2COAA

Solution structure of the ph domain of protein kinase c, d2 type from human
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
125
structure length
125
Chain Sequence
GSSGSSGTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQALMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein kinase C, D2 type
publication title Solution structure of the PH domain of protein kinase C, D2 type from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 15
structure length 125
sequence length 125
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2coaA01
2Z0OA 4HAYB 1ZSQA 3ULBA 4F7GA 2ROVA 2YT0A 3P7ZA 1V5PA 1Y19B 2DHIA 1KZ7A 3WA0A 3D8DA 2H7DA 1FHXA 4GPTB 1QQGA 2OQBA 2XQNM 5GOWB 1ZC4B 3BINA 1MK9B 4PQ0A 1EGXA 3TVVA 4GXBA 2COCA 3D8EA 2D9XA 4KAXB 2V76A 5C6RA 1ZVRA 4K2OA 2PZ1A 3PZDA 3O96A 2QKMA 4HB3B 1ZC3B 4PNKA 5HE2A 4CHJA 3X23A 1MKEA 1WG7A 4EMOA 3SUZA 5DI9B 4H8SA 4HAWB 3PVWA 1TXDA 3MDBC 1W1GA 2R09A 2Y8GA 3T06A 4A6KA 5KQ1A 4A6HA 3F5RA 1EF1A 2I1KA 3CIKA 5J3YA 1DBHA 2ADZA 1MIZB 5LOPB 5DHFB 2Z0QA 5L81A 2MDXA 2UVMA 4F7HA 2EMTA 1V89A 2COAA 2RUKB 2LOXA 3DXEA 2DKQA 4ZRKA 4YONA 1U29A 4TKNA 5KQ4A 1V88A 1FOEA 1OY2A 2EMSA 1V5UA 1OMWA 4K17A 2J0MA 5DH9B 4EJNA 3PEGA 1X05A 2IFSA 2FJLA 2CAYA 1AQCA 5J3TA 4IAPA 4TYZA 2YVCA 4WSFA 1QC6A 3KZ1A 4HAZB 4NSWA 2CY5A 4A6FB 2K2UA 3CXBB 4HHVA 5C16A 2GCJA 3GYOA 1UNPA 1V61A 2W2WA 2M38A 4XWXA 4B6HA 2DX5A 1UNRA 3ODWA 1ISNA 1FHWA 2UZSA 3KY9A 1FGYA 3DXDA 1Z87A 1U5GA 4Y94A 4GZUA 1Q67A 2DLWA 2EJ8A 2D4QA 1P5TA 1BTNA 2AEHA 1MPHA 2CODA 2L2IA 4MK0A 3FM8C 2ZPYA 3WYFB 2X18A 4WJ7A 2D2QA 4EKUA 2R0DA 1MIXA 1M7EA 1WGQA 5C79A 5EFXA 1NTVA 1RRPB 2DKPA 1XCGA 1FB8A 2DX1A 4A5KA 1U5FA 5HE0A 1NTYA 1DDVA 2BCJA 5JP4A 2I5CA 4P7IA 4K2PA 2LOZA 2M14A 1X1GA 1U2BA 2HE7A 2Y7BA 2YS3A 3TW1A 2I5FA 1U5DA 2VRWB 2GS0A 3M1IB 1PLSA 1K5DB 4HAUB 1LB1A 4KHAA 1B55A 1P3RA 3LJUX 3U7DA 3V5WA 5HE3A 1OQNA 4HAXB 2VKIA 1W1HA 2ELBA 3ODXA 3P6AA 4HB0B 3VOQA 3N7CA 2CY4A 5FI0A 1BTKA 2JP2A 3AJ4A 1DYNA 2AL6A 1X86A 2RLOA 2YT1A 4HB4B 1XKEA 1DDMA 3PP2A 3KSYA 4IOYX 1UNQA 4YL8A 2J59M 1PFJA 4A6FA 4BBKA 1X1FA 2HTHB 4Z2NA 1FHOA 2UZRA 5C5BB 4DX90 3A98B 2NMBA 2CRFA 1UPRA 1ZM0A 4NY0A 5D27A 2EC1A 4KVGB 5KCVA 3D8FA 3ODOA 1NI2A 3SO6A 3PG7A 3PVLA 1H10A 1WGUA 1UEFA 3KRWA 2YS5A 3QIJA 2H7EA 1KZGA 1EVHA 4HATB 4DX8A 1XD4A 2N0YA 3QBVB 5CLLB 2RNRB 5JHGA 2LKOA 5JLJB 3AU5A 1XODA 2ROZB 2RSGA 4WVFB 2YF0A 4CYEA 2D9WA 4L6EA 4ZRIA 3BJIA 2YS1A 4IFSA 2E2XA 2LYDA 2VSZA 5HE1A 1W1DA 2G35A 3SNHA 2OTXA 5JHHA 3TO1A 4D0NB 2MWNB 1IRSA 1MAIA 1SGHA 2D9ZA 2GCLA 2DN6A 1J19A 1V5MA 4HAVB 3TFMA 2Y8FA 1WJMA 1MK7B 3A8PA 2RGNB 2P0HA 3AU4A 2KCJA 1AWEA 5DHAB 4C0AA 4CHMA 1GC7A 2Z0PA 1WVHA 2YRYA 2ELAA 2N23A 3NSUA 5D3WA 4GN1A 2L1CA 5D3VA 1FAOA 2J0KA 1NU2A 2D10A 2K2JA 3TCAA 5LONB 1SHCA 3SYXA 3ZVRA 3ULCA 2P0DA 2DHKA 2DHJA 2GJYA 5C5BA 3F0WA 4KHBB 3ML4A 3QWMA 1N3HA 3SV1A 2KGXB 5D3YA 2P8VA 1XR0B 2COFA 2IYBA 4MY6A 1BWNA 2KUPA 2DYQA 2DA0A 