2COAA

Solution structure of the ph domain of protein kinase c, d2 type from human
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
125
structure length
125
Chain Sequence
GSSGSSGTLREGWVVHYSNKDTLRKRHYWRLDCKCITLFQNNTTNRYYKEIPLSEILTVESAQNFSLVPPGTNPHCFEIVTANATYFVGEMPGGTPGGPSGQGAEAARGWETAIRQALMSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PH domain of protein kinase C, D2 type from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords Protein kinase C, D2 type
total genus 15
structure length 125
sequence length 125
ec nomenclature ec 2.7.11.13: Protein kinase C.
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2coaA01
3AU5A 1Y5OA 2MFQA 1U5DA 1DDMA 1FHXA 1SGHA 5J3YA 5C6RA 4GZUA 2DTCA 1EGXA 1FB8A 1W1DA 4K2OA 1P3RA 3G9WA 1KI1B 4MT7A 2YS3A 2J0JA 3ULBA 4A6KA 2COCA 4HAYB 1XCGA 1DDVA 2L2IA 2LYDA 1KZ7A 2PZ1A 3TW1A 4HAZB 2J59M 3CXBB 5J3QA 5C16A 4EJNA 2ROVA 1OY2A 3WYFB 2LOZA 3DXDA 1J0WA 3BINA 2I1KA 2Z0PA 2M14A 3V5WA 1GG3A 2MKRA 2YT0A 4ZRJA 1OMWA 2IYBA 4K2PA 2CAYA 4CHJA 4A5KA 3TO1A 1H10A 5LOPB 5DHAB 4KHAA 1WVHA 3D8DA 3OANA 2RLOA 4GN1A 1X05A 1TQZA 3KRWA 1EAZA 1V88A 3ODXA 4IAPA 3ZDTA 4A6HA 2ADZA 1XD4A 3RCPA 2LKOA 2OQBA 1PFJA 1PMSA 2D9YA 4HAWB 2NZ8B 1AQCA 5EFXA 1MIXA 5DH9B 4A6FA 2LOXA 2CODA 3A8PA 5L81A 1BTKA 2EJ8A 1DYNA 3MDBC 2COAA 5DI9B 5JHGA 2FJLA 2GS0A 5DHFB 2KCJA 4F7GA 4DX8A 1B55A 4MY6A 2W2WA 5JLJB 4HB4B 4PQ0A 4TKNA 1I7AA 1Y19B 3A8QA 2Z0OA 4GXBA 2HE7A 3AU4A 1E5WA 2CRFA 4WJ7A 1K5DB 4Y94A 2RSGA 2D9VA 1NTVA 2ROZB 4EKUA 2L1CA 3PG7A 3PEGA 3P7ZA 3HW2B 4CYEA 5D3VA 2RNRB 2H7EA 4NY0A 2HTHB 2GJYA 1U5EA 4ZRKA 1SHCA 1Q67A 1GC6A 3NSUA 3PVWA 2UZRA 4K81A 3KZ1A 1K5GB 1BAKA 2QKLA 3ML4A 5HE3A 2GCLA 1MK7B 3PZDA 2ELAA 3VOQA 2JP2A 4Z2MB 1IRSA 5CLQB 1UNRA 2Q13A 1M7EA 2K2JA 4EMOA 5D27A 4CHMA 5HE2A 2CY4A 1FGZA 2D2QA 2LG1A 4ZRIA 1U5GA 3O96A 1XR0B 4P7IA 2RVBB 2ELBA 5HE0A 2DHKA 2R0DA 1MKEA 2AL6A 3SUZA 4HB2B 4GMXB 1KZGA 3LJUX 1MAIA 4IOYX 3HQCA 1AWEA 1MIZB 3QWMA 1X1FA 2QKMA 1U2BA 1MK9B 2P8VA 2GCJA 3QBVB 1P6SA 3SV1A 3KSYA 5FI0A 5HE1A 5CLLB 1Z87A 1WJMA 5KQ4A 1FAOA 2YRYA 3PP2A 1TJ6A 2P0DA 1DDWA 4KHOA 1NU2A 2K00A 3WA0A 3GYPA 2AEHA 2YS5A 2ZPYA 1BWNA 3A98B 4HAXB 1GC7A 3ODWA 2DX1A 2VSZA 3FM8C 3IVFA 4HHVA 3ZVRA 3N7CA 4HDOA 2EMSA 2UZSA 4HAVB 2Y8GA 1OQNA 2N23A 1PLSA 3M1IB 5J3TA 2IFSA 5C5BB 2YS1A 5D3XA 1V5PA 1X86A 2X18A 1NI2A 1DBHA 4DXAB 2E2XA 1V5UA 2V76A 1UNPA 3KRXA 4TYZA 2D11A 3D8EA 4A6FB 4F7UP 2RGNB 4DX90 5DIFB 3MPXA 2I5CA 3VIAA 2KUPA 1LB1A 2DYQA 1DROA 4KVGB 4WVFB 3U7DA 1XKEA 4BBKA 3ODOA 5C79A 1UEFA 2W2XC 2EC1A 2DYNA 3D8FA 3GYOA 4K17A 1I2HA 3SO6A 1UPQA 1TXDA 4WSFA 1W1HA 2DFKA 4Z2NA 1V5MA 3TFMA 3DXEA 1QC6A 3PVUA 2MWNB 1ZVRA 2YF0A 1XX0A 2DLWA 2DN6A 1ZSQA 2M38A 3F0WA 2Z0QA 4HAUB 3CIKA 4B6HA 4C0AA 3SYXA 2DHIA 3X23A 4DBBA 4GPTB 5JHHA 5GOWB 2CY5A 2J0MA 4KAXB 1WGQA 5D3WA 2COFA 1U29A 2DKPA 5D3YA 2Y8FA 1WI1A 1NTYA 1ZC3B 2DX5A 5JP4A 5KCVA 4PNKA 4L6EA 4YL8A 1RRPB 5LONB 1U5FA 1WJ1A 2I5FA 