2COAA

Solution structure of the ph domain of protein kinase c, d2 type from human
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
125
structure length
125
Chain Sequence
b'GSSGSSGTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQALMSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, D2 type
publication title Solution structure of the PH domain of protein kinase C, D2 type from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 125
sequence length 125
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2coaA01
3U8ZA 1WG7A 1FHXA 2R09A 5D3YA 5FI0A 2ELAA 3PVLA 1FHOA 1Z87A 1KZ7A 2DYNA 1MK7B 2Z0PA 4GN1A 2ZPYA 2BCJA 4CHMA 1UPQA 1OMWA 1U5GA 1EGXA 1U2BA 3GYPA 1EAZA 1ZC3B 2MDXA 1MKEA 3KY9A 4EJNA 4F7UP 1W1HA 4A6KA 3OANA 1ZC4B 5J3QA 3UZTA 1WJ1A 5DHAB 1QC6A 4GMVA 2UVMA 2HTHB 3PG7A 3P7ZA 2RGNB 4HB0B 1FAOA 1BAKA 5DH9B 4Y94A 2K2UA 1ZSQA 1UPRA 1UNPA 4KHOA 1GC6A 1V5MA 4HAZB 4GPTB 4MT7A 2D10A 3ULBA 1W1DA 4MY6A 1UNRA 4IFSA 2KUPA 1X1FA 3TO1A 4GZUA 1U5FA 2DHKA 2LOXA 3U7DA 1WI1A 4HB3B 1X1GA 1XR0B 1Y19B 3SNHA 1FB8A 1M7EA 1TXDA 2GCJA 2QKLA 1DDVA 4BBKA 1DDWA 4MK0A 2DX1A 1MAIA 3KZ1A 3KRWA 2GCLA 2DTCA 2OTXA 2H7EA 2EMTA 2YF0A 3VIAA 5DHFB 2CAYA 2COFA 3PP2A 5C5BB 2YVCA 2KCJA 4GMXB 4KHBB 2K2JA 4DX90 1BWNA 2D9ZA 1ZM0A 2CRFA 2DLWA 3TW1A 2W2WA 2CY4A 1Y5OA 4ZRKA 2DYQA 2Y8GA 2AL6A 4YONA 1ISNA 2LULA 2YS3A 2J0MA 2L1CA 3SYXA 3KRXA 2RLOA 2G35A 4K81A 2E2XA 2P8VA 3ODOA 2CY5A 3ODWA 4A5KA 3WA0A 4DBBA 3D8EA 3D8FA 4DX8A 1U27A 5D3XA 1TQZA 1V89A 5HE0A 1DBHA 2ELBA 1I2HA 2RNRB 2LKOA 5C16A 1UNQA 1NU2A 3P6AA 2COCA 1XODA 2Y7BA 2MFQA 2YT0A 3AU4A 3SUZA 3N7CA 2D4QA 2VRWB 3MDBC 1P3RA 2AEHA 3PSCA 2ROVA 3BJIA 2NMBA 1LW3A 2L2IA 2D2QA 1DDMA 2Z0OA 2I1JA 2ROZB 2PZ1A 4P7IA 5LONB 4B6HA 2GS0A 2J0JA 1K5GB 4HAXB 4HB4B 1GC7A 3HQCA 3CXBB 1FGZA 2RSGA 5C79A 2J59M 1LB1A 1X05A 4D0NB 2YT1A 2X18A 4WSFA 4NSWA 2GJYA 2JP2A 5KQ4A 2D9YA 2CODA 3PZDA 3ZDTA 2M14A 3SO6A 5D3WA 5EFXA 2COAA 1KI1B 3BINA 2D9XA 4A6HA 4HB2B 5D27A 2IFSA 2UZRA 1K5DB 3KSYA 2I5CA 1I7AA 1MIXA 3PEGA 2RUKB 1TJ6A 5KQ1A 3DXDA 4ZRJA 5KCVA 5C5BA 2EC1A 2W2XC 4HAYB 2VKIA 3G9WA 2DFKA 2DX5A 4YL8A 2N0YA 2Q13A 1H10A 1M7RA 2P0HA 2DKQA 3ZVRA 2I5FA 2OQBA 4KHAA 2NZ8B 3NSUA 5JHHA 4Z2MB 3A8PA 2DN6A 1QQGA 2Z0QA 3ODXA 2YRYA 3F0WA 2EJ8A 4A6FB 3SV1A 1MIZB 3A98B 4EMOA 4F7HA 1NTYA 1WJMA 1V88A 2N23A 3DXEA 4CHJA 3IVFA 5C6RA 2RVBB 4KAXB 2P0DA 4PQ0A 5DIFB 5CLLB 3O96A 1BTNA 4PNKA 1WGQA 2QKMA 1KZGA 4WVFB 1U5DA 5JHGA 1EF1A 1RJ2A 2I1KA 3FM8C 3PVUA 1PFJA 2DHIA 4IOYX 3TCAA 4HDOA 1V5UA 3GYOA 1B55A 2YS5A 4HHVA 1DROA 5DI9B 1WGUA 4EKUA 1WVHA 5CLQB 3QBVB 3F5RA 1X86A 1P6SA 2V76A 3QWMA 2K00A 4KVGB 1MPHA 1SHCA 2H7DA 4TYZA 3RCPA 1XCGA 1NI2A 3LJUX 4K2PA 1U29A 4L6EA 1IRSA 1U5EA 1RRPB 2Y8FA 4TKNA 2YSZA 4ZRIA 5L81A 2ADZA 5D3VA 3QIJA 1OY2A 1V5PA 3MPXA 4HAVB 5LOPB 3VOQA 1X11A 1BTKA 5FI1A 2W2XD 3X23A 3ML4A 4DXAB 1GG3A 4CYEA 3V5WA 4IAPA 2D9VA 3A8QA 2XQNM 1AWEA 1PLSA 5HE1A 2MKRA 