2CO1A

Salmonella enterica safa pilin in complex with a 19-residue safa nte peptide (f17a mutant)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
123
structure length
123
Chain Sequence
DLTVSLIPVSGLKAGKNAPSAKIAKLVVNSTTLKEFGVRGISNNVVDSTGTAWRVAGKNTGKEIGVGLSSDSLRRSDSTEKWNGVNWMTFNSNDTLDIVLTGPAQNVTADTYPITLDVVGYQP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PUTATIVE OUTER MEMBRANE PROTEIN
publication title Donor-Strand Exchange in Chaperone-Assisted Pilus Assembly Proceeds Through a Concerted Beta-Strand Displacement Mechanism
pubmed doi rcsb
source organism Salmonella typhimurium
molecule tags Fibril protein
total genus 26
structure length 123
sequence length 123
ec nomenclature
pdb deposition date 2006-05-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.1950 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2co1A00
2AXWA 2CO3A 2CNZA 2CO1A 2FVNA 4OR1A 5D55A 2IXQA 2CO4A 4PHXA 2CO7A 3UIZA 3UIYA 2CO6A 2CNYA 2CO2A
chains in the Genus database with same CATH superfamily
2CPUA 3WEMA 2XWRA 4AL8H 1E27B 4ZI8A 3QDMA 1VHPA 1UGKA 5GJSH 3ESNA 1VACA 4YHPB 3BO8B 5CLWA 1P4LA 2VDMB 4U1MB 3BGFC 3E6HB 3D50A 5C97A 1M1XB 3FFCD 1T0OA 1EJOL 3ATFA 2BIHA 3ZMRA 1DBKL 4PJBA 4JFOA 5GGRY 5A7EA 1OGPA 3HVNA 1DDTA 4PPTA 4XPBL 2ATAA 3G6JB 4HFUL 2MCG1 1FZKA 3QG7L 4DK6A 4JFEB 4JZNA 1YHPA 2WD0A 4NIKB 3OG6B 2DI7A 4TTDD 5E6IA 4DERA 4DP4X 3GM0A 2CA3A 2XSKA 2HXAA 4HH8A 4I3GA 4YFLI 5KBMA 1OW0C 4QRUA 4CDGC 4DTGH 2DBLH 4FE9A 4XO9A 2CK0H 1SHSA 3GM8A 4XBEH 4XCEA 5AAPA 5DHVA 5CCKL 4LHUG 3ZKNC 35C8L 4JEGB 3EYOB 3JWDL 2F54A 4OBRA 3S37H 5EUKA 3F04A 3WTTA 3PHOA 3S3DB 5EU4A 3VFWB 1AIFA 1NFDE 3PLYA 3DI3B 3SEPA 5D5ME 4JFHD 4LLYB 3AFLA 1VFAB 4R5XA 5DFVD 3R7QA 2VZVA 1M9WA 1IGCH 5IQMA 5T3XH 4AX3A 4PBWD 1PLGH 2VNCA 2PYFA 1URLA 3KPOB 5BVPL 1LE9B 5JA8B 3VD0A 5F9WB 2NQ3A 2EXTA 5CEZD 4Y4KB 3JWNC 4NNXB 4CVXB 2KYIA 1I1FB 3PQYD 4EDXB 1CFSB 4P4KD 2YXMA 3NESA 2Y23A 5ALBL 1TG8A 1CYWA 3BPOC 3DRQB 3LTVA 4LIQL 4QXTA 4Z95H 3AABA 5D1QC 4OZIE 5DVPA 2OL3A 4KK8C 2AW2A 5HBBA 2PW1A 4KXBA 1AGCB 1UACH 1W9XA 2BMKA 2IFGA 1FN4A 2QJDA 4MYPA 2OL3L 2VXQH 3ES6A 4BFKA 4CN4A 4UV7L 2X10A 1E8ZA 1FO0H 3EDDA 2JQAA 4MQSB 2DJMA 3RJQB 2FVNA 1UKTA 1T1YB 4IRSD 3EDFA 2V33A 3UTSD 4ANVA 5ICYA 1INDL 3ZX1A 3M7FB 3LH8A 2CIKA 2WYZA 4Q6IC 5DTFA 4W9FC 4EN3C 1SBSL 2GT9B 1MH5A 1OVZA 4U1SB 1J88A 1IBYA 4M7LL 4PJGF 1FIEA 4Z7OE 5A6LA 3UO1H 2F19H 2OZ4A 3EYUL 4X6DE 5D6CA 4KRMB 4B9FA 2HRPH 5T1LB 2OZ4L 5GS2H 2J72A 2WXPA 3OZ9H 1JNLL 2AGJL 1WICA 4UTCA 3R19A 4L8DA 2J43A 5FYJU 4NPYA 1A4KB 4JN1L 4UILL 4OJDH 3FO0H 1IRAY 5D2LB 4IMKA 5I24A 2GQHA 1KBKA 2JKIS 1OPGL 4AGLA 1WISA 2KS0A 4ZUVB 2WQWA 3WSQH 4HEMA 4DW2H 3UC0L 2FTAA 2G5BB 3FQTB 3V7AE 2ICWB 4OKVB 3B7TA 3FZUC 1KJ2B 3O9WB 4NP4H 3FCGA 5HVGB 4DEWA 1UH3A 4A1RA 1V05A 2X4TA 4QRRB 3MJ7B 1INQB 3W5NA 1BQ5A 1CJYA 3WN5A 1FZOB 3R06A 1D6VL 1LEKA 4PGEA 2EO1A 4ANXA 4ZQTA 4KJWC 4TRPL 3AWFA 5DJYA 4WI9A 4G3YH 2G60H 1M6UA 1TYJA 4RMBA 3S36X 2DD8H 3OC8A 5SWQA 3ZE0E 2FYVA 2E3VA 2YD2A 3PGDA 2KL6A 2V17H 3HG2A 4YE4H 1GC1H 2WQXA 5E4AA 3SYOA 3KPLA 1XXDC 2DI9A 2UWEF 4LLDA 5HYEA 2ZUQC 2FO4A 5DD6A 3AAZB 3GBMH 4QF1B 3LRSA 4JDZA 1D5ZA 3WKMH 2NY0B 1KIRA 4C4KT 4LEOB 4M5YL 1JZIA 1TKWB 5FFOA 3LVTA 4PCYA 3GT6A 4JFQB 3VWJB 4P3CL 2GTWB 1TZHA 3A6BH 4XBPA 2B3RA 3MRRB 4QTHB 3IS1X 4MZ2A 4K9EH 4NB7A 1TSHA 1OO2A 3QRGL 3CFBA 1SN5A 5MEPB 3RBSA 4E41A 5AG8A 1E8XA 3SKOA 3ULSB 3VE0A 5I76B 1RD6A 1A3ZA 1B0RA 1SN0A 4F8OA 3DSNB 3P4OA 3NCFB 1CIUA 5I1EL 3FS9A 3ZTJG 4ZXBD 3O6FC 2Z7WA 1REIA 3H0TB 4WHTA 3O4LA 3RZWA 2X89D 2G3XA 4LARL 5J0BA 1A6UH 1DVTA 1CXKA 1CVRA 4FCHA 4PGCA 5D4HA 2NY3B 1USQA 2QR0B 1YC8A 3HE6B 5EORL 4HGWA 4HPOL 1WZ1H 2R2HA 3T09A 3VVVA 3QUYC 4Y19D 4LBEB 2FX8L 3ARGC 3CFJA 3FFCA 1AQKH 2HLFC 3A0OA 1BBJB 3C09C 3DROA 4LF3A 4NM8L 4CMMB 5DZNA 4L4TE 4ODUA 5DJZB 1ZSDB 4WI0B 1VPOL 1NFIB 4YFEA 2PXYD 4M62H 3AUWB 3BYTA 4N0UE 4Z7WA 2ZUUA 3V4VA 3U9PL 2AEQH 3BESR 3MA9L 4M56A 1UM5H 2C1OB 3KMDA 1A25A 3GUFA 2NX5E 3V4VL 5I18H 2D7OA 2EIBA 2PWHA 1NCHA 4Y9GA 2FQDA 4ORGB 3X3FH 3CLFL 3D39E 1J0ZA 2X2JA 5IT2L 4IIQB 5I9QB 4RDBA 5JXAH 4NZTL 3ZDZB 5I1IH 1FYHB 4GMTH 2X38A 1JPTL 1HTYA 2IPTL 2YEZA 4KTYA 4PTUA 5FKPB 1WBYA 1CI5A 4BFIA 3BMWA 1SGKA 5DZVA 2VERA 1RQ5A 1QR1B 3B9VA 4R2GB 1WBXA 3T9WA 4RNRA 2CK0L 4D9QD 4ZK8A 3BRGC 4UU9B 4O4YL 2ZX8A 4R0LA 3R1GH 5I1LA 1TQVA 3PQYA 2O6DA 4P4KA 2XRAH 2EIJB 1FVCA 4R8WH 1J1PL 2BSTB 2WBJB 1KDIA 1S9VA 4AJ0A 1SM3L 3EO0A 1Q9OB 1T0PB 4Z7VB 1AQMA 9PCYA 1SJHA 2QGEA 2Y6SD 1GW0A 1ZHNB 4A2FA 1EO8L 5T1DL 4JVWA 4JJ5A 3MRGA 4F91B 3B7RL 5CBEB 5DMIH 4IRSA 3TWCH 4QOKD 3MV8E 2Y4SA 1A6ZA 5KTEL 3ETBJ 4E9TA 1JPEA 3MRPA 2WWMC 4KRLB 1UCTA 3RI5K 3QG6B 4N8VB 3F7RA 4GINA 3SCMB 2CCWA 4PV9A 4P9HH 3BIKB 4XAKE 5JIDA 5ISZE 5DC4B 4JO1H 1UA7A 4GW5A 1UJTA 4X4YB 3EH2A 1FO0A 3ZR6A 2YXVA 4XPGH 4K3JH 1SHXA 3FH8A 5MHSE 4KH9A 1ZGLM 4JE0A 3GXDA 3UOAB 3V6OE 1FO0L 4S1QL 2EIDA 1LILA 1PAMA 2VZ1A 2ZG3A 3CBKB 4G72B 3TZVD 3IAGC 3EJZC 4POZD 3VD2A 3VSUA 3FTWA 1A0QH 1JPFB 3B4NA 5FIEA 2YPLD 2VISA 3KBEA 1A22B 1W2KT 3I9IA 4OGYH 3BP6A 5BZDB 1FL6B 3V9FA 2NXZD 1AP2B 3AS3A 4QHNA 5FO9B 1F3DJ 1NFDF 2JCCA 3BWUF 5D5MF 1LO4L 