1XODA 1X1GA 2D4QA 2YVCA 3TVVA 1ISNA 1ZC4B 3TCAA 1H4RA 1X11A 2P0HA 4HB0B 2D9XA 4HDQA 1M7RA 2Y7BA 1FHWA 1MPHA 2G35A 3PSCA 4GMVA 2D9WA 1UPRA 1U27A 1V61A 1WG7A 1EVHA 2OTXA 2YT1A 3U8ZA 1FGYA 2XQNM 5FI1A 4D0NB 2NMBA 2YSZA 2VKIA 3F5RA 5KQ1A 2EMTA 4IFSA 3HK0A 1LW3A 4F7HA 1UNQA 2UVMA 3PVLA 4NSWA 1N3HA 3FSSA 3UZTA 2N0YA 4H8SA 3AJ4A 4MK0A 3ULCA 1EF1A 4KHBB 2P0FA 3DXCA 2K2UA 2VRWB 3QIJA 4HB3B 2DKQA 1FOEA 1WGUA 3BJIA 2I1JA 1J19A 4HATB 3SNHA 1P5TA 1QQGA 3P6AA 2DA0A 2MDXA 2RUKB 2D10A 2DHJA 3T06A 2KGXB 4XWXA 3FEHA 2H7DA 2R09A 2LULA 1BTNA 2W2XD 1RJ2A 5C5BA 2J0KA 1V89A 1ZM0A 2BCJA 4YONA 1FHOA 1W1GA 3KY9A 2D9ZA
chains in the Genus database with same CATH superfamily
3AU5A 1Y5OA 2MFQA 1U5DA 1DDMA 1FHXA 4L1RA 1SGHA 5J3YA 5C6RA 4GZUA 2KIGA 2DTCA 1EGXA 1FB8A 1W1DA 4OSNA 4K2OA 1P3RA 3G9WA 1KI1B 4MT7A 2YS3A 5M4YB 2J0JA 3ULBA 4A6KA 2COCA 4HAYB 1XCGA 1DDVA 2L2IA 2LYDA 1KZ7A 2PZ1A 3TW1A 4HAZB 2J59M 3CXBB 5J3QA 5C16A 4EJNA 2ROVA 1OY2A 3WYFB 2LOZA 3DXDA 1J0WA 3BINA 2I1KA 2Z0PA 2M14A 3V5WA 1GG3A 2MKRA 2YT0A 4ZRJA 1OMWA 2IYBA 4GNKB 4K2PA 2CAYA 4CHJA 4A5KA 2KIEA 3TO1A 1H10A 5LOPB 4OT1A 5DHAB 4KHAA 1WVHA 3D8DA 3OANA 2RLOA 4GN1A 1X05A 1TQZA 3KRWA 1EAZA 1V88A 3ODXA 4IAPA 2GUMA 3ZDTA 4A6HA 2ADZA 1XD4A 3RCPA 2LKOA 2OQBA 1PFJA 1PMSA 2K8EA 2D9YA 4HAWB 2NZ8B 1AQCA 5EFXA 1MIXA 5DH9B 4A6FA 2LOXA 2CODA 3A8PA 5L81A 1BTKA 2EJ8A 1DYNA 3MDBC 2COAA 5DI9B 5JHGA 2FJLA 2GS0A 5DHFB 2KCJA 4F7GA 4DX8A 1B55A 4MY6A 2W2WA 5JLJB 4HB4B 4PQ0A 4GOUA 4TKNA 1I7AA 1Y19B 3A8QA 2Z0OA 4GXBA 2HE7A 3AU4A 3NWDA 1E5WA 2CRFA 4WJ7A 1K5DB 4Y94A 2RRFA 2RSGA 3NWAA 2D9VA 1NTVA 2ROZB 4EKUA 2L1CA 3PG7A 3PEGA 3P7ZA 3HW2B 4CYEA 5D3VA 2RNRB 2H7EA 4NY0A 2HTHB 2GJYA 1U5EA 4ZRKA 1SHCA 1Q67A 1GC6A 3NSUA 3PVWA 2UZRA 4K81A 2Z4DA 3KZ1A 1K5GB 1BAKA 2QKLA 3ML4A 5HE3A 2GCLA 1MK7B 3PZDA 2ELAA 3VOQA 2JP2A 4Z2MB 1IRSA 5CLQB 1UNRA 2Q13A 1M7EA 2K2JA 4EMOA 5D27A 4CHMA 5HE2A 2CY4A 1FGZA 2D2QA 2LG1A 4ZRIA 2KUQA 1U5GA 3O96A 1XR0B 4P7IA 4QXAB 2RVBB 4DIXA 2ELBA 5HE0A 2DHKA 2R0DA 1MKEA 2AL6A 2Z14A 4HB2B 4GMXB 3SUZA 5I2SA 1KZGA 3OHMB 3LJUX 1MAIA 4IOYX 3HQCA 1AWEA 1MIZB 3QWMA 1X1FA 2QKMA 1U2BA 1MK9B 2P8VA 2GCJA 3QBVB 4HSIA 1P6SA 3A58A 3SV1A 3KSYA 5FI0A 5HE1A 5CLLB 1Z87A 1WJMA 5KQ4A 1FAOA 2YRYA 3PP2A 1TJ6A 2P0DA 1DDWA 4KHOA 2YT2A 1NU2A 2K00A 4QJ3B 3WA0A 3GYPA 2AEHA 2YS5A 2ZPYA 1BWNA 1MI1A 3A98B 4HAXB 1GC7A 3ODWA 4D6WA 2DX1A 2VSZA 3FM8C 3IVFA 4HHVA 3ZVRA 3N7CA 4HDOA 2EMSA 2UZSA 4HAVB 3HSAA 1ZYIA 2Y8GA 1OQNA 2N23A 1PLSA 3M1IB 5J3TA 5LG4B 2IFSA 5C5BB 2YS1A 5D3XA 1V5PA 1X86A 2X18A 1NI2A 1DBHA 4DXAB 2E2XA 1V5UA 2V76A 1UNPA 3KRXA 4TYZA 2D11A 3D8EA 4A6FB 4F7UP 2RGNB 4DX90 5DIFB 3MPXA 2I5CA 3VIAA 2Z59A 2KUPA 1LB1A 2DYQA 3NWFA 1DROA 4KVGB 4WVFB 3U12A 2FJUB 1XKEA 3U7DA 4BBKA 3ODOA 5C79A 1UEFA 2W2XC 2EC1A 2DYNA 3D8FA 3GYOA 4K17A 1I2HA 3SO6A 1UPQA 1TXDA 4WSFA 1W1HA 2DFKA 4Z2NA 1V5MA 3TFMA 3DXEA 1QC6A 4QJ5B 3PVUA 2MWNB 1ZVRA 2YF0A 1XX0A 2DLWA 2DN6A 1ZSQA 2M38A 3F0WA 