2COBA

Solution structures of the hth domain of human lcor protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
70
structure length
70
Chain Sequence
GSSGSSGRGRYRQYNSEILEEAISVVMSGKMSVSKAQSIYGIPHSTLEYKVKERLGTLKNPPKKKMKLMR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structures of the HTH domain of human LCoR protein
rcsb
source organism Homo sapiens
molecule tags Dna binding protein
molecule keywords LCoR protein
total genus 12
structure length 70
sequence length 70
ec nomenclature
pdb deposition date 2005-05-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05225 HTH_psq helix-turn-helix, Psq domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2cobA01
5C3EJ 2IBDA 5K7FA 2KDZA 2P81A 2GBYA 1RKWA 4A3BJ 3BTCA 3CCYA 1MBFA 3Q0UA 4A3JJ 2VKVA 1HF0A 3FK7A 5HODA 1ETXA 2FX0A 2R92J 2XGCA 3K7AJ 3ZQGA 2HYJA 2M0CA 1A5JA 3B6AA 3CDLA 5IOZA 2DA5A 2M34A 1U8BA 1F43A 5IP9J 1W0TA 3CMYA 2ECCA 1R9TJ 1Z77A 4IEJA 1AKHB 2DA3A 2D5VA 4MFDA 2JA5J 2VI6A 3BTJA 3BG9A 3DCFA 2Y2ZA 2WAQN 3CQZJ 3I4MJ 3BR6A 2CRGA 2DA2A 1IJWC 2IAIA 2JMWA 3S1RJ 3C2BA 2JA6J 1JUPA 2L7MP 3JRGA 5BNGA 1FIAA 4FCYA 3S1MJ 3PO2J 1MNMC 5IYDJ 3QPSA 3S2HJ 1P7IA 2HI3A 4D5FA 3HOWJ 1MBGA 4D7NA 4JX6A 3W6VA 4I6ZA 4BY7J 3HB9A 3HGGA 1OCPA 2CQXA 4DYRA 4A3MJ 4XRMA 1IRZA 2HDDA 4A3EJ 3GBGA 1K83J 3S2DJ 1P7JA 1TWFJ 1AHDP 2HOSA 1GUUA 2R5YB 2M2EA 1PUFB 2EZHA 2JA8J 5EDNA 3GTKJ 5EZGA 2COBA 5FKOA 3OSGA 3JRHA 4DZJA 4A69C 2K40A 2I10A 3OOUA 3ZQHA 5M3MJ 1IV6A 2CUFA 2DN0A 2HXIA 3JRIA 2WB1N 4I76A 2TCTA 1ZGWA 1NTCA 1ZK8A 2LY9A 4A3CJ 1B72B 5EYRA 4IHVA 1ZKGA 4W1UA 2ECBA 2HOAA 2XB0X 1I3QJ 3QPLA 4XIDA 1GV2A 3RZDJ 3UKGA 5J1YA 4FTHA 2QCOA 3IH4A 3ZQCA 5EGOA 1ZQ3P 5IYBJ 1G2HA 1I50J 2JK3A 3H0GJ 3HEFA 5IYCJ 1I6HJ 1ORKA 5M3FJ 1QVUA 3HGYA 5E3OA 3GTQJ 1B8IB 1S7EA 5DS9A 1T33A 5K7HA 3RZOJ 2PMZN 1RR7A 2LKXA 2FJ1A 2JJ7A 3A03A 4M3FA 1WGXA 5F27A 2FD5A 