1GC1C 1MLCA 2HJLA 2X2HA 3ETTA 4EZJA 4D0DA 2GAZA 3QJOA 4YDVA 5F3HA 1X44A 3VRJB 3QFJB 3KCWA 3BUBA 3O45A 3D69B 4KTDL 4KVPA 4LLWB 4PJ5D 1JWUA 1OE1A 2BHZA 3MX0B 2YAQA 2LVEA 2QQKL 3GBLA 3IDIB 3FN9A 4LCIH 4YR6B 4S1SH 4AIEA 3O3AB 1HEZB 2A3TA 2VLRE 3RUGE 4H7VA 4LLUA 5D7JA 1V7NH 5IEHB 1FLRL 4A55A 2AXGB 4ZTEA 3HNTL 1LP9F 2GTQA 4YSEA 1R3JA 4E0RB 1MCEA 3HJ0A 4CN1A 1QHQA 1JTPA 2ITCB 1S7UB 4NQDB 1KIQB 4HUMB 3OHXB 4JO2L 1F90L 3ZT6A 2FSDA 3M1BB 1FE8L 1HSAA 2X6MA 4L8BA 1QUPA 4IGBD 3PHQB 1MFDH 2QFRA 4GIOA 4X9YA 1K4CA 1XB8A 2COQA 1WFIA 3ECBB 3LY6A 4JUSA 2I9TA 1GJUA 2I5YH 1RCYA 4MQXC 4J7RA 5E2UL 1BIHA 4FF9A 5EU5A 4WHDA 1U8LB 4X6DF 3D9AH 5AAWC 3ZYIA 3BW9B 1FNGB 1CK0L 2Z8WC 3W82A 1W6LA 4G9FD 5HYSG 2Y7NA 5K33A 4R3SA 2BM3A 4N2KA 3WLWD 3MLWL 3L3GA 4WV1A 1WQVT 3WL9B 1I3GL 4PJCA 1LQSR 4N2HA 3ME0A 4OCXH 3O8XD 2MJWA 3VQ2C 4ZXBA 3JV4A 3CVHB 3X12A 3IDYC 4NUGL 3RIAK 1XCXA 3T3PB 4HBCH 3EDJA 4I18C 5DA4A 1VJSA 3HBPA 4IW4C 5LGKA 4APQB 1MAKA 2CU9A 2CLVA 3D2TA 4K9EL 2P80D 1VGEH 3EF4A 5F7DB 3BX7C 4Y19A 2EC9T 2Y5QA 3WU1A 1PPIA 4OIAA 3NJIA 4JZJB 2WXNA 3CXHK 4NQCB 3TBWA 1HJBC 3LZQA 4R7DB 1OB1B 4PJGB 1AZNA 4ZFGL 4ORZC 5DRZB 3DA0A 1UGNA 3OZKA 4RMQA 3K71B 5LBSA 5DK0B 1QVOB 3G5VA 2PPCA 4ZFZA 1H0DB 1KIPA 5BQDA 5LBSL 3WFDH 5ID1B 4OAWB 4L1BA 4JKNA 1A5FH 5INDA 1U8IA 3NJLA 1GYVA 1XGTB 2M2DA 3CK0H 3GMMB 5JR1L 1H6EA 3FQUA 4XC1H 4XN7A 3TV8A 3V9EA 1KFGA 3VX1A 1J7VR 2BNQB 2APWA 3HRZB 1SEQL 5JHMA 3TBVA 3V0WL 4FTVE 4JFFE 3HI5H 4L4VB 1CQYA 5FGCB 4P49A 3BFOA 5GGVL 1KBGL 2GG1A 4X6FB 5DLML 3APCA 2J1XA 1U3HD 3QXDA 3LZLA 1M3IA 4YBLC 1TF4A 3CVDA 3KPSB 2XCMC 3QHTC 4XT1C 2Q86B 2YXWA 2J56A 4XP6L 2PPFA 5C86A 5E8OA 1DVFA 3MJGX 5I8EA 2BHFA 5FOBB 1NCIA 2AXHA 5H2BA 4B6ZA 3NH7H 3UX9B 4BCYA 1D5IL 3F7PC 5CFAA 1B4JL 5LN4A 2WW8A 1OCWH 2K8MA 3E38A 1AQDA 1KF9B 1CDYA 1DR9A 4G8IA 5JXAL 2UWEB 1EJ8A 4PH8A 1BM3H 5I1IL 2QELA 3RNKB 2CO7B 1KY7A 2EDNA 2YK1L 3QJVB 4TUJB 5TE7H 1ZIBA 5K59F 2P9RA 1NC2B 1DDHB 3NIDB 1E5CA 3EGDA 1KBBA 2MRYA 3VU2A 5KJRL 3B9KC 1GTFA 1VKXB 3HIZA 5DC2A 3CV5A 3LQMA 4U05A 4OD3L 4YMPA 3K6SA 4U3CA 1IKOP 4NRXB 2KH2B 4MVBC 1K2DB 2VR7A 5I0YA 5HHME 5J1AA 3GC3A 2P5WD 2VT0A 4G42A 4M4PA 2XRAL 4JHVA 3WMQA 4DP7X 4YHIA 3TBYA 3SOTA 5IREA 1NGXB 4ANUA 2HVKA 3F7YA 1HXMB 3FCBA 3BGMB 3CQFA 3DUSB 4FG6D 3QZWA 4WSJA 5D93C 1CDUA 1MCFA 3DXAD 3ROLA 4HYTB 3E8VA 3WNLA 4YPGA 1C12A 2E7BA 2LU7A 2YBGA 7PCYA 2APBA 2A6JB 5KBDA 3TZVA 4L9LB 1RPKA 3RAJL 4H26A 4IRJB 4I1RA 4KHTH 2YPLA 5D72H 3ULUE 2X4QA 4IU3B 1IAKA 4E9LA 2BOBA 4U6TA 4AT6B 3KNBB 3KPRD 3MYJB 1JGLL 1SBBA 3O3BB 3PP4L 3QORA 4GKLA 3VFOB 3MHZA 5JHLL 4XNZC 2OMVB 3T0XA 3UGUA 4P9HL 1VCAA 1TYRA 2AK1L 1MCLA 3ZKMD 4L8SA 5BZXA 1IGIL 3MMEB 4QRTA 2W9EL 4XPGL 3RVWC 1JGDA 2VL5B 1IM3D 4MA1B 4OCYH 1ZY9A 5C07A 1VSCA 1U8QA 4OW6A 5CHNA 1EAJA 4KKLC 4IBWA 1G6VK 1NEZG 5JOEA 3N43F 3LN4B 1KJMA 3IDNA 3UG4A 2CO6B 4G6FD 4DETA 4WW2A 4NO0B 4L8CA 1UB5B 1OSZA 1HCVA 3GSVA 2W92A 1J8HE 3DARA 2V0AA 4MQ7A 4BUGA 4JB9L 2Q5BA 2P45B 1IGFL 3BFQG 5I1KL 4OZGB 4FERA 3C9NB 4IGBA 4LQ1A 2X4RA 4X7TB 1WZKA 3FQ2A 4ZMVA 1IC0A 3ZZQA 5D1ZI 4YWGH 1NCOA 2RTTA 3X11A 3NA9H 2OM5A 1G6RH 4Y16D 3BWSA 3HN8A 1SRDA 1UEYA 5DFTA 4A66A 1JGEA 4JCMA 1UATA 1TJHL 1ERNA 4LCUB 1DCLA 2WLKA 3T2PA 1WD8A 3QZWG 5CEXA 2IAMA 4G9FA 2B1HL 3KYNA 1R0AL 5D1XD 5HYQA 4H5SB 3RL2B 2EYRB 5DD1L 4XMVA 3ARBB 3VD5A 1SPDA 2XY2A 1N59A 1KUMA 1ADQH 4TLSA 1F13A 1OGAB 4NKOB 5CMAA 4ZMPA 2DYPB 1NUFA 4BQCA 5BRZD 2HRLA 3BSGA 1BGXL 5E0QA 2P8MA 3IJSB 2C34A 3Q8AA 4ANWA 5GRZA 4YDJB 1I8LC 2MNUA 3FQNB 3GKWL 1SVBA 3S98A 2K3TA 4CN6A 5DUMH 4F7PA 5IB3B 4FI8A 5BMFL 1IC7H 1MWAH 3LKSB 4UF7C 3W1ZA 5IOPB 1QEWA 5B39A 4KO9A 3S8WA 4MXVE 1NBYB 1UT1A 3Q2VA 5IK3B 2FX7L 4MA8L 3ARWA 4UDUB 3U25A 4UCFA 5J9PA 3GMRA 4C8XA 4PHXA 3BJLA 2NY1B 2V9RA 3DUUA 4Y1AD 5LXVA 4Y4HD 3MFFA 3DMMA 5DC0A 4LQFL 4GFXA 2X6AA 3L3HB 4YVUA 4WUUA 1ZVHA 4LFHG 3CVIL 1YJDH 4AMKL 5C09A 2D73A 3AM8A 5C0EB 5ECJE 1CL7H 4GY4A 2HJFA 3P02A 1S9KC 2D03H 2J2ZA 1T3FB 1VENA 3Q8CA 4RMTA 3UROR 1TSRA 1NFDB 4WY7H 2KPNA 5D5MB 1XAKA 2BC4B 4MFHA 1M42A 2YN5A 5CINL 1VFMA 2OSXA 4UMSA 2O5XL 1U41A 2HRGA 1XWVA 4CDHA 2YGOA 3HE6D 5BJTA 1KXVC 3ZO0A 5E6UB 5CEYA 3ASOB 2GW5A 3T0EB 5B4MC 1JYNA 3SJVA 3DI2B 3UDWC 2RALA 4FYSA 4S1RH 3QNXA 4PRID 1LP9B 1GKEA 3V0GA 1G1CA 5JPMB 1RZJL 4OCRL 1BZOA 2VMCA 1RJLB 5FGBA 2NNRA 5GJTL 1D2OA 1QBLH 4AEHL 1AGEB 1DQJA 1MG3C 1UOLA 1EAPA 2FL5B 4HKZA 3GI9H 5F7YC 3RA7L 4K94H 5B39G 1JV5A 1YPZE 2RFXA 5KAQF 5AB1A 1FA4A 4NN6B 1XGYL 2RR3A 5D4JA 4X6DB 5D1ZA 5CD3A 2CD0A 1T7XA 3PAVA 1KPVA 2CO3A 3CIQA 5KVFL 1OCRB 2F53D 3S97C 3DXAA 3GSNB 5DT1H 5GRUL 4A7UA 2ERJC 2FT8A 4BZ2H 3DO7A 2W0KA 3JTBA 5EIIB 3N42F 3JWNE 4ADJA 4EAEA 3B2UC 4J6IA 4W1TA 1Y6NR 5D1QE 4PR5A 5TE4H 1DN2A 2NY5H 1PX4A 2WVSA 2G9HA 2OX5B 3KBPA 3QI9D 1U36A 4FYQA 5BNXD 2B5IB 2D2CC 4YK4B 4FLOA 3TNNB 5EBMB 3GTTA 1E7UA 4TUUA 1BECA 1TTFA 4PJXA 3MBWB 2XQBL 3IEAA 5HYFA 1N5YL 1IAMA 1XF2B 1AI1L 1QLEH 1XR8A 2XUWA 1KBVA 3FH7A 4LVNC 1DQTA 4X6EB 5HY9A 3C6LD 3CZNA 2NY2B 1R3KA 4GG6A 2WCPA 4IBYA 2GSIB 1MCNA 3QH3B 1BFOB 4P2CG 4OLUH 1S6NA 1BQHB 4OZFB 1MUJA 3PABA 4RGNB 2B1AH 5LNEA 5KW9L 1HINL 5D72L 1P53A 2H2SC 4J3OH 5KYXB 2J44A 3UZEA 3UGEA 1CLOL 