YXLH 4LLVA 2EE3A 2QVIA 3BLBA 2K6YA 3V9CA 2XUWA 4OT1L 4HH8A 4D9QD 5A2CA 5T1LA 1QD0A 3HW7A 1DN0B 2IBZY 4P4RB 3ROLB 2ADGA 1ACZA 2XTJD 1FCCA 2WMPB 4N22A 3D18A 4HMCA 3MLUL 4FZ8L 4ENED 3KDPB 1EPFA 1IC4L 1ZLSL 5ADPL 2PN5A 5KSUA 1NGWA 3FB5A 3RPKA 3MN8A 4IEFA 1TTAA 1OT4A 5FYKE 4ZMNA 4N8VG 4HH9A 1TTUA 3BO8A 3E8VA 4J3OH 5AW0B 3G9VA 1U2HA 2UWEA 5HD8D 4M48H 2WQWA 5F93C 2YGNA 1SY6L 4Y7OC 4HUUA 3KLSA 3HPJB 4FI8A 2L7EA 5DMYA 3BQUC 4LF3A 1I3GH 1NEUA 2AS5M 1JNNL 2HTKD 2VISB 2ZCZA 5EOTB 5D1ZA 2IV9A 5IBLC 1HIMH 4I87A 1R5WA 4L37B 2AJZB 2DBJA 2GSGB 3A0OA 1G5AA 4WSJA 5GGVY 2AMUA 4N2IA 2N56A 5C0BA 3LEYL 2K78A 2EO9A 1A6PA 1PFOA 5AENA 3TN0D 2W9LA 3RJDA 4DHLA 3C6SB 1OGAA 2VO8A 1SHXA 2GSMB 1MVFA 5HPMB 4GO9A 5DJZB 4AGQA 2P26A 3S3DB 2UZYB 2Y5TA 4BZ2H 5KJ7E 2Y7QA 1NCUA 1PD1A 5F1IA 2N0MA 2Y6TE 3O2DA 1I7TB 4J2QA 4JKPH 2XBTA 1KIUA 1SMOA 1YY9D 1QFWH 4UOJA 3QDME 1KNOA 4V1DD 1WFJA 4ELMA 3AS2A 4NPJA 4E42B 2ZP8A 3ZYJA 5IIEB 1BYOA 1FDLH 3NSJA 4HHAB 3RUGA 4MJHA 2CGRL 3D8MA 3ILDA 4JFOA 2CK2A 1J8HE 2R0LH 3HI5L 3QXDA 1GC1C 2F6AA 3RGVC 1MCJA 2CPCA 3D12B 2QPSA 1G6VK 3CN1A 3GXIA 4WY7H 3CFCH 1C1EL 1U8HB 1VACB 2EDWA 3HC4H 3SDDB 1TKWB 5J1AB 3WNNA 1I1AB 2FJHB 2GPZA 1FIEA 1IBYA 1J0ZA 1NZRA 4PMEA 1RUPL 1G6RL 2O30A 3O3UN 4W93A 3VVVA 4F7MA 5I0WA 1JUFB 2CRIA 2GIYA 4IHBA 4KAQH 1HOCB 1QSFB 4JFTA 1JZIA 1PVHA 3HEIB 2DQDL 3LZFH 4OU3A 2K9FB 1WVZA 4OT1H 4NHCL 3S2CA 3UX9B 5IHUL 5AW6B 3UTZA 2FB4H 4RRPG 1VRSA 3LPFA 1HS6A 2ZOUA 3D5OF 1BQHA 2P8MA 4HEME 4FZ8H 5CEXA 5HHME 3BZFB 5JPMA 1F4YH 2FUTA 4TQEH 3UTOA 1ZLSH 4HIEB 4GT0A 4QHKJ 3BH9A 4L5FL 2QPDB 4ELKA 1NH6A 1ES0A 1KCUL 4ZQKA 4MBRA 4Z7NB 4PJFE 4K15A 1ODUA 3ZMNA 3TBWA 4I18C 3H42L 1RZJC 2O1AA 4S1RH 3LSOA 4X6FB 4G9DA 4L1SA 2XXMB 5E4IA 1HEZB 3KWWB 1U91A 1USQA 4G5ZL 2K70A 2YC1B 2XQYA 1T83A 3N43B 1N9PA 2BHZA 1WV7T 4QRPD 4PRBB 5AW3B 4DTGL 3MODL 4K3EH 3IT8D 4KXCA 3ZKXB 3QQ3B 4XT1C 4UDTA 1DLHA 1KOAA 3O2WL 1J1XL 5FO7A 1E8WA 1NOAA 5I5IA 4ZMLA 1EDQA 2VSKB 3ECBA 5FWQA 3EGSB 1WTGT 3TFKD 4LVOC 2VXQH 1H3PL 4ODXB 3GSRA 1GZQA 2HA1A 3DOSB 2DH3A 1G9HA 3VSVA 3TV8A 4APXA 3A23A 5FR3A 1TLKA 1ZK9A 4Y19E 4NN5B 2CPUA 3WN5B 4AZ8A 2ZOTA 3DGGB 2NY0B 3HUJB 1R3HB 2X1WL 5D1QE 3NFNA 4KVNL 4ZOAA 1NKRA 4L3AA 1JWUA 4BXSV 3BYTA 4X6CB 5GSRA 3V0FA 4B6ZA 5E08L 3FF8A 2Y36H 1KACB 1UKSA 3CTTA 5B1BB 4N2KA 1FNGA 3GO1L 1YECL 3BH4A 3HZMB 4P04A 3SDYH 1A3ZA 1S3KH 2F54D 2VDNB 5JYLA 2CKBL 3F8UB 5D5ME 4YE4H 1G6RH 1ORQB 5TQ2L 1MH5B 3WHXA 2F18A 3DO7A 4UB0H 1PZ5A 2XRAL 1OTTD 1B0GA 5JLZA 3FW6A 2BDNL 1KF9B 3WU1A 1HQ4A 3RPIA 4M1CD 2ZSWA 4W9LC 5GS1A 4IU2B 4U1NA 5I6XB 5IG7A 4P5KA 3ZIYA 2GCYB 3NIDE 1PZAA 3OLGA 4L8CB 3KJ6L 2BIPA 3I6GA 3B8SA 3KYOA 2PCFB 2DQHL 4PWKA 4XVTH 4Y4FA 3GC3A 2OYPA 3FTGA 1IGCH 1C5DA 2JXMA 5AALA 2HLEB 2MKLC 1WISA 2DDQL 2H3NA 3ZZLA 2ICEA 2YRBA 3VFMA 2OPCA 4S1QH 4U6HB 4X9YA 3CD4A 2RD0A 1E4XL 3ZU8A 1KCUH 4LLUA 1OVZA 3LRSA 1PBYA 2DQGL 2ZT9C 1PAZA 2ROXA 3ATAA 4MNGB 4FA8A 3QDMA 3NK4A 1XH2A 2IG2L 2WTPA 4KVCH 1YAIA 4WEEA 1OD9A 1U21A 1P7KB 4HCRA 1EHLL 2ZKWA 3WKPA 43CAB 3FOLB 3ZE0E 1M6OB 4G5ZH 4N2BA 5HGHA 3P2BA 1J8HA 2D0GA 2F5BL 3F00A 3QWOB 4OGQC 1M1XA 2WLHA 3RWJA 3CU1A 5KBNC 2MKWA 3TOPA 3PJSA 2JB6B 4JY6B 4B3EA 2SEBB 3EJSA 4JPVL 1RUAL 3H2WA 2WSDA 2ZYIA 3D51A 4ZUTA 3N1GC 1TENA 5L2JA 1J1XH 2W0LA 1FN4A 5BS0D 2JIXA 1XSOA 3R0MA 1SXSA 5J0BA 2IAMC 3UROR 1NANI 4X6BB 1KV3A 2ZX6A 1VESA 1HAWA 4J4PA 1H3PH 4GRLD 1P53A 3IMTA 4DT2A 2EE9A 5IB1B 1AYRA 1MHHB 5I71B 1NC4B 5F7EH 1NTDA 4XPHL 5FW6A 3DJSA 1QLFA 1HZHH 1T89A 1WSST 2EDMA 4DGYL 1SN2A 2BP8B 1YLBB 4HEMA 3DDGA 1J9SA 3MLRL 3TZVC 4ZTOH 3UTTD 1QUNA 4KVNH 5I66A 4NZTL 2VDRH 1CN4A 4WI4A 5E8NB 5E08H 2FEEI 5CLZA 1TZHB 5GRUL 4I0PD 3J8F7 3QUZB 5ID1A 4E41E 4J6IA 2FBJL 2A9DA 3FZUD 3MROA 5CJOL 1MN4A 5IB4A 1JWMB 1UKQA 3WJJC 1W80A 4JCMA 5IQ9B 4GSDL 4AIOA 2ZUXA 2RIKA 5TPWL 2R0KL 1S7RB 3MC0A 4L4JA 3VWJC 4JZJC 5CU5A 5C2UB 2X4TA 4JANA 5KBLA 1XFPA 3LX9A 1NCDH 3VM5A 1J8KA 3OAYK 5FK9B 2XRAH 3GXDA 4HWBA 1UZ8B 2NR6D 1HHKA 3E80A 3ULVL 5TE6H 3FFCE 3GM8A 1KT2A 4ZYKA 4ZG1A 5I1EH 4KRPD 5GGQL 3P3SA 5J11C 5JPNA 5DI8B 2X6MA 2GJRA 5LG6A 2X5PA 2A0LD 4GW5B 3FQRA 5EZLA 1DQML 3VI4E 3A6OA 4LFHG 3U2JA 2R9HC 3FU5A 1E4XH 1QTYT 2WBXA 4WJ5B 2APSA 2LFEA 4Y19A 3WJMB 1IBZA 2DQGH 3GSNA 5HHOB 5HYSB 3OKEA 4GG8A 5D1QA 3QJXA 4PLJC 5F0LB 5FKPA 3DJRA 4GRWE 3VWKD 3SIKA 1JXFA 2JKJA 4MB4A 2YSTA 1EHLH 4UAOC 3MNDA 2D8KA 3MV9A 2V9RA 3BP5A 3HN5A 1BVNT 3SDCC 5ITFA 5HHVL 1I8IA 5DUML 2FIKB 4GQRA 2F5BH 3BD4A 3PFUA 3QNFA 4PB0L 3U0PB 2NY5C 3HZ3A 4FEIA 5FGRA 3F7YB 2AHIA 2WSKA 1AP2B 3MLPA 1KV7A 4FX5A 3P54A 5D5MA 4QTHA 1L0YA 4EN3D 3MV8B 