2Z0QA 4HAUB 3CIKA 4B6HA 4C0AA 3SYXA 2DHIA 2K49A 3NW8A 3X23A 4DBBA 4GPTB 3DCXA 5JHHA 5GOWB 2CY5A 2J0MA 4KAXB 1WGQA 5D3WA 2COFA 1U29A 2DKPA 5D3YA 2Y8FA 1WI1A 1NTYA 1ZC3B 2DX5A 5JP4A 5KCVA 4PNKA 4L6EA 4YL8A 1RRPB 3B77A 5LONB 1U5FA 1WJ1A 2I5FA 1XODA 3FVCA 2ZKMX 1X1GA 2D4QA 2YVCA 3TVVA 1ISNA 1ZC4B 2Z13A 3TCAA 1H4RA 1X11A 2P0HA 4HB0B 2D9XA 4HDQA 1M7RA 2NBVA 4KHBA 2Y7BA 5I2MA 1FHWA 1MPHA 2G35A 3PSCA 2R2YA 4GMVA 2D9WA 1UPRA 1U27A 1V61A 1WG7A 1EVHA 2OTXA 3HIEA 2YT1A 3U8ZA 1FGYA 2XQNM 5FI1A 4D0NB 2NMBA 2KR0A 2YSZA 2VKIA 3F5RA 5KQ1A 2EMTA 4IFSA 3HK0A 1LW3A 4F7HA 1UNQA 2UVMA 3PVLA 4NSWA 1N3HA 3FSSA 3UZTA 2N0YA 4H8SA 3AJ4A 1T77A 4MK0A 4QJ4B 3ULCA 1EF1A 4CSQA 4KHBB 2P0FA 3DXCA 2K2UA 2VRWB 2DKQA 3QIJA 4HB3B 1FOEA 1WGUA 5IRSA 3BJIA 2I1JA 1J19A 4HATB 3SNHA 1P5TA 1QQGA 3P6AA 2DA0A 2MDXA 2RUKB 2D10A 2DHJA 2KGXB 3T06A 4XWXA 3FEHA 2H7DA 2R09A 2LULA 1BTNA 2W2XD 1RJ2A 5C5BA 2J0KA 1V89A 1ZM0A 2BCJA 4YONA 1FHOA 1W1GA 3KY9A 2D9ZA
chains in the Genus database with same CATH topology
3AU5A 1Y5OA 2MFQA 1U5DA 1DDMA 1FHXA 1SGHA 5J3YA 5C6RA 4GZUA 2DTCA 1EGXA 1FB8A 1W1DA 4K2OA 1P3RA 3G9WA 1KI1B 4MT7A 2YS3A 2J0JA 3ULBA 4A6KA 2COCA 4HAYB 1XCGA 1DDVA 2L2IA 2LYDA 1KZ7A 2PZ1A 3TW1A 4HAZB 2J59M 3CXBB 5J3QA 5C16A 4EJNA 2ROVA 1OY2A 3WYFB 2LOZA 3DXDA 1J0WA 3BINA 2I1KA 2Z0PA 2M14A 3V5WA 1GG3A 2MKRA 2YT0A 4ZRJA 1OMWA 2IYBA 4K2PA 2CAYA 4CHJA 4A5KA 3TO1A 1H10A 5LOPB 5DHAB 4KHAA 1WVHA 3D8DA 3OANA 2RLOA 4GN1A 1X05A 1TQZA 3KRWA 1EAZA 1V88A 3ODXA 4IAPA 3ZDTA 4A6HA 2ADZA 1XD4A 3RCPA 2LKOA 2OQBA 1PFJA 1PMSA 2D9YA 4HAWB 2NZ8B 1AQCA 5EFXA 1MIXA 5DH9B 4A6FA 2LOXA 2CODA 3A8PA 5L81A 1BTKA 2EJ8A 1DYNA 3MDBC 2COAA 5DI9B 5JHGA 2FJLA 2GS0A 5DHFB 2KCJA 4F7GA 4DX8A 1B55A 4MY6A 2W2WA 5JLJB 4HB4B 4PQ0A 4TKNA 1I7AA 1Y19B 3A8QA 2Z0OA 4GXBA 2HE7A 3AU4A 1E5WA 2CRFA 4WJ7A 1K5DB 4Y94A 2RSGA 2D9VA 1NTVA 2ROZB 4EKUA 2L1CA 3PG7A 3PEGA 3P7ZA 3HW2B 4CYEA 5D3VA 2RNRB 2H7EA 4NY0A 2HTHB 2GJYA 1U5EA 4ZRKA 1SHCA 1Q67A 1GC6A 3NSUA 3PVWA 2UZRA 4K81A 3KZ1A 1K5GB 1BAKA 2QKLA 3ML4A 5HE3A 2GCLA 1MK7B 3PZDA 2ELAA 3VOQA 2JP2A 4Z2MB 1IRSA 5CLQB 1UNRA 2Q13A 1M7EA 2K2JA 4EMOA 5D27A 4CHMA 5HE2A 2CY4A 1FGZA 2D2QA 2LG1A 4ZRIA 1U5GA 3O96A 1XR0B 4P7IA 2RVBB 2ELBA 5HE0A 2DHKA 2R0DA 1MKEA 2AL6A 3SUZA 4HB2B 4GMXB 1KZGA 3LJUX 1MAIA 4IOYX 3HQCA 1AWEA 1MIZB 3QWMA 1X1FA 2QKMA 1U2BA 1MK9B 2P8VA 2GCJA 3QBVB 1P6SA 3SV1A 3KSYA 5FI0A 5HE1A 5CLLB 1Z87A 1WJMA 5KQ4A 1FAOA 2YRYA 3PP2A 1TJ6A 2P0DA 1DDWA 4KHOA 1NU2A 2K00A 3WA0A 3GYPA 2AEHA 2YS5A 2ZPYA 1BWNA 3A98B 4HAXB 1GC7A 3ODWA 2DX1A 2VSZA 3FM8C 3IVFA 4HHVA 3ZVRA 3N7CA 4HDOA 2EMSA 2UZSA 4HAVB 2Y8GA 1OQNA 2N23A 1PLSA 3M1IB 5J3TA 2IFSA 5C5BB 2YS1A 5D3XA 1V5PA 1X86A 2X18A 1NI2A 1DBHA 4DXAB 2E2XA 1V5UA 2V76A 1UNPA 3KRXA 4TYZA 2D11A 3D8EA 4A6FB 4F7UP 2RGNB 4DX90 5DIFB 3MPXA 2I5CA 3VIAA 2KUPA 1LB1A 2DYQA 1DROA 4KVGB 4WVFB 3U7DA 1XKEA 4BBKA 3ODOA 5C79A 1UEFA 2W2XC 2EC1A 2DYNA 3D8FA 3GYOA 4K17A 1I2HA 3SO6A 1UPQA 1TXDA 