4QYAA 5HI4D 2HMIC 3MNWB 3D33A 4RMUA 1RERA 2Y25A 1FL5B 3BH4A 3QRFM 3RQ3A 3GLDA 2BW4A 4HZAA 4J12A 5EN2A 3D3VE 1PZCA 1QSFE 4RSVA 2XN9B 3KXFE 2X87A 2Q0ZX 1MJ8L 4RIRB 4RGOL 4CW1B 3IGAB 1R5VB 1XBRA 3S48A 1VZGA 5F89B 2Z92B 1CXHA 3D0LB 4J3BA 3LEYL 2FWOA 4HH9B 4X5QA 3TYFA 5BQ7A 4AQEA 2HVJA 4ZODA 3BPCA 4UANA 1LEIB 2I24N 4YHKH 4TMPA 1T66C 1DBJL 1PW3A 3EYQC 4OM0L 3TM6A 1IE5A 3ZKXC 2V7NA 2D8KA 3FTZA 3PWPA 5D1XA 3GSRB 3FPYA 4PW3A 5E1GA 4ZAKB 4RISH 1KGJA 5DHYA 4M4RA 1N6UA 4H1LB 3IJ9A 4N0YH 1V54B 2DLHA 3CFQA 5KUKA 3CHOA 2OJEB 5JHDB 1B2WL 3RWEB 1IFGA 5ANMA 2HSIA 3W57A 2XFXB 43CAB 1H8SA 1U9KA 2X1QA 4HCRA 4FNLL 1R33A 1T5XB 2J4WL 3NEOA 2VDKH 5DQ9B 3QIBA 4D7BA 2V3FA 4HCRL 1S7QA 3L4WA 3MKKA 4MNGE 5AAMA 2ZX7A 3IF1B 4ZO9A 5A7BA 4KJQD 1Q72L 1AHWB 5C0BD 3VXSB 4YHYC 1I7TB 2DW5A 1S7RB 4RGMC 5B7EA 1GCYA 5DR5H 3VXOB 1L5GA 2VDPL 1OGTB 1SEBA 1KTBA 4WEEA 3B9EA 4L4TB 4R6UA 2CNYA 1DSFL 2XTJC 4Y1AA 3LKNB 4Y4HA 4N0UB 3STLA 2QPSA 1RHHA 3IBEA 5E51A 3WEAA 5CSZB 2UZXB 4X8CA 3LKPB 2OAAA 4ODWB 2NX5B 1JXDA 5EBGA 4HIIA 2I25N 4YSPA 3FF8A 3STZA 4YAQA 1OF2A 4JKLA 3C8KB 3E7JA 1OTTD 2CAKA 2VE6B 3FOMB 1JCVA 2AANA 1JNNH 3OKOB 1X5MA 1D5XB 1TVBB 3M86A 3G7TA 5FK9B 1CO1A 5C7ZA 3LOWA 1X5LA 4PG9B 3TJHC 2HJKA 3MJ6A 5CR1A 5C0FB 4QLRA 3D4ZA 4WKZB 1TETL 2W9DH 5KVEE 1JN6A 2BVPA 3KR3L 4KTGA 2D7MA 4TUKL 3OWEA 4NKDA 2GVYA 3K8MA 2DZEA 2HG5A 2EDDA 2Z7UA 3QFDB 2OI9C 4AE1A 1I9JL 3QNFA 1FNEA 5HYJD 1IIKA 1X5GA 3N43B 2V5YA 3VH8G 1WHPA 4JRYB 4Q58C 3BQUB 4ZMAT 2GITB 1LO5A 1WZLA 5AW4B 4LU5H 4P4RB 5BO1L 4F8PA 4PRIA 3BUTA 2HN7A 3LCYA 5KZCB 4WY7L 5GXBB 1MJ7H 3OMNB 1ECYA 2QMJA 2PTUA 2QQLL 4EUPA 1SZNA 3W11D 3SBRA 3P77A 4M1CD 1JFHA 1ES0B 4LSTL 4I2XE 4WO4D 1I8AA 3DGDA 2ZJSH 3QDHA 1UCBL 1O9WA 2EDWA 2AQ3A 3B8SA 1QZNA 4YHNA 5I71B 3H9HA 4FQCH 4MXVF 5FPIA 1FSKB 5ISZB 4MD4A 4JREB 4ZRGA 2QDWA 2F53A 3OSKA 3P73A 4NRYA 1DQDL 3KLAB 3MA7A 4QMEA 3QHFH 5JOFA 2X6CA 5DEGA 4JM0A 1ETA1 3OXSA 4PLJD 3VXUA 3OPZL 4F2FA 1BXXA 4PY7B 1TOXA 3WY2A 2VN7A 4U6XB 3KPMA 4P07A 4FL4C 4DOHE 2O5YH 3MUZ1 5I6XC 1UD6A 2V3DA 3M07A 4F7EA 3RWHA 4K94L 3KLHC 1HL4A 1WAAE 2BXZA 3MLUH 3VD1A 3GBNH 4JLRA 1QFOA 2D7NA 3VI3A 2R1WA 4FABL 3CAFA 2F74A 3EDKA 3C6LA 5E9DB 2A4CA 3SDXA 1MQKL 4UT6A 2IALA 4YDIL 3TJEH 5IFJB 2BNRB 4L23A 3FTSA 4LCYA 4YGVB 5DYFA 4UT6L 3VFNA 3T5WA 1KYDA 4X4XA 1EBPA 4ONHB 3LQAC 3LIZH 4JFPA 2OKMA 2VO5A 2CDFA 3LZRA 2C9UA 1HHKB 2VLLA 3IKKA 2QQQA 4OUUA 1FPTH 5DMJB 1BF8A 2ZUTA 3RUGB 5ETUA 3CSGA 1RHFA 3QC6X 3KVQA 3O11A 3HMWH 4NZJA 5E6SB 4NNYA 2NR6C 3ARFD 2WLNA 4RFEB 4R5TA 2R0LH 5D7IE 4AQ1C 3C6SA 3X2QB 5MERA 1HZLA 5ITBL 3D85B 4MD0A 1RZPA 4N9GB 2VQTA 2WQRA 3DOSA 3L2MA 3BQVA 3MJWA 3GHEL 2X3CA 3AY4C 3MRBA 5IESH 3ZUNC 2ZXBA 3EFFA 4PJHE 1H3UA 1B4RA 1SJVA 3SPVB 1NKGA 3MNZB 4NJ9H 1WFTA 5KVMC 1C5CH 2IQ9L 1YPZF 3SE4C 2FBJH 4NAJA 2GUOA 5IZ7A 4FXKB 3VG9B 3TH4T 4ELDA 3HZMB 4KK6D 3WENA 5JA9A 4LHQB 1PY9A 3CMOL 3VSQA 4Z3TA 1HILB 3UAEA 1JHKH 1EZLA 1L6PA 3F62A 5FM5O 2ADGA 5D7SH 5FUOL 4DCQA 2K6WA 2H4EA 1FRGL 1ODUA 1DANT 3PWVA 2Q20A 4WFHE 2CR6A 3L4CA 3ZU8A 3HE7C 1C8QA 1DQQB 1TVHB 2JELH 4G70B 5DYOB 3HB3B 5KVDL 1XMWA 4X7FC 5A43C 3CH1B 3FAXA 1OL0A 2XZCL 4AZ8A 4MMXA 1QYGH 5TE6L 2DQHL 1GGBH 5K9KA 3M7OA 2IIJA 2H32H 4I0PB 4K7PH 1FNSL 3LSOA 1KPRB 2AEWA 4GXVH 3OMAB 2AAVA 2E6JA 2IOOA 2FR4A 3SKMB 3PRZA 4N2MA 1KB3A 5JTWA 4N2AA 5JXED 3VRLE 4NJAL 3G08B 3FT3B 4Q9BA 3I6GB 5D7LE 1YA5A 5A2FA 3VSTA 4JJOA 2JJTA 4LL1A 1HJCA 3QIUB 1TU2B 5AW3B 1CE6A 1RMFH 3N42B 3GPEA 1UQSA 2NZ9D 4NGHH 3KWTA 3NVQA 1GY1A 5F3BB 2QEJA 2XX1A 3CSTA 2X53A 1AQHA 5HXMA 4JFFB 2C7UB 4J3OG 4Z8FL 4U1LA 5E2VH 1J5OL 2HUEA 5FA4B 4XX1E 3HG1B 1KB9J 5BOZG 2Z7ZA 4AV5A 3RGVA 3ARDA 3BRFA 3MU3A 3SE9H 1W8OA 1JE6A 1CC3A 2AI0H 1FGVH 2P24A 2CR3A 2ZCZA 4KI5D 4MAUH 2MOVA 3PL6A 4KRPB 3II2A 4GUPB 4UQ3B 3L9BA 3G6DL 5DVKA 5HYJA 3QK0A 1S7XA 1N2RA 2I07A 2R56H 3I2CL 4QTFA 5AZUA 4JO4H 1XGUB 3DX4A 3K2KA 4XAWH 5L8LB 1IJNA 3IE4A 1ZWIB 4Y5VC 1G1YA 5EZIH 4I13B 4N2BA 1S78C 3AQYA 3DHUA 5CAYB 1ZVSB 3JT0A 2N0KA 4WLCA 3F7QA 3SPCA 3PAYA 1JK9A 2PTTB 4Q9QL 2B7DT 1N3NA 5AUMA 3S35L 5ICXB 1FV1A 2DI8A 4UNIA 4FFZA 3TS8A 3FFDA 5DD3H 4FFZL 1T4KB 5FEBA 5EA0H 4A7VA 4O2FA 4R26H 1SHMA 1MHHB 4NQEB 4BIKA 1EFXD 2VLJD 3FAWA 4XZUA 1ZXKA 4PWFA 3E9TA 4NQVB 5E4IA 4Z3GA 2MFNA 2BZCA 5F9DC 1PKQA 1KN2H 4XR8C 1WWCA 2Y1ZA 4IRZH 4XNAA 2Q6WB 3B56A 2AXFA 3D2UB 3QAZB 3T04D 3BZ4A 1KENH 1J86A 2FYYA 2P5EB 5IR1A 4LCWA 3GB7B 4MA7L 2K1MA 4M93B 3V4LA 3CN4A 4OLXH 2YPVH 5CZXC 4IOIA 5DD5H 1T21B 3L7EB 4X5LA 1KZYA 2MCMA 4HS6A 5HPOA 4ZS7L 1E9PB 4NN7C 4GSDH 2EEXA 2R23B 4YO0B 3QZMA 2J88L 4G9DB 1JHTB 4Z7UE 5FYLD 1XQ4A 1ZLSL 4Q9CA 4AYFA 5FUZL 3QZOA 4YBQC 4MX7B 1A7PH 2WJ7A 2WVTA 4NT6B 3QCVH 5C0GB 4D0CA 3EHBD 3MRFB 2WYHA 4DKTA 4U7SA 4HBQA 2L0DA 1OAYL 4NSKA 1LO3L 1KCSL 5GISL 1U3JA 4QHMB 3HS8A 3MJ9H 3VGBA 4BFFA 1KCVL 1J8HB 2IMMA 4BBWA 1EVTC 2H2PD 3B2XA 1QASA 4X9HA 3TT1L 5JDSB 3TTSA 4B9CA 4HUVB 3LQZA 4CUCA 3BPNC 4XRCB 3K91A 5B3JE 4RMRA 3I9GH 2FBRA 1UVQB 2BP0A 4Y4FC 3F58L 2WY3B 4WDIB 5D4IA 1MCJA 1F4YH 3JVFC 4LHUB 4RESB 1RUMH 3WHXA 1U8PB 3ZR5A 4GAFB 3RI5F 1MCSA 4QCIA 3W0WA 5AVWB 4E9YA 1UOVA 1UUNA 1FPTL 2JMRA 3HC3L 5FR3A 2ENSA 3AC0A 3AT8A 2FUQA 3QPQD 1MVYA 