2YSZA 1J0WA 3FEHA 4GMXB 1GC6A 1WJ1A 4DBBA 4F7UP 1LW3A 4KHOA 2QKLA 1P6SA 2P0FA 1WI1A 2I1JA 3HW2B 1KI1B 3VIAA 1E5WA 1M7RA 2D9VA 1DROA 1TQZA 1H4RA 3GYPA 3DXCA 5DIFB 2LULA 2Q13A 5FI1A 1I2HA 2W2XD 1DDWA 4Z2MB 3PVUA 2J0JA 1EAZA 2K00A 4ZRJA 3UZTA 5CLQB 3A8QA 4MT7A 2LG1A 1U27A 3IVFA 3MPXA 1X11A 1I7AA 5J3QA 3HK0A 4HB2B 3RCPA 4GMVA 1RJ2A 2DYNA 5D3XA 3KRXA 2MKRA 3ZDTA 1PMSA 1TJ6A 2NZ8B 1XX0A 1BAKA 4HDOA 3HQCA 3G9WA 2D11A 1U5EA 3U8ZA 1K5GB 2DTCA 3FSSA 1GG3A 2MFQA 2DFKA 4K81A 3OANA 4HDQA 1Y5OA 4DXAB 2D9YA 1UPQA 2RVBB 2W2XC 1FGZA 3PSCA
chains in the Genus database with same CATH superfamily
2Z0OA 4HAYB 3HSAA 1ZSQA 3ULBA 4F7GA 2GUMA 5M4YB 2ROVA 2YT0A 3P7ZA 1V5PA 1Y19B 4KHBA 2DHIA 1KZ7A 3WA0A 3D8DA 2H7DA 1FHXA 4GPTB 1QQGA 2OQBA 2XQNM 5GOWB 1ZC4B 3BINA 1MK9B 4PQ0A 1EGXA 3TVVA 4GXBA 2COCA 3D8EA 2D9XA 4KAXB 4HSIA 2V76A 2ZKMX 5C6RA 1ZVRA 4K2OA 4QJ5B 2PZ1A 2R2YA 3PZDA 3O96A 2QKMA 4HB3B 1ZC3B 4PNKA 5HE2A 4CHJA 3X23A 2KUQA 1MKEA 1WG7A 4EMOA 3SUZA 5DI9B 4H8SA 4HAWB 3PVWA 1TXDA 3MDBC 1W1GA 2R09A 2Y8GA 5I2SA 3T06A 4A6KA 5KQ1A 4A6HA 3A58A 3F5RA 1EF1A 2I1KA 3CIKA 5J3YA 1DBHA 2ADZA 1MIZB 5LOPB 5IRSA 5DHFB 2Z0QA 5L81A 5LG4B 2KR0A 2MDXA 2UVMA 4F7HA 2EMTA 1V89A 2COAA 2RUKB 2LOXA 3DXEA 2DKQA 4ZRKA 4YONA 1U29A 4TKNA 5KQ4A 1V88A 1FOEA 1OY2A 2EMSA 3DCXA 1V5UA 1OMWA 4K17A 2J0MA 5DH9B 4EJNA 3PEGA 1X05A 2IFSA 3HIEA 2FJLA 4QJ4B 2CAYA 2KIGA 1AQCA 5J3TA 4IAPA 4TYZA 2YVCA 5I2MA 4WSFA 4QXAB 1QC6A 3KZ1A 4HAZB 4NSWA 2CY5A 4A6FB 2K2UA 3CXBB 4HHVA 5C16A 2GCJA 2NBVA 3GYOA 1UNPA 1V61A 2W2WA 2M38A 4XWXA 4B6HA 2DX5A 4QJ3B 1UNRA 3ODWA 1ISNA 1FHWA 2UZSA 1MI1A 3KY9A 1FGYA 3DXDA 1Z87A 1U5GA 4Y94A 4GZUA 1Q67A 2DLWA 2EJ8A 2D4QA 1P5TA 1BTNA 2AEHA 1MPHA 2CODA 2L2IA 4MK0A 3FM8C 2ZPYA 2FJUB 3WYFB 2X18A 4WJ7A 2D2QA 4EKUA 2R0DA 1MIXA 1M7EA 1WGQA 5C79A 5EFXA 1NTVA 1RRPB 2DKPA 1XCGA 1FB8A 2DX1A 4A5KA 1U5FA 5HE0A 1NTYA 1DDVA 2BCJA 5JP4A 2I5CA 4P7IA 4K2PA 2LOZA 2M14A 1X1GA 1U2BA 2HE7A 2Y7BA 2YS3A 3TW1A 2I5FA 1U5DA 2VRWB 2Z59A 2GS0A 3M1IB 1PLSA 1K5DB 4HAUB 1LB1A 4KHAA 1B55A 1P3RA 3LJUX 3U7DA 3V5WA 5HE3A 1OQNA 4HAXB 4GOUA 2VKIA 1W1HA 2ELBA 3ODXA 3P6AA 4HB0B 3VOQA 3N7CA 2CY4A 5FI0A 3NWFA 1BTKA 2JP2A 3AJ4A 1DYNA 2AL6A 1X86A 2RLOA 2YT1A 4HB4B 1XKEA 1DDMA 3PP2A 3KSYA 4IOYX 1UNQA 4YL8A 2J59M 1PFJA 4A6FA 4BBKA 1X1FA 2HTHB 4Z2NA 1FHOA 2K8EA 2UZRA 5C5BB 4DX90 3A98B 4D6WA 2NMBA 2CRFA 2Z13A 1UPRA 1ZM0A 4NY0A 5D27A 2EC1A 4KVGB 5KCVA 3D8FA 3ODOA 1NI2A 3SO6A 3PG7A 3PVLA 1H10A 1WGUA 1UEFA 3KRWA 2YS5A 3QIJA 2H7EA 1KZGA 1EVHA 4HATB 4DX8A 1XD4A 2N0YA 3QBVB 5CLLB 2RNRB 3OHMB 5JHGA 2LKOA 5JLJB 3AU5A 1XODA 2ROZB 2RSGA 4WVFB 3U12A 2YT2A 2YF0A 4CYEA 2D9WA 4L6EA 4ZRIA 3NWAA 3BJIA 2YS1A 4IFSA 2E2XA 2LYDA 2VSZA 5HE1A 1W1DA 2G35A 3NW8A 3SNHA 2OTXA 5JHHA 1ZYIA 3TO1A 4D0NB 2MWNB 1IRSA 1MAIA 1SGHA 2D9ZA 2GCLA 2DN6A 1J19A 1V5MA 4HAVB 3TFMA 2K49A 2Y8FA 1WJMA 1MK7B 3A8PA 4GNKB 2RGNB 2Z14A 2P0HA 3AU4A 2KCJA 1AWEA 5DHAB 4C0AA 4CHMA 1GC7A 