2CO1A

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (f17a mutant)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
b'DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
total genus 26
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2co1A00
3UIYA 2CNYA 2CO1A 2CO4A 2AXWA 2CNZA 2CO2A 2IXQA 4OR1A 2CO7A 3UIZA 2CO3A 2CO6A 5D55A 2FVNA 4PHXA
chains in the Genus database with same CATH superfamily
3CN2A 2J57A 1G7IB 1OHZA 3LB6C 4KRPD 4XCCL 1NGPL 1XD0A 2N7AA 1A2YA 1JGDB 2EEBA 5I5MA 2ICCA 3SE9L 1JI2A 3FQ2A 4JO3L 4DP4X 4LT7A 5KYYA 3G3LA 4A7VA 3D5OF 5F6HI 1Y6KR 3H1ZA 3RZWA 2P26A 1E28A 2Y1ZA 2OMZA 2QPUA 4N28A 3TEZA 4Q56A 1DL7H 1JOIA 5IVZB 3DROB 5JIQA 4OGAD 1EFXB 3B2VL 4NQXB 4HUNB 1XCWA 4GRWH 4K94H 4O02A 3GJFB 5DMIH 3TJEL 3VE0A 2P5EA 2X89D 1WA2X 1HEHC 3FZUC 4HDIA 3CFKB 5L2KD 4GW4A 1L9NA 3GS0A 3EGSA 4CNIB 1PFCA 4ILDA 3MLPA 1J5CA 4HWBL 4MTMA 1FV1B 3CU1A 2RCSL 5I73C 2O1AA 4S1SH 3HPJA 3SQBB 3MO1B 1BXXA 5LNGA 1DQML 1NCWL 1QFUH 1OZTG 2FWUA 1SXSA 2CR3A 1JCVA 3AREA 4OLVH 2B1AL 3US0A 3ECQA 2R1WB 2GI0A 4R7LA 5AOKA 2QV4A 3JV6B 4OIBA 3VFWA 2EDTA 2QSCH 4E42A 4RSYA 4OZIF 1NIFA 4JFOA 4WCYH 1MLCB 3FHAA 1HCYA 4JHUA 3VXRD 4FQQA 3O8XB 4XGZA 5HGHA 3G6DH 5IQ9A 5D2LE 1WIUA 4JVPA 3ZL4H 4U1NB 1FYTB 1KGXA 5T1JA 4Y4HD 1U91A 3HCVB 1XB8A 1NL0H 3SKOB 4N2LA 4JK0D 1JPEA 1C5BL 4FZ8H 5EO0B 3U0TA 1A25A 3CZFB 4AXWA 5HJDA 4JFHE 4MNQE 4QHNA 2V9TA 4WRLA 3V0WH 3ZJAA 3X12B 2EVGA 1TQBB 1UC6A 2FL5B 4G8EB 4R6UA 3WNLA 4DK3A 2VDLB 3IE9A 4DQOH 4ZXBB 4P5MB 2I60L 4QRTB 4MDRA 1UM6L 1AXTL 1JGLL 3KYOA 4G8IB 4UTCA 4BFEA 1PSKH 2VITB 5ALBL 4L8SA 2NCMA 3MYZA 4XAKE 3GNMH 4GMSH 2GAZB 3QULB 5FIEA 2AGJH 5T3ZE 3BKYH 1B2WH 2FZ3B 1EZUA 3FCSB 3UERA 2IPTH 3L95B 4YGVB 1INQA 4E41A 4IRSB 1MI5B 1DQLH 5E7BA 4JHBA 3UX9B 3L7FA 3T77B 1KB5B 2WNXA 3BIAX 4HUXA 1ETZB 1M05A 2NT0A 1DL7L 4KWUA 4R9HA 2Q1EA 4YHOH 4X6FB 2NW2A 4MQ7A 4HWEH 2JKNA 5GRJH 4F7MA 2DQHH 4K94L 4WJ5A 4R7NB 2IANB 5DMIL 5IB4A 1TVHB 2H0JA 4JLRA 1KTKE 3KR3H 5DUBA 3LEVH 5D8JH 2EXWC 1QQDA 3HZMB 3UTSD 2CO6B 2BVPA 2AK4E 4IMLB 1EAPB 2EDXA 2OMWB 5D7JD 1KACB 1Y6NR 1ORQB 1AY1H 3OPUA 4S1SL 2BMKA 4QO1A 4XCYA 3QIBB 4F92B 2QV2A 2YO3A 4HUWB 2A2QT 3TN0A 4NBZB 3VFUB 3MFFB 1QFUL 2EQDA 4LOEA 3D4ZA 3IDNA 3ZHFA 5BZDA 2ZJSH 5ID0A 4PBXA 4OLVL 3O45B 1IL1A 4L29A 5J3HC 5D1QD 4PJ7A 1KB3A 1ZA6B 2DQEH 4LOFA 3KPPB 2BRRH 3HS0B 3RVWD 1AS6A 4U49A 2ZOKA 2QSCL 2YLKA 3PP4H 2IAMD 4L5FE 2E27H 2PWFA 4WCYL 4HFWA 5E1AA 4CGTA 2FGWH 3UAJC 4TNVK 4YDKH 3QEQE 2XXGA 3MNZA 3WFHA 3VXNA 3CZKA 3G6DL 1PAZA 3WEAA 2KQNA 4QDGA 3ZL4L 4NKOA 5C3TA 3RP1A 3P4LA 2HSIA 1VGEH 1NL0L 4OD2A 5L9DH 4N9OB 1TTUA 1GOFA 4FZ8L 2EXSA 2M8XA 1WC7B 2DIBA 2VXUH 4HGWB 2DQDH 4PJCA 4UILH 4XOEA 3W1ZA 3KJ6H 2QZ5A 3X1BA 5I73B 3V0WL 1NLDH 3B9KD 3FAXA 3IDXH 3K0WA 4QLRA 4DQOL 5IM7B 1IAOB 4APXA 2ENPA 4I18C 4W9CC 2E6PA 2YQGA 1XSKA 3FQWB 2VR6A 3EBAA 1RZJH 1ZT4A 3QARA 4IRZH 3RPBA 5BMFH 1IKFH 5KSBA 3C2SA 3QO0A 2JXMA 1PSKL 4GJTB 5HJ3B 3VXSE 3GNML 1KJ2H 4GMSL 4U05A 2AGJL 2WIIB 4D7BA 1JWUA 3BKYL 1B2WL 2PWEA 1G9NH 1KYOK 2IPTL 5JIHA 4KFZC 1DQLL 1JD9A 1MCQA 2UXVA 1WK0A 3BEWB 4PJ9D 5T3XH 5IHZA 5J1AA 2DWTA 3JZ7A 3HC0B 1ZXKA 5DI8A 3T6VA 4MRCA 2H32A 4EF3A 4YHOL 1F3JA 5T1LB 4HWEL 5GRJL 3QGVA 3EJUA 3WFCH 2DQHL 2PCFA 4Q74A 4I0PA 5ICYA 3KR3L 2H2SD 2HJLB 3DJZA 4F9LC 3D3VA 3LEVL 4Q14A 5D8JL 4F7EB 1QKZH 4WU7B 3M8OH 5CLWA 1D5IH 3LOWA 4AYFB 3DYOA 4ADGA 1E50A 2D0HA 4HJJH 4JFFA 2YUWA 3F05A 4LPUA 1I3UA 4MNHB 4ECNA 3GM0A 1MCCA 2MOQA 2CK0H 1AY1L 5B38A 4YJZL 3OAYK 5JIPA 3KPRE 1QFPA 2CBTA 2NTFA 2G3NA 3JWDH 5EC1A 2AABH 4AM0A 4FNLH 2ZJSL 2LR4A 1NGQH 4M4RA 5MHSE 4LKXA 3TFBA 3RGVD 2QELA 1SJHB 1YECH 1XCQB 1KJVA 2FH8A 2QEJA 2DQEL 4BH8A 4QRSA 2MEJB 2BRRL 4CVZB 4XVOA 3PP4L 4N90D 2IG2H 1H19A 1RZGB 2E27L 3LRKA 3V5KB 2WQAA 5A2BA 2FGWL 4YDKL 2C9QA 4PB0H 2I32A 1S5IH 3EOBA 4RMVA 4JJOA 1HKLH 5ES4B 1NCDH 2B3RA 1VGEL 5H2BA 4FRWA 5L9DL 3VXMD 1NUDA 2P43B 1HXYB 2DM7A 2YUXA 4UILL 2VXUL 2DQDL 2V0AA 3D50A 3QCTH 3DDFA 3KJ6L 2XIDA 3II2A 1NLDL 2XN9E 4RQQA 3IDXL 3EYVB 1IVLA 3JT0A 1KYAA 5GZOA 2HA1A 3BWAA 4A7GF 1WS8A 4CN4A 2QHLA 3MLRH 1EEZB 1RZJL 2B1HH 4IRZL 4U6HA 5BMFL 1IKFL 1NPNA 4FDWA 4NHUB 1K8IB 1BJ1H 2F53A 3APNA 1KB9J 1KJ2L 5E4IA 3ZKMD 3VD4A 1AGFB 3ZDYB 2Q86A 3BSZA 2JELH 1U3HC 1GZPA 4JGNA 1ZK9A 1G9NL 25C8H 2B20A 3QQ9C 2WB7A 5EF0A 1KUMA 2W8CA 2FJFA 3FBKA 4QRAA 4QOKE 3RWCA 5IB3B 5T3XL 5B3JE 2BHYA 3FN0H 2RB8A 3GZKA 1ZRUA 3WLWD 1HK6A 1TYEB 3HB3C 5CD3B 1G7JA 2O6CA 1UWFA 3WFCL 1F11A 4HW6A 2P44B 3NCBB 4RESB 4XCEB 3RB5A 1QKZL 4RSVA 4I1PA 3M8OL 3VFRB 1D5IL 3MYJA 4I18B 1D9KA 3RKDD 1XCTB 2BP8A 3QBTB 4HJJL 3UBXA 43C9A 2VKXA 1U8PA 5DMGC 3EF7A 2R8SH 1PMYA 1XF5B 2CK0L 1EHXA 2VUOA 1OGPA 5KVDE 2A6IB 8PAZA 4KI5C 3BPCB 3JWDL 3BLBA 3TBVB 5KBKA 2AABL 1EJOH 3FOMA 1GKOA 4FNLL 2OA9A 1NGQL 3NFNB 4NOFA 5C09B 3VJ6B 4NC1C 1R46A 4PJ6A 4QXUH 1BZEA 1YECL 4JPSA 2B2XH 1II4E 4W6YB 2XFXB 3IJHA 5GGRA 4X9BA 2H45A 2B9AA 2W0FA 3OM3B 2IG2L 1UXWB 5DC0A 2BZ7A 1A5FH 5LXVA 1ZHNB 5JOPD 3FRUB 3OXSA 4MD4B 2JI3A 1CG9B 2Y2WA 2ODHA 2YWZA 3NPZB 4PB0L 4X8GA 3V0JA 5HYSA 4S2SB 1S5IL 2GCYB 2PW2A 