4WSFA 1W1HA 2DFKA 4Z2NA 1V5MA 3TFMA 3DXEA 1QC6A 3PVUA 2MWNB 1ZVRA 2YF0A 1XX0A 2DLWA 2DN6A 1ZSQA 2M38A 3F0WA 2Z0QA 4HAUB 3CIKA 4B6HA 4C0AA 3SYXA 2DHIA 3X23A 4DBBA 4GPTB 5JHHA 5GOWB 2CY5A 2J0MA 4KAXB 1WGQA 5D3WA 2COFA 1U29A 2DKPA 5D3YA 2Y8FA 1WI1A 1NTYA 1ZC3B 2DX5A 5JP4A 5KCVA 4PNKA 4L6EA 4YL8A 1RRPB 5LONB 1U5FA 1WJ1A 2I5FA 1XODA 1X1GA 2D4QA 2YVCA 3TVVA 1ISNA 1ZC4B 3TCAA 1H4RA 1X11A 2P0HA 4HB0B 2D9XA 4HDQA 1M7RA 2Y7BA 1FHWA 1MPHA 2G35A 3PSCA 4GMVA 2D9WA 1UPRA 1U27A 1V61A 1WG7A 1EVHA 2OTXA 2YT1A 3U8ZA 1FGYA 2XQNM 5FI1A 4D0NB 2NMBA 2YSZA 2VKIA 3F5RA 5KQ1A 2EMTA 4IFSA 3HK0A 1LW3A 4F7HA 1UNQA 2UVMA 3PVLA 4NSWA 1N3HA 3FSSA 3UZTA 2N0YA 4H8SA 3AJ4A 4MK0A 3ULCA 1EF1A 4KHBB 2P0FA 3DXCA 2K2UA 2VRWB 3QIJA 4HB3B 2DKQA 1FOEA 1WGUA 3BJIA 2I1JA 1J19A 4HATB 3SNHA 1P5TA 1QQGA 3P6AA 2DA0A 2MDXA 2RUKB 2D10A 2DHJA 3T06A 2KGXB 4XWXA 3FEHA 2H7DA 2R09A 2LULA 1BTNA 2W2XD 1RJ2A 5C5BA 2J0KA 1V89A 1ZM0A 2BCJA 4YONA 1FHOA 1W1GA 3KY9A 2D9ZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3AU5 A;  1Y5O A;  2MFQ A;  1U5D A;  1DDM A;  1FHX A;  1SGH A;  5J3Y A;  5C6R A;  4GZU A;  2DTC A;  1EGX A;  1FB8 A;  1W1D A;  4K2O A;  1P3R A;  3G9W A;  1KI1 B;  4MT7 A;  2YS3 A;  2J0J A;  3ULB A;  4A6K A;  2COC A;  4HAY B;  1XCG A;  1DDV A;  2L2I A;  2LYD A;  1KZ7 A;  2PZ1 A;  3TW1 A;  4HAZ B;  2J59 M;  3CXB B;  5J3Q A;  5C16 A;  4EJN A;  2ROV A;  1OY2 A;  3WYF B;  2LOZ A;  3DXD A;  1J0W A;  3BIN A;  2I1K A;  2Z0P A;  2M14 A;  3V5W A;  1GG3 A;  2MKR A;  2YT0 A;  4ZRJ A;  1OMW A;  2IYB A;  4K2P A;  2CAY A;  4CHJ A;  4A5K A;  3TO1 A;  1H10 A;  5LOP B;  5DHA B;  4KHA A;  1WVH A;  3D8D A;  3OAN A;  2RLO A;  4GN1 A;  1X05 A;  1TQZ A;  3KRW A;  1EAZ A;  1V88 A;  3ODX A;  4IAP A;  3ZDT A;  4A6H A;  2ADZ A;  1XD4 A;  3RCP A;  2LKO A;  2OQB A;  1PFJ A;  1PMS A;  2D9Y A;  4HAW B;  2NZ8 B;  1AQC A;  5EFX A;  1MIX A;  5DH9 B;  4A6F A;  2LOX A;  2COD A;  3A8P A;  5L81 A;  1BTK A;  2EJ8 A;  1DYN A;  3MDB C;  2COA A;  5DI9 B;  5JHG A;  2FJL A;  2GS0 A;  5DHF B;  2KCJ A;  4F7G A;  4DX8 A;  1B55 A;  4MY6 A;  2W2W A;  5JLJ B;  4HB4 B;  4PQ0 A;  4TKN A;  1I7A A;  1Y19 B;  3A8Q A;  2Z0O A;  4GXB A;  2HE7 A;  3AU4 A;  1E5W A;  2CRF A;  4WJ7 A;  1K5D B;  4Y94 A;  2RSG A;  2D9V A;  1NTV A;  2ROZ B;  4EKU A;  2L1C A;  3PG7 A;  3PEG A;  3P7Z A;  3HW2 B;  4CYE A;  5D3V A;  2RNR B;  2H7E A;  4NY0 A;  2HTH B;  2GJY A;  1U5E A;  4ZRK A;  1SHC A;  1Q67 A;  1GC6 A;  3NSU A;  3PVW A;  2UZR A;  4K81 A;  3KZ1 A;  1K5G B;  1BAK A;  2QKL A;  3ML4 A;  5HE3 A;  2GCL A;  1MK7 B;  3PZD A;  2ELA A;  3VOQ A;  2JP2 A;  4Z2M B;  1IRS A;  5CLQ B;  1UNR A;  2Q13 A;  1M7E A;  2K2J A;  4EMO A;  5D27 A;  4CHM A;  5HE2 A;  2CY4 A;  1FGZ A;  2D2Q A;  2LG1 A;  4ZRI A;  1U5G A;  3O96 A;  1XR0 B;  4P7I A;  2RVB B;  2ELB A;  5HE0 A;  2DHK A;  2R0D A;  1MKE A;  2AL6 A;  3SUZ A;  4HB2 B;  4GMX B;  1KZG A;  3LJU X;  1MAI A;  4IOY X;  3HQC A;  1AWE