1UEFA 5GOWB 2M38A 3AJ4A 3T06A 1FGYA 2DA0A 4A6FA 2FJLA 2DHJA 3PVWA 2LG1A 1ZVRA 1XKEA 4K17A 1P5TA 2HE7A 2LOZA 2EMSA 1FHWA 2VSZA 1XD4A 2P0FA 2YS1A 1J19A 3TVVA 3FSSA 4XWXA 4Z2NA 1MK9B 1PMSA 1NTVA 4C0AA 2UZSA 5JLJB 1FOEA 3CIKA 1Q67A 3TFMA 2DKPA 1SGHA 4H8SA 5J3TA 1J0WA 1EVHA 4NY0A 1AQCA 3ULCA 4HAWB 4HDQA 4K2OA 1H4RA 5J3YA 2R0DA 3DXCA 3D8DA 5HE2A 4F7GA 3HW2B 1OQNA 5HE3A 4WJ7A 1W1GA 1E5WA 2KGXB 3WYFB 3HK0A 2LYDA 2D11A 1DYNA 3AU5A 3FEHA 2IYBA 1XX0A 2MWNB 4HAUB 2J0KA 4GXBA 4HATB 5JP4A 3M1IB 2D9WA 1N3HA 1V61A
chains in the Genus database with same CATH superfamily
3U8ZA 1WG7A 1FHXA 2R09A 5D3YA 5FI0A 2ELAA 3U12A 3NWFA 3PVLA 1FHOA 1Z87A 1KZ7A 2DYNA 3NW8A 1MK7B 2R2YA 2Z0PA 4GN1A 3OHMB 5I2MA 2ZPYA 2BCJA 4CHMA 1UPQA 1OMWA 1U5GA 1EGXA 1U2BA 3GYPA 1EAZA 1ZC3B 2MDXA 2K49A 1MKEA 3KY9A 4EJNA 4F7UP 1W1HA 4A6KA 3OANA 1ZC4B 5J3QA 3UZTA 1WJ1A 5DHAB 1QC6A 4GMVA 2GUMA 2UVMA 3DCXA 2HTHB 3P7ZA 3PG7A 2RGNB 4DIXA 4HB0B 4QJ5B 5IRSA 2Z13A 1FAOA 1BAKA 5DH9B 4Y94A 2K2UA 1ZSQA 1UPRA 1UNPA 4KHOA 4OT1A 1GC6A 1V5MA 4HAZB 4GPTB 4MT7A 2D10A 3ULBA 1W1DA 4MY6A 1UNRA 4IFSA 2KUPA 1X1FA 3TO1A 4GZUA 1U5FA 2DHKA 2LOXA 3U7DA 1WI1A 4HB3B 1X1GA 1XR0B 1Y19B 3SNHA 1FB8A 1M7EA 1TXDA 2GCJA 2QKLA 1DDVA 3FVCA 4BBKA 1DDWA 4MK0A 4D6WA 2DX1A 1MAIA 3KZ1A 3KRWA 2GCLA 2DTCA 2OTXA 2Z4DA 2H7EA 2EMTA 2YF0A 3VIAA 5DHFB 2CAYA 2COFA 3PP2A 5C5BB 2YVCA 2KCJA 2KIEA 4GMXB 4KHBB 2K2JA 4DX90 1BWNA 2D9ZA 1ZM0A 2CRFA 2DLWA 3TW1A 2W2WA 2CY4A 1Y5OA 4ZRKA 2DYQA 2Y8GA 2AL6A 3NWDA 4YONA 1ISNA 2LULA 2YS3A 2J0MA 2L1CA 3SYXA 3KRXA 2RLOA 2G35A 4K81A 2E2XA 2P8VA 3ODOA 2CY5A 4QJ3B 3ODWA 4A5KA 3WA0A 4QJ4B 4DBBA 3D8EA 3D8FA 4DX8A 1U27A 5D3XA 1TQZA 1V89A 5HE0A 1DBHA 2ZKMX 2ELBA 1I2HA 2RNRB 2LKOA 5C16A 1UNQA 1NU2A 3P6AA 2COCA 1XODA 2Y7BA 2MFQA 2YT0A 3AU4A 3SUZA 3N7CA 2D4QA 2VRWB 1ZYIA 3MDBC 2Z14A 1P3RA 2AEHA 3PSCA 2ROVA 3BJIA 2NMBA 1LW3A 2L2IA 2D2QA 1DDMA 4QXAB 2Z0OA 2I1JA 2ROZB 2PZ1A 4P7IA 5LONB 4B6HA 2GS0A 2J0JA 1K5GB 4HAXB 4HB4B 1GC7A 3HQCA 3CXBB 2KR0A 1FGZA 2RSGA 4OSNA 5C79A 2J59M 1LB1A 1X05A 4D0NB 3A58A 2YT1A 2X18A 4WSFA 4NSWA 2GJYA 2JP2A 5KQ4A 2D9YA 2CODA 3PZDA 3ZDTA 2M14A 3SO6A 5D3WA 5EFXA 2COAA 3BINA 1KI1B 2D9XA 2RRFA 4A6HA 4HB2B 5D27A 2IFSA 2UZRA 1K5DB 3KSYA 2I5CA 1I7AA 1MIXA 3PEGA 2RUKB 1TJ6A 5KQ1A 3DXDA 4L1RA 4ZRJA 5KCVA 5C5BA 2EC1A 2W2XC 4HAYB 4KHBA 2VKIA 3G9WA 2DFKA 2DX5A 4YL8A 2N0YA 2Q13A 1H10A 3NWAA 1M7RA 2P0HA 2DKQA 5I2SA 5M4YB 3ZVRA 2I5FA 2OQBA 4KHAA 2NZ8B 3NSUA 4GOUA 5JHHA 4Z2MB 3A8PA 2DN6A 1QQGA 2Z0QA 3ODXA 2YRYA 3F0WA 2EJ8A 4A6FB 3SV1A 1MIZB 3A98B 4EMOA 2NBVA 4F7HA 1NTYA 1WJMA 1V88A 2N23A 3DXEA 4CHJA 3IVFA 5C6RA 2RVBB 4KAXB 2P0DA 4PQ0A 5DIFB 5CLLB 3O96A 1BTNA 4PNKA 1WGQA 2QKMA 1KZGA 4WVFB 1U5DA 5JHGA 1EF1A 1RJ2A 2I1KA 3FM8C 3PVUA 1PFJA 2DHIA 4IOYX 3TCAA 4HDOA 1V5UA 3GYOA 1B55A 2YS5A 4HHVA 1DROA 1T77A 5DI9B 1WGUA 4EKUA 1WVHA 5CLQB 3B77A 3QBVB 3F5RA 1X86A 1P6SA 2V76A 3QWMA 5LG4B 4GNKB 2K00A 4KVGB 1MPHA 1SHCA 