2VLKB 2HJFA 4MKMA 1Z9SB 3TNNA 5IZ7A 4R7LA 1NCGA 3ECQA 4EDXB 2GYSA 2XIDA 3DXAB 1MFBH 3ES6A 2YOCA 3E3QC 5DD5L 4Z0BL 3VRJA 4QHNB 5EC2A 5LNEA 3O0RL 1U8QA 3SGDI 3O3DB 4GUOA 1ZMYA 4WTQA 2MCPL 3MLRH 1RLWA 3K4AA 4O58L 2CIIB 2BOBA 3IMVA 5FUCC 3KYNA 4NZTH 4HCGA 4WWKC 1G1CA 3OF6A 5GRUH 2FWLB 4MCZB 1KBPA 1YPZB 3VXRD 1R5IA 4CNIA 1U41A 1NIFA 2ZQKA 5A6MA 1T0NA 3ETSA 3LRKA 1SDAB 4LEOA 4I88A 2V4LA 4LCWD 5CJOH 2A1WH 2OSXA 2YKKA 4GSDH 3D2UD 3WGVB 4YNYA 5CD5C 4KKCD 4KNSA 2R0KH 1UA7A 4L9DA 1OM9A 3OGCA 4P46B 2VM3A 1HHJA 3Q8AA 5F9OL 3SGKA 1I3RB 5AZ2H 3BGFB 4XN5A 4LAJH 4UQ2B 1S8DA 4IRZA 4JDVA 3FQUA 4AK2A 4JDZA 4DGUA 3D0VA 3TBSA 3CDZB 1PW3A 1F56A 1YMME 3FH5A 1UURA 4L4VB 2YA1A 5AW9B 3EJRA 2CDGB 4FKHA 2AZAA 3H1ZA 1G1KA 1KWGA 4HXBH 3ZYZA 2XN9D 2EKSB 4OIIL 4JFFB 3QHZH 2DIBA 2EILB 4XXWC 1DQMH 1A6AA 5DEFA 2FLMA 4A2HA 1KTLA 1AGBB 2WVVB 3B1UA 3EYFA 4F8QA 1ZHLB 5ETUA 1YYMH 2PYEE 2VOTA 5ICZA 4N0FB 4JFWA 4M8VA 1JIBA 4N6QA 2PO6B 4APQC 5HYIA 4UZGA 3VJ6B 1GGIL 1E6OL 3GXTA 1JZ4A 3BT2L 4BFEA 1HU8A 3LKPA 3NSXA 1MCIA 4QXUL 3STZA 1HYSD 4G1EA 2CR3A 5H37H 5JOFA 1SDDA 2IO5A 1EHXA 2P52A 4RAVB 4A55A 1VFAA 2AEIT 3D4CA 3W3BA 3O6FC 4E41A 1TEGA 2WBJB 3P9WB 1HK6A 4CW1B 4PB0H 5GJSL 2VRAA 1E4KA 4P59L 5AKSA 3T4YA 1L5GB 2H1XA 1T1WB 4F37K 4JFHE 2AXFB 1JZ8A 1K8IB 4FQJL 5FDYA 2MCMA 1T5WA 3QAZB 1J9CT 1GYAA 4GKZA 3SBWC 4U1MA 2ZOKA 5F7MC 5I1DB 3FFCA 3IFPA 5E1IA 4Z0BH 4AENB 4QF1B 3RVVC 1VADA 1NWOA 4WO4B 4Z7NE 1NUDA 4GG6E 3RX9A 4JE0A 1LMKA 2FQFA 2Y22A 3B9VA 3IPBA 1QWHA 4O58H 1JPGB 5I2IA 4HV8A 1INQA 5T5NG 3VI4A 5GS2H 3W9EB 5T33L 2HLAB 4X50A 5JMOC 4GQQA 1RHFA 5D9SB 1DL7H 5KTEH 4GUPB 3CPLA 3AS1A 2XWXA 2PW2B 2F9BT 2NXZD 3LQZA 3IAGC 1G1OA 1SYSA 3HC0B 3O45B 2CU9A 2NPLX 1SOQA 3H9SE 5ERWB 1JK9A 1YNTA 2EIJB 2OSYA 5F9OH 2H1PH 5HDOA 2XTSA 3C60C 1FZJA 4PLOB 2EUXA 6CGTA 1J86A 3Q2WA 1JK8B 4J3OG 5I0XA 3IJ8A 3O2DL 4P2OA 1J1PL 4KKLC 3OPZL 2B8OT 3QZNA 1ZHBB 5DK0B 2VW4A 4Z77A 2V33A 2TRYA 2Y24A 3L4UA 5D6CA 3DURB 5EO0A 3X1FA 3F05A 3NABL 3T1FB 1J87A 4E0RB 1CTOA 5G5DA 4A2DA 1WCBB 2CLVB 5FPIA 2YXWA 4AW7A 4OGAD 1D5IL 2H3XC 4KKQA 4DSYA 2WB7A 4E9QA 1BMGA 2FGZA 3ALXA 2HFFA 2W80C 1FYTD 1QW8A 1C5BH 2ICWA 3F12B 1XB8A 4WLCA 1GGIH 3UC0L 5F3BB 3BT2H 5I75B 1JS4A 4LKXB 5KSAD 4HUXA 2K7PA 2LGNA 5E2VL 2K8MA 3MGAA 3LRGA 3U9PL 4CC1A 2NW2A 1H3GA 4QXUH 3PPEA 4CBPA 3RFZB 4HK0A 2XIBA 1ODAA 1WIUA 1AS6A 4FFVC 2J43A 2Z35B 4U05A 3S5YA 1JSYA 2O6CA 3KL3A 1IGYB 5ICXB 4LU5L 1H3TA 2WWOA 4P2QD 3GMQA 4P59H 3DX8B 5AKVA 3SPVA 5A2FA 2AITA 3T3ME 2EYTA 3LN5B 2WGXA 3W0WD 1H3UA 25C8L 4Y16B 4PS3A 1AGCB 1MQKL 2XBZA 3B1TA 4JFDD 3C6SA 5IEHB 2JV6A 2LV4A 3HPLB 5HPMA 2Y2WA 4M62L 4RSVA 5AL8A 3K74B 2Q7YA 2XG4A 1N70A 3AG3B 1E7UA 3L1OH 3T3PE 4BDVB 2YPLB 1RSYA 3D9AL 4ZUWA 3RVTC 3TWYA 1N4XH 3F83A 1I8AA 5HDBB 4XNBA 4G42B 4PJEF 4DAGH 2IWKA 1OF2A 5KVGL 2M8XA 4M5TA 3SKJL 1EEUA 2EC9U 4X5QA 3ATEA 3UZVB 4N9OB 4I4WB 2G5BA 1DQQA 2UXVA 3OC8A 4MMXC 3SQOL 2XPZA 4NN6B 3ULUE 2PYEA 5F7YC 4JM2D 5H35A 3QUKB 1OZTG 2B59B 5LWYL 1VACA 3FO2B 2C8NA 3L7EA 4LIQL 5J1AA 4U1JA 3WIHH 1I1AA 2FJHA 4YUEL 1Z5LA 3BAYA 1UWFA 3TCXA 3PHOA 3ZIMA 4DPBX 2A99A 4TULH 1MOEA 1FGVL 5TK2A 4L8SB 5CR8A 2NZIA 4QJ4B 1WO2A 4NKOB 4YZFF 4OUUB 3IDYC 4LL4A 4TXVB 4MB1A 3HJEA 2WYIA 4AIXA 3B2VL 3GMRA 1J1PH 1N0LA 1G9NC 3PWJA 1XH3A 3H9HB 5E6IA 3OPZH 4M8QB 4AIZB 1OQXA 2BNQB 3NDYE 4KKNA 5DUPL 4GRMB 5CZXC 3SE8H 3NJKA 3DIDA 5FYLL 3WY3A 1E9QA 3NDZE 1JPTH 5ALBL 5FYKL 4HIEA 4FQPA 1UXLA 2I07B 4JFQB 1D5IH 2X4RA 4K8RH 4XCCL 3N41B 1Y18A 4HG4K 3WTTA 5IOKA 4GG6A 3FH7A 3IDGA 5IF0A 1YQVH 5DVPA 3K1KC 5I74C 3UC0H 3UTPE 5C86A 3IDJB 3GPEA 4X6FA 5E2VH 3US1A 5CN3A 2WTRA 4W9JC 2YPVA 3TVMC 3U9PH 5FUOH 1HEZA 3QHFH 5IVXE 3KWWA 5D96B 1WJ3A 5CHNB 3F65A 3I6LD 3FRUA 1W0VA 2XTJC 3N44B 3NIFF 3Q9PA 4FJ6A 2ZG2A 3KAAA 4K7PY 4Y1AB 4JO4H 4MB5A 2VKXA 2VM9A 4LP8A 5DHYB 3H0TB 3GSWB 4LASL 5EU6B 5JOPE 4OFYA 5DMKA 2RFXB 5IB5B 5JW3H 3PF2A 3H9SA 5TGBB 4GMTH 4F15B 25C8H 3CHSA 1Q0XH 4PY7B 4Y2DD 5HDRA 3F01A 3B7YA 5I6NA 2KLTA 4FNRA 5F88B 3A21A 4WIQA 5C0GB 1WZKA 5IJKA 1JZDC 3LCYA 1B4TA 2IH3B 3CHPA 1CWVA 1AIZA 3F7KA 5CEYB 5JA8B 3B7UX 5EF1A 4GAYB 3D9AH 4JL1A 3WN5A 4U3SB 3W5NA 1BVLA 4HCRL 5ESVB 3EADA 1E40A 3MRGB 3SKJH 4S1SL 1ETJA 1QYGH 3ZHNA 2XBDA 4WVRA 3R19A 4Q2ZB 5EEWA 5CP7A 3ETBF 4I2XE 3OKLA 3CSPA 4YVUA 5JHLA 2HWZH 3EIFA 1UD2A 4MAYB 4O5LL 2OULB 2E7HA 3MRLB 3BC9A 1ZT7A 3DMMD 3K8KA 4FULA 3NUKA 3VUAA 5EBLB 2EINB 5ICUA 5LWYH 2R0ZL 3FBQA 3NEEA 1BSIA 4XWGH 2CO1A 5K39A 4PJ9B 4QRBA 3FT9A 1NLBL 3WKQA 5JA9A 2EYSA 3IU3B 2ZYHA 5CSBA 3UDWC 5J12B 3ARFC 2AQ2A 3CBJB 4DVBB 5KEZA 3OXSB 2FSEB 3UPRB 1JFQH 