2KIEA 2Z0PA 1WVHA 2YRYA 2ELAA 2N23A 3NSUA 5D3WA 4GN1A 2L1CA 4L1RA 5D3VA 1FAOA 3B77A 2J0KA 1NU2A 2D10A 2K2JA 3TCAA 5LONB 1SHCA 3SYXA 3ZVRA 3ULCA 2P0DA 2DHKA 2DHJA 2GJYA 5C5BA 4OSNA 3F0WA 4KHBB 3ML4A 3QWMA 1N3HA 3SV1A 2KGXB 5D3YA 2P8VA 1XR0B 3FVCA 2COFA 2IYBA 4MY6A 1BWNA 2KUPA 2DYQA 2DA0A 2YSZA 1J0WA 3FEHA 4GMXB 1GC6A 1WJ1A 1T77A 4OT1A 4DBBA 4F7UP 1LW3A 2Z4DA 4KHOA 2QKLA 1P6SA 2P0FA 1WI1A 2I1JA 3HW2B 1KI1B 3VIAA 1E5WA 1M7RA 2D9VA 1DROA 1TQZA 1H4RA 3GYPA 3DXCA 5DIFB 2LULA 2Q13A 5FI1A 1I2HA 3NWDA 2W2XD 1DDWA 4Z2MB 3PVUA 2J0JA 1EAZA 2K00A 4ZRJA 3UZTA 5CLQB 3A8QA 4MT7A 2LG1A 1U27A 3IVFA 4DIXA 3MPXA 1X11A 1I7AA 5J3QA 3HK0A 4HB2B 3RCPA 4GMVA 1RJ2A 2DYNA 5D3XA 2MKRA 3KRXA 3ZDTA 1PMSA 1TJ6A 2NZ8B 2RRFA 1XX0A 4CSQA 1BAKA 4HDOA 3HQCA 3G9WA 2D11A 1U5EA 3U8ZA 1K5GB 2DTCA 3FSSA 1GG3A 2MFQA 3PSCA 4K81A 3OANA 4HDQA 1Y5OA 4DXAB 2D9YA 1UPQA 2RVBB 2W2XC 1FGZA 2DFKA
chains in the Genus database with same CATH topology
2Z0OA 4HAYB 1ZSQA 3ULBA 4F7GA 2ROVA 2YT0A 3P7ZA 1V5PA 1Y19B 2DHIA 1KZ7A 3WA0A 3D8DA 2H7DA 1FHXA 4GPTB 1QQGA 2OQBA 2XQNM 5GOWB 1ZC4B 3BINA 1MK9B 4PQ0A 1EGXA 3TVVA 4GXBA 2COCA 3D8EA 2D9XA 4KAXB 2V76A 5C6RA 1ZVRA 4K2OA 2PZ1A 3PZDA 3O96A 2QKMA 4HB3B 1ZC3B 4PNKA 5HE2A 4CHJA 3X23A 1MKEA 1WG7A 4EMOA 3SUZA 5DI9B 4H8SA 4HAWB 3PVWA 1TXDA 3MDBC 1W1GA 2R09A 2Y8GA 3T06A 4A6KA 5KQ1A 4A6HA 3F5RA 1EF1A 2I1KA 3CIKA 5J3YA 1DBHA 2ADZA 1MIZB 5LOPB 5DHFB 2Z0QA 5L81A 2MDXA 2UVMA 4F7HA 2EMTA 1V89A 2COAA 2RUKB 2LOXA 3DXEA 2DKQA 4ZRKA 4YONA 1U29A 4TKNA 5KQ4A 1V88A 1FOEA 1OY2A 2EMSA 1V5UA 1OMWA 4K17A 2J0MA 5DH9B 4EJNA 3PEGA 1X05A 2IFSA 2FJLA 2CAYA 1AQCA 5J3TA 4IAPA 4TYZA 2YVCA 4WSFA 1QC6A 3KZ1A 4HAZB 4NSWA 2CY5A 4A6FB 2K2UA 3CXBB 4HHVA 5C16A 2GCJA 3GYOA 1UNPA 1V61A 2W2WA 2M38A 4XWXA 4B6HA 2DX5A 1UNRA 3ODWA 1ISNA 1FHWA 2UZSA 3KY9A 1FGYA 3DXDA 1Z87A 1U5GA 4Y94A 4GZUA 1Q67A 2DLWA 2EJ8A 2D4QA 1P5TA 1BTNA 2AEHA 1MPHA 2CODA 2L2IA 4MK0A 3FM8C 2ZPYA 3WYFB 2X18A 4WJ7A 2D2QA 4EKUA 2R0DA 1MIXA 1M7EA 1WGQA 5C79A 5EFXA 1NTVA 1RRPB 2DKPA 1XCGA 1FB8A 2DX1A 4A5KA 1U5FA 5HE0A 1NTYA 1DDVA 2BCJA 5JP4A 2I5CA 4P7IA 4K2PA 2LOZA 2M14A 1X1GA 1U2BA 2HE7A 2Y7BA 2YS3A 3TW1A 2I5FA 1U5DA 2VRWB 2GS0A 3M1IB 1PLSA 1K5DB 4HAUB 1LB1A 4KHAA 1B55A 1P3RA 3LJUX 3U7DA 3V5WA 5HE3A 1OQNA 4HAXB 2VKIA 1W1HA 2ELBA 3ODXA 3P6AA 4HB0B 3VOQA 3N7CA 2CY4A 5FI0A 1BTKA 2JP2A 3AJ4A 1DYNA 2AL6A 1X86A 2RLOA 2YT1A 4HB4B 1XKEA 1DDMA 3PP2A 3KSYA 4IOYX 1UNQA 4YL8A 2J59M 1PFJA 4A6FA 4BBKA 1X1FA 2HTHB 4Z2NA 1FHOA 2UZRA 5C5BB 4DX90 3A98B 2NMBA 2CRFA 1UPRA 1ZM0A 4NY0A 5D27A 2EC1A 4KVGB 5KCVA 3D8FA 3ODOA 1NI2A 3SO6A 3PG7A 3PVLA 1H10A 1WGUA 1UEFA 3KRWA 2YS5A 3QIJA 2H7EA 1KZGA 1EVHA 4HATB 4DX8A 1XD4A 2N0YA 3QBVB 5CLLB 2RNRB 5JHGA 2LKOA 5JLJB 3AU5A 1XODA 2ROZB 2RSGA 4WVFB 2YF0A 4CYEA 2D9WA 4L6EA 4ZRIA 3BJIA 2YS1A 4IFSA 2E2XA 2LYDA 2VSZA 5HE1A 1W1DA 2G35A 3SNHA 2OTXA 5JHHA 3TO1A 4D0NB 2MWNB 1IRSA 1MAIA 1SGHA 2D9ZA 2GCLA 2DN6A 1J19A 1V5MA 