2H7DA 4TYZA 3RCPA 1XCGA 1NI2A 3LJUX 4K2PA 1U29A 4L6EA 1IRSA 1U5EA 1RRPB 2Y8FA 4TKNA 2YSZA 4ZRIA 5L81A 2ADZA 5D3VA 3QIJA 1OY2A 1V5PA 3HIEA 3MPXA 4HAVB 5LOPB 3VOQA 1X11A 1BTKA 5FI1A 2W2XD 3X23A 3ML4A 4DXAB 1GG3A 4CYEA 3V5WA 4IAPA 4CSQA 2D9VA 3A8QA 2XQNM 1AWEA 1PLSA 5HE1A 2MKRA 1UEFA 5GOWB 2M38A 3AJ4A 3T06A 1FGYA 2DA0A 4A6FA 2FJLA 2DHJA 3PVWA 2LG1A 2YT2A 1ZVRA 1XKEA 4K17A 1P5TA 2HE7A 2LOZA 2EMSA 2K8EA 1FHWA 2VSZA 4HSIA 1XD4A 2P0FA 2YS1A 1J19A 3TVVA 3FSSA 4XWXA 4Z2NA 1MK9B 1PMSA 1NTVA 4C0AA 2UZSA 5JLJB 1FOEA 3CIKA 2FJUB 1Q67A 3TFMA 2DKPA 1SGHA 4H8SA 5J3TA 1J0WA 1EVHA 4NY0A 1AQCA 3ULCA 4HAWB 4HDQA 4K2OA 1H4RA 5J3YA 2R0DA 3DXCA 3D8DA 5HE2A 4F7GA 3HW2B 1OQNA 5HE3A 4WJ7A 2KIGA 1W1GA 1E5WA 2KGXB 1MI1A 3WYFB 3HK0A 2LYDA 1N3HA 2D11A 1DYNA 3AU5A 3FEHA 2IYBA 1XX0A 2MWNB 4HAUB 2J0KA 4GXBA 2Z59A 4HATB 2KUQA 5JP4A 3M1IB 2D9WA 3HSAA 1V61A
chains in the Genus database with same CATH topology
3U8ZA 1WG7A 1FHXA 2R09A 5D3YA 5FI0A 2ELAA 3PVLA 1FHOA 1Z87A 1KZ7A 2DYNA 1MK7B 2Z0PA 4GN1A 2ZPYA 2BCJA 4CHMA 1UPQA 1OMWA 1U5GA 1EGXA 1U2BA 3GYPA 1EAZA 1ZC3B 2MDXA 1MKEA 3KY9A 4EJNA 4F7UP 1W1HA 4A6KA 3OANA 1ZC4B 5J3QA 3UZTA 1WJ1A 5DHAB 1QC6A 4GMVA 2UVMA 2HTHB 3PG7A 3P7ZA 2RGNB 4HB0B 1FAOA 1BAKA 5DH9B 4Y94A 2K2UA 1ZSQA 1UPRA 1UNPA 4KHOA 1GC6A 1V5MA 4HAZB 4GPTB 4MT7A 2D10A 3ULBA 1W1DA 4MY6A 1UNRA 4IFSA 2KUPA 1X1FA 3TO1A 4GZUA 1U5FA 2DHKA 2LOXA 3U7DA 1WI1A 4HB3B 1X1GA 1XR0B 1Y19B 3SNHA 1FB8A 1M7EA 1TXDA 2GCJA 2QKLA 1DDVA 4BBKA 1DDWA 4MK0A 2DX1A 1MAIA 3KZ1A 3KRWA 2GCLA 2DTCA 2OTXA 2H7EA 2EMTA 2YF0A 3VIAA 5DHFB 2CAYA 2COFA 3PP2A 5C5BB 2YVCA 2KCJA 4GMXB 4KHBB 2K2JA 4DX90 1BWNA 2D9ZA 1ZM0A 2CRFA 2DLWA 3TW1A 2W2WA 2CY4A 1Y5OA 4ZRKA 2DYQA 2Y8GA 2AL6A 4YONA 1ISNA 2LULA 2YS3A 2J0MA 2L1CA 3SYXA 3KRXA 2RLOA 2G35A 4K81A 2E2XA 2P8VA 3ODOA 2CY5A 3ODWA 4A5KA 3WA0A 4DBBA 3D8EA 3D8FA 4DX8A 1U27A 5D3XA 1TQZA 1V89A 5HE0A 1DBHA 2ELBA 1I2HA 2RNRB 2LKOA 5C16A 1UNQA 1NU2A 3P6AA 2COCA 1XODA 2Y7BA 2MFQA 2YT0A 3AU4A 3SUZA 3N7CA 2D4QA 2VRWB 3MDBC 1P3RA 2AEHA 3PSCA 2ROVA 3BJIA 2NMBA 1LW3A 2L2IA 2D2QA 1DDMA 2Z0OA 2I1JA 2ROZB 2PZ1A 4P7IA 5LONB 4B6HA 2GS0A 2J0JA 1K5GB 4HAXB 4HB4B 1GC7A 3HQCA 3CXBB 1FGZA 2RSGA 5C79A 2J59M 1LB1A 1X05A 4D0NB 2YT1A 2X18A 4WSFA 4NSWA 2GJYA 2JP2A 5KQ4A 2D9YA 2CODA 3PZDA 3ZDTA 2M14A 3SO6A 5D3WA 5EFXA 2COAA 1KI1B 3BINA 2D9XA 4A6HA 4HB2B 5D27A 2IFSA 2UZRA 1K5DB 3KSYA 2I5CA 1I7AA 1MIXA 3PEGA 2RUKB 1TJ6A 5KQ1A 3DXDA 4ZRJA 5KCVA 5C5BA 2EC1A 2W2XC 4HAYB 2VKIA 3G9WA 2DFKA 2DX5A 4YL8A 2N0YA 2Q13A 1H10A 1M7RA 2P0HA 2DKQA 3ZVRA 2I5FA 2OQBA 4KHAA 2NZ8B 3NSUA 5JHHA 4Z2MB 3A8PA 2DN6A 1QQGA 2Z0QA 3ODXA 2YRYA 3F0WA 2EJ8A 4A6FB 3SV1A 1MIZB 3A98B 4EMOA 4F7HA 1NTYA 1WJMA 1V88A 2N23A 3DXEA 4CHJA 3IVFA 5C6RA 2RVBB 4KAXB 2P0DA 4PQ0A 5DIFB 5CLLB 3O96A 1BTNA 4PNKA 1WGQA 2QKMA 1KZGA 4WVFB 1U5DA 5JHGA 1EF1A 1RJ2A 2I1KA 3FM8C 3PVUA 1PFJA 2DHIA 4IOYX 3TCAA 4HDOA 1V5UA 3GYOA 1B55A 2YS5A 4HHVA 1DROA 