2COAA

Solution structure of the ph domain of protein kinase c, d2 type from human
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
125
structure length
125
Chain Sequence
GSSGSSGTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQALMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of protein kinase C, D2 type from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Protein kinase C, D2 type
total genus 15
structure length 125
sequence length 125
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2coaA01
1EGXA 1NTYA 3FSSA 3TFMA 4EJNA 1OY2A 1MK7B 2H7EA 2K2JA 4HATB 3D8EA 3SUZA 3OANA 1RJ2A 3M1IB 1DROA 2YSZA 3U7DA 1DBHA 2DKQA 2J0JA 4HB2B 3PZDA 2RLOA 2CY4A 4HAXB 1IRSA 4HB4B 4YL8A 2D9VA 1ZC3B 2LKOA 2DHIA 4CHJA 1Y19B 4F7UP 2HTHB 2YS1A 4L6EA 3BINA 2Z0PA 3O96A 1M7RA 2YS5A 2D10A 1WVHA 1FGZA 4DXAB 1DDWA 2H7DA 2Z0QA 5HE0A 2D9XA 1DYNA 3BJIA 3ODOA 2I5CA 2YT1A 1DDMA 5KQ1A 2I1KA 1UNPA 5KCVA 4A6FB 5FI1A 2QKMA 5C16A 4XWXA 3KZ1A 3G9WA 2CRFA 4GMXB 1FHXA 2LYDA 1NU2A 1EAZA 2GJYA 1K5GB 1H4RA 4HAZB 1WGUA 2L2IA 3NSUA 1X86A 2CODA 2DHJA 2K2UA 5J3TA 2IFSA 1EVHA 3ML4A 3U8ZA 1UNRA 3WYFB 1BAKA 2XQNM 1PMSA 3DXEA 1MPHA 1NI2A 1M7EA 2P8VA 4GMVA 4K2OA 1H10A 1ISNA 4WJ7A 5KQ4A 1X11A 2AEHA 2RSGA 4NY0A 2DYQA 5D3XA 1Y5OA 1FB8A 3FM8C 1TXDA 2VKIA 2K00A 2OQBA 1UPRA 2D2QA 3PVLA 1FHOA 2LULA 4K17A 2NMBA 5JHHA 2P0FA 2HE7A 2M14A 2YS3A 1AWEA 1V61A 2Y7BA 1EF1A 3PG7A 3SYXA 1U2BA 1FOEA 2YT0A 3ULBA 4HAUB 2RNRB 5DH9B 1Z87A 1W1DA 1XKEA 5JP4A 1WGQA 3WA0A 3QBVB 4HAVB 2LOXA 2N0YA 5HE1A 3CXBB 1MK9B 1ZVRA 2QKLA 2ADZA 4HDQA 2LG1A 2G35A 2DX1A 5C5BB 4HB0B 4Z2MB 1XODA 2E2XA 2DKPA 5C5BA 2GS0A 1XCGA 2W2XD 2MKRA 3A8PA 1B55A 3KRWA 1WJMA 1U5FA 2ROVA 3SO6A 2DHKA 2J0KA 4KVGB 4PQ0A 2D9ZA 3TCAA 1KI1B 1FAOA 3MDBC 2GCJA 1KZGA 1XD4A 2RUKB 3ODXA 4WVFB 3FEHA 2MFQA 2UZRA 2DX5A 1UPQA 1DDVA 4GPTB 5D3YA 5CLLB 2BCJA 2ZPYA 1BWNA 1WI1A 3IVFA 4KAXB 3KRXA 4BBKA 1OQNA 4A6HA 1U27A 2VSZA 1TQZA 1AQCA 1ZM0A 3GYOA 4DBBA 4KHBB 5J3QA 5FI0A 2M38A 2EC1A 1V88A 5HE2A 1BTNA 3X23A 3AJ4A 3HK0A 3QWMA 3TO1A 2COAA 1FHWA 3CIKA 4HDOA 2DYNA 5DHAB 2CY5A 2ELBA 1U5EA 2FJLA 2IYBA 3ODWA 2DA0A 1FGYA 1BTKA 4P7IA 5JLJB 2D11A 3DXCA 3QIJA 2L1CA 4HAYB 1TJ6A 3KY9A 3PVUA 4TYZA 4GN1A 1X1GA 5J3YA 4TKNA 2OTXA 2UVMA 4MT7A 3TVVA 2COCA 3ULCA 1W1GA 2YVCA 2YRYA 4GZUA 1P5TA 2YF0A 1U5DA 1ZC4B 1N3HA 3N7CA 1UEFA 1KZ7A 1GC6A 3DXDA 4A6KA 1J0WA 2GCLA 4IOYX 1QQGA 2VRWB 5C79A 5D27A 1GG3A 1MAIA 2I5FA 3HW2B 2KCJA 1GC7A 4CYEA 4KHOA 3GYPA 1WG7A 5DIFB 4HHVA 4F7HA 2ELAA 1J19A 2KUPA 1P6SA 2Q13A 1X1FA 1U29A 3UZTA 5C6RA 2CAYA 5D3VA 4NSWA 1U5GA 3F5RA 5DHFB 1OMWA 1K5DB 1QC6A 4Y94A 5EFXA 1RRPB 3RCPA 1E5WA 3D8FA 3ZDTA 2Y8GA 2MWNB 2AL6A 4WSFA 4DX8A 1Q67A 3HQCA 3P6AA 5LOPB 1SHCA 1W1HA 2DTCA 3V5WA 4Z2NA 1PFJA 1SGHA 2ROZB 1NTVA 2J0MA 2P0HA 3A8QA 3D8DA 2KGXB 4A5KA 5DI9B 4MY6A 2V76A 3AU5A 1PLSA 1UNQA 1V5PA 5GOWB 2D9WA 3PEGA 2RVBB 2UZSA 1X05A 2W2WA 3SNHA 5HE3A 4EKUA 2I1JA 