1QNIA 3MRRB 1YY9C 3RB7A 3MOAH 3D08A 2IGLA 5HYFA 4JGNA 2QZ5A 1I1FB 4DJMA 1IM3B 5EEVA 2W60A 2PCFA 5DUPH 1I8MB 3RA7H 2Y2YA 4WU5B 3P30L 3HZVB 5FFLA 1UCBH 4JREB 5FYLH 5GGVH 4MDIB 5FYKH 1IM9D 4ZMTA 1HESA 1F02I 2N1TE 5ESQB 5CAYB 2PWGA 1BM3H 2GEQA 2XKNA 5CN2A 5IWLC 4XCCH 3M8OH 1PSKH 1F18A 1QFHA 3L5HA 2DQ6A 3AUVA 4POUB 4H26B 4KK5C 4M6MH 4B60A 3CFMA 4P23C 2P5EE 1HT6A 5CUSL 2OJEB 1T0MA 3BDYL 3DX7A 3PWLA 5EUOF 2ZKHL 5IROD 1PQZB 4HWBL 4NKIH 4ODBD 2OR9L 2BVEA 2CBMA 4S0SD 4BFIA 1YDPA 3KDMB 2Z1PA 1FFPB 4BFJA 2BSEA 2VMJA 3FAWA 4ISVA 5AZEL 1KPVB 2EXSA 3I74A 4PS7A 4XOAA 2H2SD 4LASH 3CAFA 5B8CC 4E2OA 2JK5B 1KCVH 1KN2L 4JR9L 5AB1A 3V0GA 4EIGB 3S35L 2FX7H 3LQAC 4K7FA 5ICYA 3PV6A 3VSUA 1TZ8A 3Q9QA 2ZONA 1GY1A 2AK1H 1BAGA 3V0AC 3JV6A 2VL5B 5FCSH 4JFPA 1NC4A 4N2GA 4A63A 5D93B 4YLCA 2VLJB 3GSNL 2TSBA 4A6YB 1K85A 3L3JA 1VIWA 1J5CA 4KRLB 1C8PA 2A9BA 1WAAF 2ZKMX 5C0JB 2EVJA 4BIKA 2DEYX 1KFGA 1T4KB 2R56H 4HWEH 1FL6A 4YVNA 2FQDA 1A4KB 3KBEA 5FYKU 2AMGA 3NACL 4UM9A 4P4KA 1SOSA 3ARPA 4PTUA 2YA2A 2BINA 2XN2A 4N5EC 5FA4B 3VFRB 3IGLA 3WS3A 2A77L 4F58H 1VEOA 4JJOA 5DZAA 3PXHA 4PGEB 3DUHA 4HG4J 2HMID 1S7RA 2VDQL 4EPSA 1ASPA 1QTPA 1MPAL 3MLWH 1GSMA 5IVXA 2CHZA 2BCKB 4MA3B 4DKTA 2VAAB 4UUJA 2R4SL 2G75A 3O9WA 3N1FC 2BERA 4LSUL 3IXAB 3VFWA 1BJMA 1JZEA 2BVUA 3CLFL 4ZO8A 4LGSB 3ESPA 5DI8A 4AUJA 4HK3J 5FCUH 2FR4B 3P30H 1EO7A 3K6OA 3V52H 1T5XB 4G6AD 1P5UC 1O7DE 3D0LA 3FUFA 3U9WA 1E27B 2CD0A 2JJWA 4NXKA 4KOBA 2JF1A 3FRPG 5F7UA 3X1NA 5I1KL 1Y6KR 2ITDA 3ARGB 1ZK5A 1BWWA 1I3UA 2NY6B 4PREA 3V4LA 1OTTC 2YN3A 4QTIL 3MA7B 1R0AH 5EU3B 4K23H 4FMKA 1VSCA 2D7MA 5CUSH 4QY8B 2ARWA 4I2XA 3MRCA 4IRZL 3IN2A 3DSNA 5JIHA 2C9RA 4L18A 5F0JB 3ORJA 5KVDE 3VXUB 4N0UE 5EWIL 3A6CL 2OA9A 3QUXC 2F58L 1IGTB 1KN2H 2FX8H 5F3FA 4F93B 1S7VA 4NT6B 1BQLH 2HJLB 5D1ZD 2CM5A 3QDHA 4BWWA 2EVHA 43C9B 4F9LC 3KCPB 4NUGL 1TJHH 3C5SA 3DXAA 4X98B 2PETA 3MNMA 2X6AA 3L16A 3OD3A 4FLRA 1N6QL 2TAAA 1MUJB 4Z7WF 2P24B 3GZOA 1XF3B 1W6LA 2D3VA 2KC0A 3BUYA 4PJXB 3RZWA 4HYTB 3QUYC 1F3JA 1FSKB 4XOCA 3NACH 1FL5A 2ADFL 4NQXB 2B4CL 5C7ZA 1JPEA 3KLHD 4UQAA 1HWGB 5E51A 3FT0A 3NCJH 3D69B 3FT4B 1MNNA 4NFDA 3UG4A 4AUUA 5KVEH 4L3FA 3FB8B 2AQQA 2P5EA 2VDQH 4FD0A 4P46A 1KXTA 3QP3A 4DEPC 1KLUB 4XRCB 4RMTA 3KYKH 1I3RA 1TNNA 1DQVA 3QIBC 1DEEA 4HPOL 2I9LB 1BMWA 5IMOA 4JFSA 5DJ6A 5A16A 2B16A 1SHWA 1M71B 1NGPH 3CDZA 5L4FA 3TTYA 5E5MB 4BQBA 2F2HA 4KUCF 5IMKA 3K1DA 5H37G 5IMLA 1FFNB 4IRSD 4QRUB 1DN2A 5DVNA 1KCBA 4MA7H 1AO7E 2XWDA 1AQDB 4BK8A 2VRQA 1CTMA 5GQBA 1RIVL 1UEMA 2VUOA 4HPYH 5KJ4A 1N59B 5I1KH 4FG0A 1J8SA 1SGKA 1CUOA 1H5BA 3BPCB 3CSFA 1MCWW 3FHQA 4J3OC 2AC0A 3JXAA 5KZCB 4XNZB 4Z3HA 4QOKD 4KRPC 5HYQA 3VRIB 3U2IA 2IVFC 3HG1D 3K80A 3UTQA 1RUML 2P7TA 1L5GA 3AW5A 1LEIA 3D6GA 4RQQA 1UOWA 4G80A 1H8OA 4C83B 3DV4B 5SWZB 4UIMB 5DMIL 1F6FB 2BY3A 1QRNE 4N2CA 2NX5B 1EERB 3DARA 2EXTA 3NCMA 4M93C 4U1LB 2K9UA 1L0QA 2ZF8A 4FQHA 4L8BA 5FWRA 3E1F1 3WTYA 1K5NB 3RZCD 1N6QH 4WEBH 4YFDB 4TUOB 3UOAB 1A4BA 2BX5A 2NY1B 1A4CA 5E94A 5HDQH 2DD8L 2W65B 5EIQA 4GW4B 3OBAA 1CGUA 1OK0A 5DJXB 1AG0A 4MNQD 4PJCF 3V4UH 2ADFH 3PHSA 2ADYA 1EDHA 2B4CH 4Z3EA 2WANA 4B9JA 5D9SA 1KB9J 3BGMA 1NGXA 4KI5E 1BOYA 2MQ0A 5I6LA 1I7RB 2LQRA 1NEPA 3ZDYB 2HJKB 2ZXDA 4L1TA 1Z7JA 1I82A 1Z5HA 3P0YL 3OZKA 3GXMA 1FFTB 4NFCA 2X2JA 3VMPA 1NICA 4A7GF 3ARDC 1FGNH 4R7DA 5B21A 2RBLA 1A0QL 4Y9FA 4H8QA 1EZSA 4HPOH 4PW4A 5LN8A 5BQ7A 3EJQA 4NM4H 4ETQA 2KUTA 4N0UA 1E50A 4ZUVA 3DUUA 2ZUQC 3QFJE 2CO7A 5KOMC 3BWAB 2XZCH 3WG7B 2CIKB 3OM3B 4FFTA 1GL4B 1BJ1J 1NANH 2C3GA 2PCPB 4N68A 3T2PA 2NY2D 1NAMH 4BFKA 4E0RA 3BVXA 2AJ3B 4PVLA 2CLVA 4XXCA 2G4GA 2IALB 1SOXA 4KKCC 1B2WL 2D0FA 4P3CL 5GIRA 1IC0A 4DVRL 1RIVH 5FX3A 3BW9B 1JGLL 4QXVA 3ZTJH 5LBGA 4Y4FD 5DK2B 5L7XH 4QAMB 1EMTH 5KYYB 4JUTA 2PTVA 4LKXA 1T21A 1G7QB 3QNYB 4NQEB 3U9UB 3VRLE 2DBLH 4HJ0C 5JHDB 1A1NA 1NLDL 1RH8A 3QR0A 1K8DA 4L9LA 5CD3B 3T0DA 4LBEA 2IH1B 3IJEB 3BP4A 5D1XC 4MTMA 1NAKL 2ZXGA 4A2MA 2OJZL 3L3IA 4FTDA 1L9RA 5AUMB 2QADC 4B9YA 2AGJL 4B96A 4Q52A 3FQYA 4BFOA 3G9AB 3LN5A 3FFDB 4Y16A 4TSAL 4NOFA 3OVUB 1UGNA 4KDTA 4ZFGH 1CI3M 5DMIH 2XETA 3BQUB 2C4XA 3DRTA 3HPLA 3LN9A 3GRWA 1IARB 2XJKA 3L3KB 4EDWL 1DUZB 3GS7A 3VI3F 1ZS8B 3MLXL 4BE5A 4W6WB 1IL1A 2JIXD 2AQTA 5EU7E 4H8VA 2H2PC 2VSDA 3LTVA 2I5YH 2MQGA 4U0RB 5E6RB 2K6ZA 4J4PD 2Y7SA 5I15H 1AO7A 2JQAA 2ODHA 1V27A 4P3DB 4FF9A 2Y3NA 3PAUA 1MVYA 1VGKB 3HG2A 1A4JA 3G04A 3QRGH 3B5HA 1SZNA 4RMUA 3ZE2F 3MRFA 4Q7DA 3UH8A 3Q3GA 3GS0A 5F9DC 2FHCA 3QI9C 1UJTA 2OXHB 2Z7ZA 4Y5XA 4A66A 1MHEB 4MXQC 5F9AC 1JG9A 4OFIA 1T1ZA 3MV7D 1PD6A 4WGVB 4WV1C 