1JTXA 2E1OA 3FISA 3ZOBA 1YRNB 2XPVA 1GDTA 1JUSA 4A3IJ 3O8GA 2GLOA 4DYCA 3IH2A 5IP6A 5FLVA 5IPAA 2E19A 3A02A 2VPRA 2LTPA 1DU0A 5J3LA 4UUSB 1TWGJ 2Y30A 3LSGA 5IP7J 3G1MA 1X58A 3GTMJ 5FKLA 1QPIA 5F0HA 3LOCA 1ITYA 2ID3A 1NK3P 4QTRA 4M3BA 3S14J 1EF4A 3HM5A 1FJLA 3TW6A 5FLMJ 3BR3A 5K7ZA 1U78A 2W48A 4CYCB 3S1NJ 1D5YA 1APLC 3JRFA 3DEWA 2DA6A 2L0KA 3Q3SA 4HNVA 1W0UA 4Y52J 1ZR4A 3JR9A 3A01B 1UMQA 4XK4A 3RKQA 2EH3A 1U9NA 4S0HB 5C44J 1O4XA 1LFUP 2Y0SN 2H8RA 1T56A 2IEKA 1X2NA 5GPAA 1HCRA 4G12A 3ZQIA 4V2FA 3Q0VA 3NAUA 2NS8A 1QRYA 3Q0WA 3O8HA 4IHWA 2N8GA 5F08A 3G1OA 1HDDC 5C4JJ 3S16J 1WH7A 4AUXA 2M9HA 3GTGJ 1POGA 3JREA 3TW7A 2LFBA 3MKLA 1JT6A 1SFOJ 1E3OC 2LVSA 4B3AA 1BJZA 1HLVA 2EQRA 5M5XJ 2R5ZA 4M6VA 2L7ZA 2CU7A 4L5EA 3HOXJ 1AKHA 1H89C 3MVPA 1ETYA 2R5YA 1TWHJ 3QQAA 3GTOJ 3RQIA 1FIPA 3BG3A 3S15J 1MBJA 2NS7A 2E2JJ 5F04A 2YUSA 1GV5A 3L1PA 3BTLA 3JRDA 2XPWA 3HKZN 4W97A 1Z0XA 3TP0A 1H8AC 3GTLJ 5E3LA 1NK2P 4JX4A 1ZTRA 3SDGA 4GFBA 4DYQA 1JKPC 3FK6A 1JKRC 3HOYJ 3JRBA 2YS9A 1VI0A 2E2HJ 2DJNA 4MO7A 4C3JJ 2JA7J 3WHCA 2DA4A 3LSPA 5F0CA 4QSHA 2R93J 2XB5A 1DU6A 5E3MA 3F0CA 5J1UA 4JP0A 2LR8A 1RKTA 2JN6A 3MN2A 2LP0A 2H1KA 1XS9A 1WI3A 2LK2A 3LSRA 4D5CA 5EG0A 1TWCJ 2G0EA 1TC3C 4A93J 3IH3A 1LE8B 2KT0A 3TEDA 1RPWA 3PM1A 1MBKA 2HXOA 4X6AJ 1CQTA 1Y1WJ 4XICA 5FKMA 1OCTC 4V2GA 4AC0A 1VFCA 4Y7NJ 1HDPA 4ABZA 1MBHA 2CQQA 1RESA 4X1EA 3JRAA 5JLWA 1BA5A 2NOGA 1GT0C 2OPTA 4QIWN 4JX5A 2EBIA 3ZQLA 3ZQFA 5GPCA 1BW5A 4BXXJ 1IDZA 4RDUA 4M3EA 1TWAJ 2B63J 2RAEA 2R5ZB 2XSDC 3BT9A 1OFCX 2NVXJ 3BR2A 2MGQA 3VPRA 4C2MJ 5C4XJ 1UG2A 2EZKA 1ETVA 9ANTA 4A3LJ 4B1RA 2X9DA 2ZB9A 2CUEA 2XRLA 3PO3J 1JGGA 2MSYA 5DTDA 4C3HJ 2Y9YA 1JKQC 3GTPJ 4M3DA 1ETKA 3HDDA 2DMQA 2K9QA 2NVTJ 4EEFG 3A01A 4IHYA 4RBOA 5FKNA 1IC8A 1LFBA 1WCMJ 3WHBA 5FJ8J 3HOUJ 1IG7A 4BBRJ 1MSEC 2XGDA 4A3DJ 4BBSJ 1YRNA 1GVDA 4IHXA 2YU9J 4MLOA 2ELKA 2Y31A 4DZPA 