1WJ1A 3LJUX 2Z0OA 1I7AA 2COFA 4GXBA 2DLWA 1MIZB 1MKEA 2W2XC 2D9YA 5L81A 3PSCA 1LB1A 4EMOA 4MK0A 4K2PA 2N23A 3P7ZA 3KSYA 4HAWB 4ZRIA 3PVWA 2EJ8A 4A6FA 2X18A 5LONB 3VIAA 1XR0B 1I2HA 2JP2A 2PZ1A 3MPXA 4F7GA 2R0DA 4IAPA 4B6HA 2DN6A 2P0DA 4PNKA 2EMSA 2NZ8B 4YONA 3SV1A 1V5UA 2Y8FA 5CLQB 3PP2A 3A98B 3T06A 5D3WA 4ZRJA 1ZSQA 3TW1A 2LOZA 2EMTA 4CHMA 1V5MA 2RGNB 4DX90 2J59M 2R09A 1V89A 4ZRKA 4K81A 1MIXA 1LW3A 4HB3B 4D0NB 2MDXA 4H8SA 3VOQA 1XX0A 2DFKA 3F0WA 4IFSA 1P3RA 3AU4A 2D4QA 4C0AA 5JHGA 3ZVRA 4KHAA
chains in the Genus database with same CATH superfamily
2KIGA 3A58A 1EGXA 1NTYA 2Z59A 3FSSA 3TFMA 4EJNA 1OY2A 1MK7B 2H7EA 2K2JA 4HATB 3D8EA 3SUZA 2FJUB 3OANA 1RJ2A 2Z4DA 3M1IB 1DROA 2YSZA 4QJ3B 3U7DA 1DBHA 2DKQA 2J0JA 4HB2B 3PZDA 2RLOA 2CY4A 4HAXB 1IRSA 4HB4B 4YL8A 2D9VA 1ZC3B 4KHBA 2LKOA 2DHIA 4CHJA 1Y19B 4F7UP 2HTHB 2YS1A 4L6EA 3BINA 2Z0PA 3O96A 1M7RA 2YS5A 2D10A 1WVHA 1FGZA 2K49A 4DXAB 1DDWA 2H7DA 2Z0QA 5HE0A 2R2YA 2D9XA 1DYNA 3BJIA 3ODOA 2I5CA 2YT1A 1DDMA 5KQ1A 2I1KA 1UNPA 5KCVA 4A6FB 5FI1A 2QKMA 5C16A 4XWXA 3KZ1A 3G9WA 2CRFA 4GMXB 1FHXA 2LYDA 1NU2A 1EAZA 2GJYA 1K5GB 1H4RA 4HAZB 1WGUA 2L2IA 3NSUA 5IRSA 1X86A 2CODA 2DHJA 2K2UA 5J3TA 2IFSA 1EVHA 3ML4A 3U8ZA 1UNRA 3WYFB 1BAKA 2XQNM 1PMSA 3DXEA 1MPHA 1NI2A 1M7EA 2P8VA 4GMVA 4K2OA 1H10A 1ISNA 4WJ7A 4GNKB 5KQ4A 1X11A 2AEHA 2RSGA 2RRFA 2DYQA 4NY0A 5D3XA 1Y5OA 1FB8A 3FM8C 1TXDA 2VKIA 2K00A 3NWFA 2OQBA 1UPRA 2D2QA 3PVLA 1FHOA 2LULA 4K17A 2NMBA 5JHHA 2P0FA 2HE7A 2M14A 2YS3A 1AWEA 1V61A 2Y7BA 3U12A 1EF1A 3PG7A 3SYXA 1U2BA 1FOEA 2YT0A 3ULBA 4HAUB 3NWAA 2RNRB 5DH9B 1Z87A 1W1DA 1XKEA 5JP4A 2KUQA 1WGQA 3WA0A 3QBVB 4HAVB 3FVCA 2LOXA 2N0YA 5HE1A 3CXBB 1MK9B 1ZVRA 2QKLA 2ADZA 4HDQA 2LG1A 2G35A 2DX1A 5C5BB 4HB0B 4Z2MB 1XODA 2E2XA 2DKPA 5C5BA 4OT1A 2GS0A 1XCGA 2W2XD 2MKRA 3DCXA 3A8PA 1B55A 3KRWA 1WJMA 1U5FA 2ROVA 3SO6A 2DHKA 2J0KA 4KVGB 4PQ0A 2D9ZA 3TCAA 1KI1B 1FAOA 3MDBC 2GCJA 1KZGA 1XD4A 2RUKB 3ODXA 4WVFB 3FEHA 2MFQA 2UZRA 2DX5A 4L1RA 1UPQA 1DDVA 4GPTB 5D3YA 5CLLB 2BCJA 2ZPYA 1BWNA 1WI1A 3IVFA 4KAXB 3KRXA 4BBKA 1OQNA 4A6HA 1U27A 2VSZA 1TQZA 1AQCA 1ZM0A 3GYOA 4DBBA 4KHBB 4D6WA 5J3QA 2GUMA 5FI0A 2M38A 2EC1A 3NWDA 1V88A 5HE2A 1BTNA 3X23A 3AJ4A 3HK0A 3QWMA 3TO1A 2COAA 1FHWA 3CIKA 4HDOA 2DYNA 5DHAB 2CY5A 2ELBA 1U5EA 2FJLA 2IYBA 3ODWA 2DA0A 1FGYA 1BTKA 4P7IA 5JLJB 2D11A 3DXCA 3QIJA 2L1CA 2ZKMX 4HAYB 1TJ6A 3KY9A 3PVUA 4TYZA 4GN1A 1X1GA 5J3YA 2YT2A 2OTXA 4TKNA 2UVMA 4MT7A 3TVVA 2COCA 3ULCA 1W1GA 2YVCA 5M4YB 2YRYA 4GZUA 1P5TA 2YF0A 1U5DA 1ZC4B 1N3HA 3N7CA 1UEFA 1KZ7A 1GC6A 3DXDA 4A6KA 1J0WA 2GCLA 4IOYX 1QQGA 3NW8A 2VRWB 5C79A 5D27A 1GG3A 1MAIA 2I5FA 3HW2B 2KCJA 1GC7A 4CYEA 5I2MA 4KHOA 3GYPA 1WG7A 5DIFB 4HHVA 4F7HA 2ELAA 4OSNA 1J19A 2KUPA 1P6SA 2Q13A 1X1FA 1U29A 3UZTA 5C6RA 2CAYA 5D3VA 4NSWA 2Z14A 1U5GA 3F5RA 5DHFB 1OMWA 1K5DB 1QC6A 4QXAB 4Y94A 5EFXA 1RRPB 3RCPA 1E5WA 3D8FA 3ZDTA 2Y8GA 2MWNB 2AL6A 4WSFA 4DX8A 1Q67A 3HQCA 