3BLPX 4KOCA 4NAQA 3C6LD 1RUKL 1IAMA 3MRJB 4XC1H 3GLZA 5HVGB 3X3FL 4D0DB 5BRZE 3RGVB 2BNRE 4EBQL 3S96B 4YXHL 2VLJE 4JRFA 1FRGH 4U1KA 2G2NA 4XN1A 3NCBB 4LP5A 1QPKA 4NRZA 5DJAB 1OV8A 3FB7B 4AIZA 4Z3FA 1PLBA 1CD1B 4B27A 2J25A 3KWUA 2OZ4L 2AEQL 2CBQA 4YHML 1QRNA 4ZXBB 2O5ZL 2EZ0C 3OZLA 4R97C 5J89A 3P4NA 2IGFL 1JNJA 4NNPH 2ICES 4KUCD 3VXTB 4YAQA 3MJ6A 1JV5B 4P3CH 5DHVB 2MHAB 4DVRH 1FNEB 2VDNL 5CMAA 1BQHG 4DKFL 3SGDH 3HB3C 5CM1A 4ZFOA 2AFNA 2QHRH 3PWUA 3VFGL 2D7TH 1SJVA 4OKDA 1MRFH 5A2IH 2Y1AA 1SYVB 2EC8A 3CZUB 4MJIB 2J8UB 4Z3JA 3JWOL 1N0XL 3PWPD 4OM1H 5C7XH 2DYRB 1NLDH 1SLWA 4F8LA 5I8CA 1GOGA 3GMNA 4XNXL 3SKNA 3TPKA 4XGZA 5C0AB 1U8CB 5IM7B 3M88A 4MQ7A 2H9GB 1NAKH 3NQIA 1ILUA 3Q43A 4CSSA 4HIIA 2YS4A 3TO4A 2AGJH 1AQ8A 2RFXA 1UB6B 4I18B 3QNZB 4PY7A 5E2JA 3APFA 1XCTB 2XQYG 4I48B 4C4BA 5E2TH 2B1HL 3NK3A 3BN9D 1XMWA 3CFJA 4LARL 2AQSA 3EOAA 2J20A 3LPPA 1GGUA 4EDWH 3MYJA 4KFZC 4LAQH 5CEYA 3WO3B 1JXKA 3MLXH 1F4XL 4O51B 3QFJA 3AG1B 3O3BA 2W0PA 32C2B 1ZWIB 2DWEB 5E6ZA 1NC2A 2CHDA 5C8JB 3DROA 1CICD 5BNXD 4XO3A 2CDFA 4GINA 2Y1ZA 5EBMB 3ZMRA 1NA8A 1BVKA 5LQBL 3O81A 4LVOB 3ULUL 1ET5A 4HD5A 1FNSL 3JZ7A 1U42A 4NSKA 4EI6B 5EOCL 1UD6A 2C9QA 4BV1A 5MEPB 5M94B 2ZCHL 1HFUA 1A7RL 3VXUE 3BE1H 2J8OA 4ANKA 4L3EE 3MO1B 3QR1A 5EC1A 1QSED 3GS4A 2ISDA 4WFHE 3D3VE 1HOEA 3U6RB 2LR4A 1KZYA 3NTCL 1RI8A 1YUHA 3OXSA 4RMQA 3H3BC 2UVEA 3LAFA 4KO7A 3NSYA 3X3FH 2VZOA 4D8OA 2E5EA 2ZOLA 1J5IA 4ZD3L 1RIUL 4YXHH 2CCLA 4M7ZC 1YN6B 1W2KT 1DVFA 1BM7A 2YQ2A 3GMLA 3U79A 2OZ4H 4YHMH 2V5YA 5IHWA 2F1AA 2YWYA 3L5XL 2DICA 5K9OA 1RHHA 3RFZA 4QO1A 3DX3A 4KQ4L 2IGFH 1U3JA 1OOWA 3LNIA 2C1OB 3GSOB 4YHLH 2G5RA 4ZO9A 1I7ZA 3R06B 1TVBA 1QOKA 2J12B 3PIQB 2VDNH 2WLLA 2ID5A 4JPKL 1D6EB 3OR6B 4H26A 3LZNA 1EQWA 5IW6B 1NFAA 3BZ4A 4HS8L 5T5NF 2BP0B 3RLSA 1N0XH 3X3GH 1BWMA 1UB5B 4NCC2 1KDIA 3IK2A 1DBAH 3OX8B 4XNXH 2HP4A 5DD6B 1MCOH 1BOGA 1S46A 1PDKB 3H4HA 2QHLA 2I7SA 4QAWA 1E3FA 1ZV9A 1AH1A 1MCKA 4BZ1H 5A2KH 4YO0B 5DC0A 1WZAA 4LLQB 5AYUH 2O61B 3MQIA 3GBML 4POZD 5EO9B 1EZLA 4NZRH 3ZL4L 1IFHL 4HSCX 2HXAA 4JFXB 4QPEA 2H32B 3MGTA 2X4QA 2B1HH 1ZGLB 2FGWL 1M2VB 1O6SA 4J3OF 4JRYE 2CBTA 4H8HA 4TVPD 5D7IF 5BRZA 1D5ZB 5FGCB 3ARSA 4QDGA 2BNRA 4LOVA 2ZUYA 2FYYA 2VLJA 4XPGL 4HU2A 1Q9KB 2XA8L 3IU4L 1HQRB 2HT2D 4JPWL 5K59E 1DVUA 3IWVA 3MJ9A 4EI5A 2KLSA 2IAMB 3B2XA 4M4PA 3X14B 2R0WH 2GAZB 5LQBH 1JNHA 3FFCD 5D7LB 4IBWA 1SXCA 5AYTA 3WIAA 2FO1A 2OKMA 3EFOA 4CAGA 5FA4A 3L3HB 1VB9A 2K3HA 1DYZA 4XNYH 4HGKC 2J1ZA 5E5UB 4UYQA 4K3JH 4LFHD 3AXLA 3D34A 3AB0C 1S9YA 2WXPA 4MKTA 5TJWK 1KEGL 1SLUA 2V7HB 5AWNL 2DI8A 1HINL 4ZSOB 1ITBB 1BHGA 2NNAA 2NX5E 3S8FB 3G5YB 2VAAA 3WIFA 3VXOA 4NIYE 1E8ZA 2VH5L 3T77B 3VXSB 2YJQA 4L05A 1EEZA 2YEQA 4WHTB 4F1SA 1RIUH 1K3ZA 2A83A 3D85D 3Q06A 1G7HA 3WLWC 1HKFA 3ULVC 3VWJB 2JKIS 2YWZA 4K71C 2JQZA 4PWFA 3GKWL 2C7FA 4JZJB 2PUQT 4PD4J 1KYFA 2OYMA 1G4MA 3V6FB 3DMMC 3L6FA 2ZOOA 4U6YA 3IDUA 4GOSA 4AJWA 4S10A 4FCAA 4PV8A 3G7TA 1MCRA 3E6HB 3ZDXF 4QMEA 3IEAA 3K2UL 3DX9B 3MBEC 3PV7A 3WDJA 3I85A 1IRAY 3SQRA 3ARGA 4BHUI 4X7TA 5TDPA 5TTRA 2NNCA 4CVZA 1BREA 7PAZA 1UJ3C 5CSZB 4CKVX 2FTAA 4FERA 2ZF9A 5JORA 4IOFC 1GJWA 2GJZA 3M45A 2QGBA 2FT7A 2AK4E 3TBVA 3UGXA 3VH8B 4Z7OE 1JN6A 3DX0A 3VXUA 1JP5A 2YEZB 1FAIH 4L3EA 3PCYA 3HRZA 3JWNH 3TV3L 3D3VA 1A7OL 3GBMH 4U7MA 4L8DA 3UZQB 1CVRA 1IFHH 1KUMA 3WL9A 2WXQA 1WLHA 2W94A 4UAOB 4P5SA 3SDCB 4M7JL 3KCPA 4W9EC 4AQ8A 2NTFB 3UJIH 1RIHH 5E6UB 5L2KB 4MD5A 2GITA 5FYJD 3SPIA 3ZQWA 5IVZB 1AKJB 5IROC 4PMFA 2XA8H 4B41A 3DUSB 3L2NA 2QQNL 2J1YA 5DO2D 2YGVA 4JPWH 5EBWB 1TZIB 4X4XB 1OSPL 3TNMB 1F3RB 3FAXA 2X3BA 4JN2A 5BUPA 3QEGL 4F7PB 1YMMD 3ESMA 3FS9A 3GBNH 4NQXA 5LBSA 3EFFB 3Q1EA 2XZAL 2EICA 3U30C 1TZAA 2NCMA 3BKYH 1QKZL 2WVSA 2EECA 2IDTA 5JXEA 3RVXC 2CK0L 4Y88A 2VABA 4OZFB 5EF0A 2ED6A 3QXUA 4X4ZA 4YSAA 4OGYL 2KQMA 4NERA 1F3DH 4UT7H 2X0UA 4XRCA 3BJ91 3TX4A 1HINH 2PYED 4WO0A 2O5XL 1WGOA 3BEWA 2OS7A 2I9LA 2FEJA 2MTAA 4K5PA 5ACMA 3RI5F 4XBEL 2VN5A 2VH5H 4PJ5D 4AMWA 1TCRB 2XYCA 5E5MA 1HSAA 5DQ9B 4YBQD 2COVD 5IHZB 1FI8C 3O3AB 4PWEA 3FCTB 3GZPA 4X9FA 1WBYA 3CNKA 5KW9L 4M4RB 3SGEI 1F8TH 4JRYA 2CO6A 1BZ9B 2XTLA 4U3CA 4W9CC 4GH7B 3A4AA 5IHHA 3ISRA 4FNTA 4CSTA 2VZUA 2YGPA 3K2UH 2D3JA 4JHVA 5C71A 3OAUL 4KZDH 4XCEB 3AXIA 1SLXA 1UQSA 2XV6B 4QWWD 3GT6A 1KBGH 2D31B 5CGMA 3AT9A 1U36A 4MXVE 5AB0A 1M7XA 2NRDA 5T1MB 2X7LB 4TOYL 2JE8A 4YR6A 3V4VB 1USZA 5HGBB 2DYPB 3WSQL 3TJHD 1XCWA 4PRIB 3VGHA 5KVDL 1N2RA 3WKML 1CE6B 2E4FA 2EXYD 1CFTA 2BP3A 2NYYD 4LVNC 4APQB 1OAYH 1IQWL 4G6AC 4PJBB 3VXPA 4LSSH 4JPIB 3BZ5A 1A7OH 4ZAKD 4FI6A 