3HRZA 3S36H 5DR5H 4LL4A 5CLZA 4JDTH 4Y1TA 1HKLL 5FW7A 1NCDL 3UJIH 1M57B 3OG4B 2PLTA 3UCRA 1CICC 3UZQB 1WDAA 5ESQA 4C56B 3ZMNA 3IU4H 1SDDA 4E5XB 2QMKA 1PZUB 1MXGA 3O8XD 3QCTL 3D0LB 4XH2A 5EIIB 5LBGA 1EMTH 3CSTA 3CC5A 5KWYC 1FYTD 1IGYB 1X5YA 1YRKA 1I1YA 3MLRL 1OT4A 2B1HL 1UWXH 4TNWK 2UY7B 4XTRD 4DP0X 3ELAT 3K91A 5I6PA 1KV7A 5B3JF 4KNSA 1NUGA 4RGND 5KUKA 3KWXA 4N0FB 4L37A 4ODTH 2JELL 1MUJB 2ADFH 4LLMB 4UZUA 5JHDB 25C8L 4W9FC 4P23C 4KOBA 4UQ2B 5BRPA 4TNEA 1YUHB 2AJSH 2YWYA 3ZTNH 3TO2B 1AGBB 4WJKB 3FN0L 4JN2B 5IFJB 3F62A 3QCVH 2VDQH 2WCPA 3VVVA 1UFUA 2YXFA 2BY2A 3ESUF 4UNTA 1IV8A 2PYEB 2W91A 3C8KA 3DURB 3LPPA 4DWHA 4RZCB 4HH9A 4X7EC 5EEUA 5MEPA 2HFEA 5K9KA 2K4AA 4PD4J 4IRSD 4PUBH 1MI5D 2XX1A 4TRPH 1T04A 1BMZA 3TVMA 2NY3C 5ALCH 3RZCD 3BWUF 4KMLB 3ALXA 3GSXB 1H5BA 3EJPA 4FG2A 4S10A 2X4UB 3ETBJ 1XZ0A 3PABB 4ISVA 2R8SL 3NH7H 3IJ8A 3K72A 1AC0A 2DN7A 4NO2B 3WIFA 4FKKA 3ULUH 3ME0A 1YEIH 1EJOL 4MA1C 4LGSB 2P8PB 1QAWA 1U3HB 1UH3A 2N4IA 5IMOA 3FQRB 3TH4T 2JKXA 4QXUL 5DJZB 3HMXA 1BCIA 3FU6A 3QXUA 3Q8CA 3KXFB 2VLME 2XZQH 2B2XL 4TNVF 1S9XB 2GFBB 4XVUD 3LB6D 2F2HA 5IW6A 4XP5H 1ULVA 2EKJA 2KLTA 4FCHA 4P2OD 1A5FL 1JERA 5D5MB 1FBIH 4MXQC 2R2HB 3Q13A 1MVUB 4PY8J 3PL6A 4X80H 5I17B 4IU2B 1FL6B 5AG8A 4QT5B 5TH2B 3S36L 3D39B 3BVDB 5DR5L 2ZWNA 1SXNA 4JDTL 4HT1H 3MJ7A 5DJ2A 3ZQWA 2C7UA 2ICWJ 4N2MA 4W1TA 3WV0A 4EUPB 3UJIL 3V7AE 2BIHA 5D7LA 3ZKNC 4BZ1A 4LHUB 3IU4L 5FO9B 2V5YA 1Z9NA 4RDBA 4ZMOA 3LNGA 4UF7C 4NI3A 2ENQA 4LEEA 4FYRA 3WLBA 5CCHE 1EMTL 2GTWB 2IDTA 5E8PA 3T6XA 5IEKA 2WZPA 4N0UA 5LBSA 3EO1A 5ENWB 2JMRA 1ET7A 4DETA 1VPOH 3SDAD 3RWDB 4YDLC 4X8JA 3SYCA 4B9JA 4G42A 2DRUA 1AGDB 4ZNEE 1RLWA 2X12A 2X70A 1H6TA 2WXIA 3RY4A 5I75C 3EF4A 3IPFA 3T0ED 2FSEA 4ODTL 2EDEA 3NJXA 3VH8B 2LHAA 2ADFL 4MDJA 1DZBA 1N59A 4YBLC 4FQHB 1L3WA 3MROA 2AJSL 4Y2DC 3PDOB 3ZTNL 4Q97A 3QCVL 2VDQL 5CEZH 5A2IH 5IR1A 5D7HA 4HIIB 2WY3B 1CICB 2VERA 3PWLB 3HJEA 2ZXQA 3PREA 5CSBA 1A8JH 1BBJB 3V6OE 2PTTB 4PJGE 2BWQA 2VDPH 3VWJD 5IBUB 2V7NB 4PUBL 1JV2A 1PYWB 2HFTA 2I25N 4TRPL 1TQCC 3KS0J 4KJQC 3LSOA 2JTDA 3X1FA 1XT5A 1P5VB 2VM9A 1DBKH 4Y4FC 1A7NH 4XMWA 5ALCL 1CI5A 4OGQC 4J3UA 1P4LB 1ZD6A 3MRLB 3MRFA 3X2QB 1T4KA 3NJVA 4BCXA 1XBRA 2OJZH 1TENA 3P73B 5ANMA 3NH7L 1LO4H 2Z31C 1KBWA 4D0CB 1AP2A 1VGKA 2KLRA 1J10A 1PY4A 4MQTB 1P2CB 4RRPG 2JQZA 3ULUL 1JPFB 2BM3A 2RGSA 1YEIL 5JMRA 3PGDA 1X5HA 2ARJA 2UUDK 3HNVH 4I3GA 3MRQB 4Z3JA 3LZRA 3QEUB 4IU3B 3D69A 1VIWA 2J7LA 4HLJA 4UDTA 4P23B 4NKDA 1G6RA 2XZQL 1Y1DA 1REIA 4N8VG 3RHWK 3O81A 1E7VA 4XP5L 2ALAA 3WUZA 1RZFH 1FBIL 4PP2A 4X80L 2VDRH 2J8OA 4QOKB 4NB7A 4AGPA 5CUSH 5LNDA 1RLBA 3RRQA 3TNMB 5IK3A 4OQTA 5IBLD 4HT1L 5FKAB 3UTTB 4U31A 4HHAA 5E8EA 1FNFA 1FGNH 4L05A 1P7QB 2AJVH 4WGKA 4UM9A 3EYSH 3U4KA 5FOBB 2ISDA 2YC1B 3DHMA 2Z0UA 1IT9H 4N1CA 4XO4A 3T3ME 4B7LA 4JZOB 5A1AA 3MRJA 4BXVA 3C12A 4YLQT 5DXWA 4LEXH 1ZCRA 1GMIA 3RWHB 2EXWD 2H1LM 3CXDH 1JZ8A 4MA1B 1VPOL 1OAKH 3VSUA 2X1WL 4A7QA 2R27A 1IAIM 4WO0A 2NX5D 3MRNA 3NA9H 4JRWA 4L0YA 1LK2B 2XFGB 4HISA 1RPKA 5TDPA 3K2MC 4CA4A 1RH8A 5BXFB 2JLLA 4KY1H 3BIKB 5EOCH 4LVEA 3QDMB 4M1CD 2A3TA 4PJGF 3FQ4A 3NJIA 2HUHA 3RVXC 3FH5A 3QISA 5J3HD 4DGIH 3VFVB 3ZL1A 3OKOA 2BIQA 4HEME 4XP1H 5CEZL 1FHGA 4WGVB 4HSCX 3IJYB 4OLYH 3NBNA 3WTSA 2OK0H 3UAJD 1AS7A 2VDPL 3ESMA 3GUTB 1ADWA 5DQJA 4XHQA 4EI6B 2V2TA 5I8KH 4OKVB 1DBKL 1A7NL 3FTYA 1GS7A 3GBDA 2XQYA 4HOXA 1N4XH 3ZDXB 5IJKC 3AS0A 3V8OA 2CO1A 2OJZL 4AYSA 4YDLB 1LO4L 4CMHB 4R2GC 4P9HH 4Y16D 4X4XB 3IDIA 1A4CA 1Q94A 2E47A 4YSEA 5I75B 3VNYA 3IMRA 3RVVC 5L2KE 2GW5A 3HNVL 3U9UB 1XGPB 1NGZB 1AG6A 2O6FA 3RJOA 4D3CH 1TJMA 2XYCA 4QRBA 3E38A 3NK4A 4XP9H 3AUVA 5DEFA 3ZT5A 4WF7A 5ID1B 4YBLB 1FL3A 1MN4A 2HZHA 4F15C 4Y2DB 5CR8A 3LN9A 3GD1C 4KGLA 2A9MH 2CDFB 2VN7A 1RZFL 1YC7A 1YSOA 3LCYA 4NAQA 2VDRL 4B3VA 4X6CE 3WY3A 4YHMH 1TVBB 4G80A 5CUSL 4Z7AA 1OE3A 1QEWB 3PHQA 3T3MF 2EUXA 4NQQA 4CDHA 1HZLA 1TQCB 2W92A 1RQ5A 1GGTA 2OI9C 2PTVA 1FGNL 4TUOB 4CVXB 1SEBA 4NUGH 2AJVL 4TNGA 4X5RA 4Y4FB 2BVOB 3AQZA 3EYSL 2R0WH 4FNQA 3SDDC 3BYYA 3D4GA 4NOBA 3W0WD 4ZW8A 4O2EB 2WNKA 3VXRE 1INEH 4GFXA 1ETJA 5IF0A 1DSYA 2AC0A 1IT9L 3QA3A 4R0LC 1PD0A 1IEBB 2Z31B 5EU6E 3AU1B 4DJMA 1QX1A 4FHBD 1KENH 2XOTA 4MX7B 2RACA 3DYPA 4LEXL 3VFTB 4A7SA 2BP3A 3FB8B 3CXDL 5FECA 1KXHA 3K5SA 1OAKL 3LQZB 1EJ6A 5TF1H 3QJHB 1QTSA 3NA9L 5EORH 3QPXH 5JORB 4X6DA 4K7FB 1SOKA 1CDHA 4LMQE 2VDMB 1U8JA 3H3PH 4KY1L 5EOCL 5HDBE 2HT2C 1SUJA 3CBRA 4Y9FA 4OFYA 4ZMYA 5AW0B 2XJKA 5HVGB 4MJID 1FVEA 1JWSA 1DEEA 2YBRA 4ZUSB 3TJHC 3ZY7A 2P5PA 4DGIL 2EUZA 1VADB 5DA0B 4MA7H 1OPOA 4XP1L 2WZAA 1ECZA 2DF3A 5C2BH 3IXAB 5D4HA 3OR6B 3ZR6A 2A4CA 4OLYL 3AG1B 3QJXA 3IE4A 4WZ9A 1IEAB 1RZKC 1WFUA 1WFTA 3WFDH 5JHDD 2OK0L 4RFNC 3FOLB 2J73A 4DEWA 2B14A 3B2PA 5AZUA 2A99A 2R23B 5I8KL 2VLJD 4Z8FH 3JTBA 2WWNA 1A1MB 5IT2H 4V33A 4CC4C 2WBKA 3VG9C 4RIRB 3FK3A 1N4XL 3DGGA 2PYED 3CHRA 1KXTA 4UTBA 2DEXX 4OZHA 1NC2B 2K70A 4K5OA 4DZBA 4P9HL 1HHKA 1BQKA 5DC9B 2LOEA 2R83A 2Y23A 1MW1A 4JANA 3GJFK 3WHXB 4X6CF 4MJ5A 3V6FB 1QI5A 4D3CL 1AVAA 4GNKB 4XP9L 1R3KA 2H1PH 1E8XA 4MMXC 