1C08B 4Y5YA 1JS4A 1S5HB 2VDQH 4QHKJ 1PEWA 4QRSA 4GRLD 1Q9LA 3ZTNL 1BEYH 2PR4H 4UV4H 1G7PB 3ZE2E 4EO5A 2W0LA 4TVPH 4GKZB 4TSAL 1NMBL 1RZKH 1QFUL 2R2BB 2VL4A 2QVTA 3B5HA 3QJUB 5CBAA 5BZWA 2CLRB 5ESVB 2CKBA 5ICZB 3JWDC 4M61A 5L4JA 3PGCA 4P2RE 4UAOC 1GYAA 4K8RD 4F2MA 1HH6B 2CKBL 2WXOA 4L3FA 2ADJA 2Z8VC 2IGLA 2IPUK 5AW1B 5F7EH 1G9EA 1XEDA 1T6BX 3L3JB 3F12B 4YHMH 4NZUL 4N6RB 2FB4H 1ZDQA 2NCEA 3V0JA 3QIWC 5D7SL 1MOEA 1YN6B 4HWEL 5JXEA 5MEQA 1KXQE 5A2AA 5HVHB 2VW7A 1NIFA 2X6BA 4K4KA 4DP1X 2UVFA 3U0TA 4KQ4L 4DP8X 3MXVL 1C5BL 4LOFA 1N26A 3VXQA 2W07B 5GZOC 3NPSB 4WEBL 2XPGA 4NQUA 4PU2A 3BD3A 1U91A 2VDOB 2H6UA 1ND0B 3IMSA 4PJEA 1R17A 2IH3B 3GMQB 3GDBA 1RZ8B 1N19A 4DPCX 5CEZH 4WK4B 4KI1A 4A6YH 3F7LA 4YDZA 1NCAH 2YD7A 3T71A 1MQ8A 4GW1A 4RCAA 5HPMB 3W9DB 3DETD 3MRQA 4CU8A 3J8F7 3BGFB 1E6OL 5B3NA 2VDRH 4H20H 1R24B 3HOGA 5LNDA 3FB8B 3P4LA 1HQ4B 2WV3A 3RDTC 2CLZA 4AH2B 5CIPH 1F4WH 2BSDA 2LTQC 3MR9A 4L1DA 4HW6A 3K4AA 4NPJA 4JFDE 1EJ6A 6TAAA 3WS6C 2J20A 4XPFL 1T2JA 4ABVA 5KOVC 3RIAF 4D9RD 3OKMB 4R4BA 4HP5A 4L4TD 1I7UA 2O1AA 1NCDH 5C0CB 3TCLA 4EZLA 2CALA 1CWVA 5I6NA 4IMKC 1YEGH 2XHNA 4PEEA 1JTOA 2IPUG 2C3XA 4IHOB 4UM9B 1F6AB 4B50A 3QUZD 2NXYC 1JNJA 2ENQA 3WTXA 1N8ZB 1IEBB 1RUKH 2HTKD 2I69A 4F3FB 3UADA 1YPZB 4MYWB 3BRDA 3LKRA 32C2B 3D39D 5K39B 1IC5L 2EACA 4BA0A 1EFXA 5H35B 3PREA 2VLJA 2OYLA 4A7GA 3IDJA 1KACB 1TIUA 1LE5A 1QLRB 5GQBA 4XPTH 3UJJL 2A6KA 5J12C 2BFVH 3C2AH 1L9RA 2OMBA 1A6WH 5I8KL 3FTUA 1DUZA 3BPOB 2HT4D 5D1QB 1XZ0B 2P1YA 4G5ZL 1SDDB 2VXSH 3CDZB 4HZ1A 1BLNB 4QRBA 1YEKH 2JB5H 3DX7B 1O6TA 1X9LA 1MFCH 1IGML 2XZAH 3BWZA 4JPIB 3OKNA 4XPAH 3WI9A 4ODTH 4FA6A 4BK4A 1WSST 4DT2A 4PAZA 1LQBC 3WNNA 3QJFA 5EMYA 3EFDH 3Q6FB 4FFYA 2L04A 4Q6IB 3SKJL 2M83A 3UBGA 3RU8L 3AWEA 1UURA 1JPST 3ARXA 3HTLX 3S34H 4EN3B 4MJID 4FQ1L 3K3QA 4GLRI 3IJHA 5FYLL 4FFYL 2X0WA 2HX8A 3MV8D 3WGVB 3CQQA 1DEEA 1TZOA 1KYOK 3TBSA 3VWKD 2YS4A 5DZJA 3QPXH 1BPVA 5LAXB 3H2QA 3EJJX 3ABKB 5L0QC 2Y0SA 2EXWC 4C55A 4ADGA 4R83A 4XAKD 1CLZH 2OLDA 5L4MA 3ZYJA 3D34A 2XWTB 3EYVA 2FZ3B 3VYOA 1NAMB 3MLVL 1QSFB 2QT6A 3W38A 1MCKA 2DYRB 3L3DA 1YYLH 1ASOA 3KXFB 4JY5H 2C3WA 1F4HA 3H8NA 2X4OB 1GOHA 4ISVB 5D55A 4MJ5B 2R7EB 3UEQA 4R84A 1YNLL 1JFQL 3ZIYA 1MAMH 1ZGLA 1G5GA 1RZKC 3B83A 5C0JB 2WXLA 3OGCA 1P7QD 3AQZA 4DPBX 4BELD 2FJHA 2VKWA 3TVMA 4XCNA 3RJDA 4XHJD 2ZXGA 3GI8H 4GQZA 1WEJH 3ZKSD 3S96B 4KHXH 3OB8A 1M2VA 4GRLA 3EFOB 2G0KA 3ESVF 5DSCA 1BX2A 4O2CA 3UJIH 1JZEA 4TTDC 2H9GB 1RZQA 2X70A 1UWFA 3X14A 5B1CA 1CICD 1F4YL 4Q9RH 1RUML 1RVFH 4E5XB 2HWZH 2JNZA 4KKCD 3MLYH 2ZUQB 3ESMA 1P5UA 1Z6JT 5CGMA 4XXCC 3KWWB 4JCLA 2J1ZA 4ZUUB 4B53A 3QXAA 4QWWD 2VLRD 4PRHE 3TOPA 2IDTA 1JWSB 4K8RL 4PW9A 2VC2B 4Z7UF 1KJVA 4KOCA 1BFTA 3SQBB 1BFSA 1OZTG 3ZHLA 4YUEH 4GRWE 1QPKA 3MGAA 4UNUA 2WLIA 4M7JH 2F0CA 4L29B 3DX6A 4TVPL 2BJMH 5DFVC 2BIOA 4KVCL 1UXSB 3N5AA 5KVGH 3Q0HA 4RVBA 1BZ8A 3N1FC 4XCCH 1YNTF 2FX9H 2IOIA 4HKXA 2Q2LA 2XWJA 2PCFA 5EUOF 4NFCA 4R0LC 1TMQA 3ARZA 4UM8B 2XWEA 4P4KC 4U1KB 1S8DA 2AKRA 3RFZA 4PV8A 5IJBC 2HT2D 5IY5B 1A6AA 1PFCA 3PDOA 1IC1A 4QY8B 2WTPA 2E46A 5B3JF 3O6FB 3B1TA 5IHZA 3RGHA 1A1MA 2D31A 1ZGLP 5MEOA 5LDUA 5E5UB 4X4ZA 5JQHC 2ESVE 3TYGL 4QD2E 5JQ6H 1QABA 1SXBA 4IRSC 1SMDA 4GG8B 4V1DB 3ALWA 1JXJA 5T3ZL 1OAXH 1DJXA 3QUYB 2DWEA 1RIUH 1KNOB 4N2GA 4RX4D 3ARGB 3EYSH 4GIAA 4Z3HA 4AXWB 5I1HL 1UYWH 2UZYB 3BT0A 4LRIC 4HVBA 4LSSL 2GJ6A 4HT1L 3SYCA 4P5TD 3C09B 4MCYB 4OCLC 2V5SA 4XWOD 5F6IC 2AJVH 5GIRB 4BKLB 3O3EB 3VAEA 2UZPA 4YZFF 2WWKT 2W91A 5HHQB 2E7LA 3EJRA 5KSUB 1ZS2A 1L3NA 4W93A 1BXAA 2GJJA 1M53A 4Q8BA 1CFQA 1ZT1A 3A4DA 4QLWA 2IPKA 2VDRL 3OLIA 1DQKA 1XGRB 3QUZA 2R1YA 4BKTC 2AHIA 3B9DA 3T6XA 1WGVA 1BMZA 1AKJD 1O7SA 4Z76B 3R8QA 1F4WL 3PPSA 2DMGA 2OV0A 3BEVB 3S88L 4QXGL 3MUUA 1X4ZA 2YKLL 4FTVD 3WJJA 3L4XA 3MVSA 5EOCH 4WWKC 4JM2D 1G0YR 3WEOA 3QR2A 4C59B 4JNXA 2K6YA 1ROCA 3V4UH 3H42H 5L2KE 5HYSB 3V6ZB 1MEXL 1E4KA 3BH9A 4DOHB 5BVJB 4PI0A 4YN3A 3LXBA 2EQDA 5K9JH 3FU9A 4X6CF 1MCCA 3MGOB 4QNPE 2XQYK 1B3IA 1W0VA 3MLRH 4OFKA 4PD4J 4ELKB 1IM9B 1MCPH 2JB6B 2J8UA 2R59A 3GXFA 4RFNC 5HHNA 1RURH 5TF1H 3X13B 4BSWA 4IS6A 1FFPB 4AGPA 2VDNL 2ZTBA 5JW4N 4XPTL 3PJSA 1P84K 3REVB 2BFVL 2E59A 3GXMA 3P30L 4MJIA 1AGFA 1YYCA 2Z35A 4M5SA 1HI6A 3F5WA 1SOXA 3VWKA 3WIFA 1HDMA 4ERSH 4ZX4A 4KKPA 5HHMD 5GGUB 4CNIA 3BPLC 3NACL 3VFSB 5L8JB 5I16A 2WZAA 3KLKA 3H54A 4L3CA 1WLHA 2VUKA 4PI2A 2L7EA 1EEZB 3ZTCC 4ECNA 4JR9H 3WEXA 3ILPA 5DWUL 1O6VA 4U1HA 1A6VL 1WPCA 3E80A 4FA8A 1TO5A 4NYLB 4KJYA 4U3SB 3QCTL 1WGOA 2W0FA 3MOBL 1RAMA 1DSWA 2GIXA 2WZ5A 4KNTA 3LS4H 3ULUD 1RU9L 4JKKA 3DLQR 1D7CA 2IG2H 4ODSH 1XH0A 4BFGA 3B37A 1BHGA 4DK3A 1IQDA 2FH8A 1QA9B 1YDPB 1TTAA 4KDTC 2B4CH 3BGAA 5IVNA 5LNGA 1MFEL 1MIML 4JY6A 2RACA 2WIIB 2QKIA 3U0PB 2KZBA 2PXYC 2IQAA 7FABH 1YYLL 2NW2B 5HDRA 1OWWA 3VGHA 2EVJA 4ODHL 2ITDB 2BCKA 2OS7A 2I7SA 4DKAA 1GTNA 3NAAH 3GTNA 3QUXA 1C7SA 5IGXL 1EXUB 1I85A 2WLMA 3PWLB 4U6HA 2G4EA 3C5JA 5J06A 1OHQA 2A74A 3FBKA 5IV2B 4FNUA 1L9QA 1NPNA 1ZHKB 4S1DD 4OI7A 1MRCL 4HPYH 1NA8A 3AXLA 3ZZLA 4JGJA 1H3GA 2BSCA 2DLFH 1QOKA 1BZQK 1IGYB 1NOLA 4X7CC 4BH7B 5IQ9B 2X1XR 4DGVH 3MBEA 3PWNA 3MUGA 4TULL 5D7LB 