4GBXA 1YUKB 4TTDC 4ERSH 4G3YL 3QFDB 4UIMA 4B3VA 1M9WA 1XIWB 2EYRB 2NX5A 5CCJA 3CFEB 1BFSA 3O6FB 4F1ZA 1DQJB 4CU6A 4U1LA 5IEKB 4HK3N 4PRPD 4LXFA 5HGAA 4GSXA 4D7BA 3H9SD 4N28A 5C97A 1N3NB 3CFKA 4Y4HB 3NCCB 1T03L 3SD5A 2QQNH 4AMKL 2VLRE 1UZ6E 1DQLH 3SPGA 1INDL 5F8RC 3VFNA 4X9GA 4TNWF 1D9KD 2BOLA 3QEGH 4KX7A 1SPDA 3FPYA 1CLZL 1ZVYA 4LPCA 1H15B 2XZAH 3S2AA 5E1AB 1NJ9B 4XXDA 4RFOL 3QQNA 5D4JA 5EZJB 4EXKA 1QKZH 4IU3B 1I7RA 4XH2B 5D1ZC 3MOQA 2CK0H 2HX9A 4YGVA 4Y4KD 3K2IA 3QO0A 3VB9A 4HWZB 4OGYH 3DNKA 5DTFB 5AEAA 4PJ7E 1ETZA 3QDJD 2OTPA 3GRWL 2ZKYA 1TQBC 4JQIA 4YQXL 5FDWA 4JK0D 2AK4A 5FV1L 3IJYA 4PRDB 3ZTJG 1MQ8A 3NJMA 5J1SC 3GBEA 4GXUN 1DJIA 5J3HC 4YDIL 3EO9L 1DR9A 4N8CL 1R3IH 1HYRC 1BZQK 3UZEA 3BH8A 3EXJA 3KLHC 5GSVB 1YJDH 5KW9H 4PJGB 4ANWA 1DSFL 4ODHH 1GIGH 2LAAA 4OD2A 1A7NH 1RCYA 5D72L 5G4NA 5LBVA 3M46A 4RDQF 3HAEB 3OAUH 1CT8B 2CBOA 2I60H 5I24A 4R2GD 3WMSA 3GSUB 4HW6A 5DK2A 1VLXA 4KKRA 4F57H 4XX1E 1CPUA 3OKDB 4ODWB 1XB6A 3LN4A 4DKDC 3UYRL 1LEGA 4DEWA 4TOYH 1DFBL 4NQUA 5L88L 5TFSH 3IJEA 4RFEB 3SDXB 1NBYA 4YHZL 3ZL1A 4G59C 2HG5B 1XR9B 2QQKL 4RZCB 1DE4B 5F3HB 1IQWH 5AYQA 4A04A 4HKBB 4NZDA 1PZ3A 4CC0A 1JVKA 1T2QL 2HVJB 4PRAB 3REWB 4PGBB 2WKOA 3V4PB 4Q89A 1K4DA 4G3YH 4UNTA 2XXGA 3U25A 3BKCL 2XWBA 3U82B 4ALAL 1U8KA 2JVUA 3BIAX 3L3KA 5JPMC 4TTGA 2V2XB 1E65A 1ZS8A 2DM3A 3JWDL 3Q2VA 1DSWA 2Y1VA 3RL1A 4BSWA 2ZYSA 4ZFOL 2M2DA 2WZPD 1LK3L 4FJYA 4FE9A 2R7EB 3NEXA 1F97A 4Q0XL 3ZE1F 3CVDA 5FA3A 5JDSA 1V7NH 4OLXL 4OJAA 1N5AA 5DS8B 1DLFL 2PW1A 3QUMB 2HVBA 2GTZB 2QR0A 1OE3A 4X6DF 3WE6A 1CLZH 4P3DA 3PY9A 1RPQA 1S78D 2Z31B 4UWQB 5M95B 2F7QA 3KM1A 1T83C 4X9BA 2V9UA 3FTSA 4EZLA 2X89D 4BINA 5FOBB 4FQCL 4QHKI 4UM9D 3GJFK 2O6DA 1CS6A 3WFZA 4JLRA 3EDDA 1KULA 1BIIB 1L6XA 2OL3A 4RDBA 3POCA 5J9PB 5IUCA 1I3VA 2F8OA 3BRDA 3MRJA 2VMEA 4HC1A 1JVOA 4RBPH 3N85L 4AEFA 4AVIA 4PVMA 4RCAA 1XBDA 3S96A 2HVKA 3MCLL 4XPFL 1ZTMA 1C7TA 3Q5YA 4GUCA 4IQHA 4BRJA 3N9GH 3IDXH 5INDA 3THML 3WJLA 1JCVA 1NCHA 1WA2X 2RR3A 2YBGA 4FFYA 4FLQA 4A37A 1LO3L 4IOIA 3II3A 5DJ2B 2OSWA 5EIIB 4BGLA 3O9WD 4ZXBA 1DSFH 2ADJB 2Q9OA 4GPVA 3RBGA 3ZLQC 5IV2B 4PJAB 1DJXA 3FSVA 3VXTA 4DZ8A 3IDYB 3X11A 1JV5A 5DHVA 3SE3A 5ADOL 2VSCA 3ARWA 4OD3L 4QRTA 5C9JB 4Y5YA 5E4EC 2VLRA 1KGJA 2VR5A 1G43A 2J8UA 3ULVF 2ZPKL 4IMLB 3AQYA 1WAPA 1DFBH 2BSRA 3G6JE 4ZSOE 4DGVL 4R4ND 5L88H 3LEXB 3NCYP 1U8JA 2BFVL 4YHZH 1UM4H 2UV3A 2BSSA 4YXKL 1JZ7A 3GI8L 1UB6A 5GS1C 4JQVA 5I74B 2WUCH 1HDMB 2AAVA 4WZ9A 4G9FE 4PJ7A 4XHJD 3RU8L 3TVMB 1MDAA 3L8QA 2YAHA 4Y4FC 4YDVA 2ZJSH 5L6YH 3BKCH 3O2VL 2CBPA 4ALAH 1EANA 3AWGA 2XTJB 2IPKB 4KZCA 3VDAA 4N0YL 2ICEC 2VQ1A 1GZPA 1UWXK 3AU0A 3KR3L 3LZOA 4J3WA 5HJDA 3QRFM 2DWEA 3AACA 2Y07L 2QV2A 4GAGH 4NQCE 1TQVA 2DWSA 3VA6A 1E90A 2MSPA 5MERB 1PYWB 2GFBA 1HI6B 4OLXH 7FABL 1EWHA 3C09C 3FT3A 4JVWA 3IN0A 3T2QA 4M1DH 2IMNA 2YD7A 2YD0A 1WP6A 2WAQA 2OMUB 2Z7YA 5SWSB 1S7SB 3HMWL 5DRWA 2BVYA 5G4OA 2I9TB 2BWQA 1QFPA 4KKAC 3AAZB 1K4CB 4TUJB 4KJQD 3II2A 3T65A 1TETL 3KBHE 5I76A 1L9TA 1DDHB 4GSRA 3R1GL 1U3NA 2H26A 3E38A 2QSQA 2E76C 1SEBA 2WWMC 3QJHB 1U3HA 4JKMA 3N85H 4J4PC 2ESVB 1NFDF 4QNPE 3N0PB 4FTVD 2P5ED 4HF5H 3MCLH 4RSYA 3MJ9L 4PLNC 4XPFH 4H8UA 3OXRA 4RAUA 3T0XA 3WV0A 4XX5A 1T89C 1KSRA 2CR6A 4HMEA 3HZKA 1LO3H 1EFXB 2X4UB 1AQKL 2Z91A 3ARFB 4O2FA 4E5XB 4F33B 5C08D 3CVHA 2IDFA 4EUPB 3GSOA 4V1DB 4OZ4B 5AAMA 4OD3H 4QHMA 4QT5A 1MCBA 2B1AH 2MIZA 2YD1A 4KQ3H 3OR6A 2AV1B 5CO1A 3NZUA 5KYWB 5DGQA 4HU8A 3AGVA 2R1YB 3LNDA 5JUEH 2VE6B 4H1LB 3SDAD 5CCGE 1M7IB 1K2DB 3R7RA 3ZTEA 3DPDA 3GMPB 4XNUL 1RJZB 3BIKB 4XMVA 3Q44A 1FVDB 2UXTA 3UERA 5FEBA 4BSVA 2MCG1 3CQQA 2YRPA 1TQTA 3LZLA 1YMHB 4YXKH 5B3JE 3EJTA 2HTLD 3PDOB 3VXNB 5KJRL 1P6WA 1M6UA 1XVSA 4H2CA 3BAIA 3H3PH 2C9VA 3ZKQD 5JPNC 1IUZA 2H32A 3VFTB 2Z1KA 4HX1B 4LLMA 3SE6A 2V2TB 1M2VA 4TSBH 4YSEA 2W9EL 1YEJL 3O2VH 3C5XA 5FC9A 4M5SA 1D5ZA 2W92A 3FB6A 3VI3B 3US9A 4WI6A 3KR3H 1CXIA 5J13C 2IGTA 4OJCA 4XN9A 1X7QB 1G7LB 4N5UA 2GIXA 3GF8A 5B8CB 5I82A 2Y07H 1EHAA 2WZ5A 3WXWL 5E9DE 3VD5A 3DETD 1OGTB 2Y7NA 4B0MB 4JHWL 5D1QC 5FF6A 2GJPA 4XHQA 5DZLA 4DETA 2CE6A 4V33A 4P5TA 1RZKL 4KVPA 2XFXB 4P9MH 3MBXH 3NJIA 1KGYE 3E9TA 1OD7A 1EDYA 5HPOA 3HOGA 3TH2T 1QEWB 1E6JH 2IQAB 3F7LA 2FSDA 2VR3A 4C58B 2BVTA 2G3XA 3BN9C 4PJBE 2K7QA 2BC4B 2V3EA 3BMVA 2WWKO 3R1GH 5T3ZE 2EEAA 3Q13A 3G6JA 4QRPB 4ZSOA 5IBTL 4IKJA 1D3CA 1NPUA 1SUJA 2GJ6B 3IGAA 3LEVL 5GPRA 3RJQB 1BLNA 3FUDA 2WC7A 1XGQA 1S7TB 3RTQD 3T77A 4A6YH 2P28B 3OKOB 5F1SA 1UT1A 3M7FB 5AW1B 2FBRA 2XNAB 1P7BA 1NFIB 3AGWA 3IFOB 3MXWH 2ORBL 4TNEA 3U7YL 4G9FA 5LGKA 4JZJA 3UTSD 