3TLRA 1NDGA 1OGAA 3BFWA 4LARH 4Y19B 4Z77B 2YAPA 1I8MB 4NKMA 1IE4A 2HYMA 3GRBA 4JBSA 2A9ML 2F54B 4DHLA 3QK0A 5FV1L 1N64H 2I07A 1U3HD 4YHML 4JPIB 3HUJE 3V4PA 2AMUA 3QIWD 4HUKB 5D1QE 5CCJA 3QQ9D 1ACYH 2CLRB 4CVWA 4MMZC 3EH3B 4F91B 3DXAB 3L4WA 3TJPA 4NUGL 1GZQB 4DPBX 3NP3A 3VWKC 4DVRH 2W0PA 5I6XC 2R0WL 2OR9H 5JO5A 2ZIDA 2NOYA 3HB3D 1OT1A 4XRCA 1INEL 4N2GA 3N06B 3VX1A 3TIEB 1IKOP 1YVLA 4B0MB 4BGDA 1T0MA 2C3WA 2UX6A 3D39D 4L8BB 2I9TA 1D6EB 2WKOA 4LSPH 4R2GB 3KYNA 3ROOA 2RIKA 1KENL 5HDBF 2JKJA 4LHUD 4G8GE 5E6RB 3H9SB 4DOHE 2CLZA 2X87A 5TF1L 1AGCA 5J0BA 4ZI8A 1HH9A 5EORL 3QPXL 1F86A 3SE3A 3BQVA 2MMXA 1NJ9B 4O2CA 3DO3A 2BY1A 4F15B 2HKFH 3WKMH 5F0PB 1GOGA 3ZRFC 3H3PL 4BBWA 4NQDD 1M3IA 3ZK0A 2H6UA 2CO4A 3S3DB 3AXIA 5K9QI 1M6OB 1QPKA 3DO7B 4F2MA 1UXMA 3QNYA 4OV5B 3EGXA 2G9HA 4MA7L 3RWFA 4ODVH 2XIBA 5CJQH 4GG6B 1T5XB 1FQ9C 5C2BL 2OI9B 2X4RB 4PWFA 2N3JA 4RETB 2ODIA 1J8HB 3SDDB 1R3LB 3WFDL 3IAGC 4GI9A 2X2IA 3FTVA 1J1PH 3LZPA 3P77A 2E8YA 3H9ZA 5INCB 4ELME 3K3QA 4DP6X 3HI1A 5I8OH 3FU5A 4R0LB 4PJFA 5E6IA 4Z8FL 1I7UA 3M45A 3FW6A 3QDJB 5IT2L 1T7XA 3IVKB 4B27A 3CFBB 4JFUA 2Z92B 3GXIA 4PJDF 5D4JA 4PGBA 1VJSA 4M7LH 3ERXA 3ZE0E 1BAWA 4NFCA 5F8QC 3DIVA 3LTVA 1GJIA 1HHHA 3MV7A 3GT6A 1QSZA 1TF4A 1LYQA 2ADIA 4OCLC 3U83A 1PZ5A 3HUJF 2FJSA 2ZCHH 2B4CH 2X6CA 4KPHH 3AACA 3ILQC 2H1PL 4FYQA 3D25A 4LARL 4AMKH 1L6XA 2RBLA 4JQIA 1T83A 4TQIA 1O6TA 3DX2A 4QWWC 2GG1A 1N64L 2GEQA 2ZCKH 1N8OE 5C0IA 5B3SB 3FHEA 4ZAKD 1RL1A 3D30A 5AKVA 4P23D 5J6HA 4RFNB 1ACYL 4ENZA 1E9QB 2XV3A 3A67H 3RDTD 4N90E 3AWFA 4I7ZC 4PP1D 4DVRL 1QBBA 4F7PB 3VG9B 2OR9L 2DOCA 3FQNA 4P3DB 4W9ZA 4Z7UE 4FHJA 4BZ2A 4RNRB 2XLLA 3SYPA 3ISRA 3OC5A 7PAZA 3B37A 2CUIA 5KANG 3IN0A 4LSPL 3SKMB 5SX5K 4U1GC 2CKBB 3UTTD 1JCKA 4BGLA 4J12A 4YR6A 4V1DA 1P7QD 1J5OH 4G70B 2NY3D 1VZHA 2FIRT 1E5BA 3C75A 2UYLA 3OZ9H 5EMYA 5HPMB 5B39B 3LH2H 5GGUB 4K3EH 2MKLC 1IM3A 4MMXB 4ORZC 1XSIA 3RVTC 5LGYA 3O3DA 2HKFL 3NIDB 4KKQA 3WKML 1F4YH 2HRLA 4O58H 3IMTA 1GY2A 3RY6A 5C9JB 1RJCA 2AF2A 4ELMF 4PSRA 1BZ7A 4PRHD 2C9UA 2HKAA 5C86A 4ZMNA 5CFAA 2JF1A 4I3SH 2Q3AA 4MMZB 4L3CB 2X2JA 4ODVL 3JWNC 5CJQL 4QHLA 3FUEA 4KKLD 4FNSA 4LLVA 4LMQI 4KX8A 1X44A 3VWKB 5I6XB 1XVSA 2FX7H 3QDMD 2QSTA 1J1PL 3BSHA 2BNUB 3ZE0F 4P46A 1UD8A 3NAAH 3WEXB 5I8OL 3ZT6A 5GGVH 3W9EB 2UXFA 4Q89A 3K2IA 1QA9A 4Y5VC 5KVDH 5EO9A 1C8PA 3ZYZA 4M7LL 4OCXH 3GB7A 5IB5B 1DVFC 5INDB 1DLHB 5CMAB 4FYSA 1EBPA 3VM7A 1RKRA 1D5XA 5HY9B 1A7QH 1C5CH 1R3IH 1TIUA 2ZCHL 1D5BB 2B4CL 4KPHL 5ELIA 4H26B 1OPGH 3NQKA 2DTSA 4U2ZA 4AMKL 2VDKB 3VXQA 4Z7VA 2MHAA 4JFZH 4XNZC 2QVFB 3LEYH 4UOZA 4JFXA 5F1KC 4Z7UF 4L4VE 2O93L 2ZCKL 8FABB 1YMMB 3N9GH 4MDIB 4LNRA 2NY5C 1KLFB 1VCBC 2BXZA 3UDWC 3GMPB 3A67L 3Q48A 3JYBA 1CC3A 5JYLA 1FNEB 1N6VA 3UABA 3BGMB 5FK9A 4L8DB 1CFVH 5T1KB 2O5ZH 1OCRB 4NPYB 1OE1A 4YO0B 2YD7A 5F1IB 4IOIA 2XY2A 2YAHA 1KCSH 3E7JA 4Z95H 4WHTA 1HEJC 1ACZA 1J5OL 1PFOA 2A6DB 4Y88A 3X13B 2I69A 3APMA 3KWVA 3S5LA 4LO9A 3JWOC 5JIMA 4JQXA 3OZ9L 1IQDB 1FAKT 1ED3A 1LMIA 3LH2L 4U1SB 5AYTA 4ZDHB 4K3EL 3JTTB 3VFNA 4AGQA 4PJEA 2Z31D 1Z66A 4DP2X 4JO1H 3FCUB 3CN1A 5I1GH 3KE0A 1URZA 3GUFA 4PJDB 1NTDA 1T20B 1F4YL 2FTAA 2FECI 2X42A 4ICXA 5AVVB 3DHUA 4O58L 3P3YA 2KZ1B 3LEXA 4UIKH 3TBSA 1XH1A 2AFNA 5AW7B 3C5ZC 2ZNWA 2D8KA 4NGHH 3GO1H 5HXMA 3Q05A 4L9LA 3VXUA 4RGNE 4I3SL 4CBZA 4AKOA 1H8LA 1SLXA 1JYXA 3FT4B 35C8H 4LP5A 1C08B 1ZVHA 2AQQA 2FX7L 2D31A 2GC4C 4WNJA 3NAAL 3GXDA 4XVJH 4BXSV 1NCJA 3GXTA 4MVBD 5G2NA 5GGVL 3QFJB 4LP8A 4PAZA 1U8HA 4U1GB 1CT8A 3DX7B 1OXYA 1SXBA 1NC4B 2OTUB 2MQ3A 1PDKA 2DYPB 4IRJA 2A7BA 5FLUA 5KVDL 3JUZA 1LE5A 5SWSA 4OCXL 2JVUA 5EZLA 2A73A 2ZWZA 4M8QA 1FPTH 1T6WA 3OAYH 5CWSA 1U8IA 4AVJA 4G8GB 2RJMA 3BMWA 2ATPB 4Q8BA 4YFEA 1VACB 1A7QL 1FVDA 3ROLA 4BINA 5C8JA 1C5CL 4YE0A 1R3IL 1QYGH 2B3IA 4U3SA 1NCNA 2X41A 4B9ZA 4PJ5B 5H37H 3BZ4B 3DK2A 1GJUA 4XB8A 1OPGL 1BAGA 2R56H 3NCYP 1S9YB 3QZPA 3NSXA 1DUYA 4JKWA 4YSPA 3I02A 1PX3A 4C4BA 2F6AA 5BO0D 4JFZL 1FFRA 1TU2B 3LEYL 2CGZA 4X7CC 4PJXA 4JRYA 4ATWA 1EK3A 3QDHA 3N9GL 1A3LH 1ZY9A 3CDGB 1P84K 5K59E 3MRCB 4XNUH 3ZL2A 4LDCA 1AHMA 4PLJC 4D94A 2F54D 2NR6D 3KBFA 1QTPA 4LEBA 4J3VA 1TDQA 1CFVL 5IMKA 2O5ZL 4Y5VB 3QEGH 4P0DA 4C4KT 1DVFB 2XCMC 2F18A 3ES6A 1KCSL 4Z95L 5IVZA 3DROA 1QEXA 3D34A 4OJDH 4CADB 1EFXA 3MRGB 3IEAA 1CYXA 3VO0A 3RILA 2DIJA 2ZAIA 3DMMC 4WJG3 2ZG1A 4G9FB 1KLGB 1HKFA 1XBDA 4JO1L 4FLOA 4CNIA 5I1GL 4R2GD 4PYGA 5SWZD 4Q9RH 2PABA 4W9EC 1FV1A 4WWKC 1L0XA 3GSNB 4QHUB 1A66A 3RVVD 3H9SD 4XNZB 1CD0A 3P3SA 3SQBA 1G7LA 4UIKL 3MO1A 2JJTA 4JRXD 5DHMC 1FJ1B 4NGHL 3GO1L 3ZE2E 1E4HA 2IMMA 4N3TA 3T0EE 4FQ2H 1OM3H 3W5MA 3QZWA 1OCWH 2R1WA 3NN8A 35C8L 3DJSA 3PWNB 3NVQA 3SKUD 3MNWB 4UBDC 4WTZG 4XVJL 2WXFA 2BSEA 5CHNB 5B1BB 3LKRB 4JE0A 1MLCA 3K8LA 5ABZA 2ZP8A 3S9DB 1JYVA 3O8XA 3VM5A 5BJTB 3CFUA 1B88A 1J8HD 1WSST 3ESNA 3SDDD 4A2HA 4JZNB 1UEYA 4U1NA 1FYTA 4P07A 1FPTL 1O0VA 4N9GA 3SKOA 2VUKA 1CD9B 1DEDA 2R51A 3N85H 5JPMC 1XB3A 3QDJD 1DVTA 5EO0A 3LQAC 4YNYA 5FYKD 1R5VA 3A24A 1QYGL 4NPKA 1WH0A 3VGFA 2WXGA 4KJPC 3WJLA 2FL5A 4HJEA 2R56L 3C5ZB 3GZPA 4ZXBA 5K59F 