1PZAA 2NY4D 2LLGA 1KEGH 4YXLH 1KG0A 1QMUA 1I1AD 1YN7A 5J4MA 2C3GA 1RK0A 4Q2ZB 2FEDD 3SGDH 4PRNB 3FB7B 3QUKA 3WD5L 5GS1C 4QRPA 4J27A 5EC2B 1S46A 1RPUA 1H9VA 1JF6A 1GGIL 3H7LA 3IDYB 3P0VH 4CVUA 2Y6SC 4PLKD 2DJUA 1XH3A 4I18B 1NL0L 1KGXA 5TDNB 2FGWL 3ZDYB 2ZOLB 3LZFH 3WE6B 1KN4L 2VDMH 1RIHH 3MBXL 5E8EA 1YC7A 4Y2DD 4DZBB 3G6AA 5C9JB 5CUSL 4H13C 3BD5A 3EOBB 5J5EA 4WNQA 3RB5A 3MJ8A 3E1ZA 3ZGHA 2F6AA 1OAUH 3ZDWA 4PGDB 4XNQA 4DEUA 5C6TL 4PTTA 3SGKC 4AEIH 4DN3L 2E86A 4JG1L 4TM9A 1PDKA 3LZOA 3S36L 1JWMB 1H6UA 2IANE 4PVLA 4BYHA 2EIZA 2R0ZH 4POZC 1FYTA 5F8RC 2PN5A 5IROD 2DQJL 1HZKA 3QUMA 1OAXL 2WVUA 1IEAB 2VDLH 4ZUSB 2EO7A 3EYSL 3ESPA 3F64A 4HWBH 3QUML 4FQXA 4BH8B 2NXZC 3QJRB 1WC7A 1X7QA 3U7WL 1WFJA 4M7KH 4ZFOA 2EDHA 2PCYA 4TLUA 1BAFH 1JRHH 2AJVL 1KLFB 4YBLB 3I6KB 4YIQB 4ZFOL 3FUKA 2QLYA 3NIGE 1M56B 4JM2A 5EOTB 5AL8A 2JJVA 3H7BB 2CHDA 1I53A 3UABA 4IDJL 5F1IB 4WI2A 2Y9RT 4N0RA 1L9NA 4L37B 2VLME 3BUQA 2BP3A 4JDTH 4O58L 3BP7B 3QT2A 4GT0A 3PU7A 3OJMB 1DN0A 5D2NC 1GW6A 2K4WA 1QRNA 2BY1A 2Y22A 4NN5C 3OX8A 1E42A 3QDJB 1CBVH 2HLAA 1AAJA 3BP4A 1IFRA 1I8KB 3GF8A 2AMUA 1W8NA 3B9KB 4IGBC 1PYWB 4HHAB 2R51A 5L9DL 2EJ1A 1ZEAH 4Z7UB 2WXIA 3MV9E 2VXTH 1N5AA 1DBAL 2XX0A 3GO1L 4DO5A 1TZGH 1JYVA 4PREA 5GSVB 1YNTB 2XQ0A 1U8HA 1ZRUA 3IN0A 1CDCA 5T1KD 3VFRB 2FQFA 5CJXC 2D4DA 2FATH 3WLWC 2Y7QA 5D93B 1U6AL 3HFML 3I9AA 4J8QA 3FXIC 5JPNC 4OLYH 5F2FA 2JK5B 2X41A 3ESUF 3O8XC 2AJ3A 4JFVA 4ZX6A 4L3EE 3OJDB 2ZT9C 5SWZB 5MENE 4ZSOB 1I7RB 2IADA 4QUOA 2B4CC 1I1YA 4PJ7A 4BV1A 2A83A 2QPUA 5GGRA 3CPUA 1NJ9A 1JGVL 1MN4A 1W72A 1ZOXA 1KJ2H 2HTLD 4HJTA 3GRWH 2VITB 5IBUG 5ICUA 2PW2B 2RBLA 4XNZB 1W72L 5JORA 3UZVA 2APSA 5K9OA 5BUPA 4LPVA 1P69B 2PO6D 3L2LA 3P0YH 3WIIL 3LN5B 3TV3H 2XPZA 4ZOCA 4RDQG 4UT9A 3W9EA 4J3UA 3C60C 5C0AD 1K8IA 4G1MB 4M9OA 4XP4H 4OJAA 5LGHL 4HS3B 4JPKH 4LNVA 5TK4A 2DQTH 3ZKQD 1QACA 4KNSA 5DDHA 2BOCA 2F68X 4I48A 4BKSC 4G8FB 3PV6B 3BKCL 2V2XB 4KGJA 4E42B 4PJIE 2L4OA 3ILEA 5C3TA 1BG1A 2WKLA 2ZKXA 3CTTA 3VI4A 3UTQB 1PTZA 4G6JH 5FV1L 4I9XA 4OV6F 3S37X 3TO4D 4NDMA 1WE5A 2NY6D 4JZOA 5LCVH 5KSBA 4PFEA 3NJHA 1U3HC 3MLZL 3L1OL 3MLXL 2IXQA 5K5YA 3D3VD 1KLGA 2VCOA 1CT8A 3SD5A 1MFNA 2DQCH 1Q0YL 3QDME 5SWSB 4F15C 2OXGA 1KPUA 1VLXA 3WUWG 3FF7A 2AQQA 3P11H 4WHCA 2G2PA 1ILSA 4ZUWA 1SF3A 1RFDL 1XEUA 4K5PA 3PAUA 4PJBE 1Y1UA 5GS0D 2Y7OA 1ZA3B 4K23L 1TFPA 1PG7W 1IVLA 1HYRC 5IB4A 3NTCH 4XP1H 4P05A 1F8TL 1KELL 1RZJC 2J8OA 5AW7B 4P59H 3X1EA 4KTEH 4TSBL 4X6CB 4NIYE 1KBPA 2DH3A 3QEQD 1CURA 2DLFL 4FADA 3UYRH 3EUDA 4OF6A 3LKOB 1NGPL 2ATKB 3CZFA 3I02A 2B2XH 2MHAB 4G43A 4RLDA 3VGAC 4CC1A 1JPGB 5ITFA 4GB9A 3GRBA 2DTSA 2YXFA 4DUXA 2F54E 2CHXA 4ZDHA 1B0WA 1RUPH 3QR1A 1A6PA 1WYJA 5EU6A 5DRXB 1NC4B 2ICWI 1NUDA 1L9TA 3NCYP 3T2NH 1LDPH 2J71A 4FXGA 2IWKA 4IU2A 2PYED 4CVZB 2HFGL 4ZO8A 4UB0H 4FG6C 5IOKA 4TNFA 4HG4J 1E27A 1UENA 2BSRB 1N0XH 3ABZA 1F6LL 2YARA 3OXRB 2GSMB 4U1MA 5JHLH 1M05B 4LIQE 3E6HA 1M7IB 2VH5L 3NZHH 5IM7B 2XJLA 3O2DA 3DOHA 3MCKA 3AGWA 4B9KC 4B5ZA 3U6RB 1MFAH 3WAKA 4PN6A 3O2DL 1LO2L 3G6JA 4GMSH 4JFEA 1Y18B 1SLUA 3EO1A 4LSPL 4A04A 4Y9BA 5KS9F 5HI3D 3IJYB 4ICXA 3CSYB 3ZKMC 3QNZB 6FABL 1SXAA 1K5WA 3FT9A 5KOMC 3L9RA 3SO3C 3K46A 4AVJA 4KK5D 3GJFA 3IFNH 3KWXA 4KV5F 4IM8A 1T0MB 2XYCA 3OR7B 5EDXA 1DQLH 3EYOA 4NRZB 4X5PA 1P2CB 3VFWA 2Q76B 5ACLA 1HU8A 2VN3A 3GQFA 3QQNA 4NX0A 1BZ7B 5EZLB 1A7RH 2ALWA 4GAYA 5CU9A 1CGTA 5ID0B 1OY3B 1MI5B 2V7HB 3I50H 3K8KA 3ZE1E 4HALA 2RCSH 2Y36H 4OB5H 1YEWA 3KPOA 4YC2C 1UG9A 4ACTA 1LE9A 1WWWX 3Q06A 4RWYL 3CFUA 2I9LB 1UZ8B 3G5XB 3EBIA 4Y4KA 4CVXA 4EDXA 4HEME 1CFSA 1XF3A 3BDBA 4K3DL 4GT7A 2L7JA 4XVTH 4UYQA 1BQRA 4X7SH 2UXVA 1AGCA 3FU8A 3SE3C 2LFGA 1FGNL 1EAQA 4Y16C 4A37A 4D9LH 3N9GL 1BVNT 3DV6B 3DJTA 3BKMH 2BWDA 1MFBH 3WTVA 4XNYL 4I77L 5T1KA 1ID2A 2E76C 2OYMA 4UUJB 4WI6A 1T22B 4OJCA 2QQNH 5D1XC 1T1YA 5HDBE 5IW3A 2ERJB 5J6GA 1AXSB 4JRXD 3VD9A 1J9TA 2CHZA 2DQUH 1L6XA 4WFFE 1XB3A 2DQIH 2GT9A 4KK9D 2JH2A 4P8QA 3GUTA 3FYEB 4U1SA 3IFOB 4TKWA 1PG7L 2AQTA 4KXZI 3NCJH 1J18A 4UQ2A 2CE6A 3IB4A 1OSYA 4HLJA 3SYAA 5HHVL 4A63A 4AGMA 4DHLA 5DJ2B 1T03L 3FCSB 2OMUB 3F00A 3FSWA 3VXMB 3ARQA 4EKXA 5AB9A 1BZDA 2PO6A 1HWWA 1A4KA 3RWCB 3SKNB 3GSQB 4LVNB 4I3RH 1MJUL 4ZUVA 4LP8A 5C0AA 1JERA 2AF2A 4HF5L 2PCPA 3OG4B 2BS8A 1UADC 3U0WL 2ICWA 3EO9H 3FNKA 4BFJA 4OKVA 5IQLA 2YPKB 4PRAB 5HDWA 3O9WA 2GY5A 4LNRB 4NUJB 3KE0A 4WI5A 4Y4HC 2H41A 4QRRA 3KM1A 1OAZL 3MJ7A 1IO4C 4F1SA 1ZV5A 4E41E 1AVAA 1INQA 1DJHA 1Q94B 5L6YL 2JKSA 4AYEC 2ZSWB 1YMMB 4JFXB 4Y5XB 5EU7C 2SEBB 4KKAD 4NKIH 1G6RB 4CC0A 1QLFA 1S9XB 2EIKB 5I2IB 4R7NB 1MJJA 1DFBH 3ARUA 1ZMYA 4KC3B 4ZW3A 1Z9LA 2HLEB 3NP3A 2WUCL 4PRHB 1IAIH 3FUMA 1AJ7L 4PBXA 4Y9CA 3OMIB 3O4LE 4N90E 3H9SA 3T0VA 5H94B 2Z4QB 5KBKA 2QBWA 5I8CB 5FYKH 2F5AL 3SY6A 1FIGH 1VIWA 3I84A 4QF1A 1JYXA 3DX1A 4JKPH 1LMKA 3HHSB 4MASA 3BVDB 3HA0A 4HJUA 1IL1B 1UOKA 3FFCE 4LEOA 4HOWA 3GFUA 3ZKXB 1TKWA 1JGUH 1B0GB 3HE6C 5FHBH 3UTTB 4G6ML 4HUUA 2PMZA 2GTWA 4HIXL 4XGZA 3MRRA 5F9JA 1FFOB 4QTHA 2XETA 3WMSA 4Z7WE 2CRZA 4F7CB 3QEQA 1W15A 1E4HA 2C4FU 5EEYA 1IVTA 5DZ9A 3NK4A 2EO9A 2WMPB 3BHBA 2ESVB 4OF7A 1E4XH 3O6ML 2ZPKL 3G5YB 4X8JB 3HZYA 4OI8A 