5DI9B 1WGUA 4EKUA 1WVHA 5CLQB 3QBVB 3F5RA 1X86A 1P6SA 2V76A 3QWMA 2K00A 4KVGB 1MPHA 1SHCA 2H7DA 4TYZA 3RCPA 1XCGA 1NI2A 3LJUX 4K2PA 1U29A 4L6EA 1IRSA 1U5EA 1RRPB 2Y8FA 4TKNA 2YSZA 4ZRIA 5L81A 2ADZA 5D3VA 3QIJA 1OY2A 1V5PA 3MPXA 4HAVB 5LOPB 3VOQA 1X11A 1BTKA 5FI1A 2W2XD 3X23A 3ML4A 4DXAB 1GG3A 4CYEA 3V5WA 4IAPA 2D9VA 3A8QA 2XQNM 1AWEA 1PLSA 5HE1A 2MKRA 1UEFA 5GOWB 2M38A 3AJ4A 3T06A 1FGYA 2DA0A 4A6FA 2FJLA 2DHJA 3PVWA 2LG1A 1ZVRA 1XKEA 4K17A 1P5TA 2HE7A 2LOZA 2EMSA 1FHWA 2VSZA 1XD4A 2P0FA 2YS1A 1J19A 3TVVA 3FSSA 4XWXA 4Z2NA 1MK9B 1PMSA 1NTVA 4C0AA 2UZSA 5JLJB 1FOEA 3CIKA 1Q67A 3TFMA 2DKPA 1SGHA 4H8SA 5J3TA 1J0WA 1EVHA 4NY0A 1AQCA 3ULCA 4HAWB 4HDQA 4K2OA 1H4RA 5J3YA 2R0DA 3DXCA 3D8DA 5HE2A 4F7GA 3HW2B 1OQNA 5HE3A 4WJ7A 1W1GA 1E5WA 2KGXB 3WYFB 3HK0A 2LYDA 2D11A 1DYNA 3AU5A 3FEHA 2IYBA 1XX0A 2MWNB 4HAUB 2J0KA 4GXBA 4HATB 5JP4A 3M1IB 2D9WA 1N3HA 1V61A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3U8Z A;  1WG7 A;  1FHX A;  2R09 A;  5D3Y A;  5FI0 A;  2ELA A;  3PVL A;  1FHO A;  1Z87 A;  1KZ7 A;  2DYN A;  1MK7 B;  2Z0P A;  4GN1 A;  2ZPY A;  2BCJ A;  4CHM A;  1UPQ A;  1OMW A;  1U5G A;  1EGX A;  1U2B A;  3GYP A;  1EAZ A;  1ZC3 B;  2MDX A;  1MKE A;  3KY9 A;  4EJN A;  4F7U P;  1W1H A;  4A6K A;  3OAN A;  1ZC4 B;  5J3Q A;  3UZT A;  1WJ1 A;  5DHA B;  1QC6 A;  4GMV A;  2UVM A;  2HTH B;  3PG7 A;  3P7Z A;  2RGN B;  4HB0 B;  1FAO A;  1BAK A;  5DH9 B;  4Y94 A;  2K2U A;  1ZSQ A;  1UPR A;  1UNP A;  4KHO A;  1GC6 A;  1V5M A;  4HAZ B;  4GPT B;  4MT7 A;  2D10 A;  3ULB A;  1W1D A;  4MY6 A;  1UNR A;  4IFS A;  2KUP A;  1X1F A;  3TO1 A;  4GZU A;  1U5F A;  2DHK A;  2LOX A;  3U7D A;  1WI1 A;  4HB3 B;  1X1G A;  1XR0 B;  1Y19 B;  3SNH A;  1FB8 A;  1M7E A;  1TXD A;  2GCJ A;  2QKL A;  1DDV A;  4BBK A;  1DDW A;  4MK0 A;  2DX1 A;  1MAI A;  3KZ1 A;  3KRW A;  2GCL A;  2DTC A;  2OTX A;  2H7E A;  2EMT A;  2YF0 A;  3VIA A;  5DHF B;  2CAY A;  2COF A;  3PP2 A;  5C5B B;  2YVC A;  2KCJ A;  4GMX B;  4KHB B;  2K2J A;  4DX9 0;  1BWN A;  2D9Z A;  1ZM0 A;  2CRF A;  2DLW A;  3TW1 A;  2W2W A;  2CY4 A;  1Y5O A;  4ZRK A;  2DYQ A;  2Y8G A;  2AL6 A;  4YON A;  1ISN A;  2LUL A;  2YS3 A;  2J0M A;  2L1C A;  3SYX A;  3KRX A;  2RLO A;  2G35 A;  4K81 A;  2E2X A;  2P8V A;  3ODO A;  2CY5 A;  3ODW A;  4A5K A;  3WA0 A;  4DBB A;  3D8E A;  3D8F A;  4DX8 A;  1U27 A;  5D3X A;  1TQZ A;  1V89 A;  5HE0 A;  1DBH A;  2ELB A;  1I2H A;  2RNR B;  2LKO A;  5C16 A;  1UNQ A;  1NU2 A;  3P6A A;  2COC A;  1XOD A;  2Y7B A;  2MFQ A;  2YT0 A;  3AU4 A;  3SUZ A;  3N7C A;  2D4Q A;  2VRW B;  3MDB C;  1P3R A;  2AEH A;  3PSC A;  2ROV A;  3BJI A;  2NMB A;  1LW3 A;  2L2I A;  2D2Q A;  1DDM A;  2Z0O A;  2I1J A;  2ROZ B;  2PZ1 A;  4P7I A;  5LON B;  4B6H A;  2GS0 A;  2J0J A;  1K5G B;  4HAX B;  4HB4 B;  1GC7 A;  3HQC A;  3CXB B;  1FGZ A;  2RSG A;  5C79 A;  2J59 M;  1LB1 A;  1X05 A;  4D0N B;  2YT1 A;  2X18 A;  4WSF A;  4NSW A;  2GJY