A;  1MIZ B;  3QWM A;  1X1F A;  2QKM A;  1U2B A;  1MK9 B;  2P8V A;  2GCJ A;  3QBV B;  1P6S A;  3SV1 A;  3KSY A;  5FI0 A;  5HE1 A;  5CLL B;  1Z87 A;  1WJM A;  5KQ4 A;  1FAO A;  2YRY A;  3PP2 A;  1TJ6 A;  2P0D A;  1DDW A;  4KHO A;  1NU2 A;  2K00 A;  3WA0 A;  3GYP A;  2AEH A;  2YS5 A;  2ZPY A;  1BWN A;  3A98 B;  4HAX B;  1GC7 A;  3ODW A;  2DX1 A;  2VSZ A;  3FM8 C;  3IVF A;  4HHV A;  3ZVR A;  3N7C A;  4HDO A;  2EMS A;  2UZS A;  4HAV B;  2Y8G A;  1OQN A;  2N23 A;  1PLS A;  3M1I B;  5J3T A;  2IFS A;  5C5B B;  2YS1 A;  5D3X A;  1V5P A;  1X86 A;  2X18 A;  1NI2 A;  1DBH A;  4DXA B;  2E2X A;  1V5U A;  2V76 A;  1UNP A;  3KRX A;  4TYZ A;  2D11 A;  3D8E A;  4A6F B;  4F7U P;  2RGN B;  4DX9 0;  5DIF B;  3MPX A;  2I5C A;  3VIA A;  2KUP A;  1LB1 A;  2DYQ A;  1DRO A;  4KVG B;  4WVF B;  3U7D A;  1XKE A;  4BBK A;  3ODO A;  5C79 A;  1UEF A;  2W2X C;  2EC1 A;  2DYN A;  3D8F A;  3GYO A;  4K17 A;  1I2H A;  3SO6 A;  1UPQ A;  1TXD A;  4WSF A;  1W1H A;  2DFK A;  4Z2N A;  1V5M A;  3TFM A;  3DXE A;  1QC6 A;  3PVU A;  2MWN B;  1ZVR A;  2YF0 A;  1XX0 A;  2DLW A;  2DN6 A;  1ZSQ A;  2M38 A;  3F0W A;  2Z0Q A;  4HAU B;  3CIK A;  4B6H A;  4C0A A;  3SYX A;  2DHI A;  3X23 A;  4DBB A;  4GPT B;  5JHH A;  5GOW B;  2CY5 A;  2J0M A;  4KAX B;  1WGQ A;  5D3W A;  2COF A;  1U29 A;  2DKP A;  5D3Y A;  2Y8F A;  1WI1 A;  1NTY A;  1ZC3 B;  2DX5 A;  5JP4 A;  5KCV A;  4PNK A;  4L6E A;  4YL8 A;  1RRP B;  5LON B;  1U5F A;  1WJ1 A;  2I5F A;  1XOD A;  1X1G A;  2D4Q A;  2YVC A;  3TVV A;  1ISN A;  1ZC4 B;  3TCA A;  1H4R A;  1X11 A;  2P0H A;  4HB0 B;  2D9X A;  4HDQ A;  1M7R A;  2Y7B A;  1FHW A;  1MPH A;  2G35 A;  3PSC A;  4GMV A;  2D9W A;  1UPR A;  1U27 A;  1V61 A;  1WG7 A;  1EVH A;  2OTX A;  2YT1 A;  3U8Z A;  1FGY A;  2XQN M;  5FI1 A;  4D0N B;  2NMB A;  2YSZ A;  2VKI A;  3F5R A;  5KQ1 A;  2EMT A;  4IFS A;  3HK0 A;  1LW3 A;  4F7H A;  1UNQ A;  2UVM A;  3PVL A;  4NSW A;  1N3H A;  3FSS A;  3UZT A;  2N0Y A;  4H8S A;  3AJ4 A;  4MK0 A;  3ULC A;  1EF1 A;  4KHB B;  2P0F A;  3DXC A;  2K2U A;  2VRW B;  3QIJ A;  4HB3 B;  2DKQ A;  1FOE A;  1WGU A;  3BJI A;  2I1J A;  1J19 A;  4HAT B;  3SNH A;  1P5T A;  1QQG A;  3P6A A;  2DA0 A;  2MDX A;  2RUK B;  2D10 A;  2DHJ A;  3T06 A;  2KGX B;  4XWX A;  3FEH A;  2H7D A;  2R09 A;  2LUL A;  1BTN A;  2W2X D;  1RJ2 A;  5C5B A;  2J0K A;  1V89 A;  1ZM0 A;  2BCJ A;  4YON A;  1FHO A;  1W1G A;  3KY9 A;  2D9Z A; 
#chains in the Genus database with same CATH topology
 3AU5 A;  1Y5O A;  2MFQ A;  1U5D A;  1DDM A;  1FHX A;  4L1R A;  1SGH A;  5J3Y A;  5C6R A;  4GZU A;  2KIG A;  2DTC A;  1EGX A;  1FB8 A;  1W1D A;  4OSN A;  4K2O A;  1P3R A;  3G9W A;  1KI1 B;  4MT7 A;  2YS3 A;  5M4Y B;  2J0J A;  3ULB A;  4A6K A;  2COC A;  4HAY B;  1XCG A;  1DDV A;  2L2I A;  2LYD A;  1KZ7 A;  2PZ1 A;  3TW1 A;  4HAZ B;  2J59 M;  3CXB B;  5J3Q A;  5C16 A;  4EJN A;  2ROV A;  1OY2 A;  3WYF B;  2LOZ A;  3DXD A;  1J0W A;  3BIN