4ZQKB 1K8DB 3DSNA 4AV0A 2V5RA 4MHHG 5I74C 4JQIA 4NZDA 4FP8L 4ZPVB 5GRVL 2A4ZA 4YHYB 4RGMB 4JQIL 5B7FA 3H0TA 1DQIA 5DJXB 2VXVH 1TZAA 4NAMA 2PYEA 3O81A 2ZCKL 4P2OD 4BZ1A 1XGQA 4GEJA 2JVUA 2XTJB 2E7DA 2C9PA 5IMKB 3PV7A 2HG0A 3C8DA 4HU2A 3TEUA 4BZ1L 5F7KC 4LBEA 2O61A 3PQYE 4PJIF 2ITEA 3QI9C 2X05A 3M88A 5DJZA 4WI0A 4HIEA 1NFIA 5K93A 2A1WH 3CE1A 2NNXA 3IPEA 4QRQB 4QYOB 4XP9H 3KG5A 2WGXA 1EGJA 4PJ9D 5T5FH 5DHXB 3BFWA 3Q2NA 4LKCB 4W4OC 1EGJL 2OK0L 3C6LC 2OZNA 5TDOB 1W8EA 4FD0A 2YIHA 5C08D 1EJFA 2Z93B 2HX7A 3NZHL 4KMTH 3SDYL 3NIFE 4F20A 2OJ1A 5L2KB 1IC4H 3LJ3A 4PJBF 5JUEL 2OI9B 3TP4A 4KZEL 1MFAL 4KPHL 5LB1A 5J8OA 5HI4C 5FDWB 4M5TA 4HUNB 3FRUB 3LNFA 5JZ7D 3EG9B 1KTJA 2WXHA 3GIVB 3W3BA 4JFZL 1E28A 4YXHH 4Z0BH 1BVLB 2PUQT 1OP5H 1X5AA 2QADD 3KYKL 1F4XH 3MRDB 3VFTB 1P4IH 3QDGB 1IX2A 4LMQI 4OCWH 1GA2A 4HDIB 3KPQB 2BSTA 5DJ6B 2G4GA 3T77B 1MREH 3SGJA 2Q3ZA 1DL7H 5I1CH 1Q9OA 3FU7A 2JCCE 4YQXH 1GJIA 3DO4A 1OOAA 1J87A 5ACZB 1ZHNA 3N91A 5CILL 1DVUA 1NEPA 3L81A 1A7OL 5E5RB 3SY0B 3ZK0A 4G7QB 5INCB 4A2HA 3NSDA 4P2YA 1P7KB 3HS0B 4Y1TA 1CD1A 1ZXQA 4JRXA 2IDCA 2ZCHH 3V9CA 2E4TA 2B0SH 1OLLA 4LVOC 3BZFA 3QG6A 4N8VA 3CWGA 3PGFH 3ZL1A 5GHWL 3BKYH 4WKXA 3SCMA 2I26N 4FL4B 5I6XB 1HXYB 5IFHL 3MV7B 2WYTA 4X4YA 1T1ZA 5T1JA 2ZWKA 1CFVH 4Y88A 3KZ8A 3KVDD 2BZDA 2V5TA 3MRLB 4ZBJA 1NUGA 5CZVL 4WI7A 4I87A 2E75C 2R4RL 5IB2B 2UX7A 1LEGB 1J05B 2ZOUA 4KJQC 3ZBMA 1CCZA 4FZ8L 4PIBA 1PSKL 3OWRA 4JGNA 3K74B 5BZDA 2APXA 1FL6A 3NPZB 2CBTA 3K4ZA 1AP2A 5FO9A 4JHWH 3JTTB 5TQ0H 3HPLB 2JJTC 2ZYSA 4F37F 5CEZL 2W60B 1CFNA 2H5UA 5KANI 4HUXA 4AGNA 1A65A 3VRJA 3QFJA 1XT5A 1B0IA 1NCTA 2YA2A 5D70L 5CF3A 5EC1A 1OTTC 3SPGA 4CGUB 2BHYA 3EW3B 5E8PB 3VD4A 1KXTA 1Y0LB 4QTIH 3H3PL 3OLGA 3AG1B 3BJ91 3IDIA 1JK8A 2DAVA 4JQXC 4KX8A 1LWRA 1OKEA 4YR6A 3C5SB 3O3AA 2GJRA 1HEZA 3D18B 1AXTL 1FLTX 1A3LL 4PHZA 2RHEA 5IEHA 1XO8A 4A7SA 2OP4H 1M9SA 3H6AA 4E0RA 2ITCA 4NQDA 4Y19E 4Z5RB 3CVCA 3ZL4H 2WSPA 3SDCB 3M1BA 4MS6A 1QUNB 1Z0MA 2FWLB 5I30H 4ZW7A 4NKIL 3CDGB 2X4NB 2MQGA 4GBXD 2WGNB 2VN6A 3S3CB 1EZVY 1BFVL 1U8CA 4MB5A 4ODVL 3K80A 4FLSA 3MRHA 2N59A 5FWQA 1GZHA 1A9BB 1U8LA 4X83A 1HKLL 3HE7B 5B3SB 1FIGL 4X8GA 3FONB 1XB6A 4G7VL 3W11C 3ULVD 4CA4A 4J39A 4M1CC 2NNAB 4L0ZA 1WCBB 4WO4C 3WYRA 1P9MA 5FYJD 1Q1JL 3CSFA 4ZO6A 5E24E 4NHCL 4P3DB 3VFUB 4WRLA 4B3VA 3CVHA 3LB6D 2VWEC 4HAGA 2X44D 4P2RD 3FBQA 3FRPA 1MDAA 2HB0A 3CVHL 4KQ3H 2MTPA 1RIVL 2AXJA 5DRWB 4P2OA 2VYRE 3OKLB 3TIEA 2DMHA 5F7DA 4FNPA 4RETB 4XMLL 4PLJC 2IANB 4HUWA 3RNQB 1UFUA 3DIDA 4JZJA 4C4BA 2FIKA 2QSCL 4JHAL 1G7IB 4PJGA 1WCQA 3K8LA 2E27H 2LAGB 5F7BA 2YLHA 5DRZA 1VFBA 1I3RB 1VERA 3K71A 1YEFH 1F56A 3EF7A 1GS6X 5D7KD 4PJ9A 1DLHB 1IAOB 3PWJB 3D4GA 5ID1A 2VAAB 1UWEL 4X99B 1Q0XH 4AK1A 1ZIAA 3RWDB 2Z4TA 3U79A 4ZS6D 3Q3GB 2BNQA 5C08A 3CLEH 1QWUA 1A7NL 5EO9B 4PBVC 1U2CA 4L4VA 2R2EB 4CC4A 1KLUA 1DE4B 4X6FA 3DURA 5T5FA 4S11A 5FF6A 1J5IA 4XXDB 1H15A 4W6XB 4J23A 3DGGB 3KPSA 4LBAA 5LBVA 2K78A 5T5FL 2D3LA 2Q86A 4TOYL 3FUDA 4Y5VB 5ELIA 3J2PA 4F9LA 3ARFC 2JTYA 4MTMA 5FOBA 2Q7NA 1AY1H 1UZGA 1A7QH 1NLDH 2CR0A 4IDLA 3WXWL 3E0GA 2YPLE 4AQOA 4CSZA 2WVVB 4JFDD 1HNGA 1BG9A 3ROOA 4GXUN 3TNMA 2ILLA 4B5EA 1QNIA 2DM4A 5HJGA 3UAJA 3C5XA 5DS2A 5ADOH 1JVOA 3V0HA 3MV9B 1QHPA 4EIBA 3A47A 1DQVA 3ELQA 1XF5A 3FUFA 5DS8B 1D9KD 3RNKA 2CO7A 4UI2A 1OTUD 2CKNA 4TUJA 4HCIA 4KK6C 4NWUH 3QEHB 4IOFC 1DDHA 4LSDA 1UA6L 5BXFB 4PWEA 4Y5YC 1YCSA 1VKXA 1FNHA 4G6AD 2B59A 4P23D 3US9A 1WFOA 3F8UB 5C07E 5HDQH 4ONFL 1OP5K 3QUGA 1B4TA 4X98A 3NFSL 1EANA 1EEYA 4XMXA 1K2DA 3ZDXF 1F4XL 1YUHB 1TQSA 2AJSL 3IFPB 3L3IB 4YE0A 3SDDD 1IU1A 2EEAA 2XJKA 1KJ3H 4FQQB 2F08A 4LCCC 4XCFH 1NGXA 1NFKA 2K7QA 4YXKL 1EIBA 1ZHBB 3FCTB 3BGMA 3DUSA 3QJHB 4AQ8A 4YQXL 4M7LT 4IJ3C 1QPXA 5C3IA 1IFHL 3U9UB 4X0NA 3RY6C 4DZ8A 2WO4A 3NZ8B 3IPBA 5TFSL 1DJIA 3LRLA 1E9QB 25C8L 4NN7B 1YEJH 1V7ML 3W81A 1R1CA 4DAGH 2GIYA 2WLLB 2TRYA 3F83A 4YHOL 4OZFH 2Z91B 4AKQA 4OM1H 4AM0A 4AT6A 5JXEC 3NIFF 1HL9A 3MYJA 3BVTA 2WTRB 3BKYL 3VFOA 5G4OA 1A47A 3BKJH 5AVZB 5CO1A 4G9FE 4TSCH 3VUAA 3PP3H 1PKOA 1XAUA 1ZDSA 1BM7A 4OTXL 3D25B 2ED7A 3CHPA 4LASH 4TYUA 3GS7A 3F01A 5KANG 1CFVL 3L5XL 2NZ9C 1RLBA 4PJIB 3OM3B 3ECQA 3QXUA 5B38A 3BPNB 2KKQA 3VXPB 1XIWD 2XZQH 4W9LC 4B0MB 5H8DA 1GRWA 4Y4FB 3ARPA 3LN4A 2OSLA 2CO6A 4KKBD 1WZMA 5GRXG 4H0HB 3O2WH 4MNQD 5SX4I 4H4NA 1Z7JA 1JUFA 3M1OA 3QWOB 4J4PA 4WJ5A 2LABA 3C08L 1CFTB 1OD9A 1VACB 2AJXL 4YSTA 1P4LB 2BPBA 1PZDA 1HNFA 4KI5C 1F58L 4YNYB 4BQ6A 1O7DC 4NQTA 4PJBB 1MLBA 4JFOB 2WTOA 3BH8A 4H1LH 5I17B 4X7TA 3GNMH 4MXWH 5B22A 1FZKB 3OKDA 3IMTA 4JZNB 1QNZH 3BDYH 1R9FA 5E6IB 5GRJH 2EUVA 1X9UA 1QBBA 2HKHH 2OTPA 1UEMA 1OM9A 4WUUE 1ZE3H 2X4PB 4WJKB 2A7BA 4JAMA 3B3IA 3CX5K 3EJYD 5C09E 1U58A 1S7TA 4UAOB 3V5KA 3ULVL 3CBRA 2WXJA 3ARBA 2ADFL 1Q38A 5E95B 5EUKB 3PHOB 2P49B 5IIEA 5FYJL 5EU4B 1OGAA 1F1GA 4NKOA 2DYPA 3BAIA 2R4SH 1IT9H 3QIWB 3F6JA 4N0FB 4XXWA 3BVUA 2Y7SA 3IJSA 3MACH 2VMEA 4Z7IA 2OW7A 2WO3B 1U8OA 5AWNH 2HP4A 3AT9A 2ZONA 5HHXH 3FTYA 3FQNA 3G04A 4POYA 4YX2L 5IB3A 3FQXB 2Q2EB 3HLAB 5IOPA 1CTMA 3SJVE 4NC2B 4N20A 2EKSB 3X17A 5FGSA 1NBYA 4UZUA 5IK3A 4BQ9A 4CJ0A 1U3YA 4CADB 1ED3B 2Z9TA 1MHCA 