1JJ8C 1VF9A 2VUMJ 1JKOC 4J19A 4FISA 2NVQJ 1VNDA 4FE7A 2ME0A 3BR1A 5EEAA 3G1LA 3TP3A 2DA1A 2XGEA 1RETA 1JT0A 2DA7A 4A3KJ 3HOZJ 1ETQA 1JUMA 1ZR2A 1WH5A 1Q1VA 3BG5A 2K9SA 4C3IJ 1MH4A 4CYCA 4A3FJ 1K61A 2Y9ZA 3S1QJ 1AU7A 5F1JA 1HOMA 2M8GX 4FE4A 2OF7A 5E3NA 4M3GA 1B72A 3SFIA 5JLXA 4LOCA 1JTYA 3S17J 3M3YJ 3BR0A 1FTZA 4MIMA 4D7MA 2LLKA 3HOVJ 1BW6A 1U9OA 4B4CA 1X2MA 2AO9A 1MH3A 2CJJA 1A6IA 2DMTA 2EZLA 3SJMA 3LSJA 5EF6A 1B8IA 1IUFA 2E2IJ 2LD5A 2MW8A 3BQZA 2AHQA 2R7ZJ 4XRSG 2R0QC 5GP9A 3OIOA 1ETWA 1JJ6C 5EZHA 2NVYJ 1SANA 1F36A 1PUFA 2TRTA 2HOTA 1OJLA 3K2AA 2ME6A 5J1RA 2FQ4A 2QF7A 4JYKA 4UUSA 1H88C 3NARA 1FEXA 4DW6A 3B6CA 1WPKA 1FTTA 1IGNA 2O7OA 4MFEA 4BY1J 1MSFC 2K9NA 2HQ5A 3FIWA 4A3GJ 4NDLA 5IOYA 4UUTA 2MG4A 2GM4A 4XRSA 2ID6A 3IV5A 5M5WJ 2O8KA 3JRCA 1QVTA 4AYBN 5F0FA 1LE8A 3BTIA 2EZIA 1BL0A 1UHSA 3GTJJ 2VKEA 1MBEA 3E7LA 1XC5A 2DMNA 1XG1A 3BR5A 3I4NJ 2X6OA 5M5YJ 2WV1A 5EGOB 2L7FP 1IDYA 2L9RA 4BKXA 1ENHA 2XPUA 3LNQA 3HBLA 5FKKA 3H3VK 2X48A 1Y1VJ 2O9LA 2JWTA 2DMUA 3OSFA 3D1NI 3BQYA 1ETOA 5EG0B 3M4OJ 3FKIJ 2DTZA 2DMPA
chains in the Genus database with same CATH superfamily
5C3EJ 5K7FA 2GBYA 1RKWA 3D5SC 1MBFA 2P4WA 2MABA 1WHUA 4LG0B 1E17A 4ASNA 3UR3C 3SYTA 3MZYA 2DT6A 3K7AJ 4GYIA 4Y15A 1G59A 3ZQQA 2G9WA 4EJVA 1A5JA 4ZTFA 5CQEA 2DA5A 3K2ZA 5IP9J 3KEQA 1T6SA 3CMYA 1VQOI 2ECCA 1S29A 1Z77A 1T2KA 1PVEA 2RKHA 1H9TA 3VSLA 3ZMVA 3SZPA 3I4MJ 1R5ID 3HKZA 1X4OA 2O6GE 1LDJA 4M6YA 1UAAA 4ETSA 2L5QA 2IAIA 2JA6J 3C2BA 1P4WA 1Y0NA 1YYVA 4E7ZA 2L7MP 2A3SA 5KCMA 3DEUA 3PO2J 2MC4A 4UUVA 1DP7P 3S2HJ 1LDDA 2M30A 4JX6A 5ED4A 2LREA 3J80K 4I6ZA 2CUJA 3JW4A 3MQ0A 2ZO4A 4IRGA 2Z33A 4BACA 1MJ9A 5J8CA 2WA0A 1IO2A 2KISA 4KUMA 3KP4A 5DD4A 1K83J 1OCOH 1P7JA 3VYRB 3F8FA 2HOSA 4A5NA 3ZP5A 2RREA 4KT5C 2R5YB 1T0FC 3H35A 4BGDA 5FROA 5EDNA 4ZYDA 1H0MA 3GTKJ 2DK5A 2RQPA 2GWRA 1O3QA 3RKXA 3CC7I 2KIQA 2XKPA 2I10A 