1HH9B 1AQKH 4P0DA 1YYLL 5LBSL 5DFTA 4X6EB 1QR4A 4OH2A 1NBVL 4GIAA 1Y1UA 4LCUA 1UXWA 1M05A 1QWUA 1CZ8L 4OZGE 3ZSTA 4NQCA 2VC2L 5I23A 5HHNB 3I6SA 4G43A 3EDJA 1BFVL 4MA8L 3NPSC 1KIPB 1PZCA 4ZBJA 5KSBB 1AZNA 1S9XB 3RL2A 1P5UB 2IADB 3SGKC 4C56D 5HYSG 4K3DL 5IOPB 1HE8A 4RWHA 2W0FA 4JCWA 3VTMA 2R1XB 3SOBH 3DBSA 5ILTL 2MPAL 3MLYH 5E8PA 2A73B 1A22B 2NQDA 3PAYA 4RLDA 3NAAL 1ILSA 2GC7C 3LH8A 5T1DL 3W82A 4LKCB 4I7ZC 4X8CA 3ZR6A 4PJGE 1YEJH 3I6KB 5ID0B 4TNFA 4UZUA 5IVZA 1YNKL 2Y72A 2BRQA 3DUSA 1AI1L 4Y4KA 4AZUA 3QUXB 5AW5B 1JNLH 3TNMA 5HHPA 3DVNB 4KZ0A 4DO6A 2E9IA 5HDWA 5DURB 3H7BA 1LO0L 3CHXA 1XR8A 5H94B 1E0OB 1MAJA 4JRXD 1UH3A 3V5DB 1RZKH 3U1QA 4B53A 2TRHA 3OKMB 5EH1A 12E8L 1LQSR 1CG9B 1D5XB 3Q48A 4Y1SA 5BOZG 5FV2A 3MRKA 4DUXA 1E4KC 4JFUA 3B37A 2NQCA 3LKQB 4FXGA 4WDIA 3RDTA 4CN6A 3QUYB 2NY4C 5IBTH 4GUQA 3LB6D 3IXTA 5GGTA 1JCKA 4X2UA 5E8EA 2WXRA 3IJ7A 2FYVA 2Z0BA 1CFQA 4OCSL 1HXMB 4FQ2L 3UAFA 5IB2A 3ZX1A 2R29H 2DMBA 4GRLB 5BJTB 3T8VA 3EYSH 4GKSB 2R2BA 4DEPB 3BKMH 3RI5K 1I1YA 1JE6A 3QIBB 1YYLH 3MLTA 4TMPA 2CDEA 4AK1A 5GZOD 1FA4A 2UZIL 3RWDA 4ZO6A 1NBVH 5CBEA 1IBFA 3UTTB 5HBBA 3DJZA 4UZSA 4XN4A 1TZGL 3F6JA 3ARED 3PL6D 2ZIDA 2GBVA 3Q6FA 3HMXH 4BGDA 5F9WC 2X1XR 5E9DA 5FOJA 2YSSA 2DMKA 3NJFA 5DQJB 5MEOB 1QHQA 2DQJL 2YARA 5T1MA 3BVNB 1R3KB 3MXVL 5KANG 5AB9A 1W72B 4ZPVA 2N4IA 4DK5A 4XO5A 1MNUH 1CE6A 4K3DH 4ADGA 3KPRE 5EEYA 4G8GB 2AEOA 4BELD 5ILTH 2MPAH 4PJBA 5F72S 5I6KA 4JPIA 4P2OC 2Q20A 3NAAH 5T3XD 4R26H 2OW6A 4LLAA 3QDGD 1BLIA 2ENQA 1L9PA 1SMDA 3G6DL 4X83A 1XIWA 2ZXQA 3TT3H 3CFEA 1UWGH 4KRPB 1LJMA 3VNYA 2ZAIA 4GKNB 3VXQA 4IGBD 4PCKA 1OW0A 1V7MH 4XP4H 4IBSA 5CLTA 3SE9H 4MJ6B 4Y4HA 1BZOA 1AI1H 1G7IB 3W56A 5C3LD 3FOMA 2I85A 1BMZA 4G8FB 3KVQA 2ZSVB 4GO8A 2Q8BH 5J06A 5T8IA 4ZS7H 3QPQD 4X5PA 3TBTB 4AE0A 4H5SB 3CSYB 3EHBD 2VL4A 3CV5A 4J8QA 4QR7A 4OV5A 4RGNE 2DQCL 1U9KA 1X44A 4KQ0A 5LKNA 5E1AA 1NJ9A 1H8LA 3LNHA 4M93B 4PJ8D 3UBFA 3ZRCC 2B20A 4JM0A 12E8H 4OZGA 3AABA 2X0WA 4TNWK 4KH2A 4P5MA 3FYEB 4D0CB 1FL3A 4JKLA 5DTFA 3TONA 3Q05A 2CCWA 4ENZA 1XGPB 3SE4A 4D9QE 4I1PA 4G11A 4QHLA 5DHMC 4HKZB 2YZ8A 1V3KA 3PAVA 2NQ3A 1NEZB 4PRDA 3WNMA 2V9TA 1JMZA 4X9IA 3F7RA 3EH5B 3OAZH 5ALCH 3ZKND 2DWDB 3VGGA 1P5VB 3IRCA 3H6JA 1EV2E 1CURA 2CWRA 4TN9A 2A9NL 3W38A 2IIJA 4BH8A 2B2XL 1N18A 3ARDB 4JY4B 3I75B 4PJGA 3ZDXB 3NGBC 4M3JA 4FKKA 3JYBA 4LNVA 4PAZA 1YSOA 4TLUA 3CUPA 2UZIH 3NCFB 1F2QA 3HAEA 4HBQA 1TZGH 2NNXA 4KJWD 1CIDA 5TE7L 4WCYH 5D55A 2ZUQB 2J3SA 5E8OB 5LNDA 4LLYA 3C5JB 4YC2C 1CVSC 5ANHA 1MHCB 2DQJH 1I1AC 4LCWB 4Y5VA 4RMVA 2OL3L 1P4IH 4KHTL 4D7PA 1TTGA 1B0IA 3LXUX 1RXLA 4F2EA 1F13A 1GC1L 4ODSH 1XZ0B 3U83A 3IGKA 3QUGA 4HD9A 4FGMA 1DQDH 4KK9D 5F1NB 1XR9A 5HYJD 1LE9B 3FO9A 3L3GB 4XAKD 3PGCB 5MP6L 3AU1A 4HKBA 5DHXB 5ISZD 1XGYH 4FQQB 4TF4A 2W91A 3V4PA 5I9QC 5E6IC 3WEOA 5HY9B 1KENL 3CC5A 3OMIB 2ATPB 1ND0B 4QWWC 1ZA6B 3I2CL 1AXIB 2Z93A 3QYCA 5D1XB 5IQ7L 4BJLA 5L9DH 5KUKA 4YHOH 3WELA 2QADB 5DJDA 4KV5F 1T7WA 4K8RD 4NNXA 2JCCB 5C6WH 1L9NA 1HHHA 2OCFD 3MREB 3I50L 4L4TB 2XWTB 1D2OA 1FE8L 2WOYA 3MBWA 4A2LA 5BRZD 1ZA3B 4X5WA 4ORGB 3IPEA 4P48A 2ARJB 3W5MA 3DVFA 2Z31A 5BO1L 3D25A 4PRHD 4HUVA 2ZICA 4ABVA 4EI5D 1L3WA 4QHUA 1HHGA 1MEXL 4QEGA 2XY1A 3VGDA 3KPSE 1EXUB 4Y1TA 2V8MA 1UVQB 1QACA 4W9FC 2UZXA 1SQ2N 4FZEL 1H3XA 4Z7QB 1HCFX 3X1EA 1J5DA 3KPRA 3LNGA 2YGQA 3NH7L 1GKEA 5IJKC 3O8XD 3CK0L 4FYSA 4OKVA 2VJXA 1BA9A 2YK1L 1D9KC 2CHWA 4HBCL 4YWGL 4QCIB 4EOWL 3BYYA 3QI9B 1T3FA 1K6QH 2A9NH 3WN5C 4MAUH 2KLRA 3DSFL 2B2XH 2NUPB 4NO5A 1RULL 4WV1B 1IAOA 2E86A 4XMLL 3V0WL 4PJIB 2HFEA 2FATH 5D5MF 1L9SA 4OW6A 5DF0A 3C08L 2A6JB 4WI0A 2X4PB 5TE7H 3BOVA 1A9BB 4FLSA 1RJYB 2ADIA 3HE6A 3MRNB 2RCSL 1CGTA 1KYOK 1P7QA 4TNGA 5A2LH 4KO6A 1MCDA 5CEZH 2YD8A 4IMLA 2VMDA 3NIDF 1VKXB 1CBVL 4KHTH 2F68X 2XXCB 3LEXA 1JPSL 4R97B 4U6XB 1OLZA 1YQ2A 1NGZB 1GC1H 2UYLA 3JWOC 4ZX3A 2QVKA 2X70A 3VFPA 5IQNA 4QXTB 4B9ZA 1JTOA 4KZEL 4RETB 4EI0A 3HB3B 5MP6H 4NO2A 2QKSA 3TJEL 5JIKA 5KG9B 5SX5H 2IH8A 3MX0A 4WW1B 3FHEA 1DBML 1NBQA 3HCVB 2CLZB 35C8L 2DEWX 2WZ6A 5IR1B 5K9KB 3CVHL 4HKJA 4N2AA 3I2CH 4NPYA 5DHVH 4KMTH 2O26U 1R34A 2OTWB 3V10A 1WF5A 2PWEA 4WFHD 4YE0A 3HLKA 3HBQA 4KXAA 5C0IB 4JAMB 4K0OA 5AD0B 1ZV5A 4LLWB 1FE8H 4TSCL 2OX5B 3SGEH 2BOCB 4MYWB 3CCHA 3AQXA 2WWKT 3VD9A 1BBJA 2YD5A 2MMXA 5KSBE 1WFMA 2R69H 4UANA 4OVUA 1JGEB 2F54E 3R4RA 2P49B 5KSAB 4FQIH 2HLFD 1WEJH 5BO1H 2X9YA 1IT9H 3ULUC 3C6EA 5E70A 3RWEA 1KTRL 3HI1B 1OP3H 3AAZA 1RZJH 4TUJA 2IOIA 4HGMA 4O9HH 4NQTA 4HXAL 5KS9E 2VXSH 1MCWM 5GHWL 5C0CD 1MVUB 4PGDB 5EA0L 3V7AE 4P2QB 4FZEH 2C1PA 4HJSA 