3ZOAA 2XVKA 5A2JH 1R5WB 5DQDL 4N2LA 3ETSA 3S5LB 1N67A 2EC8A 4BCZA 2RAMA 2DQFB 1N7MH 1XH1A 5DTFB 1ULVA 2P5WE 3UZQA 1I9IL 5D6DA 1OM3L 3RDTB 4WF7A 1KSRA 5KVFE 1T3FA 3EHBC 4PIRF 3ZRFC 3IVKB 4W9HC 3MLSH 2VQ4A 1YY9D 2P52A 2IGFH 5A2KH 2BC4A 3DXAE 5JW5B 5A40E 1DBBL 2CUAA 1RZFL 3R8BB 1VEPA 2H2PC 2DL2A 1CR9L 4NKMB 5ABDE 2YAEA 4NPYB 1RK1A 4YFDB 1JYWA 2YA1A 1DJGA 4H8PA 4OFYA 5J1SC 1CI3M 1YECL 4ZZFA 1OARH 1WS8A 2YBRA 3PF2A 3FU0A 3T0EA 4P9MH 2VUOA 1CD9B 1DLFH 1EX0A 2NXYB 2MQCA 3MGTB 4PJXE 4ZOEA 5T33L 1D9KA 3KL5A 1LP9A 2K70A 5I1JH 2OJZH 2X4TB 4P48A 5I8OL 3W5MA 2TSBA 4KRNA 5HSFA 2F8XC 3QPQC 4LSVL 1HWGB 1RJLA 3LXCA 2EEFA 1UZ6E 4GG6E 5BV7H 3NG5A 2QVIA 1LEKB 3HR5A 3WBDA 4N0CD 4GRLC 1E4WH 5DJYB 1A7QL 4BJLA 2FL5A 5C0ND 3UG5A 1IKNA 3FHAA 3X1BA 5SWQB 1KWGA 5FHAH 1QTPA 1WRFA 4W9JC 4Z7QE 3PGDB 4G8GD 4GSRA 3V5HA 4W9GC 2CPCA 3SDDA 4OFDA 3KPLB 2RD0A 1A3RL 4PW4A 1BCIA 4N2FA 5DD6B 3QHZH 2CDEB 3GSNA 2ZAIA 4K8RC 4DF9A 1S7VB 4RMVA 2P7TA 4TLKA 3BSZA 4XWGL 4F57L 5GRYA 4FZEL 1SY6H 15C8L 3GSNL 3GEFA 1F1DA 7CGTA 3BSZL 3WO4C 3Q05A 2NOYA 2JIXB 4XPHL 1TZHB 3O2VL 1S4IA 3BN3B 4HXAL 3FMGH 2ZXWB 4P04A 2O93L 1GH7A 1I9RL 2E74C 1F0LA 3VM5A 1U93A 1QW9A 4OLWL 4M7ZC 4WSKA 4JUTA 5GZND 4AYDC 2JKTM 2AV1A 1HE8A 3PWPE 3UYPB 5D1XE 1MCOH 2AJYH 2WYIA 3SKOB 5DVLA 3EH5B 5L0QB 3RFZC 2UXTA 4HMDA 4FJYA 2UY7A 3P4NB 3Q01A 3H2PA 2GSIA 3GZQA 3QH3A 4HIHA 1Q0EA 4DVRH 4IIZA 4ZNEA 2AC0A 4OZFA 1BQHA 1XIWA 3T4YA 3UMNA 4DAGL 2AJUL 4WHTB 2VDQB 3IDXH 4OLZL 4MNQA 2Q8AH 3KGUA 4MNHB 1FL5A 4XNMB 2ZZUT 1PZUB 1KCKA 3DETC 1FH2A 2R2HB 3GSXB 3PP3K 1P1ZB 4DN4H 3EDEA 1M6OB 2FNBA 4GAGH 3ZPDA 1KFAH 3CFJB 3FFCB 3C5ZD 2XN9A 3JWOH 1GSKA 1NGZB 4RIRA 4CW1A 3IGAA 2VMDA 3NGBC 4ODUB 2J55A 5GGTH 5BS0D 2VABA 5F89A 3KHOA 2Z92A 1KV7A 2XZQL 3D0LA 3P3RA 4HH9A 5KBNC 4HJSA 4Y1AE 1J0IA 5EZPA 2OMNA 3MQIA 4EPSA 1IZJA 3FQ1A 4HHWA 4ICWA 4XNXH 1PCSA 3ZHNA 1MWOA 4LPXA 4ZTOH 2ZKMX 4J3TA 5EIIG 1XF4B 2WIMA 1N6QH 4NKQB 2XVGA 3QUZC 3WCYA 2HTKC 3MN8A 3RVTC 5JHDA 1LO0H 1QQDA 3V7AG 1AE6H 1UWXH 2CIIB 4MS8D 2YEZB 2DDQL 3EJQA 4PTUB 5IVZB 1WBYB 2DOCA 2XFXA 43CAA 1OCZB 4YSCA 3M17B 1WWBX 1T5XA 2HKHL 2VAJA 5DQ9A 3WTYA 3RX9A 4RNRB 1LL1A 3ZDXB 4PGZA 3EOTH 1HHJA 4HS8H 4R0LB 3JV5A 1T89A 3PQYB 4Z7NE 1AHWA 4P4KB 3VXSA 1S7RA 3VXOA 5LXGH 2HT4C 2AFNA 3P4MB 2H8PB 4OZFG 1BQHG 3AG3B 4HGMA 3VYNA 2J3SA 1GHFH 5ESAA 3X3GH 1L7IH 4PRIE 2ZSVA 5DJ0A 1SJHB 2H3KA 4LSRH 5IHLB 4ATTA 3MO1B 3N0PB 3WTWA 5CIPB 5GGQL 2QGBA 4JJ5B 5E8NA 2FJFA 3RWFB 1PLAA 4IRSB 4LLVB 2BSEA 3LKPA 2WOYA 3UTSB 4AV4A 3D12B 3QZBA 1A6ZB 2Z8RA 4KXCA 3ZQ9A 1CS6A 3MRPB 1P0SE 1NAKL 3FOMA 4HOXA 3NIFB 4YDKL 3ZQXA 3BVXA 4PG2A 4PV9B 4ZFQA 3TH3T 3V4PA 3VWKC 3DDGA 3CFCL 4PG9A 1Z3RA 5AVSB 3SD2A 5F6IB 2F53E 2OFQA 3V4PL 5KYUB 4QHKI 5C0FA 3TFKD 2A9ML 2O6PA 4WKZA 3DYOA 3ZSSA 4AUYA 4LAJH 3VXUE 4TUOA 2HKFL 5TPWH 4XN8A 4U0RC 3GSOA 5MI0C 2V9UA 4FQJH 2A6IA 5HHPB 3ZJAA 3QRLA 3WDJA 1E6JL 2EECA 1NMCC 5BV7C 1FG2B 2PR9A 4H1LG 3BP6B 1O9VA 1P6AB 4U4BA 2VRKA 2ICCA 1KGUA 5ERWA 1E3XA 4JRYA 3BQUA 2CXGA 2GITA 3A3YB 4BFBD 3Q8BA 4EI5D 3BMVA 1GYUA 4M1GH 1RI8A 3QUHA 5C7XH 2HJLB 4F92B 4U2ZA 3W39A 2XA8H 2WNKA 4ONOA 5D9SB 2GAZB 4YDVB 1T4WA 2YSTA 4XHJC 5DVOA 1ZCRA 3O45B 5CN1A 1ES0A 1JWUB 2BVTA 1S9WA 5IKCA 1G9NL 1GY2A 1V3MA 3ABMB 1SYVA 1COBA 3EJCA 3S5YA 4FEMA 3VGEA 1OARL 3WFEL 2YZ1A 2DBJA 3ULUH 2OXHB 1EEUA 1WK0A 1CICC 1AGBB 1HHGB 1X7SA 2OMXB 4GI6A 1UH4A 3HCVA 1R34A 1XCTB 4I4WB 3D30A 1BVKB 3QBTB 3MRKB 4IYKA 4KKCC 4MB3A 2VXUL 4OV5B 3RY5A 4U1GC 5LG6A 1CFMA 3OB0H 3QJTB 1R3JB 1AS6A 4HK3N 1ODAA 3K81A 3IDGB 2X0VA 4QWWC 3CU1A 1C1EH 1RSFA 4L8BB 4RFNB 2W80C 2VZUA 4PY7A 2W0PA 4K7PX 5DZOA 3FYIB 3L48A 2I9TB 3DVFA 1QHOA 3D6GA 4YSAA 2Y5EA 2CXKA 4MJ6A 5EU5B 2NQDA 2DLEA 4WNSA 5D8JH 2R1XB 2JJWA 3KPTA 4MDIA 5C9KA 3GMPA 3IGFA 2BXYA 3NUKA 1PEZA 1BAWA 3BPLB 4OD1H 2H6PB 2MPAH 1PCXA 5E9DA 3BN9D 3L5WA 3MTRA 3RIFF 4BUHA 3VG9C 5IFJA 1BVNP 4LLQB 2HT2C 2BNRA 3A67H 1ZVNA 3ME0B 4M6OL 2C26A 3D48R 1KIUA 4GAJH 4ZXBB 1L3WA 3K2IA 3HFFA 5FCUL 3X12B 5KVDE 2QSTA 5C0DA 5EWIH 1MRDL 4A39A 1UJ3C 3TURA 1ASPA 1G87A 3E8UH 3K6FA 4LEXL 1S7WA 4LGSB 1PFOA 2VZOA 4XVSH 5DMKA 4L3ED 2CLVB 3OKEA 2BX5A 2DWDA 3IGUA 5FGRA 5MEND 4EQ2A 2WZPD 1AMXA 4DQOL 3O0RH 4Y19B 5TTRA 3VXRD 3D85A 3C5ZA 5F7AA 3WKQA 3QC5X 2BHUA 5E5MA 3FSAA 2ZYIA 5IW1B 1P4BH 1KCUH 3T6ZA 2MTAA 4P5TC 1TJGH 3THMH 4XWOC 2WN3A 2LQRA 3A5VA 4PS3A 5BS0A 2NY7H 4U1JA 3G5VB 2PXYB 1UM6L 2CCLA 2FJGA 2F7IA 4O5LH 4ZFZB 1KIPB 5FKAA 1KT2B 4FXKA 4OF8A 4YHZH 3HAEH 3HZMA 4TS6A 5DD0H 5EFIB 3U2JA 4W9ZA 1CGSL 3Q1SH 4TQEL 5INDB 3TN0D 2R0WH 2AITA 5E23A 5AOZA 2JKJA 1T5WA 2YMXL 5M94B 4DN4L 3RVXD 3SQRA 1B88A 4ZZKA 5AYUH 2M8XA 3TBVB 3BUDA 4BFEA 1MPAL 2P8LA 2VZTA 5F7WC 2BVYA 2Y72A 3QXDB 2NPLX 1TVHA 2BDNH 4FI7A 1J0JA 4Q7DA 3AS2A 4FC3E 5E8OB 1UM4H 4JM2C 2DV6A 3I9PA 4XN1A 5EZOL 1IILE 2NYYD 3L3KA 4I0PA 2ORBL 3LZPA 1U95B 3QDMD 1RULH 4BWTA 1KPRA 1IBGL 3IFLL 2BS71 3N04A 5HYJE 5KYNA 1GSMA 5KSAA 1AQDB 3SKMA 5GS1B 5IP4A 1MHEB 1R6VA 2VDOH 4G8IB 3WNMA 3G08A 3FT3A 1UWXK 1MF2H 2K9FB 3A6CL 1M3JA 3I6GA 4LSUL 1FCCA 2GJZB 5F7FA 1ACYL 2P28B 2XIBA 2EP6A 4LPCA 4GPVA 4TNGA 3QIUA 1TU2A 2FAUA 1T20B 4QOKB 2CNZA 4HZLB 3K6SB 3QS3A 2NYZA 4WGVB 