4HAVB 3TFMA 2Y8FA 1WJMA 1MK7B 3A8PA 2RGNB 2P0HA 3AU4A 2KCJA 1AWEA 5DHAB 4C0AA 4CHMA 1GC7A 2Z0PA 1WVHA 2YRYA 2ELAA 2N23A 3NSUA 5D3WA 4GN1A 2L1CA 5D3VA 1FAOA 2J0KA 1NU2A 2D10A 2K2JA 3TCAA 5LONB 1SHCA 3SYXA 3ZVRA 3ULCA 2P0DA 2DHKA 2DHJA 2GJYA 5C5BA 3F0WA 4KHBB 3ML4A 3QWMA 1N3HA 3SV1A 2KGXB 5D3YA 2P8VA 1XR0B 2COFA 2IYBA 4MY6A 1BWNA 2KUPA 2DYQA 2DA0A 2YSZA 1J0WA 3FEHA 4GMXB 1GC6A 1WJ1A 4DBBA 4F7UP 1LW3A 4KHOA 2QKLA 1P6SA 2P0FA 1WI1A 2I1JA 3HW2B 1KI1B 3VIAA 1E5WA 1M7RA 2D9VA 1DROA 1TQZA 1H4RA 3GYPA 3DXCA 5DIFB 2LULA 2Q13A 5FI1A 1I2HA 2W2XD 1DDWA 4Z2MB 3PVUA 2J0JA 1EAZA 2K00A 4ZRJA 3UZTA 5CLQB 3A8QA 4MT7A 2LG1A 1U27A 3IVFA 3MPXA 1X11A 1I7AA 5J3QA 3HK0A 4HB2B 3RCPA 4GMVA 1RJ2A 2DYNA 5D3XA 3KRXA 2MKRA 3ZDTA 1PMSA 1TJ6A 2NZ8B 1XX0A 1BAKA 4HDOA 3HQCA 3G9WA 2D11A 1U5EA 3U8ZA 1K5GB 2DTCA 3FSSA 1GG3A 2MFQA 2DFKA 4K81A 3OANA 4HDQA 1Y5OA 4DXAB 2D9YA 1UPQA 2RVBB 2W2XC 1FGZA 3PSCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0O A;  4HAY B;  1ZSQ A;  3ULB A;  4F7G A;  2ROV A;  2YT0 A;  3P7Z A;  1V5P A;  1Y19 B;  2DHI A;  1KZ7 A;  3WA0 A;  3D8D A;  2H7D A;  1FHX A;  4GPT B;  1QQG A;  2OQB A;  2XQN M;  5GOW B;  1ZC4 B;  3BIN A;  1MK9 B;  4PQ0 A;  1EGX A;  3TVV A;  4GXB A;  2COC A;  3D8E A;  2D9X A;  4KAX B;  2V76 A;  5C6R A;  1ZVR A;  4K2O A;  2PZ1 A;  3PZD A;  3O96 A;  2QKM A;  4HB3 B;  1ZC3 B;  4PNK A;  5HE2 A;  4CHJ A;  3X23 A;  1MKE A;  1WG7 A;  4EMO A;  3SUZ A;  5DI9 B;  4H8S A;  4HAW B;  3PVW A;  1TXD A;  3MDB C;  1W1G A;  2R09 A;  2Y8G A;  3T06 A;  4A6K A;  5KQ1 A;  4A6H A;  3F5R A;  1EF1 A;  2I1K A;  3CIK A;  5J3Y A;  1DBH A;  2ADZ A;  1MIZ B;  5LOP B;  5DHF B;  2Z0Q A;  5L81 A;  2MDX A;  2UVM A;  4F7H A;  2EMT A;  1V89 A;  2COA A;  2RUK B;  2LOX A;  3DXE A;  2DKQ A;  4ZRK A;  4YON A;  1U29 A;  4TKN A;  5KQ4 A;  1V88 A;  1FOE A;  1OY2 A;  2EMS A;  1V5U A;  1OMW A;  4K17 A;  2J0M A;  5DH9 B;  4EJN A;  3PEG A;  1X05 A;  2IFS A;  2FJL A;  2CAY A;  1AQC A;  5J3T A;  4IAP A;  4TYZ A;  2YVC A;  4WSF A;  1QC6 A;  3KZ1 A;  4HAZ B;  4NSW A;  2CY5 A;  4A6F B;  2K2U A;  3CXB B;  4HHV A;  5C16 A;  2GCJ A;  3GYO A;  1UNP A;  1V61 A;  2W2W A;  2M38 A;  4XWX A;  4B6H A;  2DX5 A;  1UNR A;  3ODW A;  1ISN A;  1FHW A;  2UZS A;  3KY9 A;  1FGY A;  3DXD A;  1Z87 A;  1U5G A;  4Y94 A;  4GZU A;  1Q67 A;  2DLW A;  2EJ8 A;  2D4Q A;  1P5T A;  1BTN A;  2AEH A;  1MPH A;  2COD A;  2L2I A;  4MK0 A;  3FM8 C;  2ZPY A;  3WYF B;  2X18 A;  4WJ7 A;  2D2Q A;  4EKU A;  2R0D A;  1MIX A;  1M7E A;  1WGQ A;  5C79 A;  5EFX A;  1NTV A;  1RRP B;  2DKP A;  1XCG A;  1FB8 A;  2DX1 A;  4A5K A;  1U5F A;  5HE0 A;  1NTY A;  1DDV A;  2BCJ A;  5JP4 A;  2I5C A;  4P7I A;  4K2P A;  2LOZ A;  2M14 A;  1X1G A;  1U2B A;  2HE7 A;  2Y7B A;  2YS3 A;  3TW1 A;  2I5F A;  1U5D A;  2VRW B;  2GS0 A;  3M1I B;  1PLS A;  1K5D B;  4HAU B;  1LB1 A;  4KHA A;  1B55 A;  1P3R A;  3LJU X;  3U7D A;  3V5W A;  5HE3 A;  1OQN A;  