3HPLB 1BWWA 3AITA 2AVGA 4ODWB 1JDDA 4FKEA 4NRYB 2VITA 2HT2D 3KCWA 3BCFA 1TITA 4JRFA 1JHTB 2GAZA 1A3LL 5HVHC 1VESA 1NUNB 1YQ2A 3QWOA 3ILEA 5CILH 4PJ8C 3IB4A 2ZUUA 4XNUL 2FZ3A 3V0EA 2VMJA 3FCSA 4JFQB 1TZ8A 3I6KB 3L95A 4OSUH 4G72B 5DJDA 3QEGL 1NAMB 4OFPA 3T77A 3MJ8A 1ETZA 3FRPG 4HG4J 5FDWB 2DW5A 1FG2B 2WVSA 3LZLA 4X6FA 4Y1AA 3GDCA 4F8PA 3S96B 3M17B 1AQ8A 1UFGA 2IANA 4R7NA 1BHGA 1NGWB 2AW2A 3KPLB 3ZMRA 2W80C 2OMNA 3UROR 3ZE2F 3HZMA 5E5RB 4Q9RL 1EAPA 1YNKH 2OMWA 1OP5K 4AWJC 4K3GA 4M7LT 5E00B 2PWGA 3QDGE 2VLRD 2XG5B 5E70A 2YFOA 1DE4B 1ORQA 3CSYB 3VXPB 3QIBA 1RJYB 1S5HB 4DFHA 2WHVA 3I9PA 2NX5E 4OBSA 3VI3E 4EN2A 3VFUA 3RQ3A 4F7CB 5CN1A 1MWOA 4IKIA 3OD3A 1AKJD 1T3FB 1OB0A 4FQ2L 1OM3L 4ZX6A 3O45A 3X1NA 1BSIA 5F3HB 1OCWL 1OKEA 3WN5C 1ZA6A 4WEUD 3N5AA 3F58H 3KPPA 5D1XD 3HS0A 3P2DA 1IBFA 2YD4A 2G4EA 4A2DA 4PR5A 4J3SA 3ALPA 4FC3E 2GJ6B 2EINB 4WI8A 4AYBA 3ATBA 1T0NB 1RV6X 4FAAB 2EVJA 1J8SA 4MCZB 3VWKD 4JY4B 3CLWA 3KHOA 1HAUA 5EFIB 3DMMB 3U0PB 4L3FA 1NFDE 1I82A 3HBGA 4PWIA 2YAOA 2DB8A 3F8UB 4KKRA 3DX1A 2YKLH 1SXZA 3N85L 4KUZH 4QRPE 4HGWA 3S2CA 4H20H 5D2NC 1Z0NA 1EO7A 4UAOC 3NCYS 3EO0A 4HZ1A 4U1JB 4WWKB 4A68A 1EDQA 1IAOA 1MY5A 2BY0A 3K80A 2HT4C 5CNHA 5DD5H 5FCUH 1I8IB 3FQWA 4OFKA 1IMHC 4LGPB 4QHPA 1HWGB 3PQYB 2X7LB 5HJ3A 5M95B 3FN3A 5GGVY 5IOPB 3S4SG 5IQLA 2MIZA 2VXQH 3Q2WA 3K4ZA 5CILL 3ZYIA 2J12B 2CRMA 3OX8B 2DI8A 4YIQB 5E9DE 3WNKA 4OSUL 4QY8B 2X4NA 3FO9B 3V5HB 2Y24A 4LLUB 3HAEB 5H8DA 5GS2D 2P46B 2YGVA 4G7SB 1YMMD 4FN0A 1U3NA 2WP3T 4OZGE 2RD0A 5EBGA 4HSQA 1UM4H 3EJSA 3HC0A 1TYRA 3SZ6A 1EHLH 3P9MB 4PV9B 5T1LA 3KNBB 2X10A 5JPMB 2ETWA 4NKQB 3QVAA 1H3UA 4HWZB 3W0WE 3ZHNA 3VI3F 4FFYH 4JM2C 3CSGA 3EIFA 4IS6B 4WU7A 1FNGB 1JZDC 4PBVC 4W68A 1YNKL 4MNHA 1C7SA 2X3CA 3QZMA 1B0RA 1IKNC 4YAQB 5I76B 1I75A 4PJHF 2XPZA 1QP1A 2DDQH 1DHKA 2EILB 3ESOA 4P5RA 1E0OB 5HVHB 3ILQD 5F3FA 3WE6B 1FHNA 1ZTXE 4PJ8B 3KLLA 4XZUA 2EABA 4DESA 3KLAB 5DWPA 3IXTB 1KBKA 1SJHA 1CVRA 1XCQA 4NUMA 4QWWD 4E36A 1OW0C 3F58L 3CK0H 3DECA 3WJJC 4MJIE 1NFDF 3FF8A 4CVZA 4XMTA 4WK0B 5I0DA 1ML0A 3V5KA 2UVEA 1OOWA 3MUHL 3R7QA 4PIBA 1XH3B 1QZNA 5FDYA 5E5LA 2HFGH 4S0TD 4XN5A 4PBWD 3FTGB 2BP0A 3SE4A 4PJAE 1OO2A 2VLJE 3QFJD 4YDZA 2YKLL 3TBTB 1HXYA 4KUZL 5KJ7E 4H20L 4OD3H 2UUDH 1NC4D 4FTVB 3TBCA 3ZYOA 3D85B 2EDNA 3A6OA 2PCYA 5DD5L 5FCUL 4FEMA 2HXAA 1CN4A 1G5GA 1EEZA 1E6JH 5G5DB 5J89A 2X6UA 4NHUA 1F2QA 3LRLA 1MCDA 5J06A 2F74B 4ZYKA 4NT6A 4D9RD 3WN5B 3HN8A 3VU2A 2VXQL 5HGBB 3JUYA 5IGXH 1G7QB 3CJJA 5IUSA 2ALWA 1KTCA 5IJVA 1PLBA 2XG4B 1EZLA 3MJ9A 2VZVA 5IB3A 1TTGA 5HYJD 1NFIA 5CU5A 1UM4L 4KMQA 1J9RA 1EHLL 2R15A 2YEZB 2CHXA 5CD3A 1PZAA 1ZLUK 3MDJA 3TWCH 4E9LA 5F88B 3OXRB 5D2NB 3WO3B 4UAOB 3GMLB 2CDEB 1I4FB 4FFYL 4MJJA 1R5IA 3BP7B 5E8OA 1HHGB 4XCEA 2WLLA 4P5TC 3U6RB 2DD8H 2WLNA 4XOBA 3VFRA 4YLCA 1EZVY 5IIEA 1GGUA 1XCTA 3I9IA 4MNQA 1YY8B 3CVHH 5C0EB 1BYNA 3F7LA 1QVOB 2FUTA 2EDJA 4LLWB 3ZQ9A 2ADYA 1X9QA 4PY7B 1PY9A 5ECJE 2DDQL 3PRZA 1CF8H 2IDSA 3BPCA 3K2KA 4WV1C 5FYLE 2XETA 3CE1A 4RA0C 3RFZC 2HP4A 2ZSWB 3MLZH 4UIMA 4NQDE 5C09A 2O5NA 5DU7A 3DV6B 5GIRA 3VJ6A 5FR3A 2IOMA 4AYID 1MFMA 1VB9A 5CKAA 3CK0L 2I9LB 3T2NH 3ZVVA 2X0UA 4OFIA 2DJ4A 1QBLH 4XCNA 4Z0XB 2BW4A 1ZHNA 4NS0A 2X9WA 3F5WB 5SV4A 3FRUA 4K3HA 1M1XB 1OM9A 1EX0A 2LU4A 4S2SA 3NDZE 3OKNB 1HJBC 3OKDA 3Q9PA 1COBA 1L9RA 2HFGL 4ZTPH 3TZVA 5FYJE 4R26H 4F8OA 4JM2B 3OKMB 4ZO9A 1EAJA 3VFMB 1EGJH 4C56A 1KPRB 2F8OA 1MELA 5BUAA 3T6WA 4E5XA 1ZDQA 4OD3L 2B5IC 4G6KH 2JWYA 1ES0B 2F7OA 3EH4B 3D0LA 3FB6B 1BIIB 3I74A 3RUGE 4EI5A 1S8DB 3LKPB 5TPWH 5LO7A 5J11C 4R7VA 1Q4NX 1E6JL 3E1F1 2UY7A 5ITFA 4IHOB 2AI0H 1MJUH 2XVKA 3GEWB 4LGRB 3OKKB 4TV3A 5J4MA 2WQWA 3C5ZD 1KN2H 1ZTMA 3HLKA 1K3ZA 3I2CH 5AOLA 2BX5A 5IGXL 4QTHB 7CGTA 1MUJA 4JFWA 4PJHB 3MLTB 4EN3C 3SSGA 2FECL 1YUHA 2RQEA 4OFQA 3D9AH 1AGBA 5GQBA 3TO2A 3WIHA 4PB9H 3QEQA 5BZZA 2NY0C 1QRNE 3DURA 4OFDA 1IGJA 2BZCA 4RZCA 3TWCL 2JB6B 4RWHA 1FL5A 1UURA 5FUCE 3S3SA 1NFDB 4NO5A 2ZICA 3UPRB 5HPOA 4QRPB 2DD8L 1K72A 4GXFA 2P42B 3U36B 4IOSD 1DLFH 1YYCA 3CVHL 2WLMA 3GMMA 4HJSA 4JRLA 2Y9RT 3FU9A 5TE6H 5K39B 2XRAH 2IXQA 4UYQA 4NO2A 1CF8L 4U7KA 5A6LA 5BRZD 2P8PA 3FT1A 2CNZA 4J8RA 3MLZL 4JPKH 3SGEI 3VXSA 3FQRA 1T80A 4UT6H 5DJZA 1IBBA 4FQXC 5DJAA 2A9BA 2GK0A 3KXFA 2OTWA 2GFBA 2ZKMX 3T2NL 3V5DB 4A7GA 4A6YH 1QBLL 3CG8A 4X7SH 2BRQA 5E9DB 5ISZD 1XXDC 1MQ8A 5I17A 1ROCA 1FL6A 3B7UX 3RI5F 4KQ0A 4PLJD 4QT5A 2EVHA 2Q10A 2APXA 5HSFA 3PHOA 1MWAH 4ZTPL 2W0LA 3C6LA 3LNDA 5KVGE 4QNPE 2RAMA 3WHE1 4R26L 1WFNA 1JG9A 3RBGA 4EUPA 2F08A 1BX2A 2MTPA 1E8YA 2APSA 1EGJL 4P5TB 5FO9A 1CBVH 1DR9A 5C0AB 5MP6H 4G6KL 5EO1B 1JPST 3GJFH 1PZ3A 2GTWA 1R19A 3DMMD 5C3LD 4YH6A 2P8MA 5AB0A 1KBGH 5TPWL 1L9MA 3BFOA 1LP9B 4WV1B 5DURD 2XTJE 3RFZB 3KPOB 2GTQA 5I30H 3RWDA 5HHNB 2E5EA 2AI0L 1MJUL 4FNRA 3CFQA 1AGDA 4WWKD 1VFAA 4L18A 1ZXQA 5DD1H 3D12B 2YD1A 1JGVH 1S7WB 2HT3D 3EHBC 1KN2L 4P2YA 3I2CL 3CFIC 5CLXA 3IGLA 4UINH 3TBWB 3PIQB 4HIHB 4FQHA 4P99A 5IJCC 3HHSB 3PQYD 3N40P 2IH8A 4NC2B 1TEYA 3D9AL 3HNTH 1DJZA 1KG0B 1ADQA 3O9WC 4PB9L 3G6AA 1OD7A 2VMCA 5IVOA 3H8NA 