5F3BA 1NIDA 1PD6A 4LOUC 3VA6A 1ORSB 4MSWB 3GHBH 4G42B 3TEYA 1YEHL 1E65A 2XI9A 3N40P 2RJMA 3B2VH 4JFFA 3SGEH 2C7UA 3SOBH 3L17A 3IETA 2IWFA 4YHIB 3TBYB 5C2BL 4ACPA 2F54D 4J6RL 5FA4A 4F9PA 2HVKB 3F7YB 3HG1A 3VJ6A 1NCCL 1EUUA 3ORJA 3D09A 3WE1A 1PKQE 4YPGB 5A3ID 5EB9A 5CJQH 2F61A 3KAAA 3M8OH 3TZVB 3ECVA 2X2UA 5H37H 3WJLA 1V5JA 4JGMA 1U92A 4H26B 3Q6GH 4GUPA 2YPLB 4LCWE 4TNEA 5DUPL 1DTUA 1LK2A 4EXPX 2A77H 1IAKB 3R4RA 4XNUH 5TQ2H 1XF1A 1XGUA 4EI5A 2E6QA 2OMYA 2NXZB 1ZWIA 2DWSA 3QA3A 1CZ8L 1Y7VA 3BUYA 4FXLA 4X80H 3RIKA 3ULUC 5D7EA 2L7UA 2QPDB 2P44B 1ZVSA 1TTCA 3VSVA 1JGDB 3KM2A 4HJJL 1NKRA 3IWUA 1M4KA 3BZEA 2ETWA 3JWNH 3BAEL 1U8QB 5F9OL 3VDAA 5KAQG 4A68A 3LZNA 1T4KA 4CKQA 3EBGA 3LH2H 5I1GL 1MHHA 1YQVL 3D5OF 1A9EB 4NQEA 5FYKU 4B9PA 5IFAL 12E8H 1OSZB 5D2NB 4XN2A 1G9ML 4HUKB 5FUCC 1SNRA 2Y2TA 4NN5B 4KMLB 4NQVA 4NZRL 3H3BC 4O02B 4LSQL 5IHUL 5J11C 2GFBB 4K2UH 2H7WA 3UJTH 4G6KL 1IBZA 1N0LB 1KEML 1KYAA 4S1DC 3D2UA 5L7XL 4IGBB 4JE4B 4I5BB 4HX1B 3KPPB 2P5EA 2X4RB 3BEWA 1CLYH 3GB7A 4ES8A 4DKDC 2JJSC 4XN5A 4AY0A 5ADPH 3V55A 3LEVL 3QR0A 2K45A 5IBTH 4K73A 3W0WE 3KVPA 1TUPA 5A1AA 1T21A 3L7EA 4WU7B 1JGEB 2KQNA 2NY4C 4JO8A 2Z0UA 3OB0K 1T7VA 1G0XA 3N55A 5CEXB 1U21A 3L54A 1E9PA 4G9FB 4N8CH 2EH7H 1I1AC 2G3MA 2XBTA 3KYNB 4PB0L 2FCBA 4AOFA 5IJCC 5HYQB 1RUAL 3S2AA 2H6OA 3TONA 4YO0A 4JRWA 3I85A 4G9DA 1JHTA 1W91A 5ILTH 5JPNB 1EAOA 1JZ8A 5LVEA 2DQDL 4MDJA 3O8XB 4OF5A 4NT6A 4Z23A 1X6NA 2Q8BL 5C0GA 3O4OC 1FAIL 5CMAB 4PLKC 3VA2C 3MRFA 3D06A 3FK3A 4CAGA 1GAFL 1SOQA 2AK4D 3TLRA 5JMOC 2PLTA 2EUWA 1BQLH 4FEIA 1D5BB 2P8MB 2XV2A 3F05A 1ID5I 4G59C 4NNPH 4QHMA 4XNBA 4MRCA 4Y89A 5D8JL 5AKSA 5GS0H 4OH2A 4F2ME 4Y2DC 4Q0XH 2OR7A 3VMNA 3ZYZA 3VXRA 1NWOA 4XRCA 4F7PB 5E9NA 1DHKA 2VMFA 1UVQA 3WG7B 3AVEA 3EZ8A 4FXGC 5IVXF 4ZTPH 4LHUA 3AITA 1NDMA 3GLAA 1SOSA 4HIJA 1U8PA 3FT0A 4ABUA 1WA0X 3IRPX 3DUUB 3HNSL 4FQLH 1UWGH 4UQEA 3ZGIA 2QHRL 2BRRH 2OBGA 4K07A 3NN8A 3IXAB 2V2TA 4FI6A 1CD0A 1RZ7H 3FU3A 3TN0A 1C08A 4EQ3A 1HHHB 4WO0A 5IROC 4CSSA 1S5HA 3ASWA 2ARWA 2H0FA 1T6WA 1SYSA 3QQ9D 4KJWD 4E41D 2C3HA 2HFFB 3P9WB 2EH8L 4MAYA 4ONGL 1XGPB 2CJUH 2VC2H 5F70A 4PJEE 3GPSA 2KDYA 3L16A 5CSGA 4BK5A 4G83A 3QYMA 1TJGL 2B08A 1B3JA 1SXZA 2R2BA 2ZOKA 1U3HB 4QXUH 1GZPB 1FL3A 4M6NL 5LWYL 2CLRA 3R0MA 4F15B 4U33A 4JDVA 4OT1H 3TA3D 3U1QA 5ICZA 3O4LD 2NYKA 3OLEA 3BE1L 3CUPA 2XWBB 2V4LA 1O7DE 5TH2B 4HGKC 3B34A 3MPCA 1NCBH 1F3RB 3L3JA 3MRCB 3CFMA 3K2UH 4OQTH 4U0QB 5FV2A 3WKYA 2BSSB 4XO5A 2RH0A 1YN6A 3RX7A 4GQRA 1NCJA 5IG7A 3OAWA 5G5DB 2SODB 5FM4A 1M7XA 5I5MA 4XMKL 1AR1D 1OV8A 4OFVA 1EWHA 1YEEL 3DX9B 4P46D 3TO2B 3VGAB 5J13C 3ML9A 5KVEH 4BINA 5F96L 2W07A 4AG4H 5D71H 1EAPB 2J12B 3N85L 4FG4A 4Y9EA 4ETQB 2P5WB 2FWSA 1H3VA 4D3CL 1CU4L 4JM4L 4KROD 3ALPA 2RFXB 3H6JA 4RZCB 3ILDA 2AEIT 2WQ8A 1NM4A 4P2QD 5CD3B 1L9MA 2IH3A 3GMQA 5HVWA 2VDLB 1RZ8A 4NP9A 2K3HA 4JRLA 1JPSH 1KPVB 2VLJE 4ZX3A 1U3ZA 1BDYA 3QQ4B 3KW8A 5DC9B 3DXAB 4ZMOA 3W9DA 5F71A 4P5MB 4M8QB 4KWUA 1ORQB 1VFOA 1V55B 1R24A 2HLFD 1E8WA 4IKKA 4O51B 3S3JA 4F7KA 3L5HA 4PV1C 1NCUA 3DTUB 3L2NA 5J7CC 1AIZA 4PR5B 2P5PA 1OP3H 2EC9U 2HTLC 3KPRB 8CGTA 2AEPH 1H8OA 4Z3EA 1SUHA 1Y1DA 5BW7C 5CLZA 1ML0A 5DURD 4GQPH 3OKMA 3ARSA 1OW0A 3KYOA 5C0CA 4LKXB 1DEDA 3GEWB 1XR8B 3T3PF 4EI0A 4NCDA 2FIRT 3SO3B 3LKQB 1IM3B 1R3KB 5AVYB 5FYLE 4G7YL 3INOA 5E2TL 1RJYB 3ESOA 4DFHA 4ILDA 4DGIH 5CJQL 3ZL2A 5G4MA 4F8LA 1IEBA 2HFEA 1B6DA 2A77L 4G6FB 2A9NH 32C2A 2X9YA 5E2WH 3OAYH 1X6LA 5H35A 1EHLH 2X2YA 4IJTA 2E4FA 3FUHA 5CM1A 3GJEB 4YC2B 3OD3A 1R3IL 2XICA 4HJIA 4G1EA 3LPGA 2VW6A 4UT7L 3TO4C 2CRMA 2R8SH 5E94B 2NY6C 2O5NA 3OF6A 3EADA 4RWHA 3GMLA 1L7TL 4PJFF 5EEWA 3QWNA 3EOAB 4ZMXA 1XZ0A 1YNKL 2V3EA 1SDDA 3MROA 1JXFA 5BQ7B 3LH2L 4Y16B 1EEQA 2HVJB 3CDZA 3TPUA 1BLNA 1FBIL 1UXWA 5IHHA 4JPIA 4EKJA 5DK3A 2X1OA 3FFOA 5D1XB 3UPAA 3LH9A 2WQVA 5GS0C 2IBZY 2HH0H 4K2UL 4M4RB 2YQBA 2WWMD 4KXAA 1SQ2N 4M00A 1QAWA 4OLVL 4JO3L 3V10A 2AK4A 1K6QL 4DP0X 5BRZB 3TF4A 1LMIA 3DJZA 3DK2A 3FQRA 2EICA 2ED8A 4GUOA 1CTNA 1S7QB 5D7JD 4FQ2H 2H3NB 3Q2CA 1UXMA 2Y2YA 2FZ3A 5E99L 1NAMA 5H37G 3U2SA 1NCGA 5GPRA 2E9JA 1M1SA 1XTLA 3FT4B 2VR6A 3NIDF 4C56D 1NAML 1L5GB 2X4OA 1CF8H 4YHLH 1FFTB 2LHAA 5DMGC 3ZO9A 3TBBA 4ISVA 3WFCH 4FFTA 3JV6A 4MJ5A 1KCRL 2R7EA 4ZMZA 1FQ9C 1RUQH 4HETA 1OSEA 4Y1AB 4N85A 4Y4HB 5L4IA 1NGYA 4UTBA 1HEJC 3STLB 1BJ1H 1RHHB 5JNYA 1S9YB 3FN0H 5C0JA 1MKFA 4UTBL 3FB6B 2ZCLL 4NNPL 2Q3XA 1XSJA 1U8JA 4HLEA 4HIIB 1A3QA 3QQXA 1IKFL 3PUUA 3S96A 3LMJH 4YAQB 5JYMA 1OF2B 1OAKL 2PP9A 1HOEA 1IZKA 3JWNG 5E8DH 3EFOA 4NHUB 1B4LA 5HI3C 2FD6H 1TJIH 2D7TH 4Y1SA 1QKZH 4FG0A 1ET5A 4E5XA 5T3ZE 2KLRA 3CGTA 1AO7D 3V2AR 2Y06L 1HZHH 1H5BA 5I0WA 1X5YA 2H45A 1DQML 5EG6C 3TA3A 1G7HA 4KK5C 1A14H 3F7VA 4KGLA 4U2YA 1JN6B 2BVPB 4YGAB 3BWAB 4NERA 4NKDB 3BLKA 3DX8A 4YSDA 3SPHA 3JBG7 1HNYA 1MVUA 2GJ6E 4FNSA 3IU4H 4HAKA 4GI9A 1WJ3A 4LVEA 3IAPA 2B39A 3HZKB 2PWFA 5F0LB 1RY7B 3WFBL 1LO5B 2VC2L 4L29A 5GS3A 2MOGA 3OPUA 4PRIB 4N26A 4D9RE 2HN7B 4PVMA 2DYSB 3O6LL 3KEDA 3PFUA 1QRKA 4URKA 4P46A 4EUPB 1CDGA 1E5BA 4BUQA 2NQCA 3P77B 3QZPA 1O6SA 1Z3GL 2YC1A 3NFNA 4MLSA 3D52A 1EUTA 2IDUA 4QY8A 5I74B 3SGJC 2B14A 1DJZA