3P6AA 5LOPB 1SHCA 1W1HA 2DTCA 3V5WA 4Z2NA 1PFJA 1SGHA 2ROZB 1NTVA 2J0MA 2P0HA 3D8DA 3A8QA 3B77A 2NBVA 2KGXB 2KR0A 4GOUA 3OHMB 4A5KA 5DI9B 4DIXA 5I2SA 4MY6A 2V76A 3AU5A 1PLSA 1UNQA 1V5PA 3HSAA 5GOWB 2D9WA 3PEGA 2RVBB 2UZSA 1X05A 2W2WA 3SNHA 5HE3A 5LG4B 3HIEA 4EKUA 2Z13A 2I1JA 1MI1A 1WJ1A 3LJUX 2Z0OA 1ZYIA 1I7AA 2COFA 4GXBA 4CSQA 2DLWA 1MIZB 1MKEA 2W2XC 2D9YA 4QJ5B 5L81A 3PSCA 1LB1A 4EMOA 4MK0A 4K2PA 2N23A 3P7ZA 3KSYA 4HAWB 4ZRIA 3PVWA 2EJ8A 4A6FA 2X18A 5LONB 3VIAA 1XR0B 1I2HA 2JP2A 2PZ1A 2KIEA 3MPXA 4F7GA 2R0DA 4IAPA 4B6HA 2DN6A 2P0DA 4PNKA 2EMSA 4QJ4B 2NZ8B 4YONA 3SV1A 1V5UA 2Y8FA 5CLQB 3PP2A 3A98B 3T06A 5D3WA 4ZRJA 1ZSQA 3TW1A 2LOZA 2EMTA 4HSIA 4CHMA 1V5MA 2RGNB 4DX90 2J59M 2R09A 1V89A 4ZRKA 2K8EA 4K81A 1MIXA 1LW3A 4HB3B 4D0NB 2MDXA 4H8SA 3VOQA 1XX0A 2DFKA 3F0WA 1T77A 1P3RA 3AU4A 4IFSA 2D4QA 4C0AA 5JHGA 3ZVRA 4KHAA
chains in the Genus database with same CATH topology
1EGXA 1NTYA 3FSSA 3TFMA 4EJNA 1OY2A 1MK7B 2H7EA 2K2JA 4HATB 3D8EA 3SUZA 3OANA 1RJ2A 3M1IB 1DROA 2YSZA 3U7DA 1DBHA 2DKQA 2J0JA 4HB2B 3PZDA 2RLOA 2CY4A 4HAXB 1IRSA 4HB4B 4YL8A 2D9VA 1ZC3B 2LKOA 2DHIA 4CHJA 1Y19B 4F7UP 2HTHB 2YS1A 4L6EA 3BINA 2Z0PA 3O96A 1M7RA 2YS5A 2D10A 1WVHA 1FGZA 4DXAB 1DDWA 2H7DA 2Z0QA 5HE0A 2D9XA 1DYNA 3BJIA 3ODOA 2I5CA 2YT1A 1DDMA 5KQ1A 2I1KA 1UNPA 5KCVA 4A6FB 5FI1A 2QKMA 5C16A 4XWXA 3KZ1A 3G9WA 2CRFA 4GMXB 1FHXA 2LYDA 1NU2A 1EAZA 2GJYA 1K5GB 1H4RA 4HAZB 1WGUA 2L2IA 3NSUA 1X86A 2CODA 2DHJA 2K2UA 5J3TA 2IFSA 1EVHA 3ML4A 3U8ZA 1UNRA 3WYFB 1BAKA 2XQNM 1PMSA 3DXEA 1MPHA 1NI2A 1M7EA 2P8VA 4GMVA 4K2OA 1H10A 1ISNA 4WJ7A 5KQ4A 1X11A 2AEHA 2RSGA 4NY0A 2DYQA 5D3XA 1Y5OA 1FB8A 3FM8C 1TXDA 2VKIA 2K00A 2OQBA 1UPRA 2D2QA 3PVLA 1FHOA 2LULA 4K17A 2NMBA 5JHHA 2P0FA 2HE7A 2M14A 2YS3A 1AWEA 1V61A 2Y7BA 1EF1A 3PG7A 3SYXA 1U2BA 1FOEA 2YT0A 3ULBA 4HAUB 2RNRB 5DH9B 1Z87A 1W1DA 1XKEA 5JP4A 1WGQA 3WA0A 3QBVB 4HAVB 2LOXA 2N0YA 5HE1A 3CXBB 1MK9B 1ZVRA 2QKLA 2ADZA 4HDQA 2LG1A 2G35A 2DX1A 5C5BB 4HB0B 4Z2MB 1XODA 2E2XA 2DKPA 5C5BA 2GS0A 1XCGA 2W2XD 2MKRA 3A8PA 1B55A 3KRWA 1WJMA 1U5FA 2ROVA 3SO6A 2DHKA 2J0KA 4KVGB 4PQ0A 2D9ZA 3TCAA 1KI1B 1FAOA 3MDBC 2GCJA 1KZGA 1XD4A 2RUKB 3ODXA 4WVFB 3FEHA 2MFQA 2UZRA 2DX5A 1UPQA 1DDVA 4GPTB 5D3YA 5CLLB 2BCJA 2ZPYA 1BWNA 1WI1A 3IVFA 4KAXB 3KRXA 4BBKA 1OQNA 4A6HA 1U27A 2VSZA 1TQZA 1AQCA 1ZM0A 3GYOA 4DBBA 4KHBB 5J3QA 5FI0A 2M38A 2EC1A 1V88A 5HE2A 1BTNA 3X23A 3AJ4A 3HK0A 3QWMA 3TO1A 2COAA 1FHWA 3CIKA 4HDOA 2DYNA 5DHAB 2CY5A 2ELBA 1U5EA 2FJLA 2IYBA 3ODWA 2DA0A 1FGYA 1BTKA 4P7IA 5JLJB 2D11A 3DXCA 3QIJA 2L1CA 4HAYB 1TJ6A 3KY9A 3PVUA 4TYZA 4GN1A 1X1GA 5J3YA 4TKNA 2OTXA 2UVMA 4MT7A 3TVVA 2COCA 3ULCA 1W1GA 2YVCA 2YRYA 4GZUA 1P5TA 2YF0A 1U5DA 1ZC4B 1N3HA 3N7CA 1UEFA 1KZ7A 1GC6A 3DXDA 4A6KA 1J0WA 2GCLA 4IOYX 1QQGA 2VRWB 5C79A 5D27A 1GG3A 1MAIA 2I5FA 3HW2B 2KCJA 1GC7A 4CYEA 4KHOA 3GYPA 1WG7A 5DIFB 4HHVA 4F7HA 2ELAA 1J19A 2KUPA 1P6SA 2Q13A 1X1FA 1U29A 3UZTA 