A;  2JP2 A;  5KQ4 A;  2D9Y A;  2COD A;  3PZD A;  3ZDT A;  2M14 A;  3SO6 A;  5D3W A;  5EFX A;  2COA A;  1KI1 B;  3BIN A;  2D9X A;  4A6H A;  4HB2 B;  5D27 A;  2IFS A;  2UZR A;  1K5D B;  3KSY A;  2I5C A;  1I7A A;  1MIX A;  3PEG A;  2RUK B;  1TJ6 A;  5KQ1 A;  3DXD A;  4ZRJ A;  5KCV A;  5C5B A;  2EC1 A;  2W2X C;  4HAY B;  2VKI A;  3G9W A;  2DFK A;  2DX5 A;  4YL8 A;  2N0Y A;  2Q13 A;  1H10 A;  1M7R A;  2P0H A;  2DKQ A;  3ZVR A;  2I5F A;  2OQB A;  4KHA A;  2NZ8 B;  3NSU A;  5JHH A;  4Z2M B;  3A8P A;  2DN6 A;  1QQG A;  2Z0Q A;  3ODX A;  2YRY A;  3F0W A;  2EJ8 A;  4A6F B;  3SV1 A;  1MIZ B;  3A98 B;  4EMO A;  4F7H A;  1NTY A;  1WJM A;  1V88 A;  2N23 A;  3DXE A;  4CHJ A;  3IVF A;  5C6R A;  2RVB B;  4KAX B;  2P0D A;  4PQ0 A;  5DIF B;  5CLL B;  3O96 A;  1BTN A;  4PNK A;  1WGQ A;  2QKM A;  1KZG A;  4WVF B;  1U5D A;  5JHG A;  1EF1 A;  1RJ2 A;  2I1K A;  3FM8 C;  3PVU A;  1PFJ A;  2DHI A;  4IOY X;  3TCA A;  4HDO A;  1V5U A;  3GYO A;  1B55 A;  2YS5 A;  4HHV A;  1DRO A;  5DI9 B;  1WGU A;  4EKU A;  1WVH A;  5CLQ B;  3QBV B;  3F5R A;  1X86 A;  1P6S A;  2V76 A;  3QWM A;  2K00 A;  4KVG B;  1MPH A;  1SHC A;  2H7D A;  4TYZ A;  3RCP A;  1XCG A;  1NI2 A;  3LJU X;  4K2P A;  1U29 A;  4L6E A;  1IRS A;  1U5E A;  1RRP B;  2Y8F A;  4TKN A;  2YSZ A;  4ZRI A;  5L81 A;  2ADZ A;  5D3V A;  3QIJ A;  1OY2 A;  1V5P A;  3MPX A;  4HAV B;  5LOP B;  3VOQ A;  1X11 A;  1BTK A;  5FI1 A;  2W2X D;  3X23 A;  3ML4 A;  4DXA B;  1GG3 A;  4CYE A;  3V5W A;  4IAP A;  2D9V A;  3A8Q A;  2XQN M;  1AWE A;  1PLS A;  5HE1 A;  2MKR A;  1UEF A;  5GOW B;  2M38 A;  3AJ4 A;  3T06 A;  1FGY A;  2DA0 A;  4A6F A;  2FJL A;  2DHJ A;  3PVW A;  2LG1 A;  1ZVR A;  1XKE A;  4K17 A;  1P5T A;  2HE7 A;  2LOZ A;  2EMS A;  1FHW A;  2VSZ A;  1XD4 A;  2P0F A;  2YS1 A;  1J19 A;  3TVV A;  3FSS A;  4XWX A;  4Z2N A;  1MK9 B;  1PMS A;  1NTV A;  4C0A A;  2UZS A;  5JLJ B;  1FOE A;  3CIK A;  1Q67 A;  3TFM A;  2DKP A;  1SGH A;  4H8S A;  5J3T A;  1J0W A;  1EVH A;  4NY0 A;  1AQC A;  3ULC A;  4HAW B;  4HDQ A;  4K2O A;  1H4R A;  5J3Y A;  2R0D A;  3DXC A;  3D8D A;  5HE2 A;  4F7G A;  3HW2 B;  1OQN A;  5HE3 A;  4WJ7 A;  1W1G A;  1E5W A;  2KGX B;  3WYF B;  3HK0 A;  2LYD A;  2D11 A;  1DYN A;  3AU5 A;  3FEH A;  2IYB A;  1XX0 A;  2MWN B;  4HAU B;  2J0K A;  4GXB A;  4HAT B;  5JP4 A;  3M1I B;  2D9W A;  1N3H A;  1V61 A; 
#chains in the Genus database with same CATH topology
 3U8Z A;  1WG7 A;  1FHX A;  2R09 A;  5D3Y A;  5FI0 A;  2ELA A;  3U12 A;  3NWF A;  3PVL A;  1FHO A;  1Z87 A;  1KZ7 A;  2DYN A;  3NW8 A;  1MK7 B;  2R2Y A;  2Z0P A;  4GN1 A;  3OHM B;  5I2M A;  2ZPY A;  2BCJ A;  4CHM A;  1UPQ A;  1OMW A;  1U5G A;  1EGX A;  1U2B A;  3GYP A;  1EAZ A;  1ZC3 B;  2MDX A;  2K49 A;  1MKE A;  3KY9 A;  4EJN A;  4F7U P;  1W1H A;  4A6K A;  3OAN A;  1ZC4 B;  5J3Q A;  3UZT A;  1WJ1 A;  5DHA B;  1QC6 A;  4GMV A;  2GUM A;  2UVM A;  3DCX A;  2HTH B;  3P7Z