4HAX B;  2VKI A;  1W1H A;  2ELB A;  3ODX A;  3P6A A;  4HB0 B;  3VOQ A;  3N7C A;  2CY4 A;  5FI0 A;  1BTK A;  2JP2 A;  3AJ4 A;  1DYN A;  2AL6 A;  1X86 A;  2RLO A;  2YT1 A;  4HB4 B;  1XKE A;  1DDM A;  3PP2 A;  3KSY A;  4IOY X;  1UNQ A;  4YL8 A;  2J59 M;  1PFJ A;  4A6F A;  4BBK A;  1X1F A;  2HTH B;  4Z2N A;  1FHO A;  2UZR A;  5C5B B;  4DX9 0;  3A98 B;  2NMB A;  2CRF A;  1UPR A;  1ZM0 A;  4NY0 A;  5D27 A;  2EC1 A;  4KVG B;  5KCV A;  3D8F A;  3ODO A;  1NI2 A;  3SO6 A;  3PG7 A;  3PVL A;  1H10 A;  1WGU A;  1UEF A;  3KRW A;  2YS5 A;  3QIJ A;  2H7E A;  1KZG A;  1EVH A;  4HAT B;  4DX8 A;  1XD4 A;  2N0Y A;  3QBV B;  5CLL B;  2RNR B;  5JHG A;  2LKO A;  5JLJ B;  3AU5 A;  1XOD A;  2ROZ B;  2RSG A;  4WVF B;  2YF0 A;  4CYE A;  2D9W A;  4L6E A;  4ZRI A;  3BJI A;  2YS1 A;  4IFS A;  2E2X A;  2LYD A;  2VSZ A;  5HE1 A;  1W1D A;  2G35 A;  3SNH A;  2OTX A;  5JHH A;  3TO1 A;  4D0N B;  2MWN B;  1IRS A;  1MAI A;  1SGH A;  2D9Z A;  2GCL A;  2DN6 A;  1J19 A;  1V5M A;  4HAV B;  3TFM A;  2Y8F A;  1WJM A;  1MK7 B;  3A8P A;  2RGN B;  2P0H A;  3AU4 A;  2KCJ A;  1AWE A;  5DHA B;  4C0A A;  4CHM A;  1GC7 A;  2Z0P A;  1WVH A;  2YRY A;  2ELA A;  2N23 A;  3NSU A;  5D3W A;  4GN1 A;  2L1C A;  5D3V A;  1FAO A;  2J0K A;  1NU2 A;  2D10 A;  2K2J A;  3TCA A;  5LON B;  1SHC A;  3SYX A;  3ZVR A;  3ULC A;  2P0D A;  2DHK A;  2DHJ A;  2GJY A;  5C5B A;  3F0W A;  4KHB B;  3ML4 A;  3QWM A;  1N3H A;  3SV1 A;  2KGX B;  5D3Y A;  2P8V A;  1XR0 B;  2COF A;  2IYB A;  4MY6 A;  1BWN A;  2KUP A;  2DYQ A;  2DA0 A;  2YSZ A;  1J0W A;  3FEH A;  4GMX B;  1GC6 A;  1WJ1 A;  4DBB A;  4F7U P;  1LW3 A;  4KHO A;  2QKL A;  1P6S A;  2P0F A;  1WI1 A;  2I1J A;  3HW2 B;  1KI1 B;  3VIA A;  1E5W A;  1M7R A;  2D9V A;  1DRO A;  1TQZ A;  1H4R A;  3GYP A;  3DXC A;  5DIF B;  2LUL A;  2Q13 A;  5FI1 A;  1I2H A;  2W2X D;  1DDW A;  4Z2M B;  3PVU A;  2J0J A;  1EAZ A;  2K00 A;  4ZRJ A;  3UZT A;  5CLQ B;  3A8Q A;  4MT7 A;  2LG1 A;  1U27 A;  3IVF A;  3MPX A;  1X11 A;  1I7A A;  5J3Q A;  3HK0 A;  4HB2 B;  3RCP A;  4GMV A;  1RJ2 A;  2DYN A;  5D3X A;  3KRX A;  2MKR A;  3ZDT A;  1PMS A;  1TJ6 A;  2NZ8 B;  1XX0 A;  1BAK A;  4HDO A;  3HQC A;  3G9W A;  2D11 A;  1U5E A;  3U8Z A;  1K5G B;  2DTC A;  3FSS A;  1GG3 A;  2MFQ A;  2DFK A;  4K81 A;  3OAN A;  4HDQ A;  1Y5O A;  4DXA B;  2D9Y A;  1UPQ A;  2RVB B;  2W2X C;  1FGZ A;  3PSC A; 
#chains in the Genus database with same CATH topology
 2Z0O A;  4HAY B;  3HSA A;  1ZSQ A;  3ULB A;  4F7G A;  2GUM A;  5M4Y B;  2ROV A;  2YT0 A;  3P7Z A;  1V5P A;  1Y19 B;  4KHB A;  2DHI A;  1KZ7 A;  3WA0 A;  3D8D A;  2H7D A;  1FHX A;  4GPT B;  1QQG A;  2OQB A;  2XQN M;  5GOW B;  1ZC4 B;  3BIN A;  1MK9 B;  4PQ0 A;  1EGX A;  3TVV A;  4GXB A;  2COC A;  3D8E A;  2D9X A;  4KAX B;  4HSI A;  2V76 A;  2ZKM X;  5C6R A;  1ZVR A;  4K2O A;  4QJ5 B;  2PZ1 A;  2R2Y A;  3PZD A;  3O96 A;  2QKM A;  4HB3 B;  1ZC3 B;  4PNK A;  5HE2 