2RC4A 3DLAA 1LNWA 2MYSA 2HXIA 2E1MB 2WB1N 4EQQA 4I76A 4IJAA 3MKZA 2V4JC 2PBIA 4NC6A 3DPLC 5CVRA 5E20A 4BHPA 3KYCB 3LSKA 4LK1F 4OOIA 1ZK8A 1OYIA 4IHVA 2HZDA 4HX8A 1D3YA 1BM9A 2V79A 3QPLA 3IRQA 1JI8A 1S9HA 2OQRA 3IUOA 4FASD 3SDBA 1BIBA 3DWLE 2I8DA 2X0LA 3LSHA 2FSWA 4RMNA 2QCOA 1VZ0A 5H6RA 3ZQCA 1ZQ3P 2NYXA 1P4XA 1QU3A 1I50J 2FOKA 2JK3A 5GTHC 1I6HJ 1ORKA 5M3FJ 3SHFA 4HAMA 4EJTA 2LBFA 5DS9A 2BV6A 3SQNA 3RZOJ 2PMZN 1L0OC 2FJ1A 2JJ7A 3NQOA 5E18F 1D1AA 2HU9A 3LFUA 1G3SA 2FD5A 2E1OA 5DV5A 4KIGA 2XPVA 5DM7F 1JUSA 5E8GA 3O8GA 4DYCA 1FP1D 4KFCA 2KJCA 2EV5A 2E60A 5L3GA 3E6DA 2ESHA 2OA4A 2LC2A 2LTPA 3JAMZ 3U1KA 2G7HA 4F92B 5IP7J 1LJ9A 5FKLA 2GXGA 4IO9F 1IN4A 3HTUA 2ID3A 3R0JA 5CPRB 3T1BA 3OYKA 2STTA 5B5EC 1NK3P 1KQ9A 2QLZA 1EF4A 4IF4A 3PNVA 1O3RA 4N9HA 3S1NJ 2FF4A 2IVMA 3DEWA 3DBHB 3HUGB 3U9GA 1ZR4A 4XK4A 1UFMA 4I01A 3IC7A 3FMRA 4S0HB 4D9JA 3TO6A 2HOEA 3HSRA 3CMEI 2H8RA 3GCMA 1AA7A 1S8NA 3WG7H 1XMKA 1VQ4I 3T5XA 3C7JA 4PJ0C 2IGNA 3OYEA 3IWFA 5JFRA 2DBBA 5GPAA 2KQRA 4G12A 1P9QC 2Z16A 3RPUD 1STZA 4C9YA 4V2FA 1XDSA 3Q0VA 3S8PA 3BZKA 3W2VA 3I0TA 5D6FA 1RUOA 4IHWA 5F08A 3L00A 4AIDA 3E6CC 4E7KA 1IRFA 4AUXA 3TW7A 4IKFA 5D4SA 2LFBA 3K70D 4RM2A 2BVMA 2XAGA 2DCEA 1HXDA 4KMUX 1N25A 5TGTA 4YFXF 2WY8Q 1ZLJA 1YJNI 3LSIA 2V6EA 3D0SA 3EUHC 3PUFA 5M5XJ 2R5ZA 3CP2A 3C2HA 4M6VA 2L7ZA 3WTWC 3JTGA 3WTTC 3TO7A 5H20A 4XL9A 2M7AA 4HSTA 2W4SA 2IGKA 3L2VA 4GXOA 3EQLF 1JHHA 1ETYA 5KK1A 1Z1DA 2XF5A 3G73A 3G3ZA 3HXLA 5FFZA 1MBJA 2E2JJ 4UVBA 3KEYA 2X4HA 4RGSA 2E7WA 3GTLJ 3OYAA 2KHMA 1QGPA 5E3LA 5K1YA 1H8AC 1NK2P 2V1XA 1X3ZB 4RB1A 3HG9A 3JRBA 1JXSA 2E2HJ 1UZCA 2KRCA 2QQ9A 4MO7A 3CTAA 2AQEA 2JA7J 4I7HA 2K85A 2XKOA 1ODDA 3GVAA 2DK8A 3WHCA 4UY8I 5JHFA 2MLGA 3LSPA 2E34A 4BHBA 1K78B 2IS1A 1D8KA 3LQQA 4JP0A 2LR8A 3D5RC 2IGMA 3CF5F 3MN2A 4JK1X 3IAS2 3ZR8X 2LK2A 1N75A 3BG7A 4AU7A 2FBKA 4LIVA 5EG0A 4PGGA 2G0EA 