A;  3PG7 A;  2RGN B;  4DIX A;  4HB0 B;  4QJ5 B;  5IRS A;  2Z13 A;  1FAO A;  1BAK A;  5DH9 B;  4Y94 A;  2K2U A;  1ZSQ A;  1UPR A;  1UNP A;  4KHO A;  4OT1 A;  1GC6 A;  1V5M A;  4HAZ B;  4GPT B;  4MT7 A;  2D10 A;  3ULB A;  1W1D A;  4MY6 A;  1UNR A;  4IFS A;  2KUP A;  1X1F A;  3TO1 A;  4GZU A;  1U5F A;  2DHK A;  2LOX A;  3U7D A;  1WI1 A;  4HB3 B;  1X1G A;  1XR0 B;  1Y19 B;  3SNH A;  1FB8 A;  1M7E A;  1TXD A;  2GCJ A;  2QKL A;  1DDV A;  3FVC A;  4BBK A;  1DDW A;  4MK0 A;  4D6W A;  2DX1 A;  1MAI A;  3KZ1 A;  3KRW A;  2GCL A;  2DTC A;  2OTX A;  2Z4D A;  2H7E A;  2EMT A;  2YF0 A;  3VIA A;  5DHF B;  2CAY A;  2COF A;  3PP2 A;  5C5B B;  2YVC A;  2KCJ A;  2KIE A;  4GMX B;  4KHB B;  2K2J A;  4DX9 0;  1BWN A;  2D9Z A;  1ZM0 A;  2CRF A;  2DLW A;  3TW1 A;  2W2W A;  2CY4 A;  1Y5O A;  4ZRK A;  2DYQ A;  2Y8G A;  2AL6 A;  3NWD A;  4YON A;  1ISN A;  2LUL A;  2YS3 A;  2J0M A;  2L1C A;  3SYX A;  3KRX A;  2RLO A;  2G35 A;  4K81 A;  2E2X A;  2P8V A;  3ODO A;  2CY5 A;  4QJ3 B;  3ODW A;  4A5K A;  3WA0 A;  4QJ4 B;  4DBB A;  3D8E A;  3D8F A;  4DX8 A;  1U27 A;  5D3X A;  1TQZ A;  1V89 A;  5HE0 A;  1DBH A;  2ZKM X;  2ELB A;  1I2H A;  2RNR B;  2LKO A;  5C16 A;  1UNQ A;  1NU2 A;  3P6A A;  2COC A;  1XOD A;  2Y7B A;  2MFQ A;  2YT0 A;  3AU4 A;  3SUZ A;  3N7C A;  2D4Q A;  2VRW B;  1ZYI A;  3MDB C;  2Z14 A;  1P3R A;  2AEH A;  3PSC A;  2ROV A;  3BJI A;  2NMB A;  1LW3 A;  2L2I A;  2D2Q A;  1DDM A;  4QXA B;  2Z0O A;  2I1J A;  2ROZ B;  2PZ1 A;  4P7I A;  5LON B;  4B6H A;  2GS0 A;  2J0J A;  1K5G B;  4HAX B;  4HB4 B;  1GC7 A;  3HQC A;  3CXB B;  2KR0 A;  1FGZ A;  2RSG A;  4OSN A;  5C79 A;  2J59 M;  1LB1 A;  1X05 A;  4D0N B;  3A58 A;  2YT1 A;  2X18 A;  4WSF A;  4NSW A;  2GJY A;  2JP2 A;  5KQ4 A;  2D9Y A;  2COD A;  3PZD A;  3ZDT A;  2M14 A;  3SO6 A;  5D3W A;  5EFX A;  2COA A;  3BIN A;  1KI1 B;  2D9X A;  2RRF A;  4A6H A;  4HB2 B;  5D27 A;  2IFS A;  2UZR A;  1K5D B;  3KSY A;  2I5C A;  1I7A A;  1MIX A;  3PEG A;  2RUK B;  1TJ6 A;  5KQ1 A;  3DXD A;  4L1R A;  4ZRJ A;  5KCV A;  5C5B A;  2EC1 A;  2W2X C;  4HAY B;  4KHB A;  2VKI A;  3G9W A;  2DFK A;  2DX5 A;  4YL8 A;  2N0Y A;  2Q13 A;  1H10 A;  3NWA A;  1M7R A;  2P0H A;  2DKQ A;  5I2S A;  5M4Y B;  3ZVR A;  2I5F A;  2OQB A;  4KHA A;  2NZ8 B;  3NSU A;  4GOU A;  5JHH A;  4Z2M B;  3A8P A;  2DN6 A;  1QQG A;  2Z0Q A;  3ODX A;  2YRY A;  3F0W A;  2EJ8 A;  4A6F B;  3SV1 A;  1MIZ B;  3A98 B;  4EMO A;  2NBV A;  4F7H A;  1NTY A;  1WJM A;  1V88 A;  2N23 A;  3DXE A;  4CHJ A;  3IVF A;  5C6R A;  2RVB B;  4KAX B;  2P0D A;  4PQ0 A;  5DIF B;  5CLL B;  3O96 A;  1BTN A;  4PNK A;  1WGQ A;  2QKM A;  1KZG A;  4WVF B;  1U5D A;  5JHG A;  1EF1 A;  1RJ2 A;  2I1K A;  3FM8 C;  3PVU A;  1PFJ A;  2DHI A;  4IOY X;  3TCA A;  4HDO A;  1V5U A;  3GYO A;  1B55 A;  2YS5 A;  4HHV A;  1DRO A;  1T77 A;  5DI9 B;  1WGU A;  4EKU A;  1WVH A;  5CLQ B;  3B77 A;  3QBV B;  3F5R A;  1X86 A;  