A;  4CHJ A;  3X23 A;  2KUQ A;  1MKE A;  1WG7 A;  4EMO A;  3SUZ A;  5DI9 B;  4H8S A;  4HAW B;  3PVW A;  1TXD A;  3MDB C;  1W1G A;  2R09 A;  2Y8G A;  5I2S A;  3T06 A;  4A6K A;  5KQ1 A;  4A6H A;  3A58 A;  3F5R A;  1EF1 A;  2I1K A;  3CIK A;  5J3Y A;  1DBH A;  2ADZ A;  1MIZ B;  5LOP B;  5IRS A;  5DHF B;  2Z0Q A;  5L81 A;  5LG4 B;  2KR0 A;  2MDX A;  2UVM A;  4F7H A;  2EMT A;  1V89 A;  2COA A;  2RUK B;  2LOX A;  3DXE A;  2DKQ A;  4ZRK A;  4YON A;  1U29 A;  4TKN A;  5KQ4 A;  1V88 A;  1FOE A;  1OY2 A;  2EMS A;  3DCX A;  1V5U A;  1OMW A;  4K17 A;  2J0M A;  5DH9 B;  4EJN A;  3PEG A;  1X05 A;  2IFS A;  3HIE A;  2FJL A;  4QJ4 B;  2CAY A;  2KIG A;  1AQC A;  5J3T A;  4IAP A;  4TYZ A;  2YVC A;  5I2M A;  4WSF A;  4QXA B;  1QC6 A;  3KZ1 A;  4HAZ B;  4NSW A;  2CY5 A;  4A6F B;  2K2U A;  3CXB B;  4HHV A;  5C16 A;  2GCJ A;  2NBV A;  3GYO A;  1UNP A;  1V61 A;  2W2W A;  2M38 A;  4XWX A;  4B6H A;  2DX5 A;  4QJ3 B;  1UNR A;  3ODW A;  1ISN A;  1FHW A;  2UZS A;  1MI1 A;  3KY9 A;  1FGY A;  3DXD A;  1Z87 A;  1U5G A;  4Y94 A;  4GZU A;  1Q67 A;  2DLW A;  2EJ8 A;  2D4Q A;  1P5T A;  1BTN A;  2AEH A;  1MPH A;  2COD A;  2L2I A;  4MK0 A;  3FM8 C;  2ZPY A;  2FJU B;  3WYF B;  2X18 A;  4WJ7 A;  2D2Q A;  4EKU A;  2R0D A;  1MIX A;  1M7E A;  1WGQ A;  5C79 A;  5EFX A;  1NTV A;  1RRP B;  2DKP A;  1XCG A;  1FB8 A;  2DX1 A;  4A5K A;  1U5F A;  5HE0 A;  1NTY A;  1DDV A;  2BCJ A;  5JP4 A;  2I5C A;  4P7I A;  4K2P A;  2LOZ A;  2M14 A;  1X1G A;  1U2B A;  2HE7 A;  2Y7B A;  2YS3 A;  3TW1 A;  2I5F A;  1U5D A;  2VRW B;  2Z59 A;  2GS0 A;  3M1I B;  1PLS A;  1K5D B;  4HAU B;  1LB1 A;  4KHA A;  1B55 A;  1P3R A;  3LJU X;  3U7D A;  3V5W A;  5HE3 A;  1OQN A;  4HAX B;  4GOU A;  2VKI A;  1W1H A;  2ELB A;  3ODX A;  3P6A A;  4HB0 B;  3VOQ A;  3N7C A;  2CY4 A;  5FI0 A;  3NWF A;  1BTK A;  2JP2 A;  3AJ4 A;  1DYN A;  2AL6 A;  1X86 A;  2RLO A;  2YT1 A;  4HB4 B;  1XKE A;  1DDM A;  3PP2 A;  3KSY A;  4IOY X;  1UNQ A;  4YL8 A;  2J59 M;  1PFJ A;  4A6F A;  4BBK A;  1X1F A;  2HTH B;  4Z2N A;  1FHO A;  2K8E A;  2UZR A;  5C5B B;  4DX9 0;  3A98 B;  4D6W A;  2NMB A;  2CRF A;  2Z13 A;  1UPR A;  1ZM0 A;  4NY0 A;  5D27 A;  2EC1 A;  4KVG B;  5KCV A;  3D8F A;  3ODO A;  1NI2 A;  3SO6 A;  3PG7 A;  3PVL A;  1H10 A;  1WGU A;  1UEF A;  3KRW A;  2YS5 A;  3QIJ A;  2H7E A;  1KZG A;  1EVH A;  4HAT B;  4DX8 A;  1XD4 A;  2N0Y A;  3QBV B;  5CLL B;  2RNR B;  3OHM B;  5JHG A;  2LKO A;  5JLJ B;  3AU5 A;  1XOD A;  2ROZ B;  2RSG A;  4WVF B;  3U12 A;  2YT2 A;  2YF0 A;  4CYE A;  2D9W A;  4L6E A;  4ZRI A;  3NWA A;  3BJI A;  2YS1 A;  4IFS A;  2E2X A;  2LYD A;  2VSZ A;  5HE1 A;  1W1D A;  2G35 A;  3NW8 A;  3SNH A;  2OTX A;  5JHH A;  1ZYI A;  3TO1 A;  4D0N B;  2MWN B;  1IRS A;  1MAI A;  1SGH A;  2D9Z A;  2GCL A;  2DN6 A;  1J19 A;  1V5M A;  4HAV B;  3TFM A;  2K49 A;  2Y8F A;  1WJM A;  1MK7 B;  3A8P A;  4GNK B;  2RGN B;  2Z14 A;  2P0H A;  3AU4 A;  