A;  2I1K A;  2Z0P A;  2M14 A;  3V5W A;  1GG3 A;  2MKR A;  2YT0 A;  4ZRJ A;  1OMW A;  2IYB A;  4GNK B;  4K2P A;  2CAY A;  4CHJ A;  4A5K A;  2KIE A;  3TO1 A;  1H10 A;  5LOP B;  4OT1 A;  5DHA B;  4KHA A;  1WVH A;  3D8D A;  3OAN A;  2RLO A;  4GN1 A;  1X05 A;  1TQZ A;  3KRW A;  1EAZ A;  1V88 A;  3ODX A;  4IAP A;  2GUM A;  3ZDT A;  4A6H A;  2ADZ A;  1XD4 A;  3RCP A;  2LKO A;  2OQB A;  1PFJ A;  1PMS A;  2K8E A;  2D9Y A;  4HAW B;  2NZ8 B;  1AQC A;  5EFX A;  1MIX A;  5DH9 B;  4A6F A;  2LOX A;  2COD A;  3A8P A;  5L81 A;  1BTK A;  2EJ8 A;  1DYN A;  3MDB C;  2COA A;  5DI9 B;  5JHG A;  2FJL A;  2GS0 A;  5DHF B;  2KCJ A;  4F7G A;  4DX8 A;  1B55 A;  4MY6 A;  2W2W A;  5JLJ B;  4HB4 B;  4PQ0 A;  4GOU A;  4TKN A;  1I7A A;  1Y19 B;  3A8Q A;  2Z0O A;  4GXB A;  2HE7 A;  3AU4 A;  3NWD A;  1E5W A;  2CRF A;  4WJ7 A;  1K5D B;  4Y94 A;  2RRF A;  2RSG A;  3NWA A;  2D9V A;  1NTV A;  2ROZ B;  4EKU A;  2L1C A;  3PG7 A;  3PEG A;  3P7Z A;  3HW2 B;  4CYE A;  5D3V A;  2RNR B;  2H7E A;  4NY0 A;  2HTH B;  2GJY A;  1U5E A;  4ZRK A;  1SHC A;  1Q67 A;  1GC6 A;  3NSU A;  3PVW A;  2UZR A;  4K81 A;  2Z4D A;  3KZ1 A;  1K5G B;  1BAK A;  2QKL A;  3ML4 A;  5HE3 A;  2GCL A;  1MK7 B;  3PZD A;  2ELA A;  3VOQ A;  2JP2 A;  4Z2M B;  1IRS A;  5CLQ B;  1UNR A;  2Q13 A;  1M7E A;  2K2J A;  4EMO A;  5D27 A;  4CHM A;  5HE2 A;  2CY4 A;  1FGZ A;  2D2Q A;  2LG1 A;  4ZRI A;  2KUQ A;  1U5G A;  3O96 A;  1XR0 B;  4P7I A;  4QXA B;  2RVB B;  4DIX A;  2ELB A;  5HE0 A;  2DHK A;  2R0D A;  1MKE A;  2AL6 A;  2Z14 A;  4HB2 B;  4GMX B;  3SUZ A;  5I2S A;  1KZG A;  3OHM B;  3LJU X;  1MAI A;  4IOY X;  3HQC A;  1AWE A;  1MIZ B;  3QWM A;  1X1F A;  2QKM A;  1U2B A;  1MK9 B;  2P8V A;  2GCJ A;  3QBV B;  4HSI A;  1P6S A;  3A58 A;  3SV1 A;  3KSY A;  5FI0 A;  5HE1 A;  5CLL B;  1Z87 A;  1WJM A;  5KQ4 A;  1FAO A;  2YRY A;  3PP2 A;  1TJ6 A;  2P0D A;  1DDW A;  4KHO A;  2YT2 A;  1NU2 A;  2K00 A;  4QJ3 B;  3WA0 A;  3GYP A;  2AEH A;  2YS5 A;  2ZPY A;  1BWN A;  1MI1 A;  3A98 B;  4HAX B;  1GC7 A;  3ODW A;  4D6W A;  2DX1 A;  2VSZ A;  3FM8 C;  3IVF A;  4HHV A;  3ZVR A;  3N7C A;  4HDO A;  2EMS A;  2UZS A;  4HAV B;  3HSA A;  1ZYI A;  2Y8G A;  1OQN A;  2N23 A;  1PLS A;  3M1I B;  5J3T A;  5LG4 B;  2IFS A;  5C5B B;  2YS1 A;  5D3X A;  1V5P A;  1X86 A;  2X18 A;  1NI2 A;  1DBH A;  4DXA B;  2E2X A;  1V5U A;  2V76 A;  1UNP A;  3KRX A;  4TYZ A;  2D11 A;  3D8E A;  4A6F B;  4F7U P;  2RGN B;  4DX9 0;  5DIF B;  3MPX A;  2I5C A;  3VIA A;  2Z59 A;  2KUP A;  1LB1 A;  2DYQ A;  3NWF A;  1DRO A;  4KVG B;  4WVF B;  3U12 A;  2FJU B;  1XKE A;  3U7D A;  4BBK A;  3ODO A;  5C79 A;  1UEF A;  2W2X C;  2EC1 A;  2DYN A;  3D8F A;  3GYO A;  4K17 A;  1I2H A;  3SO6 A;  1UPQ A;  1TXD A;  4WSF A;  1W1H A;  2DFK A;  4Z2N A;  1V5M A;  3TFM A;  3DXE A;  1QC6 A;  4QJ5 B;  3PVU A;  2MWN B;  1ZVR A;  2YF0 A;  1XX0 A;  2DLW A;  2DN6 A;  1ZSQ A;  2M38 A;  3F0W A;  2Z0Q A;  4HAU B;  