1P6S A;  2V76 A;  3QWM A;  5LG4 B;  4GNK B;  2K00 A;  4KVG B;  1MPH A;  1SHC A;  2H7D A;  4TYZ A;  3RCP A;  1XCG A;  1NI2 A;  3LJU X;  4K2P A;  1U29 A;  4L6E A;  1IRS A;  1U5E A;  1RRP B;  2Y8F A;  4TKN A;  2YSZ A;  4ZRI A;  5L81 A;  2ADZ A;  5D3V A;  3QIJ A;  1OY2 A;  1V5P A;  3HIE A;  3MPX A;  4HAV B;  5LOP B;  3VOQ A;  1X11 A;  1BTK A;  5FI1 A;  2W2X D;  3X23 A;  3ML4 A;  4DXA B;  1GG3 A;  4CYE A;  3V5W A;  4IAP A;  4CSQ A;  2D9V A;  3A8Q A;  2XQN M;  1AWE A;  1PLS A;  5HE1 A;  2MKR A;  1UEF A;  5GOW B;  2M38 A;  3AJ4 A;  3T06 A;  1FGY A;  2DA0 A;  4A6F A;  2FJL A;  2DHJ A;  3PVW A;  2LG1 A;  2YT2 A;  1ZVR A;  1XKE A;  4K17 A;  1P5T A;  2HE7 A;  2LOZ A;  2EMS A;  2K8E A;  1FHW A;  2VSZ A;  4HSI A;  1XD4 A;  2P0F A;  2YS1 A;  1J19 A;  3TVV A;  3FSS A;  4XWX A;  4Z2N A;  1MK9 B;  1PMS A;  1NTV A;  4C0A A;  2UZS A;  5JLJ B;  1FOE A;  3CIK A;  2FJU B;  1Q67 A;  3TFM A;  2DKP A;  1SGH A;  4H8S A;  5J3T A;  1J0W A;  1EVH A;  4NY0 A;  1AQC A;  3ULC A;  4HAW B;  4HDQ A;  4K2O A;  1H4R A;  5J3Y A;  2R0D A;  3DXC A;  3D8D A;  5HE2 A;  4F7G A;  3HW2 B;  1OQN A;  5HE3 A;  4WJ7 A;  2KIG A;  1W1G A;  1E5W A;  2KGX B;  1MI1 A;  3WYF B;  3HK0 A;  2LYD A;  1N3H A;  2D11 A;  1DYN A;  3AU5 A;  3FEH A;  2IYB A;  1XX0 A;  2MWN B;  4HAU B;  2J0K A;  4GXB A;  2Z59 A;  4HAT B;  2KUQ A;  5JP4 A;  3M1I B;  2D9W A;  3HSA A;  1V61 A; 
#chains in the Genus database with same CATH homology
 3U8Z A;  1WG7 A;  1FHX A;  2R09 A;  5D3Y A;  5FI0 A;  2ELA A;  3PVL A;  1FHO A;  1Z87 A;  1KZ7 A;  2DYN A;  1MK7 B;  2Z0P A;  4GN1 A;  2ZPY A;  2BCJ A;  4CHM A;  1UPQ A;  1OMW A;  1U5G A;  1EGX A;  1U2B A;  3GYP A;  1EAZ A;  1ZC3 B;  2MDX A;  1MKE A;  3KY9 A;  4EJN A;  4F7U P;  1W1H A;  4A6K A;  3OAN A;  1ZC4 B;  5J3Q A;  3UZT A;  1WJ1 A;  5DHA B;  1QC6 A;  4GMV A;  2UVM A;  2HTH B;  3PG7 A;  3P7Z A;  2RGN B;  4HB0 B;  1FAO A;  1BAK A;  5DH9 B;  4Y94 A;  2K2U A;  1ZSQ A;  1UPR A;  1UNP A;  4KHO A;  1GC6 A;  1V5M A;  4HAZ B;  4GPT B;  4MT7 A;  2D10 A;  3ULB A;  1W1D A;  4MY6 A;  1UNR A;  4IFS A;  2KUP A;  1X1F A;  3TO1 A;  4GZU A;  1U5F A;  2DHK A;  2LOX A;  3U7D A;  1WI1 A;  4HB3 B;  1X1G A;  1XR0 B;  1Y19 B;  3SNH A;  1FB8 A;  1M7E A;  1TXD A;  2GCJ A;  2QKL A;  1DDV A;  4BBK A;  1DDW A;  4MK0 A;  2DX1 A;  1MAI A;  3KZ1 A;  3KRW A;  2GCL A;  2DTC A;  2OTX A;  2H7E A;  2EMT A;  2YF0 A;  3VIA A;  5DHF B;  2CAY A;  2COF A;  3PP2 A;  5C5B B;  2YVC A;  2KCJ A;  4GMX B;  4KHB B;  2K2J A;  4DX9 0;  1BWN A;  2D9Z A;  1ZM0 A;  2CRF A;  2DLW A;  3TW1 A;  2W2W A;  2CY4 A;  1Y5O A;  4ZRK A;  2DYQ A;  2Y8G A;  2AL6 A;  4YON A;  1ISN A;  2LUL A;  2YS3 A;  2J0M A;  2L1C A;  3SYX A;  3KRX A;  2RLO A;  2G35 A;  4K81 A;  2E2X A;  2P8V A;  3ODO A;  2CY5 A;  3ODW A;  4A5K A;  3WA0 A;  4DBB A;  3D8E A;  3D8F A;  4DX8 A;  1U27 A;  5D3X A;  1TQZ A;  1V89 A;  5HE0 A;  1DBH A;  2ELB A;  1I2H A;  2RNR