3VFSB 5I1IH 1UHVA 5DRZB 2UX7A 4IOSD 4P2RD 4R96B 3N3EA 3OSVA 1KLFA 2BVOA 3NH7H 4NWUH 5AVWB 3TN0A 3DPBA 5DZVA 1SEQL 2I27N 2YK1H 4IMKA 3Q0HA 4F7CA 4HBCH 1QHOA 4YWGH 2FH8A 3ARVA 4YFLI 3T2LA 1AR1D 1IJ9A 1U95B 2ITEA 4MWFB 2WUBL 1S78C 1MJJB 4NQSB 3EUDA 2X4UA 4B95C 4D0BA 4E5XA 1E5AA 4M1GH 5F7DA 2HSIA 2QLYA 3TEWA 4P4KC 4RFNC 3A47A 3C08H 4XAWL 1Z3RA 4M7ZB 4N2HA 1YEWA 3G08A 4JO1L 3OKNA 2XICA 5E03A 3TO2A 3CMGA 4U2YA 4H1LA 1TJGH 4HJJH 5A40E 5HXMA 4F7EB 5KAQG 2J88H 1JPSH 4ZS6D 1NM9A 3GMPA 4UAHA 4GXVL 4UI2A 2YD4A 2W59A 4KU1A 5DLMH 5AAPA 2QL1A 5BS0E 4HKXB 3KPOB 4FNSA 3O9WC 3PABA 4OLYL 5A2AA 1F11B 3KPSA 3W2DH 3TJEH 2BVQB 4RMBA 2X4OB 4CKQA 4ONGL 1ANUA 1SJXA 2FJFA 1DBMH 35C8H 3KPQB 1KTDB 1X9LA 5I1LB 1CE1L 1II4E 2F7PA 4GRWF 5EMYA 2Y6SD 3FUJA 1YNTF 4NRXA 3T0AA 4JPQA 4MLIA 5JZ7C 3SGJA 5GRZA 2ODIA 3QQ4B 1S7XA 4FMFA 3WFEH 5GJTH 5LHDA 1IGML 4X4YA 1P6AB 3FRPB 1T7YA 4X6DB 2K8QA 3UPAA 4AGLA 1INEL 4GSUA 5IFAH 3VGFA 3EZJB 1T7ZA 4DWHA 2XFXA 4HETA 2YD2A 1AHWA 1LGVA 1MG2C 1SXAA 4H0LC 4TLSA 1I9JH 1EJOL 4M00A 4R9HA 1N7MH 1UT9A 4XHJC 1ZGLM 2IQAA 1R33A 5LNGA 3MMEB 4OZIB 3KPLA 2BC4A 2NLJB 4AXWB 2FRGP 4HXAH 1KYOJ 4NO0B 4Q9QL 5GHWH 3O41B 3IRPX 3IJ9A 4ANXA 3G5XA 3B7SA 1U93B 2IH9A 2R2EA 2PCYA 4X8XA 4PJDB 1LTXA 4QRQA 2V3FA 3G5VA 4R3SB 4ORZC 2YXVA 3NESA 1SEQH 1A2YB 3IFOA 3A4EA 3S3BB 4AQ1A 4EN2A 3IJHB 4ESKA 3ZZQA 5GGSY 3AB0B 3SKOB 1BD2D 3WS6A 2VXVH 4XBMA 4X0KB 5E7BA 1R24A 2VXUH 2E74C 2F74A 4L2YA 1NL0H 4DP9X 1FG9C 3WLBB 2HT4D 3LIZA 3FN0L 4FCHA 4HFWA 4NI3A 3MNWA 3S5ZA 3VDBA 4JGUA 3UIYA 3WKNA 4CMMB 5JW4N 4RISL 1LO5B 1JOIA 2FDBP 1GGYA 5HHNA 2CJUH 4JO1H 4LHUA 4EZJA 4K71B 4DPRA 5DXWA 2DTML 1YEEL 5GGTL 2X10A 4HDIB 5B1JA 1R6VA 3DMMB 3VYOA 4OZHB 5KSBA 4P46C 2V37A 3LS4H 5EN2B 2IADA 2F54A 4BA0A 2XKSA 4TS6A 4XWOD 1NDGB 1CLVA 3MBEB 3ZYOA 3JTBA 3NPZB 4ZODA 4DGIH 3L5JA 4IKLA 1ZTXH 2LVCA 5KS9A 5EDXA 2WLKA 1KFAL 1UJ3B 3CJJA 2IEPA 4ONGH 2OMTB 2D0HA 2XYBA 4U4IA 3BFQG 2C3XA 4ZUUB 1CE1H 4DP4X 4X99A 1M4KA 3OPUA 3MRPA 1PU0A 4M7KL 3MUJA 2C9AA 1UD3A 1AMYA 4NQDD 3C9NB 2ZXWB 4JBSA 2JELL 2C3WA 4ZUSB 1AOHA 2M1KA 5A2JH 2A6IA 3ZBMA 2FD6L 2OK0H 4HZLB 4PR5B 1C5CL 3VXRE 1IGMH 2JTYA 1FWXA 2RA1A 1H5BC 1HN1A 4DK3A 3UXFA 1YHPA 2V5TA 4KROD 3QJUB 3OKMA 1EJOH 1RK0A 5D7HA 3NFSL 5TF1H 3UYPB 5HJ3A 1ORSB 5T3ZL 3G3LA 5GS0D 3LKQA 3CFTA 4R4FL 5BV7C 1IC5L 3RE0A 4Z7NF 2Z4TA 4RNRB 3VG9B 3QIWD 2A6DA 4L0PB 5C07B 2GG1A 4GAJL 3CX5K 3P40A 1A9VA 2NY5H 4XE5B 3U30B 5BS0A 1FVEA 2X1PA 1T20A 3U46B 5BOJA 2WQUA 3SB3A 2XN9E 4R8WL 5ANME 2DLEA 1X5XA 3ABKB 5GISL 5IJVB 3O3EA 3N43F 4GRLA 4AQEB 5BJTA 1EZVX 5K9JL 4UBDC 5AW7B 4AT6B 3OJVC 4TYUA 3MNVA 3KPMB 3KLDA 1NMCC 4G70B 3U4BL 1NCBL 5ELIA 5GXBB 1A6VL 3HHSB 4QRSA 1O7DC 2JH2A 2XQYK 3EGDA 3UTTA 1YRKA 3CN0A 3HNTL 1JYVA 5EF2A 4ZNCD 4OZFH 2G2RB 3CDGA 3QWRA 4G8IA 2PXYD 3KXFD 4ZMPA 2X2YA 1PIFA 4I0PA 3MRDB 1ZGLP 1IE4A 3OC5A 4WHYH 4WFEE 4HS3A 1M3JA 3FQ2A 1MFMA 4LPXA 1AS8A 5KN5B 4JFZL 4AYGA 3HUJF 4OCXL 1FZOB 1OCZB 4BWUA 4L23A 4NDMA 2OMVB 4UT6A 3FUIA 3TEXA 4X6CF 3RYMA 1U92A 2DMHA 3SOTA 4UOW0 4PJHB 4GMSH 4M03A 3PGDB 2OW7A 3FU6A 2NR6A 1BQKA 3IKCB 3OMZA 1KFAH 1XO8A 1ZVSB 4DEUA 1V10A 4Y2OB 2EDRA 3NJHA 1JPFB 4F27A 1LVEA 1DUYA 2ZX5A 3NIGB 5FIEA 4PQXA 2WQXA 3UCRA 4Q9CA 4PJIE 2X38A 3IDMB 4UOZA 3NP4A 4PP1D 4XXCC 1OAZH 1WFNA 3MCG1 4LLVB 2CHNA 4LVNB 5J6HA 2P5WE 3P0VL 3NEOA 2JELH 5G4MA 6FABH 4LOUC 4P2CG 4GI9A 5C3IA 1N5YL 2FD6H 3GXNA 3TBTA 3V4VH 1HJCA 2ADGB 3CSYA 4H5SA 5JYMA 1R3JA 5DJ0A 3D18B 1LEKA 3T3MF 5I75C 3N1MC 3VXMD 2EXWD 1D6VL 1HKLH 3M86A 1MFEL 3K72A 1MRDH 4L9LC 1XGUA 1WT5A 2IOOA 3MUGA 1CGXA 3BAXA 3VWKA 5KSUB 1NGWB 3FB5B 4U7SA 4IEFB 3P9MA 2PKDA 1I1RA 2BJML 1XF4A 3BO8B 3V4PL 3ZHKA 1BYNA 2ALAA 2CRMA 1F0LA 3AM8A 3DJTA 4J12A 3UJJL 4NYLA 1OGPA 2UWEB 4ZW8A 1IC5H 1XGPA 4AH2A 2HX7A 4Y16C 2R2CA 4KDTC 2WO4A 1OCCB 4WTZA 5EZPA 4K94L 4N3UA 1NEZA 4GAJH 4HCIA 5I28A 4LF3B 4EN3A 4HIQA 5LGHH 2EP6A 5DRXA 1A7QL 4JG0L 5DEZA 3BDXA 2WVTA 1IZJA 5D1ZB 4JKKA 1RQ5A 3DHJA 3QG6A 3ULUF 2VAJA 1OOAA 2A9CA 1R5WB 4FP8H 1A1MA 3BJLA 5C0BB 1LL1A 3ZO0A 1AGEA 5JXAL 1X3DA 1H9VA 2HPTA 3TU6A 4FG6D 1TQBB 2X6CA 1FYTE 4R0LA 3NZHL 5D71H 4I85A 1OGAB 3EYQC 2RGSA 4GAFB 4JS7A 1Q1JL 3HNTH 2B14A 1DVQA 5EZIH 4M7LL 2Y5TB 5DS1A 1DVTA 4MVBD 5E8OA 1V3JA 3ATDA 2Y7QB 1BBDL 4F80A 5F1IB 1X5HA 5IESL 3VXRA 3C5JA 3WNIA 4RGMB 1MHCA 2VDKB 4BQ8A 1KIUB 1JYNA 4Y5XC 5PAZA 1KNOB 4P2QE 4ELMB 1FFOA 3D2UA 4HIJA 1XZ0A 1I31A 4OCXH 1IGIL 3RUGB 1IAII 4LLDA 3W0WE 3FTZA 4GP4B 1NSNH 2YUWA 1CC3A 2D03H 2PABA 3QXDB 1RJCA 4JFDE 3DVGA 4HFUL 1ZCRA 3TA3D 1DJHA 3SKMB 3T8XA 1DFXA 4GIPD 4GFTB 1GPOH 3ISWA 4DESA 