5C6RA 2CAYA 5D3VA 4NSWA 1U5GA 3F5RA 5DHFB 1OMWA 1K5DB 1QC6A 4Y94A 5EFXA 1RRPB 3RCPA 1E5WA 3D8FA 3ZDTA 2Y8GA 2MWNB 2AL6A 4WSFA 4DX8A 1Q67A 3HQCA 3P6AA 5LOPB 1SHCA 1W1HA 2DTCA 3V5WA 4Z2NA 1PFJA 1SGHA 2ROZB 1NTVA 2J0MA 2P0HA 3A8QA 3D8DA 2KGXB 4A5KA 5DI9B 4MY6A 2V76A 3AU5A 1PLSA 1UNQA 1V5PA 5GOWB 2D9WA 3PEGA 2RVBB 2UZSA 1X05A 2W2WA 3SNHA 5HE3A 4EKUA 2I1JA 1WJ1A 3LJUX 2Z0OA 1I7AA 2COFA 4GXBA 2DLWA 1MIZB 1MKEA 2W2XC 2D9YA 5L81A 3PSCA 1LB1A 4EMOA 4MK0A 4K2PA 2N23A 3P7ZA 3KSYA 4HAWB 4ZRIA 3PVWA 2EJ8A 4A6FA 2X18A 5LONB 3VIAA 1XR0B 1I2HA 2JP2A 2PZ1A 3MPXA 4F7GA 2R0DA 4IAPA 4B6HA 2DN6A 2P0DA 4PNKA 2EMSA 2NZ8B 4YONA 3SV1A 1V5UA 2Y8FA 5CLQB 3PP2A 3A98B 3T06A 5D3WA 4ZRJA 1ZSQA 3TW1A 2LOZA 2EMTA 4CHMA 1V5MA 2RGNB 4DX90 2J59M 2R09A 1V89A 4ZRKA 4K81A 1MIXA 1LW3A 4HB3B 4D0NB 2MDXA 4H8SA 3VOQA 1XX0A 2DFKA 3F0WA 4IFSA 1P3RA 3AU4A 2D4QA 4C0AA 5JHGA 3ZVRA 4KHAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EGX A;  1NTY A;  3FSS A;  3TFM A;  4EJN A;  1OY2 A;  1MK7 B;  2H7E A;  2K2J A;  4HAT B;  3D8E A;  3SUZ A;  3OAN A;  1RJ2 A;  3M1I B;  1DRO A;  2YSZ A;  3U7D A;  1DBH A;  2DKQ A;  2J0J A;  4HB2 B;  3PZD A;  2RLO A;  2CY4 A;  4HAX B;  1IRS A;  4HB4 B;  4YL8 A;  2D9V A;  1ZC3 B;  2LKO A;  2DHI A;  4CHJ A;  1Y19 B;  4F7U P;  2HTH B;  2YS1 A;  4L6E A;  3BIN A;  2Z0P A;  3O96 A;  1M7R A;  2YS5 A;  2D10 A;  1WVH A;  1FGZ A;  4DXA B;  1DDW A;  2H7D A;  2Z0Q A;  5HE0 A;  2D9X A;  1DYN A;  3BJI A;  3ODO A;  2I5C A;  2YT1 A;  1DDM A;  5KQ1 A;  2I1K A;  1UNP A;  5KCV A;  4A6F B;  5FI1 A;  2QKM A;  5C16 A;  4XWX A;  3KZ1 A;  3G9W A;  2CRF A;  4GMX B;  1FHX A;  2LYD A;  1NU2 A;  1EAZ A;  2GJY A;  1K5G B;  1H4R A;  4HAZ B;  1WGU A;  2L2I A;  3NSU A;  1X86 A;  2COD A;  2DHJ A;  2K2U A;  5J3T A;  2IFS A;  1EVH A;  3ML4 A;  3U8Z A;  1UNR A;  3WYF B;  1BAK A;  2XQN M;  1PMS A;  3DXE A;  1MPH A;  1NI2 A;  1M7E A;  2P8V A;  4GMV A;  4K2O A;  1H10 A;  1ISN A;  4WJ7 A;  5KQ4 A;  1X11 A;  2AEH A;  2RSG A;  4NY0 A;  2DYQ A;  5D3X A;  1Y5O A;  1FB8 A;  3FM8 C;  1TXD A;  2VKI A;  2K00 A;  2OQB A;  1UPR A;  2D2Q A;  3PVL A;  1FHO A;  2LUL A;  4K17 A;  2NMB A;  5JHH A;  2P0F A;  2HE7 A;  2M14 A;  2YS3 A;  1AWE A;  1V61 A;  2Y7B A;  1EF1 A;  3PG7 A;  3SYX A;  1U2B A;  1FOE A;  2YT0 A;  3ULB A;  4HAU B;  2RNR B;  5DH9 B;  1Z87 A;  1W1D A;  1XKE A;  5JP4 A;  1WGQ A;  3WA0 A;  3QBV B;  4HAV B;  2LOX A;  2N0Y A;  5HE1 A;  3CXB B;  1MK9 B;  1ZVR A;  2QKL A;  2ADZ A;  4HDQ A;  2LG1 A;  2G35 A;  2DX1 A;  5C5B B;  4HB0 B;  4Z2M B;  1XOD A;  2E2X A;  2DKP A;  5C5B A;  2GS0 A;  1XCG A;  2W2X D;  2MKR A;  3A8P A;  1B55 A;  3KRW A;  1WJM A;  1U5F A;  2ROV A;  3SO6 A;  2DHK A;  2J0K A;  4KVG B;  4PQ0 A;  2D9Z A;  3TCA A;  1KI1 B;  1FAO A;  3MDB C;  2GCJ A;  1KZG A;  1XD4 A;  2RUK B;  3ODX A;  4WVF B;  3FEH A;  2MFQ A;  2UZR A;  2DX5 A;  1UPQ A;  1DDV A;  4GPT B;  5D3Y A;  5CLL B;  2BCJ A;  