2KCJ A;  1AWE A;  5DHA B;  4C0A A;  4CHM A;  1GC7 A;  2KIE A;  2Z0P A;  1WVH A;  2YRY A;  2ELA A;  2N23 A;  3NSU A;  5D3W A;  4GN1 A;  2L1C A;  4L1R A;  5D3V A;  1FAO A;  3B77 A;  2J0K A;  1NU2 A;  2D10 A;  2K2J A;  3TCA A;  5LON B;  1SHC A;  3SYX A;  3ZVR A;  3ULC A;  2P0D A;  2DHK A;  2DHJ A;  2GJY A;  5C5B A;  4OSN A;  3F0W A;  4KHB B;  3ML4 A;  3QWM A;  1N3H A;  3SV1 A;  2KGX B;  5D3Y A;  2P8V A;  1XR0 B;  3FVC A;  2COF A;  2IYB A;  4MY6 A;  1BWN A;  2KUP A;  2DYQ A;  2DA0 A;  2YSZ A;  1J0W A;  3FEH A;  4GMX B;  1GC6 A;  1WJ1 A;  1T77 A;  4OT1 A;  4DBB A;  4F7U P;  1LW3 A;  2Z4D A;  4KHO A;  2QKL A;  1P6S A;  2P0F A;  1WI1 A;  2I1J A;  3HW2 B;  1KI1 B;  3VIA A;  1E5W A;  1M7R A;  2D9V A;  1DRO A;  1TQZ A;  1H4R A;  3GYP A;  3DXC A;  5DIF B;  2LUL A;  2Q13 A;  5FI1 A;  1I2H A;  3NWD A;  2W2X D;  1DDW A;  4Z2M B;  3PVU A;  2J0J A;  1EAZ A;  2K00 A;  4ZRJ A;  3UZT A;  5CLQ B;  3A8Q A;  4MT7 A;  2LG1 A;  1U27 A;  3IVF A;  4DIX A;  3MPX A;  1X11 A;  1I7A A;  5J3Q A;  3HK0 A;  4HB2 B;  3RCP A;  4GMV A;  1RJ2 A;  2DYN A;  5D3X A;  2MKR A;  3KRX A;  3ZDT A;  1PMS A;  1TJ6 A;  2NZ8 B;  2RRF A;  1XX0 A;  4CSQ A;  1BAK A;  4HDO A;  3HQC A;  3G9W A;  2D11 A;  1U5E A;  3U8Z A;  1K5G B;  2DTC A;  3FSS A;  1GG3 A;  2MFQ A;  3PSC A;  4K81 A;  3OAN A;  4HDQ A;  1Y5O A;  4DXA B;  2D9Y A;  1UPQ A;  2RVB B;  2W2X C;  1FGZ A;  2DFK A; 
#chains in the Genus database with same CATH homology
 2Z0O A;  4HAY B;  1ZSQ A;  3ULB A;  4F7G A;  2ROV A;  2YT0 A;  3P7Z A;  1V5P A;  1Y19 B;  2DHI A;  1KZ7 A;  3WA0 A;  3D8D A;  2H7D A;  1FHX A;  4GPT B;  1QQG A;  2OQB A;  2XQN M;  5GOW B;  1ZC4 B;  3BIN A;  1MK9 B;  4PQ0 A;  1EGX A;  3TVV A;  4GXB A;  2COC A;  3D8E A;  2D9X A;  4KAX B;  2V76 A;  5C6R A;  1ZVR A;  4K2O A;  2PZ1 A;  3PZD A;  3O96 A;  2QKM A;  4HB3 B;  1ZC3 B;  4PNK A;  5HE2 A;  4CHJ A;  3X23 A;  1MKE A;  1WG7 A;  4EMO A;  3SUZ A;  5DI9 B;  4H8S A;  4HAW B;  3PVW A;  1TXD A;  3MDB C;  1W1G A;  2R09 A;  2Y8G A;  3T06 A;  4A6K A;  5KQ1 A;  4A6H A;  3F5R A;  1EF1 A;  2I1K A;  3CIK A;  5J3Y A;  1DBH A;  2ADZ A;  1MIZ B;  5LOP B;  5DHF B;  2Z0Q A;  5L81 A;  2MDX A;  2UVM A;  4F7H A;  2EMT A;  1V89 A;  2COA A;  2RUK B;  2LOX A;  3DXE A;  2DKQ A;  4ZRK A;  4YON A;  1U29 A;  4TKN A;  5KQ4 A;  1V88 A;  1FOE A;  1OY2 A;  2EMS A;  1V5U A;  1OMW A;  4K17 A;  2J0M A;  5DH9 B;  4EJN A;  3PEG A;  1X05 A;  2IFS A;  2FJL A;  2CAY A;  1AQC A;  5J3T A;  4IAP A;  4TYZ A;  2YVC A;  4WSF A;  1QC6 A;  3KZ1 A;  4HAZ B;  4NSW A;  2CY5 A;  4A6F B;  2K2U A;  3CXB B;  4HHV A;  5C16 A;  2GCJ A;  3GYO A;  1UNP A;  1V61 A;  2W2W A;  2M38 A;  4XWX A;  4B6H A;  2DX5 A;  1UNR A;  3ODW A;  1ISN A;  1FHW A;  2UZS A;  3KY9 A;  1FGY A;  3DXD A;  1Z87 A;  1U5G A;  4Y94 A;  4GZU A;  1Q67 A;  2DLW A;  2EJ8 A;  2D4Q A;  1P5T A;  1BTN A;  2AEH A;  1MPH A;  2COD A;  2L2I A;  4MK0 A;  3FM8 C;  2ZPY A;  