1X5FA 2L4OA 4U49A 4AEHL 1Z32X 4F7MB 2JCWA 4XC3L 1N8OE 2CO3A 3CX5J 5C0DB 1OCWL 2QKIB 1J48A 2XN9A 5ANMA 4ALAC 3FTXA 1NCCH 1J8RA 2WQRA 3VW3H 1N5YH 3SDDD 3UTZB 3DC0A 3JWDC 5SWQA 2VW7A 1PEZA 2IBBA 2XQBL 3OB0H 1BQHB 2E7CA 2BHFA 2P8MB 5J7CC 1QSFD 3MRHB 5JPMB 4MCYA 4M61A 2FJGA 2PP7A 5ABZA 1NGQH 5KVFH 1B0RA 2N3JA 2P1YA 3BH9B 2HUHA 4KI5C 4N0CD 2OAAA 4ELKB 1ES0B 4A7TA 1G7JA 4ZQKB 4MCMA 5E99L 2FEDD 3TO4C 3V4PH 4MB3A 1I8KA 1UVQA 4WUKL 3TBWB 4YEEA 3HG1B 2BP5M 3LSOB 3LV3A 5F7WC 3QQ9C 1E9PA 3W37A 1U91B 1OAKH 3PJLA 4DN4L 5MI0C 3WFCL 3FU0A 5ABDE 1A14H 2G30A 4QCIA 1CYXA 2FBOJ 1H9DA 1QFUL 5D2LE 1QR1A 3AVEA 5GRYA 2XPYA 3EAKA 1AE6H 3QC6X 3X12B 1VFBA 4KBPA 2P80D 4UDTB 1DLHB 5JXAH 3QUMH 1TIUA 4PV9A 5FO7B 2KH2B 2OQJA 3W9DA 4PJIA 3ECBB 2X4SA 3CE1A 4QRFA 4UTBL 4EZKA 2QELA 1H0DB 3D39E 4K5NA 1XV8A 3QAQA 1HH6A 3N1PC 4DP7X 4QI3A 1GZQB 4JCLA 5I8EA 4G9FD 1OP4A 4M7LH 3QSKB 4WWNA 4EXPX 2FWSA 4JHAL 1KJVA 3I6LE 3MCYA 3NSFA 3WEBA 4AZ8B 2NY3D 4Z0XA 4LCYA 3S3SA 2GI7A 3NFNB 1JWUB 1FJ1A 1EZUA 1IGIH 5GSRB 2DLFH 1K9TA 1MCPL 1D5BA 4KUZL 5EULV 2D7OA 3KLLA 1FNGB 1AYOA 1G5GA 1YPZF 3EYUH 1XL6A 2YAEA 4JMXA 5KG9A 2JI3A 4HFUH 3OLDA 2NY0D 4WNQA 4HALA 3LOWA 1TEFA 1DVFC 3CPUA 1KXVA 5T5FH 5IR1A 2HFTA 3HN8A 2CLRA 5DD0H 5DYFA 3DI2B 3WHXB 3DO7B 3RFZC 1OCWH 4TQIA 1QLEL 1B0GB 5JLZB 3MA9L 5CGBA 1QBLL 3NT0A 2PPDA 2QTEA 1SJEA 1HQ4B 3RKDD 2A5UA 2ZSWB 3AITA 5DJYB 5EU7C 3ZR5A 1PPIA 4U1NB 4UT9A 4P5KB 2R2HA 1IGFH 2BOCA 5GGUB 4JVPA 3EH2A 4KK9C 3UO1L 3KYOB 3MSPA 3PNWA 4PI0A 4Y4FB 1JHLL 1FYTA 2XQBH 1UXMA 1C5DB 2JXMB 2VQ4A 3PP4L 1B2YA 4LHJB 2H3NB 5KSAA 1NCJA 2ICEB 2XXFA 3P69A 5E7FA 3VFMB 3BAEL 3MZGB 1MJ7H 3FTYA 3BX7C 3FKUS 3G6AB 4LSTH 4LLUB 4GQZA 3LRSB 3NQKA 4I1RA 3LY6A 2F53E 3QDMB 4FC3E 4WUKH 4YPJA 4P2QA 3OZ9L 3C09B 5DRZA 4FFWC 1IBHA 3W0WA 1O5DT 5HGHB 4JN1L 1IC7L 1J8HB 4LGRB 4U1SB 4JFDA 4TL5A 3RWJB 1UACH 1QFUH 2KI6A 3GIVB 2R4RL 1UENA 1N26A 4ZUTB 1PY9A 5L2JB 3K8LA 3TYFB 1OM3L 1FN4B 4CC4A 2JIXB 4G8EB 3T2OA 4EI5C 3RX8A 1ZPUA 1T6BX 4UTBH 4C57C 3RJOA 2E56A 2O5YH 2H47C 4UCFA 1ZIAA 1AIFA 2WB1A 4TLTA 4GSQA 3ZRFC 2L7JA 2X2UA 1QLFB 2WYTA 1SM3H 4JG5A 4K07A 5FXCH 4JM2A 1JV2A 3L45A 2DW5A 2XC8A 4F7EA 3FCBA 4PS8A 3QZMA 5HHMB 5I66B 3BZEA 5DC4B 4Z7AA 1LDPL 4U33A 3UBGA 5EEXA 1CLCA 3LXCA 2EH7L 5F44A 1MCPH 1KB3A 4KUZH 5ID1B 4HKXA 3MROB 3M1OA 3T5WA 5IB4B 1F11A 4PJFB 4F9PA 4OAWB 3A24A 5DU7A 1KZQA 4DFIA 2MOQA 4JG1H 2QQLL 3LIZL 1KTDA 2N0KA 4EUPH 2FH6A 4Z7IA 1PJ9A 2X4TB 4JANB 4S2SB 5E56A 1BF5A 3QUZD 5I8KL 1CXLA 1IIIA 1RZIB 2K4AA 2HN7A 3LH9A 5CJ8A 2D2OA 4IBQA 5HP5A 3MA9H 1NKOA 1HHKB 1QBLH 3GI9H 3L4ZA 5D2LA 5LUMA 2L0DA 5DFVC 1KT2B 1SF5A 4ZYKB 3ARGC 3ZQ9A 4LPTA 5TQ0H 1TO5A 4LNRA 3ZT5A 5JPNB 1PLCA 2ZWSA 4H1LH 4N8PA 2Z7WA 3CBRA 5CWSA 3ZT6A 1ZV2A 2QGEA 1N8ZA 1TFPA 1UXSA 2KERA 2MOVA 1OAUH 3D39A 1KJ2A 2WO3B 2XN1A 5EZLB 2J6EH 4JG9A 5BCAA 2W38A 1I9RL 5J13B 4MD4B 5D1ZI 5EO1A 3JV5A 4Y19B 1GS7A 3GSNB 3H3KA 3EZ8A 1MHPH 3EJYD 3FN9A 3HRZC 4GG8B 4GEJA 4PV1C 4R5TA 3M17A 1CR9L 4ZW5A 3OZ9H 5FKPB 1MF2L 1GMEA 3M1BA 4XBGB 3ZTNH 3WEMA 1O5PA 3NIGE 1FLTX 3FF7A 4R3SA 4B0MM 5HGDA 5ITFB 4Y2DA 1I8IB 4JN1H 1IC7H 4XVUD 5F6HI 4AQ8C 4YZFE 1A8JH 3FONA 4OV6F 4A38A 1CFNB 5EF3A 4OGXH 5DMGC 1YEIH 3U7WL 5HHOD 2JKTM 3LQAH 4N1EA 2WP3T 1A1OB 4BK4A 4DP1X 1ZVHA 1J5HA 2JTDA 3MR9B 1OM3H 4QTHB 3WLBA 1ITCA 1X5LA 5I5JA 1FSKC 2HJFB 4CU8A 3TNNB 1OB1A 4N0RA 3GFUA 4UOW1 2XN0A 4WSGA 1GAFL 4LQFL 5JXEC 5EC2B 3QPKA 1YNLH 1AJ7L 5C2BH 4U2ZA 1U8QB 3MV8D 4OZHA 3MACH 5HDBF 1QQDA 4K4KA 2DS4A 1X9RA 2BOBB 3U4EA 3PLYA 1NDGA 2GB2A 3KYNB 4POYA 4G8AC 1F4WL 1HL4A 1LDPH 2X6BA 4YPGA 4Z8FH 2EH7H 1SVZA 2WXKA 1R5IB 1LM8V 1XAUA 1Z3GL 3NIFE 4CNIB 1T0NB 1XX9C 4LEOB 5E95B 4XPAH 3NN8A 2C3VB 3CFUA 1VCBC 2F53A 3NPSB 5JOEA 3EJZD 3HFML 4YNYB 2QQLH 3TGXA 2H6UA 1URLA 1MCQA 3VH8G 2DM2A 3B83A 1HHJB 1XD1A 1SN0A 3ZE0B 3NRPA 1L7TL 4K3GA 3SCMD 4G7QB 5AKRA 3GEFA 3ATBA 2YPKA 4NIKB 3REVA 5I8KH 3ZHDA 1S8DB 4JDVB 3FQUB 1F90H 4MS8C 4JDZB 1IM9A 1QVOA 3D0VB 4KKBC 4ZS6C 3SZ6A 3TBSB 2VMFA 1PEWA 2ITFA 4HIPA 3IFLH 5JQ6L 3PRZA 1YEHL 1OCOB 2MTPA 4XOEA 4FG2A 1W72L 1T4WA 2BVPB 2WQAA 4PCYA 1EA9C 3OQ3B 4XNZC 5DR5L 3NJVA 3V55A 1J88A 1Q1PA 5CP3A 4AC2A 4IBYA 1A6AB 5DEFB 1I9RH 1KTLB 2Y9RT 4J3BA 4M43H 3EYFB 4OUOA 5I1JL 4DN3L 4OLEA 2ENSA 5ETUB 4FXKB 4HEPA 3MRMB 5ICZB 3RIFF 4GW1A 3ARBA 1OARH 1J9RA 5ENWA 1P4LA 1MW1A 3RWIA 2L04A 4YBLC 3Q6GH 1TF4A 2DL9A 1ED3B 3A67L 3VE0B 4JFFD 4IS6A 4B9GA 4GBXC 3LKPB 3OMAB 2ZWLT 3STZB 4G1EB 1SDDB 1CD9B 4OZFG 4H13C 4OJDH 5IJBC 1VFAB 1AGDB 3GTNA 4ZMXA 2IANE 5IJVA 1HCYA 3I9GL 1ZJBA 2PO6D 4HLJA 3BUBA 3WUWB 3N44F 1X5GA 1OSZA