2ZPY A;  1BWN A;  1WI1 A;  3IVF A;  4KAX B;  3KRX A;  4BBK A;  1OQN A;  4A6H A;  1U27 A;  2VSZ A;  1TQZ A;  1AQC A;  1ZM0 A;  3GYO A;  4DBB A;  4KHB B;  5J3Q A;  5FI0 A;  2M38 A;  2EC1 A;  1V88 A;  5HE2 A;  1BTN A;  3X23 A;  3AJ4 A;  3HK0 A;  3QWM A;  3TO1 A;  2COA A;  1FHW A;  3CIK A;  4HDO A;  2DYN A;  5DHA B;  2CY5 A;  2ELB A;  1U5E A;  2FJL A;  2IYB A;  3ODW A;  2DA0 A;  1FGY A;  1BTK A;  4P7I A;  5JLJ B;  2D11 A;  3DXC A;  3QIJ A;  2L1C A;  4HAY B;  1TJ6 A;  3KY9 A;  3PVU A;  4TYZ A;  4GN1 A;  1X1G A;  5J3Y A;  4TKN A;  2OTX A;  2UVM A;  4MT7 A;  3TVV A;  2COC A;  3ULC A;  1W1G A;  2YVC A;  2YRY A;  4GZU A;  1P5T A;  2YF0 A;  1U5D A;  1ZC4 B;  1N3H A;  3N7C A;  1UEF A;  1KZ7 A;  1GC6 A;  3DXD A;  4A6K A;  1J0W A;  2GCL A;  4IOY X;  1QQG A;  2VRW B;  5C79 A;  5D27 A;  1GG3 A;  1MAI A;  2I5F A;  3HW2 B;  2KCJ A;  1GC7 A;  4CYE A;  4KHO A;  3GYP A;  1WG7 A;  5DIF B;  4HHV A;  4F7H A;  2ELA A;  1J19 A;  2KUP A;  1P6S A;  2Q13 A;  1X1F A;  1U29 A;  3UZT A;  5C6R A;  2CAY A;  5D3V A;  4NSW A;  1U5G A;  3F5R A;  5DHF B;  1OMW A;  1K5D B;  1QC6 A;  4Y94 A;  5EFX A;  1RRP B;  3RCP A;  1E5W A;  3D8F A;  3ZDT A;  2Y8G A;  2MWN B;  2AL6 A;  4WSF A;  4DX8 A;  1Q67 A;  3HQC A;  3P6A A;  5LOP B;  1SHC A;  1W1H A;  2DTC A;  3V5W A;  4Z2N A;  1PFJ A;  1SGH A;  2ROZ B;  1NTV A;  2J0M A;  2P0H A;  3A8Q A;  3D8D A;  2KGX B;  4A5K A;  5DI9 B;  4MY6 A;  2V76 A;  3AU5 A;  1PLS A;  1UNQ A;  1V5P A;  5GOW B;  2D9W A;  3PEG A;  2RVB B;  2UZS A;  1X05 A;  2W2W A;  3SNH A;  5HE3 A;  4EKU A;  2I1J A;  1WJ1 A;  3LJU X;  2Z0O A;  1I7A A;  2COF A;  4GXB A;  2DLW A;  1MIZ B;  1MKE A;  2W2X C;  2D9Y A;  5L81 A;  3PSC A;  1LB1 A;  4EMO A;  4MK0 A;  4K2P A;  2N23 A;  3P7Z A;  3KSY A;  4HAW B;  4ZRI A;  3PVW A;  2EJ8 A;  4A6F A;  2X18 A;  5LON B;  3VIA A;  1XR0 B;  1I2H A;  2JP2 A;  2PZ1 A;  3MPX A;  4F7G A;  2R0D A;  4IAP A;  4B6H A;  2DN6 A;  2P0D A;  4PNK A;  2EMS A;  2NZ8 B;  4YON A;  3SV1 A;  1V5U A;  2Y8F A;  5CLQ B;  3PP2 A;  3A98 B;  3T06 A;  5D3W A;  4ZRJ A;  1ZSQ A;  3TW1 A;  2LOZ A;  2EMT A;  4CHM A;  1V5M A;  2RGN B;  4DX9 0;  2J59 M;  2R09 A;  1V89 A;  4ZRK A;  4K81 A;  1MIX A;  1LW3 A;  4HB3 B;  4D0N B;  2MDX A;  4H8S A;  3VOQ A;  1XX0 A;  2DFK A;  3F0W A;  4IFS A;  1P3R A;  3AU4 A;  2D4Q A;  4C0A A;  5JHG A;  3ZVR A;  4KHA A; 
#chains in the Genus database with same CATH topology
 2KIG A;  3A58 A;  1EGX A;  1NTY A;  2Z59 A;  3FSS A;  3TFM A;  4EJN A;  1OY2 A;  1MK7 B;  2H7E A;  2K2J A;  4HAT B;  3D8E A;  3SUZ A;  2FJU B;  3OAN A;  1RJ2 A;  2Z4D A;  3M1I B;  1DRO A;  2YSZ A;  4QJ3 B;  3U7D A;  1DBH A;  2DKQ A;  2J0J A;  4HB2 B;  3PZD A;  2RLO A;  2CY4 A;  4HAX B;  1IRS A;  4HB4 B;  4YL8 A;  2D9V A;  1ZC3 B;  4KHB A;  2LKO A;  2DHI A;  4CHJ A;  1Y19 B;  4F7U P;  2HTH B;  2YS1 A;  4L6E A;  3BIN A;  2Z0P A;  3O96 A;  1M7R A;  2YS5 A;  2D10 A;  1WVH A;  