3WYF B;  2X18 A;  4WJ7 A;  2D2Q A;  4EKU A;  2R0D A;  1MIX A;  1M7E A;  1WGQ A;  5C79 A;  5EFX A;  1NTV A;  1RRP B;  2DKP A;  1XCG A;  1FB8 A;  2DX1 A;  4A5K A;  1U5F A;  5HE0 A;  1NTY A;  1DDV A;  2BCJ A;  5JP4 A;  2I5C A;  4P7I A;  4K2P A;  2LOZ A;  2M14 A;  1X1G A;  1U2B A;  2HE7 A;  2Y7B A;  2YS3 A;  3TW1 A;  2I5F A;  1U5D A;  2VRW B;  2GS0 A;  3M1I B;  1PLS A;  1K5D B;  4HAU B;  1LB1 A;  4KHA A;  1B55 A;  1P3R A;  3LJU X;  3U7D A;  3V5W A;  5HE3 A;  1OQN A;  4HAX B;  2VKI A;  1W1H A;  2ELB A;  3ODX A;  3P6A A;  4HB0 B;  3VOQ A;  3N7C A;  2CY4 A;  5FI0 A;  1BTK A;  2JP2 A;  3AJ4 A;  1DYN A;  2AL6 A;  1X86 A;  2RLO A;  2YT1 A;  4HB4 B;  1XKE A;  1DDM A;  3PP2 A;  3KSY A;  4IOY X;  1UNQ A;  4YL8 A;  2J59 M;  1PFJ A;  4A6F A;  4BBK A;  1X1F A;  2HTH B;  4Z2N A;  1FHO A;  2UZR A;  5C5B B;  4DX9 0;  3A98 B;  2NMB A;  2CRF A;  1UPR A;  1ZM0 A;  4NY0 A;  5D27 A;  2EC1 A;  4KVG B;  5KCV A;  3D8F A;  3ODO A;  1NI2 A;  3SO6 A;  3PG7 A;  3PVL A;  1H10 A;  1WGU A;  1UEF A;  3KRW A;  2YS5 A;  3QIJ A;  2H7E A;  1KZG A;  1EVH A;  4HAT B;  4DX8 A;  1XD4 A;  2N0Y A;  3QBV B;  5CLL B;  2RNR B;  5JHG A;  2LKO A;  5JLJ B;  3AU5 A;  1XOD A;  2ROZ B;  2RSG A;  4WVF B;  2YF0 A;  4CYE A;  2D9W A;  4L6E A;  4ZRI A;  3BJI A;  2YS1 A;  4IFS A;  2E2X A;  2LYD A;  2VSZ A;  5HE1 A;  1W1D A;  2G35 A;  3SNH A;  2OTX A;  5JHH A;  3TO1 A;  4D0N B;  2MWN B;  1IRS A;  1MAI A;  1SGH A;  2D9Z A;  2GCL A;  2DN6 A;  1J19 A;  1V5M A;  4HAV B;  3TFM A;  2Y8F A;  1WJM A;  1MK7 B;  3A8P A;  2RGN B;  2P0H A;  3AU4 A;  2KCJ A;  1AWE A;  5DHA B;  4C0A A;  4CHM A;  1GC7 A;  2Z0P A;  1WVH A;  2YRY A;  2ELA A;  2N23 A;  3NSU A;  5D3W A;  4GN1 A;  2L1C A;  5D3V A;  1FAO A;  2J0K A;  1NU2 A;  2D10 A;  2K2J A;  3TCA A;  5LON B;  1SHC A;  3SYX A;  3ZVR A;  3ULC A;  2P0D A;  2DHK A;  2DHJ A;  2GJY A;  5C5B A;  3F0W A;  4KHB B;  3ML4 A;  3QWM A;  1N3H A;  3SV1 A;  2KGX B;  5D3Y A;  2P8V A;  1XR0 B;  2COF A;  2IYB A;  4MY6 A;  1BWN A;  2KUP A;  2DYQ A;  2DA0 A;  2YSZ A;  1J0W A;  3FEH A;  4GMX B;  1GC6 A;  1WJ1 A;  4DBB A;  4F7U P;  1LW3 A;  4KHO A;  2QKL A;  1P6S A;  2P0F A;  1WI1 A;  2I1J A;  3HW2 B;  1KI1 B;  3VIA A;  1E5W A;  1M7R A;  2D9V A;  1DRO A;  1TQZ A;  1H4R A;  3GYP A;  3DXC A;  5DIF B;  2LUL A;  2Q13 A;  5FI1 A;  1I2H A;  2W2X D;  1DDW A;  4Z2M B;  3PVU A;  2J0J A;  1EAZ A;  2K00 A;  4ZRJ A;  3UZT A;  5CLQ B;  3A8Q A;  4MT7 A;  2LG1 A;  1U27 A;  3IVF A;  3MPX A;  1X11 A;  1I7A A;  5J3Q A;  3HK0 A;  4HB2 B;  3RCP A;  4GMV A;  1RJ2 A;  2DYN A;  5D3X A;  3KRX A;  2MKR A;  3ZDT A;  1PMS A;  1TJ6 A;  2NZ8 B;  1XX0 A;  1BAK A;  4HDO A;  3HQC A;  3G9W A;  2D11 A;  1U5E A;  3U8Z A;  1K5G B;  2DTC A;  3FSS A;  1GG3 A;  2MFQ A;  2DFK A;  4K81 A;  3OAN A;  4HDQ A;  1Y5O A;  4DXA B;  2D9Y A;  1UPQ A;  2RVB B;  2W2X C;  1FGZ A;  3PSC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...