3CIK A;  4B6H A;  4C0A A;  3SYX A;  2DHI A;  2K49 A;  3NW8 A;  3X23 A;  4DBB A;  4GPT B;  3DCX A;  5JHH A;  5GOW B;  2CY5 A;  2J0M A;  4KAX B;  1WGQ A;  5D3W A;  2COF A;  1U29 A;  2DKP A;  5D3Y A;  2Y8F A;  1WI1 A;  1NTY A;  1ZC3 B;  2DX5 A;  5JP4 A;  5KCV A;  4PNK A;  4L6E A;  4YL8 A;  1RRP B;  3B77 A;  5LON B;  1U5F A;  1WJ1 A;  2I5F A;  1XOD A;  3FVC A;  2ZKM X;  1X1G A;  2D4Q A;  2YVC A;  3TVV A;  1ISN A;  1ZC4 B;  2Z13 A;  3TCA A;  1H4R A;  1X11 A;  2P0H A;  4HB0 B;  2D9X A;  4HDQ A;  1M7R A;  2NBV A;  4KHB A;  2Y7B A;  5I2M A;  1FHW A;  1MPH A;  2G35 A;  3PSC A;  2R2Y A;  4GMV A;  2D9W A;  1UPR A;  1U27 A;  1V61 A;  1WG7 A;  1EVH A;  2OTX A;  3HIE A;  2YT1 A;  3U8Z A;  1FGY A;  2XQN M;  5FI1 A;  4D0N B;  2NMB A;  2KR0 A;  2YSZ A;  2VKI A;  3F5R A;  5KQ1 A;  2EMT A;  4IFS A;  3HK0 A;  1LW3 A;  4F7H A;  1UNQ A;  2UVM A;  3PVL A;  4NSW A;  1N3H A;  3FSS A;  3UZT A;  2N0Y A;  4H8S A;  3AJ4 A;  1T77 A;  4MK0 A;  4QJ4 B;  3ULC A;  1EF1 A;  4CSQ A;  4KHB B;  2P0F A;  3DXC A;  2K2U A;  2VRW B;  2DKQ A;  3QIJ A;  4HB3 B;  1FOE A;  1WGU A;  5IRS A;  3BJI A;  2I1J A;  1J19 A;  4HAT B;  3SNH A;  1P5T A;  1QQG A;  3P6A A;  2DA0 A;  2MDX A;  2RUK B;  2D10 A;  2DHJ A;  2KGX B;  3T06 A;  4XWX A;  3FEH A;  2H7D A;  2R09 A;  2LUL A;  1BTN A;  2W2X D;  1RJ2 A;  5C5B A;  2J0K A;  1V89 A;  1ZM0 A;  2BCJ A;  4YON A;  1FHO A;  1W1G A;  3KY9 A;  2D9Z A; 
#chains in the Genus database with same CATH homology
 3AU5 A;  1Y5O A;  2MFQ A;  1U5D A;  1DDM A;  1FHX A;  1SGH A;  5J3Y A;  5C6R A;  4GZU A;  2DTC A;  1EGX A;  1FB8 A;  1W1D A;  4K2O A;  1P3R A;  3G9W A;  1KI1 B;  4MT7 A;  2YS3 A;  2J0J A;  3ULB A;  4A6K A;  2COC A;  4HAY B;  1XCG A;  1DDV A;  2L2I A;  2LYD A;  1KZ7 A;  2PZ1 A;  3TW1 A;  4HAZ B;  2J59 M;  3CXB B;  5J3Q A;  5C16 A;  4EJN A;  2ROV A;  1OY2 A;  3WYF B;  2LOZ A;  3DXD A;  1J0W A;  3BIN A;  2I1K A;  2Z0P A;  2M14 A;  3V5W A;  1GG3 A;  2MKR A;  2YT0 A;  4ZRJ A;  1OMW A;  2IYB A;  4K2P A;  2CAY A;  4CHJ A;  4A5K A;  3TO1 A;  1H10 A;  5LOP B;  5DHA B;  4KHA A;  1WVH A;  3D8D A;  3OAN A;  2RLO A;  4GN1 A;  1X05 A;  1TQZ A;  3KRW A;  1EAZ A;  1V88 A;  3ODX A;  4IAP A;  3ZDT A;  4A6H A;  2ADZ A;  1XD4 A;  3RCP A;  2LKO A;  2OQB A;  1PFJ A;  1PMS A;  2D9Y A;  4HAW B;  2NZ8 B;  1AQC A;  5EFX A;  1MIX A;  5DH9 B;  4A6F A;  2LOX A;  2COD A;  3A8P A;  5L81 A;  1BTK A;  2EJ8 A;  1DYN A;  3MDB C;  2COA A;  5DI9 B;  5JHG A;  2FJL A;  2GS0 A;  5DHF B;  2KCJ A;  4F7G A;  4DX8 A;  1B55 A;  4MY6 A;  2W2W A;  5JLJ B;  4HB4 B;  4PQ0 A;  4TKN A;  1I7A A;  1Y19 B;  3A8Q A;  2Z0O A;  4GXB A;  2HE7 A;  3AU4 A;  1E5W A;  2CRF A;  4WJ7 A;  1K5D B;  4Y94 A;  2RSG A;  2D9V A;  1NTV A;  2ROZ B;  4EKU A;  2L1C A;  3PG7 A;  3PEG A;  3P7Z A;  3HW2 B;  4CYE A;  5D3V A;  2RNR B;  2H7E A;  4NY0 A;  2HTH B;  2GJY A;  1U5E A;  4ZRK A;  1SHC A;  1Q67 A;  1GC6 A;  3NSU A;  3PVW A;  2UZR A;  