1FGZ A;  2K49 A;  4DXA B;  1DDW A;  2H7D A;  2Z0Q A;  5HE0 A;  2R2Y A;  2D9X A;  1DYN A;  3BJI A;  3ODO A;  2I5C A;  2YT1 A;  1DDM A;  5KQ1 A;  2I1K A;  1UNP A;  5KCV A;  4A6F B;  5FI1 A;  2QKM A;  5C16 A;  4XWX A;  3KZ1 A;  3G9W A;  2CRF A;  4GMX B;  1FHX A;  2LYD A;  1NU2 A;  1EAZ A;  2GJY A;  1K5G B;  1H4R A;  4HAZ B;  1WGU A;  2L2I A;  3NSU A;  5IRS A;  1X86 A;  2COD A;  2DHJ A;  2K2U A;  5J3T A;  2IFS A;  1EVH A;  3ML4 A;  3U8Z A;  1UNR A;  3WYF B;  1BAK A;  2XQN M;  1PMS A;  3DXE A;  1MPH A;  1NI2 A;  1M7E A;  2P8V A;  4GMV A;  4K2O A;  1H10 A;  1ISN A;  4WJ7 A;  4GNK B;  5KQ4 A;  1X11 A;  2AEH A;  2RSG A;  2RRF A;  2DYQ A;  4NY0 A;  5D3X A;  1Y5O A;  1FB8 A;  3FM8 C;  1TXD A;  2VKI A;  2K00 A;  3NWF A;  2OQB A;  1UPR A;  2D2Q A;  3PVL A;  1FHO A;  2LUL A;  4K17 A;  2NMB A;  5JHH A;  2P0F A;  2HE7 A;  2M14 A;  2YS3 A;  1AWE A;  1V61 A;  2Y7B A;  3U12 A;  1EF1 A;  3PG7 A;  3SYX A;  1U2B A;  1FOE A;  2YT0 A;  3ULB A;  4HAU B;  3NWA A;  2RNR B;  5DH9 B;  1Z87 A;  1W1D A;  1XKE A;  5JP4 A;  2KUQ A;  1WGQ A;  3WA0 A;  3QBV B;  4HAV B;  3FVC A;  2LOX A;  2N0Y A;  5HE1 A;  3CXB B;  1MK9 B;  1ZVR A;  2QKL A;  2ADZ A;  4HDQ A;  2LG1 A;  2G35 A;  2DX1 A;  5C5B B;  4HB0 B;  4Z2M B;  1XOD A;  2E2X A;  2DKP A;  5C5B A;  4OT1 A;  2GS0 A;  1XCG A;  2W2X D;  2MKR A;  3DCX A;  3A8P A;  1B55 A;  3KRW A;  1WJM A;  1U5F A;  2ROV A;  3SO6 A;  2DHK A;  2J0K A;  4KVG B;  4PQ0 A;  2D9Z A;  3TCA A;  1KI1 B;  1FAO A;  3MDB C;  2GCJ A;  1KZG A;  1XD4 A;  2RUK B;  3ODX A;  4WVF B;  3FEH A;  2MFQ A;  2UZR A;  2DX5 A;  4L1R A;  1UPQ A;  1DDV A;  4GPT B;  5D3Y A;  5CLL B;  2BCJ A;  2ZPY A;  1BWN A;  1WI1 A;  3IVF A;  4KAX B;  3KRX A;  4BBK A;  1OQN A;  4A6H A;  1U27 A;  2VSZ A;  1TQZ A;  1AQC A;  1ZM0 A;  3GYO A;  4DBB A;  4KHB B;  4D6W A;  5J3Q A;  2GUM A;  5FI0 A;  2M38 A;  2EC1 A;  3NWD A;  1V88 A;  5HE2 A;  1BTN A;  3X23 A;  3AJ4 A;  3HK0 A;  3QWM A;  3TO1 A;  2COA A;  1FHW A;  3CIK A;  4HDO A;  2DYN A;  5DHA B;  2CY5 A;  2ELB A;  1U5E A;  2FJL A;  2IYB A;  3ODW A;  2DA0 A;  1FGY A;  1BTK A;  4P7I A;  5JLJ B;  2D11 A;  3DXC A;  3QIJ A;  2L1C A;  2ZKM X;  4HAY B;  1TJ6 A;  3KY9 A;  3PVU A;  4TYZ A;  4GN1 A;  1X1G A;  5J3Y A;  2YT2 A;  2OTX A;  4TKN A;  2UVM A;  4MT7 A;  3TVV A;  2COC A;  3ULC A;  1W1G A;  2YVC A;  5M4Y B;  2YRY A;  4GZU A;  1P5T A;  2YF0 A;  1U5D A;  1ZC4 B;  1N3H A;  3N7C A;  1UEF A;  1KZ7 A;  1GC6 A;  3DXD A;  4A6K A;  1J0W A;  2GCL A;  4IOY X;  1QQG A;  3NW8 A;  2VRW B;  5C79 A;  5D27 A;  1GG3 A;  1MAI A;  2I5F A;  3HW2 B;  2KCJ A;  1GC7 A;  4CYE A;  5I2M A;  4KHO A;  3GYP A;  1WG7 A;  5DIF B;  4HHV A;  4F7H A;  2ELA A;  4OSN A;  1J19 A;  2KUP A;  1P6S A;  2Q13 A;  1X1F A;  1U29 A;  3UZT A;  5C6R A;  2CAY A;  5D3V A;  4NSW A;  2Z14 A;  1U5G A;  3F5R A;  5DHF B;  1OMW A;  1K5D B;  1QC6 A;  4QXA B;  4Y94 A;  5EFX A;  1RRP B;  3RCP A;  1E5W