B;  2LKO A;  5C16 A;  1UNQ A;  1NU2 A;  3P6A A;  2COC A;  1XOD A;  2Y7B A;  2MFQ A;  2YT0 A;  3AU4 A;  3SUZ A;  3N7C A;  2D4Q A;  2VRW B;  3MDB C;  1P3R A;  2AEH A;  3PSC A;  2ROV A;  3BJI A;  2NMB A;  1LW3 A;  2L2I A;  2D2Q A;  1DDM A;  2Z0O A;  2I1J A;  2ROZ B;  2PZ1 A;  4P7I A;  5LON B;  4B6H A;  2GS0 A;  2J0J A;  1K5G B;  4HAX B;  4HB4 B;  1GC7 A;  3HQC A;  3CXB B;  1FGZ A;  2RSG A;  5C79 A;  2J59 M;  1LB1 A;  1X05 A;  4D0N B;  2YT1 A;  2X18 A;  4WSF A;  4NSW A;  2GJY A;  2JP2 A;  5KQ4 A;  2D9Y A;  2COD A;  3PZD A;  3ZDT A;  2M14 A;  3SO6 A;  5D3W A;  5EFX A;  2COA A;  1KI1 B;  3BIN A;  2D9X A;  4A6H A;  4HB2 B;  5D27 A;  2IFS A;  2UZR A;  1K5D B;  3KSY A;  2I5C A;  1I7A A;  1MIX A;  3PEG A;  2RUK B;  1TJ6 A;  5KQ1 A;  3DXD A;  4ZRJ A;  5KCV A;  5C5B A;  2EC1 A;  2W2X C;  4HAY B;  2VKI A;  3G9W A;  2DFK A;  2DX5 A;  4YL8 A;  2N0Y A;  2Q13 A;  1H10 A;  1M7R A;  2P0H A;  2DKQ A;  3ZVR A;  2I5F A;  2OQB A;  4KHA A;  2NZ8 B;  3NSU A;  5JHH A;  4Z2M B;  3A8P A;  2DN6 A;  1QQG A;  2Z0Q A;  3ODX A;  2YRY A;  3F0W A;  2EJ8 A;  4A6F B;  3SV1 A;  1MIZ B;  3A98 B;  4EMO A;  4F7H A;  1NTY A;  1WJM A;  1V88 A;  2N23 A;  3DXE A;  4CHJ A;  3IVF A;  5C6R A;  2RVB B;  4KAX B;  2P0D A;  4PQ0 A;  5DIF B;  5CLL B;  3O96 A;  1BTN A;  4PNK A;  1WGQ A;  2QKM A;  1KZG A;  4WVF B;  1U5D A;  5JHG A;  1EF1 A;  1RJ2 A;  2I1K A;  3FM8 C;  3PVU A;  1PFJ A;  2DHI A;  4IOY X;  3TCA A;  4HDO A;  1V5U A;  3GYO A;  1B55 A;  2YS5 A;  4HHV A;  1DRO A;  5DI9 B;  1WGU A;  4EKU A;  1WVH A;  5CLQ B;  3QBV B;  3F5R A;  1X86 A;  1P6S A;  2V76 A;  3QWM A;  2K00 A;  4KVG B;  1MPH A;  1SHC A;  2H7D A;  4TYZ A;  3RCP A;  1XCG A;  1NI2 A;  3LJU X;  4K2P A;  1U29 A;  4L6E A;  1IRS A;  1U5E A;  1RRP B;  2Y8F A;  4TKN A;  2YSZ A;  4ZRI A;  5L81 A;  2ADZ A;  5D3V A;  3QIJ A;  1OY2 A;  1V5P A;  3MPX A;  4HAV B;  5LOP B;  3VOQ A;  1X11 A;  1BTK A;  5FI1 A;  2W2X D;  3X23 A;  3ML4 A;  4DXA B;  1GG3 A;  4CYE A;  3V5W A;  4IAP A;  2D9V A;  3A8Q A;  2XQN M;  1AWE A;  1PLS A;  5HE1 A;  2MKR A;  1UEF A;  5GOW B;  2M38 A;  3AJ4 A;  3T06 A;  1FGY A;  2DA0 A;  4A6F A;  2FJL A;  2DHJ A;  3PVW A;  2LG1 A;  1ZVR A;  1XKE A;  4K17 A;  1P5T A;  2HE7 A;  2LOZ A;  2EMS A;  1FHW A;  2VSZ A;  1XD4 A;  2P0F A;  2YS1 A;  1J19 A;  3TVV A;  3FSS A;  4XWX A;  4Z2N A;  1MK9 B;  1PMS A;  1NTV A;  4C0A A;  2UZS A;  5JLJ B;  1FOE A;  3CIK A;  1Q67 A;  3TFM A;  2DKP A;  1SGH A;  4H8S A;  5J3T A;  1J0W A;  1EVH A;  4NY0 A;  1AQC A;  3ULC A;  4HAW B;  4HDQ A;  4K2O A;  1H4R A;  5J3Y A;  2R0D A;  3DXC A;  3D8D A;  5HE2 A;  4F7G A;  3HW2 B;  1OQN A;  5HE3 A;  4WJ7 A;  1W1G A;  1E5W A;  2KGX B;  3WYF B;  3HK0 A;  2LYD A;  2D11 A;  1DYN A;  3AU5 A;  3FEH A;  2IYB A;  1XX0 A;  2MWN B;  4HAU B;  2J0K A;  4GXB A;  4HAT B;  5JP4 A;  3M1I B;  2D9W A;  1N3H A;  1V61 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...