2CW0F 3W2AA 3F8NA 3IH3A 5LHHA 3QPTA 1RC9A 1MMGA 3S32A 3BC8A 4EMSA 3I53A 2QEXI 4PK4A 1Y6IA 1CQTA 1PUEE 4EATA 4V2GA 4A6EA 4Y7NJ 3CUQB 1CGPA 1MBHA 1RESA 2KIUA 1N77A 4L0ZB 3U2RA 5FD6A 2BY1A 1KGSA 4IQJA 1RR8C 1I3AA 2NOGA 4QIWN 3HRSA 4Y3OA 5KNLA 3ZQLA 3CO7C 4NUBA 1DUXC 3TMOA 3GZ6A 3I3LA 1XPXA 1YE9A 4RDUA 2B63J 1JGSA 2R5ZB 4MHGA 4BXFA 2NVXJ 2MGQA 5GAEJ 2FA5A 2EZKA 1WZ2A 4B1RA 2X1DA 2ZB9A 2CUEA 2UV1A 2L9SA 4OWRB 4XSZF 5ERIA 3U21A 1AWCA 1F1ZA 1WVRA 4O3MA 2F5EA 5F64A 4C3HJ 3GTPJ 4A6DA 3DBLB 4B44A 2NVTJ 1OCRH 3BCBA 1PJRA 3WU2C 4BDYA 2GIZA 4EGYA 1YI2I 1VQ6I 2XF6A 5FJ8J 1BI0A 4I2OA 4LIUA 3HOUJ 2NNYA 2M8EA 1WKMA 5HNFA 2XGDA 2BZTA 4BBSJ 2W85A 1GVDA 3VYSB 4IXAA 3LAJA 4IHXA 1WJCA 3HZJA 3RYRA 2BXZA 4XBFA 4BE2A 2OTJI 4I0AA 1JJ8C 4ESBA 1VF9A 2OUMA 1JKOC 4J19A 5CVJA 1VNDA 4G8XA 5E1XA 2ELJA 3MD2A 3G1LA 2VC0A 3ULQB 3WTVC 1JT0A 1FSEA 5DCMB 1USSA 4A3KJ 2Q2EB 3MCZA 1DPRA 2P0WA 1JUMA 1XN7A 4X0GA 3OYHA 1FYMA 1QQIA 3BG5A 3IAM2 3NEUA 2PFBA 3O6BB 2Y9ZA 3VFZA 2R7WA 2BVLA 5L3FA 5A2QZ 2GOXB 4FE4A 1SFKA 5IT3A 4LOCA 3QOPA 3M3YJ 4P55A 3KYLA 1LKXA 3BR0A 2M5WA 4XOPA 1FTZA 1VQ8I 1J59A 1T0FA 2VE9A 2LLKA 3HOVJ 4KIBA 1YS7A 3HC7A 4WXHA 3HSEA 3R60A 3K10A 2ZC2A 1K7AA 2K27A 2CJJA 1IN5A 2EZLA 2X6WA 5J40A 3ZMDA 3BROA 3FXJA 1HSJA 3FBIB 4CA0A 1A31A 4V19K 4AM3A 2MW8A 3O3KA 1SVLA 2JVGA 1W5TA 3KEOA 4HBLA 4E7HA 2ZBKA 2XV4S 1OYWA 1ETWA 2ZCWA 4M73A 2EJRA 4HYEA 1SANA 1T8IA 2VONA 1XGSA 3FF5A 2VPLA 1NH3A 2ME6A 5J1RA 2V1NA 2E1MC 1WPKA 4L5JA 4ZYAA 1FTTA 3K1PA 4ENNA 5DUIA 5B1BH 3KYDB 4XORA 1MSFC 2IT0A 4DIQA 1Z6RA 3K4KA 1EKEA 2QQAA 3QODA 2Q0OA 2CWEA 3TGNA 2ID6A 1BN5A 2HYFA 4XLEA 1FC3A 3I9V2 3UNGC 2FNPA 2BW3A 2HQAA 2QGUA 3ECHA 3W6JB 3WODF 4RB2C 2BOLA 2HVRA 1B6AA 1LE8A 1HQCA 2EZIA 3PIPF 1W7PB 1LDKB 2FBIA 3K4NA 2ZSHB 3TOBA 3GFJA 1Q1HA 2FXAA 3RSNA 4BQNA 1DP3A 3WE3A 1ZGJA 1L3LA 1QNTA 1XB4A 2DJIA 2WV1A 4BL0B 1Y8RB 4HQEA 2L7FP 3E97A 