A;  3D8F A;  3ZDT A;  2Y8G A;  2MWN B;  2AL6 A;  4WSF A;  4DX8 A;  1Q67 A;  3HQC A;  3P6A A;  5LOP B;  1SHC A;  1W1H A;  2DTC A;  3V5W A;  4Z2N A;  1PFJ A;  1SGH A;  2ROZ B;  1NTV A;  2J0M A;  2P0H A;  3D8D A;  3A8Q A;  3B77 A;  2NBV A;  2KGX B;  2KR0 A;  4GOU A;  3OHM B;  4A5K A;  5DI9 B;  4DIX A;  5I2S A;  4MY6 A;  2V76 A;  3AU5 A;  1PLS A;  1UNQ A;  1V5P A;  3HSA A;  5GOW B;  2D9W A;  3PEG A;  2RVB B;  2UZS A;  1X05 A;  2W2W A;  3SNH A;  5HE3 A;  5LG4 B;  3HIE A;  4EKU A;  2Z13 A;  2I1J A;  1MI1 A;  1WJ1 A;  3LJU X;  2Z0O A;  1ZYI A;  1I7A A;  2COF A;  4GXB A;  4CSQ A;  2DLW A;  1MIZ B;  1MKE A;  2W2X C;  2D9Y A;  4QJ5 B;  5L81 A;  3PSC A;  1LB1 A;  4EMO A;  4MK0 A;  4K2P A;  2N23 A;  3P7Z A;  3KSY A;  4HAW B;  4ZRI A;  3PVW A;  2EJ8 A;  4A6F A;  2X18 A;  5LON B;  3VIA A;  1XR0 B;  1I2H A;  2JP2 A;  2PZ1 A;  2KIE A;  3MPX A;  4F7G A;  2R0D A;  4IAP A;  4B6H A;  2DN6 A;  2P0D A;  4PNK A;  2EMS A;  4QJ4 B;  2NZ8 B;  4YON A;  3SV1 A;  1V5U A;  2Y8F A;  5CLQ B;  3PP2 A;  3A98 B;  3T06 A;  5D3W A;  4ZRJ A;  1ZSQ A;  3TW1 A;  2LOZ A;  2EMT A;  4HSI A;  4CHM A;  1V5M A;  2RGN B;  4DX9 0;  2J59 M;  2R09 A;  1V89 A;  4ZRK A;  2K8E A;  4K81 A;  1MIX A;  1LW3 A;  4HB3 B;  4D0N B;  2MDX A;  4H8S A;  3VOQ A;  1XX0 A;  2DFK A;  3F0W A;  1T77 A;  1P3R A;  3AU4 A;  4IFS A;  2D4Q A;  4C0A A;  5JHG A;  3ZVR A;  4KHA A; 
#chains in the Genus database with same CATH homology
 1EGX A;  1NTY A;  3FSS A;  3TFM A;  4EJN A;  1OY2 A;  1MK7 B;  2H7E A;  2K2J A;  4HAT B;  3D8E A;  3SUZ A;  3OAN A;  1RJ2 A;  3M1I B;  1DRO A;  2YSZ A;  3U7D A;  1DBH A;  2DKQ A;  2J0J A;  4HB2 B;  3PZD A;  2RLO A;  2CY4 A;  4HAX B;  1IRS A;  4HB4 B;  4YL8 A;  2D9V A;  1ZC3 B;  2LKO A;  2DHI A;  4CHJ A;  1Y19 B;  4F7U P;  2HTH B;  2YS1 A;  4L6E A;  3BIN A;  2Z0P A;  3O96 A;  1M7R A;  2YS5 A;  2D10 A;  1WVH A;  1FGZ A;  4DXA B;  1DDW A;  2H7D A;  2Z0Q A;  5HE0 A;  2D9X A;  1DYN A;  3BJI A;  3ODO A;  2I5C A;  2YT1 A;  1DDM A;  5KQ1 A;  2I1K A;  1UNP A;  5KCV A;  4A6F B;  5FI1 A;  2QKM A;  5C16 A;  4XWX A;  3KZ1 A;  3G9W A;  2CRF A;  4GMX B;  1FHX A;  2LYD A;  1NU2 A;  1EAZ A;  2GJY A;  1K5G B;  1H4R A;  4HAZ B;  1WGU A;  2L2I A;  3NSU A;  1X86 A;  2COD A;  2DHJ A;  2K2U A;  5J3T A;  2IFS A;  1EVH A;  3ML4 A;  3U8Z A;  1UNR A;  3WYF B;  1BAK A;  2XQN M;  1PMS A;  3DXE A;  1MPH A;  1NI2 A;  1M7E A;  2P8V A;  4GMV A;  4K2O A;  1H10 A;  1ISN A;  4WJ7 A;  5KQ4 A;  1X11 A;  2AEH A;  2RSG A;  4NY0 A;  2DYQ A;  5D3X A;  1Y5O A;  1FB8 A;  3FM8 C;  1TXD A;  2VKI A;  2K00 A;  2OQB A;  1UPR A;  2D2Q A;  3PVL A;  1FHO A;  2LUL A;  4K17 A;  2NMB A;  5JHH A;  2P0F A;  2HE7 A;  2M14 A;  2YS3 A;  1AWE A;  1V61 A;  2Y7B A;  1EF1 A;  3PG7 A;  3SYX A;  1U2B A;  1FOE A;  2YT0 A;  3ULB A;  4HAU B;  2RNR B;  5DH9 B;  1Z87 A;  1W1D A;  1XKE A;  5JP4 A;  1WGQ A;  3WA0 A;  3QBV B;  4HAV B;  2LOX A;  2N0Y