3IETB 5EU3A 1CICA 3PWLA 3DETC 1EJ8A 3MBED 4CSTA 3UGUA 4UV7H 4MASA 4WFEE 4J3OD 3CLEH 2V7NA 1YEFH 1QATA 2B5IB 1PYWA 1AZUA 2HH0H 1MRFH 3QWRD 4GQQA 3VYNA 4QKTA 3O11B 5K5YA 5J11B 3MRLA 1N8ZB 4HUVB 1DLFL 4NQED 1WPCA 2ID5A 4ZSOE 4G7YH 2XN9A 2CIIB 3P73A 3I84A 5DRZA 5G55A 5DUMH 2I27N 5TE6L 3WS6C 4D0CA 5KBDA 2XRAL 4OZFA 3WTUA 1BOGA 1DFXA 1SF3A 4KJPD 1P2CA 3UZVB 4ESKA 1Z5HA 5CP7A 3WEOA 2Q76B 4JPKL 3SE8H 3QEUA 4IU3A 3JV0A 3T3PB 4M1DH 4M61B 4UT6L 1USQA 1MFCH 1U95A 3WFZA 4QNPF 4EN3B 2CBPA 3KYAA 3DX9A 4F20A 4A6YL 2BHZA 4DERA 1F2XK 4X7SL 4TL5A 1PVHA 2IPKB 4S1DC 2AQ1A 3DSFH 2NY0B 1WGOA 4QOKA 1HEZA 1V3KA 2E3VA 3KVDD 2I85A 1HE8A 3DBXA 1EVUA 3TNMA 1RZ7H 1MWAL 2R0LH 4MCYB 2QSQA 2HAZA 4W9DC 3ARXA 4UQ3A 1P7QA 1KJ3H 3GIVB 4N87A 5FOBA 2C9RA 1CBVL 1BLNA 4K4KA 3SCMC 43CAB 1H3PH 5MP6L 4LCWB 5E94A 2Y7NA 2J8UE 1XL4A 4JZOA 2V2WB 5BS0D 2DMKA 1KBGL 2EIJB 1G5AA 3OAUH 3ELQA 5I5JA 1IAMA 5I30L 4XMXA 3BGFC 1BVNT 5DHVB 3CFMA 4JG9A 4FTVD 1AZBA 4FQXB 5DD1L 3ZUCA 4DKTA 4A66A 1JGVL 5J9PB 1EUUA 4PJBB 3BQUA 4MD5A 4MS6A 2VWEE 4UINL 1T1WB 1CQKA 2NY1D 1PKQB 3HFMH 4NZFA 1EXHA 3VFVA 1M7XA 2HLAB 3O3BA 1R34A 3EDKA 3HNTL 3KHQA 4QJ4B 2OPCA 1B3JA 2Q7NA 4L1TA 3JVGA 3CNKA 5F0MB 5T33H 3V9EA 4OGXH 5SX5H 2C9XA 4UV7L 2D7MA 1X4YA 4LP4A 4RFEB 3CLEL 1YEFL 2DWXA 1L0PA 3L45A 1IO4C 4EI6A 4BV1A 2VR4A 2HH0L 1MRFL 2OULB 4EVNA 1VEMA 4HJ0D 4OKVA 2WSPA 4ZMLA 3SO3C 4WUUE 3LRGA 2K6ZA 1SY6A 2WLIA 4G7YL 1B2YA 4N1EA 5DUML 4X4XA 1X5AA 3VI4E 1BQSA 1HU8A 3NJJA 3EHBB 5I1CH 4K7PH 1UT9A 2HT4D 3U9UA 5SWZE 1NGZA 2R29H 2ZUXA 4JDEA 2F5AH 4R7DB 5PAZA 3SE8L 4AY0A 1MCFA 2C4FT 4M1DL 3T9WA 1MFCL 1PNDA 5DJ8A 5KVFH 5AVWB 4QKXB 3ALWA 1U9KA 3ZTDC 1ZANH 4MAUH 3N1FC 3QQ4B 4K07A 3REVA 4Y2DA 4Z3EA 3O9WB 4LSVH 3ZR5A 1UD4A 4MAYC 3IJ7A 2IDQA 5C0JB 1V27A 1HDMA 3DSFL 2UY6A 3G04B 4MCNA 1RK0A 1TVBA 3VGGA 5LB1A 4AM0Q 2CIKB 3PJSA 3PJLA 5CO1A 1QEWA 2ITEA 2J8UF 4HS6B 2YPVA 1RZ7L 2R0LL 1QRKA 4KK6C 5D70H 5KSUA 1RHHA 3CFDB 2EH7H 2K8QA 4PTTB 2M83A 4CVXA 1PLGH 1KJ3L 4Y4FA 3DLQR 2ZUSA 2LVCA 1NWPA 4LIQE 1PG7X 1RSYA 1H3PL 3PJNA 3U46B 3K0YA 4P2RB 3RTLA 1IEBA 2Z31A 4JJ5A 3O4LB 1R3HA 2HRHA 1M56B 3MGAA 2YPKB 3AU1A 2IAAC 2W9EH 3OAUL 4JM2D 4MX7A 2RR3A 4GXUN 4WW2F 3FB8A 3ZX1A 4PRPE 1AMYA 4I9WD 1OGSA 1JFQH 3BT2H 5FYKE 1QSFE 1Q1PA 2VO5A 3LMJH 4H1LB 5JORA 3H4HA 3GWJA 4NRXB 4MBOA 2VKWA 3NEOA 3ZYJA 3HZKA 3IU3B 2FQFA 3IPBA 4H13C 2QHRH 2UWEE 3HFML 1UZGA 3HG1B 3RGHA 1FIGH 4I87A 5EUOE 2R0ZH 5H37A 4ZUSA 1F5WA 3U7AA 4S1RH 4XZ4A 1P6WA 2WQUA 1GW6A 4OLXH 2OMXA 1ZV5A 2FEDC 4G43B 1MNUH 3IXAA 1H3TA 4FA6A 3APFA 5T33L 4OGXL 4OY9A 1IEAA 3GBEA 1MEXH 4OKDA 3OMZA 4WWPA 4K5NA 1K4CB 1KJMB 3SCMB 3FOLA 2CCWA 3W11C 4EO5A 1WA0X 2WZ5A 2R23A 3VI4F 3D09A 1NSNH 4PHZA 2VDOB 1V3JA 4OGZA 1XWVA 4RIRA 3QHFH 1HILA 4B9GA 3QXDB 2ZUVA 4G9DA 4EDXB 3EFFB 3NJKA 4EZMA 3BGFB 1NC2A 2Y69B 3P3TA 4XO5A 2VUYA 1IM9A 2C7FA 3PNRB 4AT6B 4C83A 1GJWA 3WTYA 2Q3XA 5I1CL 4K7PL 4XPBH 5MEQA 2R29L 3BD4A 2F5AL 2D9QB 3V6FA 3RWJA 4GW5B 2OJ1A 5KVFL 1D2OA 1ZANL 2Y0SA 3EOTH 4MAUL 4Z77A 2EYRA 4Q2ZB 4QRRE 4Y19A 4BK5A 1I8MA 2BNRD 3P02A 5F7DB 5GSVB 4LSVL 3SBPA 2IPUG 3Q1SH 2R9HC 4L48A 3FJTA 2X0WA 4MZ2A 5I8CA 1NCIA 3NFSH 2FLRT 2OYPA 1CGVA 7FABL 5D70L 3ASNB 3CCHA 1WCBB 3IMWA 4R97C 3TL5A 2EH7L 5D1XE 1KLUB 3AREC 3DXAA 3BXNA 3BUTA 1PLGL 2E76C 1GZQA 2XXCB 3BP4B 3LIZA 3QAZC 2Z35B 4PJGA 3EBIA 5IJKA 4NJAH 3TIEA 2AHIA 1CIUA 2FJGB 3H7BA 1D6EA 4AJYV 2PYFB 2VSKB 3KAAA 3Q2NA 4LCVA 2B59A 2W9EL 2X88A 4XO9A 5GPRA 5J6SA 4ZSOB 3V4VB 3C6SB 4P5TD 2UWEF 2Y1YA 4WVRA 3WNPA 5E8DH 2DWDB 2GBTA 1JFQL 3BT2L 3QS2A 5EUOF 3QG7H 2YD6A 3G5YB 4URTB 1UOLA 3LMJL 4XE5B 5HHME 4MSWB 4ETQA 1NJ9A 2X1OA 3PWPB 3THMH 1LL1A 5HDRA 2KI6A 1B4RA 4KNUA 3UIYA 1MFNA 1A6WH 2QHRL 4ZPVA 4MAYB 4E68A 3PE9A 1V3MA 5HI3D 4NO3B 1FIGL 3AUWB 3B6SB 1M6OA 2R0ZL 3NESA 2YQBA 3DO7A 4NHCH 3GRGA 4S1RL 4GP8B 1WITA 2YD2A 4GG6A 4OLXL 1CFSA 4K55A 1T5XA 4NENB 1MNUL 2LU3A 1SQMA 1JVOA 2Q2EB 5IROA 4L8SC 5DDHB 3SDDA 5ERWB 1MEXL 3VXTB 1G84A 2HJFA 2CSPA 4XXWC 3VSTA 2P1YA 3CQQA 4R0LA 4YHZH 3QH3B 3UPAA 4ANUA 4XCFH 4XB7A 1NSNL 5CJ8A 5CAYB 3IVKA 1NCBH 3QHFL 2G4GA 3QW9A 3CFBA 4DTGH 2Z92A 2J8UB 2VCOA 5F1NA 5EF3A 1ZTXH 3CDFA 2R4RH 3OKLB 1WHOA 2G75B 1QPPA 2NXYC 5TDOB 4OAWB 5D7IE 3GHBH 3ARDC 4QHMB 4G5AA 2E7HA 4FLHA 2HX7A 4XPBL 2BCKB 1KIPB 2IOOA 3M07A 5F96H 4D8OA 4ZFOL 1A4KB 5JW4N 4AH2B 1Q0XH 2E9JA 5KSAD 3EOTL 4HS8H 3ML8A 4OUUB 4CMMA 3Q1SL 5F9OH 2DL9A 1N26A 4FQPA 4XNMB 3AS2A 5CZXD 2D73A 4AZUA 3NFSL 4EN3D 3IPEA 1A2YB 5ADPH 2ILLA 5FF6B 1WZKA 3BAIA 3F85A 1WD8A 1U8CB 2AJ3B 1U21A 4CC4A 4F7PA 3ZQXA 3UL4A 4LRNH 4M3KB 5CGYC 5I71C 4RNRA 5JW4M 1Q72H 4KFMA 4PTUA 4WI9A 4NJAL 5C70A 1GW0A 1OVZA 1LDSA 3P30H 3SKMA 1OP9A 1W72H 1IC7H 1UA3A 1WRFA 4KAQH 4M6AA 5DFVD 3SE6A 3L3IA 4HK0B 1I8AA 3IGKA 1MCPH 2K4WA 5E8DL 1YG9A 2M2DA 4O02B 3R0MA 3QG7L 5HPMA 3VI4B 3VE0B 5GGUA 1GPOH 4BM7A 1J5HA 2E46A 4LOUC 5KYXA 4OTXH 3THML 4GW4B 4D9QD 1M42A 4LSSH 1A6WL 1OEZW 1HL4A 3EADA 1T7VA 3MZTA 5BZXA 5ACLA 4YN3A 1M7IB 1EBAA 2JE8A 3QZLA 4NHCL 3EDDA 4FQXD 4KBPA 1LD9B 5IY5B 1JGEA 5F7WC 4R97B 3LN4B 4OCRH 1MCBA 1UD2A 3AREB 1UJTA 3UH8A 