1IDYA 4BKXA 2Q8KA 2XPUA 2JUGA 3LNQA 2X48A 4I09A 3TL4X 6PAXA 2JWTA 4DQ2A 2CFOA 2B0LA 3BQYA 3S2WA 3DTIA 4A3FJ 2DMPA 3I64A 4KIFA 3CCEI 3AG1H 1U6GA 3PQKA 4U7BA 2DOEA 3OYNA 5ICGA 2YX7A 3VB2A 2VKVA 3WTUC 3FK7A 2VXZA 4HLXA 3EUHA 3CUQA 5FRMA 2HPMA 3ZQGA 2HYJA 1REPC 1HW5A 4Y33A 1AOYA 1YW8A 4LG3A 1U8BA 3H36A 1I39A 4HEA2 1F4KA 1ON1A 4HX4A 2EFPA 3VSKA 1Y39A 3WGHA 1ONVA 1R9TJ 4IEJA 1D0XA 2VQHA 2DA3A 3GZNB 4MFDA 2F5CA 2D5VA 1X1CA 2KP6A 4ZH4F 3G71I 3FHNA 4N4OB 2Y2ZA 2WAQN 2L7KA 3CQZJ 2CRGA 4R1HA 4XLCA 5HDNA 2DA2A 2AS5F 5KAFC 1IJWC 4A5MA 2P5LC 3MAJA 3JRGA 1IRXA 1FIAA 4ESJA 2OV7A 4BUPA 3S1MJ 2KDOA 1R00A 4CCLA 3FDYA 3IWZA 5IYDJ 1D0YA 3FM3A 3QU3A 3KFWX 1MBGA 4D7NA 3CCSI 3H1CA 3E6MA 2CV0A 1OCPA 2OCCH 2KRFA 1WQ2A 4RGXA 1XDUA 2AXLA 4XOTA 4CH7A 3RTRA 4RAFA 3WTYC 3S2DJ 1LVKA 3FX3A 4A12A 1KU7A 4OIRF 4P9UA 3A1YA 2M2EA 4ZYGA 1PUFB 1R49A 4RLQA 3GW2A 1TTYA 3J7YJ 1T08B 3ABLH 2FU4A 3K4CA 4FT8A 5FKOA 1HKSA 3JRHA 2Y48A 4DZJA 2PJPA 2V1DA 1LFPA 4WK8F 1IAWA 2ACJA 2VBYA 2K4BA 3COAC 2VT3A 3OOUA 3GLLA 2CUFA 1ZG5A 2ELHA 3ML6A 2HQNA 4QPQA 4EVIA 4RAYA 1ZG1A 2QBYA 4BDZA 5B1AH 2OBPA 1XGMA 2KFDA 4A3CJ 1BC8C 1B72B 1RZ4A 3HOTA 2EA4A 3FXOA 2F4MB 1ON2A 3OYLA 3HPGA 2DW4A 5HDGA 4J00A 2ECBA 2ZMEB 2NVUB 4CCNA 1W36C 5K5QA 4E7IA 1ZH5A 3UKGA 2NOJB 3OS2A 1XGOA 4NHJA 5CQGA 1GHCA 3ASOH 5IYBJ 1G2HA 2BE5F 3K4BA 2V9KA 1QVUA 3MKYB 1QHGA 4I0BA 4U0VA 1T33A 5K7HA 2ZJRF 3DEEA 1OQYA 4P9FA 4F52A 4M71A 2XRNA 2LKXA 2LH9A 2V7FA 1EA3A 1Z9CA 4M3FA 2VODA 2LKPA 4U7DA 5F27A 5F6FA 3ZOBA 5LGTA 1YRNB 1XSXA 2EWNA 2JTVA 1GDTA 3F8CA 1VTNC 1VQKI 2EK5A 1YOVB 1YTYA 3IH2A 5IPAA 2FE3A 3TBIA 3K0LA 5BS6A 5DUKA 1P2FA 2LY2A 3PFYA 4E7SA 5J3LA 5DYMA 4UUSB 1TWGJ 3E5UA 1DPUA 1R4NB 3LSGA 2FRHA 3H9QA 1QPIA 2DU9A 5F0HA 4RM3A 4KT6A 3HRUA 3FZVA 5E1ZB 3RJPA 4QTRA 1MIJA 4YELA 3HM5A 4G9YA 3OYMA 5BPIA 2W48A 3TDZC 4PFPA 1D5YA 3ZRGA 4F7ZA 1ZRCA 2DA6A 4HNVA 3OYGA 