A;  5HE1 A;  3CXB B;  1MK9 B;  1ZVR A;  2QKL A;  2ADZ A;  4HDQ A;  2LG1 A;  2G35 A;  2DX1 A;  5C5B B;  4HB0 B;  4Z2M B;  1XOD A;  2E2X A;  2DKP A;  5C5B A;  2GS0 A;  1XCG A;  2W2X D;  2MKR A;  3A8P A;  1B55 A;  3KRW A;  1WJM A;  1U5F A;  2ROV A;  3SO6 A;  2DHK A;  2J0K A;  4KVG B;  4PQ0 A;  2D9Z A;  3TCA A;  1KI1 B;  1FAO A;  3MDB C;  2GCJ A;  1KZG A;  1XD4 A;  2RUK B;  3ODX A;  4WVF B;  3FEH A;  2MFQ A;  2UZR A;  2DX5 A;  1UPQ A;  1DDV A;  4GPT B;  5D3Y A;  5CLL B;  2BCJ A;  2ZPY A;  1BWN A;  1WI1 A;  3IVF A;  4KAX B;  3KRX A;  4BBK A;  1OQN A;  4A6H A;  1U27 A;  2VSZ A;  1TQZ A;  1AQC A;  1ZM0 A;  3GYO A;  4DBB A;  4KHB B;  5J3Q A;  5FI0 A;  2M38 A;  2EC1 A;  1V88 A;  5HE2 A;  1BTN A;  3X23 A;  3AJ4 A;  3HK0 A;  3QWM A;  3TO1 A;  2COA A;  1FHW A;  3CIK A;  4HDO A;  2DYN A;  5DHA B;  2CY5 A;  2ELB A;  1U5E A;  2FJL A;  2IYB A;  3ODW A;  2DA0 A;  1FGY A;  1BTK A;  4P7I A;  5JLJ B;  2D11 A;  3DXC A;  3QIJ A;  2L1C A;  4HAY B;  1TJ6 A;  3KY9 A;  3PVU A;  4TYZ A;  4GN1 A;  1X1G A;  5J3Y A;  4TKN A;  2OTX A;  2UVM A;  4MT7 A;  3TVV A;  2COC A;  3ULC A;  1W1G A;  2YVC A;  2YRY A;  4GZU A;  1P5T A;  2YF0 A;  1U5D A;  1ZC4 B;  1N3H A;  3N7C A;  1UEF A;  1KZ7 A;  1GC6 A;  3DXD A;  4A6K A;  1J0W A;  2GCL A;  4IOY X;  1QQG A;  2VRW B;  5C79 A;  5D27 A;  1GG3 A;  1MAI A;  2I5F A;  3HW2 B;  2KCJ A;  1GC7 A;  4CYE A;  4KHO A;  3GYP A;  1WG7 A;  5DIF B;  4HHV A;  4F7H A;  2ELA A;  1J19 A;  2KUP A;  1P6S A;  2Q13 A;  1X1F A;  1U29 A;  3UZT A;  5C6R A;  2CAY A;  5D3V A;  4NSW A;  1U5G A;  3F5R A;  5DHF B;  1OMW A;  1K5D B;  1QC6 A;  4Y94 A;  5EFX A;  1RRP B;  3RCP A;  1E5W A;  3D8F A;  3ZDT A;  2Y8G A;  2MWN B;  2AL6 A;  4WSF A;  4DX8 A;  1Q67 A;  3HQC A;  3P6A A;  5LOP B;  1SHC A;  1W1H A;  2DTC A;  3V5W A;  4Z2N A;  1PFJ A;  1SGH A;  2ROZ B;  1NTV A;  2J0M A;  2P0H A;  3A8Q A;  3D8D A;  2KGX B;  4A5K A;  5DI9 B;  4MY6 A;  2V76 A;  3AU5 A;  1PLS A;  1UNQ A;  1V5P A;  5GOW B;  2D9W A;  3PEG A;  2RVB B;  2UZS A;  1X05 A;  2W2W A;  3SNH A;  5HE3 A;  4EKU A;  2I1J A;  1WJ1 A;  3LJU X;  2Z0O A;  1I7A A;  2COF A;  4GXB A;  2DLW A;  1MIZ B;  1MKE A;  2W2X C;  2D9Y A;  5L81 A;  3PSC A;  1LB1 A;  4EMO A;  4MK0 A;  4K2P A;  2N23 A;  3P7Z A;  3KSY A;  4HAW B;  4ZRI A;  3PVW A;  2EJ8 A;  4A6F A;  2X18 A;  5LON B;  3VIA A;  1XR0 B;  1I2H A;  2JP2 A;  2PZ1 A;  3MPX A;  4F7G A;  2R0D A;  4IAP A;  4B6H A;  2DN6 A;  2P0D A;  4PNK A;  2EMS A;  2NZ8 B;  4YON A;  3SV1 A;  1V5U A;  2Y8F A;  5CLQ B;  3PP2 A;  3A98 B;  3T06 A;  5D3W A;  4ZRJ A;  1ZSQ A;  3TW1 A;  2LOZ A;  2EMT A;  4CHM A;  1V5M A;  2RGN B;  4DX9 0;  2J59 M;  2R09 A;  1V89 A;  4ZRK A;  4K81 A;  1MIX A;  1LW3 A;  4HB3 B;  4D0N B;  2MDX A;  4H8S A;  3VOQ A;  1XX0 A;  2DFK A;  3F0W A;  4IFS A;  1P3R A;  3AU4 A;  2D4Q A;  4C0A A;  5JHG A;  3ZVR A;  4KHA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...