2WYHA 2XZZA 3QAZB 1HZKA 2GT9B 1LWRA 2BNUA 3Q0HA 5E0FA 5TD4A 3VFWB 2G5RA 2CAKA 4YHZL 3W3BA 2JTYA 3W9EA 4XCFL 4JFOB 5D7IF 3VD7A 4ZTOH 4ANWA 5KVMC 5A43C 1E9PB 1NCBL 3QHZH 4DTGL 1UGKA 4QEGA 1OP5H 1JJUA 4MJ2A 5EU6A 5IB5A 1ZTXL 2R4RL 4C58B 1PNCA 5CMAA 3GI8H 2W38A 2Y6SD 3AT0A 3GHBL 5HY9A 4A55A 1TUPA 5KYWB 1QTYT 2WB1A 4I0PC 3B2UC 5F96L 1A6UH 4MJHA 1G43A 3DNKA 2VSDA 1Q0XL 4H26A 4FFYA 2B15A 4TN9A 3B3BA 2AQ3A 3QJUB 4HS8L 4BKTC 1IB5A 2YRPA 3KYOB 5F9OL 5AW1B 1F4HA 1PPIA 3GZOA 2PETA 5FYJH 4L8SB 3VDAA 2ARJQ 4MDIA 5ADPL 1YAIA 2FLMA 3FULA 3GMPA 4HZLA 2NSMA 1FNEA 3O9WD 3IT8D 2AV1B 3KW7A 3BGMA 1FNLA 5IOKA 4E41B 1PTZA 5T1KA 4NPYA 4LRNL 1Q72L 1BD2D 4Y89A 2KC0A 4HUXB 5LJYH 1M05B 3Q8EA 1HXKA 4X8CA 4K7PY 4ZQKA 2NXYB 3P30L 5TTRA 1W72L 1IC7L 4KAQL 5I5IA 1A9BB 2N1TE 1ZHBB 4NNXA 5F97E 2NW2B 2QL1A 3ARDB 3C6EA 4MQ7B 3X13A 5FFLA 1MCPL 4F7MB 3L5JA 1FNAA 4W4OA 5KYNA 1QFOA 2KS0A 1GYCA 4IBYA 5LG6A 2YUVA 4WFFD 1SOQA 3JSSA 1GPOL 4LVHC 3NFPB 4U1SA 4P2RD 5DUBB 4ZDHA 4X4ME 3RWGB 3O4LD 1QQDB 4WO4D 1HCVA 4OTXL 1K9TA 4LSSL 5DTFA 4PJDA 2VLKB 1T20A 3MRHB 4FFVC 1NFAA 4HOMA 5C6WH 1FORH 3MACH 4QO1B 2Q7YB 4PN6A 1GS6X 4QRRB 4HK3N 2X05A 5F2FA 3GQFA 3GSRA 3BH4A 4JFDE 1GTNA 4GAYB 4L0PB 5E2TH 2HG0A 3IDNB 4OCRL 5BZDB 2VO8A 1IL1B 2Z4QB 4WDIA 1EJFA 4HIXH 1Z9OA 4S1DD 4H2CA 3HI6H 1F6LL 1UB5A 4P59H 1QFWI 4XN4A 5I71B 5LHDA 2ZOKB 4FHKA 2FQDA 1PS3A 5F1OB 3K1DA 4NEHB 5E1AB 5F7EH 3DX7A 3QHZL 4BJLA 2A6JA 2ZYSA 2OTUA 2DYPA 1QI3A 4NKOB 1U92B 3HA0A 3VNZA 1FG9C 3AFLA 3GI8L 4G8GA 3CSFA 2ATPA 5KTEH 1VACA 3I6LD 4AW7A 3ULVC 4B60A 4FG0A 5F6IC 1T7WA 1IGTA 2IGFH 5ACMA 4R4ND 1T89A 2VXVH 4L1BA 1A6UL 4PJ5A 3BZ4A 1JGUH 4P3WA 3WY2A 3STBA 1U8NB 4PCYA 4XNQB 4TQHA 3I3BA 1S9YA 1D9KC 2E86A 1JS4A 5C0BD 4PGDA 4ABWA 1ZT4B 3FRPB 4FJ6A 2E7CA 1EDHA 1FUNA 2FO1A 1G4MA 5BRZE 3DPBB 2YZ8A 3CVHA 5FYJL 4H4NA 5F9WC 1S78D 1OV8A 5CM1A 3L2MA 5GGSA 5F7MC 1CB4A 1M1SA 2UVFA 2C5DC 1JWUB 3CDZB 5ISZE 2VZTA 5E56A 4X5WB 5C92A 3BKCH 2LV4A 1U93B 3S98A 5IHZB 4MJ6A 4ZFZA 5J1AB 4URKA 1DVFA 1KULA 4PGZA 4KXBA 4BYHA 4CADA 2G5BA 1TZOA 5CGTA 4BUHA 4JPWH 4HH8A 4I0PB 5ICYB 4NP9A 4G9FA 3DTXA 4N20A 5D7IB 3QI9D 3RTQC 3NJMA 1I8LC 1O5DT 2ZKHH 3ESVF 4JUSA 2V9UA 5IHBA 1EGJA 3KGTA 4JCMA 3MCYA 3N6YA 3GSNA 4QHUA 4HV8B 1FORL 1KCLA 3MACL 3MODH 3HVDA 1OSEA 3SYAA 4C8XA 1FJ1A 5EC2A 2XA8H 1PQZA 5EC1B 5E2TL 1MDTA 3PWPD 4AM0B 2P47B 4M4RB 1CYGA 3V6ZB 3SQOH 3PWNA 4HIXL 1ZLUH 4XOAA 3HI6L 2COVD 3DYMA 4P59L 4MQSB 3D1MC 4JPQA 3MRMA 3QCUH 5CHNA 5CIPB 3RX7A 1LXMA 5I26A 2JKIS 5F7EL 2QTVA 4Z7UA 5BJTA 1SVCP 4M6MH 3A0OA 1F1AA 3B7YA 4PRNA 1S7VB 4Q0XH 4HEPA 4JZNA 4HMEA 1OP3K 2RA1A 3GBNH 3O41A 2N01B 3L1EA 2QZQA 4LVHB 5AB1A 2NDGA 5KTEL 3S4SB 2D2CC 5C0GB 1ZS8B 4D0DB 2IGFL 2VXVL 5HDWA 4NQEE 5AAMA 1JGUL 1KB9K 3CFEA 1A65A 1S3RA 1P69B 1PGRB 5D1ZI 4KNTA 3FFCB 3HPLA 2NDFA 4JKLA 4DP8X 4Z7WF 3QZOA 4ODWA 4U6HB 1QNIA 3BKJH 5DMYA 7FABH 1MFEH 4NRYA 1J18A 4WI0B 1JHTA 3P2TA 5FGSA 3WDJA 1TFPA 2CJSA 4Y9BA 2FSDA 2J5LC 4M1GH 4DPAX 4JFQA 3MR9A 5FGBC 3Q5TA 3RPIB 1HXMB 3ABGA 3BKCL 4POUB 2FJFB 3GBMH 1EXGA 1NAMA 2FEJA 1JUFB 4A6YA 3BAWA 3PDDA 4H25A 5FDWA 3W11D 1FG2A 3LD8C 4G8FB 2VT0A 1XR9A 3PL6C 1I1AC 2D7QA 1FE8H 4JY6B 1NEPA 1PKOA 5IMLA 5F6IB 1BEYH 4F93B 4JPWL 4FFZA 1NGWA 2BSTB 4CJ1A 3KPLA 4GQ9H 3LHPH 2ZKHL 1L3NA 4EXKA 3PWVA 4WI5A 1D9KB 3BH9B 4X9YA 3TONA 3LXUX 3UXFA 2HX9A 43C9B 1U8PB 2XG5A 3EYQC 5IKCA 3CSYA 1RJYA 2Y22A 3MODL 1S5HA 5F9WB 1OAYH 5IW1B 2P5ED 2ITDB 2XA8L 3OWRA 3FOMB 2NLJB 2XZCH 3NT0A 3OWEA 1YYLH 4L4VA 3TM6A 2X2UA 5F3HA 4CU7A 3SQOL 4F80A 3CHPA 2R9HD 1CGTA 3KYMB 2V5TA 5EU7E 5GGRB 3QCUL 2YGNA 3DUHA 4C54A 4KJYA 4A2EA 2GJ6A 3NJHA 3AB0C 3EOAB 5FO7B 2EIBA 3ARED 3W81A 1T0NA 3AADB 4M6ML 3LPGA 2PW2B 4JY4A 3QEHB 4Q0XL 3U0PA 2JKWA 4LCYB 4PU2A 3GBNL 2B8OT 3RTQB 2JSFA 3TPUA 1P6AB 3MHZA 2ZXEB 5FGCE 1TVDA 4U1JA 4UB0H 4XH2B 4U1MB 5HHOE 5L88H 3RG1C 3CC5B 4LFHG 2XWXA 3FYIB 2A6KB 5AW3B 1TQSA 2C4FU 4WY7H 4I1NB 4GKZB 1XB6A 3H4FA 3BKJL 3MRIA 1MFEL 1YZZA 1IZJA 1BMWA 2X7LA 2ZKYA 4JFDB 5IOPA 1VHPA 1W6LA 2FGZA 2XPYA 5EG6C 3V0VB 1YAZA 2OMUB 1CXEA 1GR7A 4M1GL 5HYFA 4LIQH 4X5XB 4DGYH 5C07E 1U3YA 3M86A 4YLBA 4PD4K 4OFVA 3HAEA 4UOW1 3GBML 1O7DE 4O51A 2DH2A 4KK9C 3FT9A 3LXCA 2OAAA 2OSXA 5FYKH 5AYQA 3KNBA 4ZMWA 1FE8L 2OR8A 3GMRA 4N85A 2HFEB 1DUZB 1BEYL 4E41D 2WTOA 4HWZA 1S7RA 4PQXA 3EJCA 4ODUB 1T04B 2VDNB 3WJMB 4J2XA 2V7HA 4HIQA 3W56A 4G6AD 4GQ9L 3LHPL 4MFHA 5FB8B 4IS6A 4P49A 3CVCA 2IDFA 4RWYH 2C1OA 1CGXA 1FNGA 2NXYD 4HYTB 2YN5A 2OL3H 3NCMA 1XZ0B 1MY7A 4J6IA 5I76A 4I9WE 1V05A 3K72B 1JNNH 1OAYL 4GS7C 4R5TA 3QXWA 2GPZA 4JFPA 1KTLB 5DK2B 2XDHA 4PJ8A 2J5LB 3AMKA 3B43A 3KLAA 2XZCL 1YYLL 3WMQA 2AV7A 3MUGB 1LE9B 4TXVB 4YDMA 1JHKH 2HMIC 4N8CH 3TN0D 4Z7WB 5IW6B 4BIKA 4ZMXA 4GKNA 2YZ1A 3LD8B 2X53A 3BAYA 1PW3A 3PL6B 1Z9LA 2YN3A 2ZYRA 4NQSA 3WBDA 1I1AB 2NUTB 2Y1VA 1XQ4A 1I9IH 1HI6B 1RK1B 3MJ7B 4KZ0A 2C7UB 5DJ2B 3NIGE 4JKPH 4TQEH 1WA1X 3TBTA 3L7EA 4HCRH 1GYAA 2J71A 3JXAA 3HN5A 3ZGIA 4JCWA 2J1WA 3MA7A 4UB0L 3D85A 2Y72A 5L88L 5BOPA 3A4EA 4JAMB 5EH1A 1Z3RA 1HOCB 4WFGD 1KZQA 4WY7L 3EO1B 4ATTA 4KI1A 4LOUD 4X4KA 5EHFA 