4WXDA 5LD2C 1W0UA 3I5UA 4HV6A 3FMQA 3JR9A 2JRMA 1WJDA 4RB3C 1K79A 3RKQA 2EH3A 2QUFA 1O4XA 1VQ7I 2CO5A 2VL8A 5LFAA 1W7PA 2CW8A 4IOCF 3ECOA 4IRHA 1T56A 4LG0A 4TV7A 1X2NA 2MLKA 1TW2A 2YPRA 3Q9VA 3ZQIA 2W1OA 1SD6A 1ACIA 2QVOA 2NS8A 3SEQA 3GF2A 1MGTA 4WCGA 1ULYA 3E5XA 2R4GA 2UUZA 2W00A 1HDDC 4Y13A 5C4JJ 2A05A 3F8BA 3QP6A 3OS0A 2M9HA 2JSPA 2WBMA 3EETA 2V26A 3GTGJ 4HZFA 4OIOF 4CCOA 1OKRA 3H5NA 3MKLA 2IS2A 1IXSB 1JT6A 2L3DA 4B09A 2FUG2 2LVSA 1BJZA 1HLVA 3T8TA 2EQRA 4U87A 5CVIA 2P5KA 3CO6C 1HKTA 2MFZA 1EH6A 5LEKA 2CU7A 4IPAA 3VOEA 1BI2A 4XLNF 1Z6TA 4XM3A 4ZTJA 1SMTA 2RNGA 2Y69H 2R5YA 3CCQI 1TWHJ 3QQAA 2R7QA 3GTOJ 3WTZA 2Q2EA 3BG3A 2F6CA 3LQRA 3PUBA 3S15J 1D0ZA 4ZJZA 1FOYA 1Z7LA 4L9TA 4IRIA 2YUSA 1SVMA 1UHMA 1GV5A 3L1PA 3IHUA 3JRDA 3E5QA 3QRFF 4JX4A 4L9JA 2RNJA 2L2OA 3SDGA 3ONQA 1O3SA 4H4KC 1JKPC 2DAOA 2PMHA 3HOYJ 3L7WA 1FPQA 2YS9A 4YFNF 1KZHA 3IKVA 2DJNA 2EFNA 1R71A 2O3FA 3A0HC 4R79A 3FXRA 4FHTA 4C3JJ 3OYFA 3EUAA 3E3VA 4MGRA 3GO5A 4PCQA 5F0CA 2P8TA 2CQKA 5ICEA 2XB5A 1DU6A 1FWZA 1P6RA 1RKTA 4GRIA 4PJJA 3HJEA 1XS9A 1EJ9A 4EGZA 1TWCJ 1TT5B 4LLLA 4DBQA 1OISA 3DQVC 4D1QA 3I59B 2R7SA 2Z9OA 2QENA 1O3TA 3TEDA 5D5UB 3LMMA 1RPWA 1IF1A 2HXOA 2QQ8A 2PN6A 4GCVA 4MTDA 4HA8A 4AC0A 2IW5A 4D0PA 3G6EI 2WWYA 3VEPA 2ICWG 4KN7X 5FRNA 5JLWA 3C2GA 1OR7C 3DXJF 1KQ0A 1BA5A 2JVHA 3FXLA 4H0EA 4JX5A 3RKYA 3ZQFA 4U0YA 1K6YA 2DDAA 3HHHA 1BW5A 3CJQB 1RRJA 4BXXJ 1EH8A 2KPMA 4B8XA 1R7JA 2A07F 1MMSA 3GZ5A 3AL0C 1NG7A 3VPRA 3DV8A 4PUSA 1ETVA 4A3LJ 5E79C 2X9DA 1IW7F 2IA2A 1VQLI 3A4CA 3H9GA 2BY0A 3H5RA 1HKQA 2MSYA 4MNUA 1N78A 2HVQA 2Y9YA 3HDDA 1ETKA 2DXIA 2PMUA 4ENJA 1FOXA 2DFHA 2DYRH 3BJOA 2A69F 1OLTA 2MC3A 2H27A 2VC1A 4RBOA 1IC8A 3V8JA 4UB8C 2DT5A 2L9NA 4BBRJ 1MSEC 2HKOA 5HOOA 4A3DJ 5JHUA 4XNFA 1YRNA 1X1DA 4RB0A 3CD6I 3N05A 2ZNYA 4M9XA 4RS8A 5FGMA 2ELKA 2Y31A 1YW9A 2R7DA 4G6DA 3WE2A 3OYJA 1S6LA 2VUMJ 