4K81 A;  3KZ1 A;  1K5G B;  1BAK A;  2QKL A;  3ML4 A;  5HE3 A;  2GCL A;  1MK7 B;  3PZD A;  2ELA A;  3VOQ A;  2JP2 A;  4Z2M B;  1IRS A;  5CLQ B;  1UNR A;  2Q13 A;  1M7E A;  2K2J A;  4EMO A;  5D27 A;  4CHM A;  5HE2 A;  2CY4 A;  1FGZ A;  2D2Q A;  2LG1 A;  4ZRI A;  1U5G A;  3O96 A;  1XR0 B;  4P7I A;  2RVB B;  2ELB A;  5HE0 A;  2DHK A;  2R0D A;  1MKE A;  2AL6 A;  3SUZ A;  4HB2 B;  4GMX B;  1KZG A;  3LJU X;  1MAI A;  4IOY X;  3HQC A;  1AWE A;  1MIZ B;  3QWM A;  1X1F A;  2QKM A;  1U2B A;  1MK9 B;  2P8V A;  2GCJ A;  3QBV B;  1P6S A;  3SV1 A;  3KSY A;  5FI0 A;  5HE1 A;  5CLL B;  1Z87 A;  1WJM A;  5KQ4 A;  1FAO A;  2YRY A;  3PP2 A;  1TJ6 A;  2P0D A;  1DDW A;  4KHO A;  1NU2 A;  2K00 A;  3WA0 A;  3GYP A;  2AEH A;  2YS5 A;  2ZPY A;  1BWN A;  3A98 B;  4HAX B;  1GC7 A;  3ODW A;  2DX1 A;  2VSZ A;  3FM8 C;  3IVF A;  4HHV A;  3ZVR A;  3N7C A;  4HDO A;  2EMS A;  2UZS A;  4HAV B;  2Y8G A;  1OQN A;  2N23 A;  1PLS A;  3M1I B;  5J3T A;  2IFS A;  5C5B B;  2YS1 A;  5D3X A;  1V5P A;  1X86 A;  2X18 A;  1NI2 A;  1DBH A;  4DXA B;  2E2X A;  1V5U A;  2V76 A;  1UNP A;  3KRX A;  4TYZ A;  2D11 A;  3D8E A;  4A6F B;  4F7U P;  2RGN B;  4DX9 0;  5DIF B;  3MPX A;  2I5C A;  3VIA A;  2KUP A;  1LB1 A;  2DYQ A;  1DRO A;  4KVG B;  4WVF B;  3U7D A;  1XKE A;  4BBK A;  3ODO A;  5C79 A;  1UEF A;  2W2X C;  2EC1 A;  2DYN A;  3D8F A;  3GYO A;  4K17 A;  1I2H A;  3SO6 A;  1UPQ A;  1TXD A;  4WSF A;  1W1H A;  2DFK A;  4Z2N A;  1V5M A;  3TFM A;  3DXE A;  1QC6 A;  3PVU A;  2MWN B;  1ZVR A;  2YF0 A;  1XX0 A;  2DLW A;  2DN6 A;  1ZSQ A;  2M38 A;  3F0W A;  2Z0Q A;  4HAU B;  3CIK A;  4B6H A;  4C0A A;  3SYX A;  2DHI A;  3X23 A;  4DBB A;  4GPT B;  5JHH A;  5GOW B;  2CY5 A;  2J0M A;  4KAX B;  1WGQ A;  5D3W A;  2COF A;  1U29 A;  2DKP A;  5D3Y A;  2Y8F A;  1WI1 A;  1NTY A;  1ZC3 B;  2DX5 A;  5JP4 A;  5KCV A;  4PNK A;  4L6E A;  4YL8 A;  1RRP B;  5LON B;  1U5F A;  1WJ1 A;  2I5F A;  1XOD A;  1X1G A;  2D4Q A;  2YVC A;  3TVV A;  1ISN A;  1ZC4 B;  3TCA A;  1H4R A;  1X11 A;  2P0H A;  4HB0 B;  2D9X A;  4HDQ A;  1M7R A;  2Y7B A;  1FHW A;  1MPH A;  2G35 A;  3PSC A;  4GMV A;  2D9W A;  1UPR A;  1U27 A;  1V61 A;  1WG7 A;  1EVH A;  2OTX A;  2YT1 A;  3U8Z A;  1FGY A;  2XQN M;  5FI1 A;  4D0N B;  2NMB A;  2YSZ A;  2VKI A;  3F5R A;  5KQ1 A;  2EMT A;  4IFS A;  3HK0 A;  1LW3 A;  4F7H A;  1UNQ A;  2UVM A;  3PVL A;  4NSW A;  1N3H A;  3FSS A;  3UZT A;  2N0Y A;  4H8S A;  3AJ4 A;  4MK0 A;  3ULC A;  1EF1 A;  4KHB B;  2P0F A;  3DXC A;  2K2U A;  2VRW B;  3QIJ A;  4HB3 B;  2DKQ A;  1FOE A;  1WGU A;  3BJI A;  2I1J A;  1J19 A;  4HAT B;  3SNH A;  1P5T A;  1QQG A;  3P6A A;  2DA0 A;  2MDX A;  2RUK B;  2D10 A;  2DHJ A;  3T06 A;  2KGX B;  4XWX A;  3FEH A;  2H7D A;  2R09 A;  2LUL A;  1BTN A;  2W2X D;  1RJ2 A;  5C5B A;  2J0K A;  1V89 A;  1ZM0 A;  2BCJ A;  4YON A;  1FHO A;  1W1G A;  3KY9 A;  2D9Z A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...