3US1A 4MNGE 4X8JB 3G9VA 4N22A 2F74A 3NJLA 4Z7OE 3H9HB 3WN5A 3ENEA 5LXGH 1E4JA 2K6WA 3S0PA 2FSEB 2EYSA 4WW1A 3FONA 4F33A 1G7QA 4LIQL 2BNRE 5I24A 4QPEA 1QW9A 3UTQA 4DGYL 2LGNA 4CDGC 4DNLA 3AB0B 4MDJB 3O6MH 1N59B 3LZOA 1JV5A 1UH4A 4XBPA 2XG4A 3K6DA 2EIMB 1YMHB 3BRDA 2YPLB 4U0QB 2V8LA 4UNIA 2QMJA 3U48A 3PHAA 2IH3A 5FYKL 1JWMB 1VF5C 5F88A 3OXRA 5D2NA 2WYTA 1Q1JH 2OMYB 3MV9B 5GXBB 4HK3J 4Z3IA 3BP7A 3S34H 5F9DC 3I50H 1QFWH 3U6RA 2P5WB 1TTCA 2C3VA 3O0RH 4RWYL 1RUPH 2E4FA 2OL3L 4XMVA 1T4KB 1YY8A 2VC2H 3DIDA 4ICWA 2GIMA 3CZEA 3V0HA 4OI9A 3ZDZF 5DD6B 3IJSA 2OQJB 3BZDA 1AP2B 1VGKB 4I0PD 2GSGA 3B2UD 3MLUH 1JNNL 1IILE 2OR7A 4PY7A 4DW2H 1T0OA 3IS1X 3GI9H 3GKZA 1DVSA 2AEIT 3D3VD 3H3KA 1KGJA 2QKIC 1RHFA 3PGDB 2HKHH 4WK2B 2WSKA 4JFFD 3DV6A 3HG2A 1N10A 5SV3A 1JHKL 4J27A 2QGBA 4N8CL 3L5HA 5GRVK 4HGKC 2Q6WB 5C0CE 1H9DA 3F5WA 5E2WH 4ZX4A 3V4UH 4QXTB 2EADA 4L9DA 5KW9H 3WUWG 1NCGA 1I9IL 1X5MA 3SY0B 3GZQA 3UBXG 1E42A 4NN6C 3L2NA 4JKPL 2OV0A 4TQEL 2C9AA 2X6VA 1DN0B 1KPRA 1QW8A 3KDMA 4HCRL 3NCWA 4GUPB 1N3NB 4M7ZC 1ES0A 1BJ8A 4Z7OF 1RZIA 2XV0A 3FB6A 5DD3H 1JZFA 1S8DA 1UUSA 2ROXA 4XWGH 4GS7B 7PCYA 2VZSA 4K5PA 3QDGA 4FX5A 4E9SA 3U79A 3TEUA 4XXDA 1BLIA 2LFGA 2R69H 3L3GB 4X7TB 3V55A 3ABKB 3SBWA 3VI3A 4CSPA 3OKKA 2RMNA 4G11A 2GC7C 3B5HA 3EH5B 5MEOB 2PP9A 2CO2A 1DQQB 3E9TA 3H2PA 1OW0A 5LXGL 3BVNA 5GZOD 1OTSC 3SPHA 3FFCD 2DEWX 1JNJA 5KAQG 4QTHA 1WV7T 4JKNA 3QIUC 3UCQA 3WIIH 3VB8A 4K94C 4PJHA 3MLTA 3O6ML 5JQIB 4U4BA 3EUDA 2VABB 4Q9CA 5B7FA 5L7XH 2F53D 3OKOB 2DEYX 4BK4A 4ZFGH 2XUWA 3L2LA 5DFTA 3HG0A 5T5FH 1UZ6E 2F7RA 3UMNA 2ZCLH 1S7QA 2JB6A 4RRPA 4U1IA 4WGWB 3U9WA 1BWMA 1FIEA 1NFDA 2A1WH 4AMWA 1T2JA 4FI7A 1Q1JL 4W9GC 4HOZA 3GFUA 3S34L 4XBGB 3I50L 4QRPA 1QFWL 4L3EE 3FQYA 3O0RL 3QNXA 1RUPL 3U36A 4N8VA 2Y7LA 2HFFB 2VC2L 5HHOB 4XC1H 3MQIA 3ULVD 2GYSA 5K39A 4BFOA 2ENYA 3MLUL 4YHKH 4DW2L 2V37A 3OMAB 1Q94B 4ZUUA 3GI9L 1U8MB 3G6JE 1UKQA 4PLOB 1P1ZA 1MCWM 1T1YA 1ETB1 2HKHL 1D9KD 2WJ7A 1V3LA 1E43A 4DP7X 3DRTB 3FT3B 5I28A 4I77H 3K8MA 5DEFB 1G7HA 5DEZA 4KDVA 2H6OA 3V5DA 3M1CA 5F7KC 5E9DA 5AAWC 4Y2OA 1OTUC 2VXTH 3QRGH 3RL1B 5E2WL 2H0EA 3V4UL 6PAZA 3T8XB 3SDXE 3D52A 3REWA 5KW9L 3PHQB 1XXFC 3FSZA 2QLYA 2HTKC 1N67A 1AANA 1I7ZA 4TULH 1SEBB 5LN4A 4C55A 2WWOA 2NCEA 1KPVB 5E4OA 5C0AA 4AQ1A 3WEMA 5EO1A 5IF0B 1MLBB 2AXGA 5E6IC 5DD3L 1K85A 4XWGL 1BP3B 4PREA 3L4TA 4NN7C 1I53A 4YL4A 3BN9D 5EA0H 4WV1A 2QKIB 3MXWH 3KPOA 1JF6A 2R69L 5FA3A 5HHNA 3X17A 1IVTA 1SNRA 4O5LH 1WBYB 4WLCA 1SHXA 3T0XA 2NY5H 1WO2A 5IBTH 2PPFA 1I1RA 3TBWA 2QGDA 1UZ6F 3PIQA 4NQCE 3ZDZB 5I16B 4HIHA 5J7CC 4GG8B 3S97C 3WIIL 4WSKA 3N43F 1JWSB 1NCUA 1ORSA 3HHSA 4AEFA 1YEEH 3K2UH 5L7XL 4DSYA 2IALB 1YEDB 1HNFA 3C9NA 2E56A 4JFSA 4H5SB 3BPLC 3IETA 4ZFGL 1NMCC 4NN6B 3GBLA 1KELH 5T5FL 1B4TA 2ZCLL 4AKQA 4M5TA 1YPZF 3EDJA 2A1WL 3JWOH 4M7ZB 1CWVA 4L1DA 4WKZA 3DX4A 3G6JF 1WQVT 3O11A 4ZW5A 2SEBA 3VW3H 3S2AA 1QOKA 5HVWA 1N8ZA 3DGGB 5K33A 3S48A 4HJIA 4XC1L 2CIIA 3BH8B 1TCRA 3QORC 15C8H 4YHKL 5DEJA 4HWUA 3EXLA 1SVBA 3R1GH 4IKLA 3TVMD 3UZVA 2AEWA 1HC1A 3V0DA 2J1KA 1CLYH 3BDXA 4ZNCD 4UT9H 1SZNA 2CHNA 4JANB 5J12C 1DO5A 3GTTA 4MJ5B 3SDXF 4AGMA 4Z7OB 3DOHA 1TEGA 3CLFH 3QIUB 4GRWB 3H2QA 1M4KA 4I77L 4WSJA 4YGAB 3NABH 3KZ8A 1OGAB 2W94A 4PW4A 1CDGA 2G60H 4CVUA 1TTRA 4N2IA 4U3HA 2RQ8A 4NKMB 5HDQH 2VXTL 3QRGL 5D6DA 2A9NH 5ANHA 5CN3A 2GSIB 5EEXA 3QZNA 2Z7YA 3VRIB 1AO7E 2YFNA 2X1PA 5L8JB 2KQMA 1A64A 1RZJC 4TULL 3GIVA 4JFEE 2ICEC 5JO5B 2J1ZA 2B39A 3PL6D 1N2RB 4LCWA 4IQHA 1T0MB 2J55A 2I9TB 2V2WA 3IM1A 3VQLA 3B34A 2WXRA 1KCBA 3NJGA 4P3CH 2E7DA 5D7LD 5EA0L 1G9NC 1NA8A 3R7RA 3BRFA 3CXFA 3MXWL 2W07A 4R8WH 5DHVA 1AGCB 4CSZA 5F7UA 1IIIA 2Q87A 2NPLX 4O5LL 3EYQD 2X28A 3SKNB 1TQUA 3TTYA 4O2CB 2WO2B 1F00I 2FWSA 2NY5L 2WZPD 4YPGA 5IBTL 1JI1A 1ZDSA 1Z9MA 3C60C 4BSWB 1VSCA 5L6YH 5IJDC 1PKQA 1ET5A 1TZAA 2CBOA 2TRHA 2GI7A 5JXAH 5B22A 1Y0LB 4GSQA 4F2MB 4NCDA 1RJLB 1YEEL 2HLAA 3K2UL 5A2CA 2MRYA 1NGXB 2XQBH 1P7KB 2JFCA 5LDUA 1I3RB 2J21A 2Z8VC 3HE7B 1KELL 4JGUA 3FTSA 3B7TA 5L4MA 2CCLA 3BUQA 1ET8A 3JWOL 3STLA 4M02A 3JWDC 4PJFB 5E6IB 3FFDB 2YPLD 1I7UB 1DJHA 4BUGA 5I82A 3B8YA 3VW3L 5MENB 4NN7B 4YWGH 3WGVB 2CXGA 1E65A 3NJNA 4L0ZA 3WEBA 4PGBB 2C3GA 4I2XE 3GF8A 4HLEA 4V11A 4FXKC 4YDIH 5D6CB 15C8L 4A7UA 3MV9D 4EZKA 3OJ2C 4AYEC 3R1GL 3MV7B 1CLYL 4EQ2A 3BWSA 4UT9L 5BVPH 4R7DA 3FQ1A 4DK5A 4GIPD 4DGVH 3CLFL 4BA0A 1NOFA 3NABL 1TZIB 4FQLH 5DS8A 5FUZH 2F58H 3QQ4A 3D25B 2BIPA 2G60L 4G7VH 3V4LA 3BPLB 1JVKA 2A9NL 3FPYA 1NMCB 2EYTA 3P9LB 2D7OA 5C0JA 1E30A 4J3OH 2AXFB 2A4EA 1NWOA 4GRMB 1H0DA 4HS6A 4P2QE 5J6HB 2YD8A 5FWRA 3CFDA 3TYFB 1QRNA 2IO5A 2QDWA 3OG6B 4PY8I 4GIOA 1ITBB 3FQNB 2WXHA 4UMSA 4X4YB 3U46A 1KNOB 3B3IA 1ASPA 5C08E 4OUOA 2ICWI 2UX7A 4RVBA 3AG4B 2YPKA 3QORB 3G7TA 4P3CL 5ADOH 4V1DB 4YE4H 4UM9D 5A2KH 4R4FH 1YPZB 4IRJC 4R8WL 1M9WA 5J12B 1SQ2N 4TYUA 2UYLB 3PGCA 5HP5A 5E6ZA 1Z2KA 4NRXA 2YA2A 4DCQB 1IM3B 1C12B 2K1MA 3O3DB 1MHCB 5JIKA 1HQRA 3IU3A 4H88H 4LBEA 5E95B 5L6YL 5IVXE 2XWRA 3HG1A 1NPJA 3QQNA 4FMFA 5JXAL 1BZ7B 1DDTA 1X6NA 2XQBL 2MOVA 3QUZA 3Q6FB 4ES9A 2HMID 3UPCA 1AC6A 2NNRA 2Y2TA 2D0FA 1JTOA 5GS0D 1SHSA 2ICEB 5AUMA 5B3NA 3MCLH 1K4CA 2X38A 1ZHKB 1L5GB 3SCMA 2QVKA 4YQXH 1Z3GH 3RNQA 4BSVB 4LSRH 1KJ2B 1OARH 4OJEH 2Z91B 3D06A 2Y7MA 1UJ3C 3SZKC 3HHRB 4Y2NA 2ZG3A 4YWGL 3QXDA 2QVIA 4KRMB 4ETYA 4APQA 3EFFA 2H6PA 5CEXA 1BAFH 3BVTA 1EUTA 2P8LA 3FBQA 5B8CC 3SEPA 3NZSA 4YDIL 3GEFA 1RUAH 4MAZA 4AT6A 4E9XA 5DJCB 2OX5A 1D5XB 2WUCH 4UZSA 1OCCB 3C60B 1Q9OB 5BVPL 4Z3FA 3AXLA 4DGVL 2DQCH 4H40A 4ABQA 3CSBA 4FQLL 3L9RA 4TVUA 5FUZL 4GUQA 2F58L 2C3HA 3GPEA 4Q2ZA 1LWHA 2GBAA 3DRQB 2NW3B 4K15A 3WNOA 3ILDA 1NINA 3KPNB 5GSVA 1HL8A 4G7VL 4MLSA 1J9SA 1MCLA 5LCVH 4WQOA 1GL4B 4BKLA 5KZCB 5B21A 1PX4A 4BQ9A 1KLUA 1DJIA 4P5SA 5AW8B 1KXVC 1T1XB 4N24A 3BP4A 5K1VA 1YNTF 2KMWA 4M7JH 2H3XC 1KN4H 3OPZH 3NDYE 4HWNA 2FJGA 3K1KC 4DVBA 4FXKB 1S7SB 1B4LA 4ZD3H 2PYFA 4WHTB 1UWEH 1J0JA 2BP5M 2CJUH 3BUBA 5ADOL 3A6CH 4ZSOA 5CEZE 3V4VA 3C6SA 4YE4L 4KK5C 2XNAB 3H9YA 4R4FL 3S5LB 4AYDC 4JDZA 4K8RC 2APFA 1MHPH 4LB8A 3G5YA 1ED3B 1UEMA 1H3XA 4MSWA 3JVFC 4RRPM 1P6FA 3UBFA 4ZFFB 5ICXA 4HGMA 4H88L 3ULUF 4MAYA 1JHLH 3BYTA 3BE1H 3GM8A 3OGOE 1KZYA 4NO3A 3WJLC 1GOHA 3MV8E 3WOVA 3B6SA 3LEXB 3TBSB 4K5MA 1GYWA 2XKUA 2BWDA 3FF7A 3H7LA 3BO8B 1HT6A 1R24B 2YD3A 4LCUB 4NFDA 4FA8A 1Q0YH 4NENA 1ZLSH 1CGUA 1ZAGA 4FULA 1UA6H 3FS9A 3DUSA 4F5CA 5ERWA 3FTXA 4OFYD 1E3XA 4Z5RA 4LNVA 2D31B 5E6SB 5GGTA 3MCLL 3VXTA 4YQXL 1Z3GL 4LSRL 1OARL 2W65B 3QH3A 1LHZA 4BHUI 3ULUC 5A2FA 2CRIA 1B0GB 4AV4A 4KO9A 3R4DA 5H35B 4WI3A 5KVEE 1N7MH 2J8UA 4IRJB 4UOW0 1OY3B 1BAFL 3OB0K 1SFHA 3OKLA 5EZLB 1JD7A 4S11A 3R8BB 1FZJB 2VXSH 3CXHJ 1JTTA 1RUAL 3GINA 5CWSB 5TDOA 4AJWA 1U8IB 5SWQB 2WUCL 1FVDB 5H94A 2VQ1B 2BCKA 1KIPA 3C87A 3QFGA 1A4KA 2DQCL 2GKIA 4EI0A 3GRWH 3PV6B 3VRJB 4AH2A 1ZA3B 4JZJC 3HBZA 3WS6A 1DUYB 1FFTB 5F7NC 4TVSa 4OUUA 1GMEA 1H15B 1OTSD 1QLRB 2QT6A 5LCVL 4JREC 1GRWA 4XNMA 4PJXB 4JRYB 1HVXA 2WAHA 5DRNA 4NO0B 4F58H 4LLQB 4GO8A 1OGAD 5FF6A 5CP3H 1OP3H 1CURA 4YBQC 4ES8A 1U8CA 2AJ3A 4PVBA 1UJ3B 4IKNA 3OL2A 3OMIB 3ZN6A 4M7JL 3G08B 5IMKB 3HS0C 1KN4L 3OPZL 3SDCC 2HPOA 1LLAA 5B8CB 4PJ7E 3ES6B 4WUUA 4ZD3L 2GUYA 1UWEL 2WUBH 5CD5C 3IKCA 2CJUL 3A6CL 3O6LH 4DKDC 4HK0A 3QR0A 4NNYB 1J5DA 3P0GB 4FNTA 3VD3A 3MGTA 1MHPL 1EO8H 4HJUA 2D3JA 3WKYA 3LKNA 4OVVA 3VI4A 1MFVA 3V0GA 2JLPA 4Z7QB 1ZPUA 2V6HA 4FMVA 1BQHG 5DC4B 1XIWC 1L4IA 1G0XA 1MCIA 1ACXA 3TIDB 5A2JH 1JHLL 3BE1L 4MWFB 1M7IA 1CXLA 2MSPA 1G7LB 2NXZC 3U2IA 4PJCE 3T2PA 1LD9A 2IBBA 3VB9A 1XF4B 2OZ4H 3UP1A 5LWYH 1AOZA 2EVFA 1UGNA 3HE6C 2Y4SA 3LN4A 1Q0YL 1SMOA 1ZLSL 1OK8A 1SOXA 5ABAA 3GLEA 3QZWB 2DKUA 1UA6L 4M29A 2PCPA 3L3DB 3NN8B 2WOYA 1QLEH 4HF5H 4KTEH 3TGXA 5JW4Q 2GT9A 2ICES 3HMWH 2NY6C 3U9PH 5FO8A 5KSBE 2EKSB 4N26A 4HUCA 4MB5A 1CL7I 1FYHB 4QAMB 5F3BB 3MRDA 2OP4H 3CD4A 4H8WH 5I0ZA 1E9PA 2DS4A 2K3TA 4OD1H 4ZMQA 1OTTC 4X5LA 5D55A 5C08B 1KIUB 1N7ML 1YEGH 1VKXA 3GSOA 3UMTA 4B97A 3LH9A 2ITCB 3Q8AA 2VXSL 1USZA 2HTLD 2VDQB 2X0VA 4N9GB 4PRPA 5E6ID 3OVUB 1YNTB 1ZIBA 4WWOA 4BH7B 5KYWA 1PAMA 4YNYB 1QSFA 1R5VB 3VACA 1I1FB 4A38A 1UD6A 5BOJA 1VFMA 3GRWL 4KUCF 3N1MC 4OW6A 4X0NA 1R75A 4K9EH 2UWEA 3MV7D 5MERA 3D3VE 1JNHB 2EE0A 1TR7A 2OL3A 3LH8A 5EUOA 1I7RA 3ZLQC 1OD9A 2P7TB 1BMGA 2LAGB 4F58L 2NSXA 4HG4K 4PJ7F 3QWOB 4XXWA 4KVNH 3QT2A 4F24A 4FTDA 5ICUA 5DLLA 2AV1A 1SJVA 5DJDB 2GK2A 4DP9X 3IFOB 3E3QE 1RUQH 1DVQA 2XBDA 2ZUQC 2XHNA 3MJ8B 3RAJH 3V8CA 5BZWA 2J2ZB 1AD9A 3FU8A 2WUBL 4RMRA 4ENEC 2HRGA 1A9BA 3BAKA 3M1BB 4HKJB 1ZHBA 4OLWH 3O6LL 4M03A 4Q7DA 4RCAA 4Y1AB 3ARDA 5JMOC 3T0WA 1E5UI 3MLVH 4ZRGA 3EDFA 3DVGA 1EO8L 3IRCA 4Q52A 4LSQH 3NFPA 3SE4C 4UQAA 4JZJB 3RWGA 4I0CC 4NUJA 1AHKA 3NCFB 2VLKA 3MRHA 5FA4A 4V1DD 3L3OA 3L6FA 1NAKH 2QTEA 4LSTH 2Q7YA 4JREB 4QRRA 2RTTA 4EEEA 1VZIA 3MKGA 3DJRA 2X3AA 2NYYD 3AY4C 2OZ4L 4GAYA 5GRYA 5LWYL 1IM3D 2HJKA 3HFFA 3K6NA 3ARBC 2JH2A 1MAMH 4AL8H 2SODB 2Z4QA 4KTEL 4HF5L 1QLEL 5D2LF 3QO1A 2NY2C 1X5XA 3CH1A 4NSKB 3HMWL 3U9PL 3CIQA 4WKZB 1G9HA 4YL9A 2IWKA 3SDCB 1Q9KA 2VR7A 4X2UA 4UANA 4PRBB 2Y07H 4PR5B 2J4WH 1W0VA 2GIXA 2LE9A 2OP4L 4H8WL 4F1ZA 5CBEB 4OD1L 3SYOA 2BVQB 3UG5A 5L2JB 5T5NG 4AIZA 2E0PA 4PIRF 1YEGL 1U92A 4P46D 5DZ9A 4IEFA 4ABVA 5AB2A 2W59A 1J8RA 3U4EB 3WXWH 1UH2A 3WDHA 4F37F 1XIWB 2UZYA 1RZ8B 3N41F 3FFOA 4UV4H 3CHSA 3EO0B 2M26A 4PLKC 2VDPB 4HUUB 2VQTA 3BP6B 5T1MA 4BQ8A 1GSMA 2L8AA 1B9KA 2NXZB 4HFUH 1IC1A 2H0PA 3IKKA 1U8NA 2AQPA 5T3XD 4XNQA 4K9EL 1NCCH 4KO7A 1OF0A 3X1EA 1J0KA 4AI7A 1FNHA 3HE6B 5JLZA 2J5WA 3FRPA 5L8LB 3MV8B 4QJ5B 3DPBA 1DYZA 2KDYA 2LU7A 4PWHA 5I66A 4M48H 4IIZA 5CZVH 3VA6A 2NY6B 4BA8A 3BAXA 3DHJA 2VOTA 1B0IA 1OSPH 4KVNL 3CDZA 2W60B 2J6EA 1FO0H 2X4NB 4X5WA 1MPAH 1RXLA 2PW1A 1U93A 4M56A 5JXEC 1RUQL 2Q20A 3MFGB 3RAJL 3T1WA 1Z1WA 3RIAK 3UP6A 3BVXA 1E4XI 4ONOA 5HDQL 4OLWL 4J3WA 2VDRB 3SBQA 2ED8A 3MLVL 3X1GA 2BNQE 3O2DH 3TZVC 4YXHH 3K6SB 3MC0A 1IAKA 3QZBA 4LF3A 4LSQL 2EICA 4OZIB 5D7IA 4DFIA 5FCSH 4YFDB 4XB3A 2X4OB 4BFIB 3I6GB 4QTIH 2NT1A 1B0RB 2N1KA 1DVXA 3KGRA 4B53A 4RAHA 3AT8A 1NAKL 3A21A 2BO0A 4HV8A 4KO5A 4LSTL 2O4EA 5TGBB 3BVUA 4EI5C 2V8MA 2X9ZA 2IEPA 2KH2B 2ZOUA 3KS0H 3MV01 4XZUB