2DTRA 4FE7A 1X1PA 3BR1A 2L02A 2XAUA 1SEUA 5BPDA 4KNYA 3VODA 3VWBA 2YR2A 1WJEA 2WAFA 1YHQI 4I98B 1NHAA 1JE8A 1BC7C 2DA7A 1BOBA 2IS4A 5J4YA 3HOZJ 4B3XA 2GQQA 1WH5A 1Q1VA 2K9SA 4BJ6C 4C3IJ 2M3AA 3MZ8A 2EFQA 3OYIA 2LY1A 2M4KA 5HDKA 4EM1A 5F1JA 2M8GX 1B72A 3V7CA 3OR1C 3OL4A 2H8WA 1JTYA 4BAYA 3S17J 2RGVA 2DODA 5ILVA 5TRDA 1D1CA 1BW6A 1R1UA 2LMDA 4B4CA 3HTSB 1KYWA 4XKWA 2QKMB 2QSGX 1A6IA 3SJMA 3HIFA 2VLAA 2ETHA 2PMZA 2ZXWH 4ZYHA 2EINH 3ASNH 3BQZA 3K69A 3L2WA 5HLTA 1R5HA 2ZJQF 3ROUA 2K02A 2R0QC 2GAUA 3WG9A 3EYYA 1JJ6C 4AIHA 1YJ9I 3F9KA 1U5TB 2RQQA 5D6EA 3GLXA 1XX5A 3K4MA 3FHZA 3QWLA 1PUFA 2TRTA 3BDDA 1FOWA 3PQJA 4RA2A 3PSIA 1V55H 3GUDA 3ZCOA 1Z3XA 1T38A 1J0RA 2QF7A 4JYKA 4UUSA 1FEXA 4MEXF 1I27A 2BXYA 4II3A 4DGWB 3GEZA 3FWEA 4QWQA 2QYOA 3DPTA 3CP8A 4EJOA 1R4MB 4HDUA 1X4PA 4CDGA 2BGCA 1OPCA 3GFIA 1FMWA 5IOYA 2LG4A 1A36A 1WWXA 1G6NA 4A0ZA 2MG4A 2STWA 5B66C 2BY2A 2EPFA 4FX0A 3BOQA 5EEGA 2O8KA 2QKLB 2MBFA 3JRCA 2XHKA 3DKWA 2KZGA 2ZSIB 2J5OA 3KE2A 4CGZA 1XGNA 4KISA 5HLHA 4XMYA 2WC2A 3BPXA 1G3YA 1FSHA 2ISZA 4LK0F 2QSHX 1MBEA 4CHUA 1XC5A 4C2UA 1XG1A 4CZZA 1QZYA 2X6OA 5M5YJ 1B9NA 4BQOA 4CXFA 3P5JA 3HBLA 5FKKA 3ZMUA 2EFOA 4CCKA 4IVNA 3HHGA 3PNTA 1SD7A 2M1BA 1ETOA 3GYHX 3M4OJ 1IRGA 1IV8A 3ZMTA 2W84A 1U2WA 3AFHA 3CLQA 3SZTA 3SFZA 2P81A 2EIKH 4YFKF 3BTCA 1YX3A 4YEJA 1HF0A 3ZXSA 3RQ4A 3CDIA 1ETXA 2FX0A 2XF7A 2R92J 3L9FA 1BR2A 2HDCA 4OMZA 3B6AA 1X1AA 5IOZA 1F43A 1XCBA 1W0TA 2NNNA 1P4AA 1YQAA 3BLYA 3I54A 2JA5J 1O57A 1IN8A 3MMYB 3BTJA 1ZGAA 3TQNA 3L2QA 2R7RA 3BG9A 1LEAA 4Q5SF 2VB6A 1TT0A 4XSXF 1S7OA 2PLYA 3BR6A 3C3WA 3DP7A 5JVGF 1MNEA 3H3UA 4LGWA 1O7FA 1FX7A 3OIPA 1RIOH 5LHGA 4LFUA 4BNCA 1FT9A 3S1RJ 1G8XA 3HUGA 2EIJH 1JUPA 2O8XA 4G7OF 2L9VA 4FCYA 3QPSA 3W3CA 1P7IA 2HI3A 2IS6A 3HOWJ 4BHCA 3W6VA 3HB9A 1MNDA 4A3MJ 4XRMA 2DPUA 4I99C 1IRZA 2HDDA 3Q5FA 4A3EJ 3GBGA 4YIRX 4JBAA 2MD5A 1VQ9I 3C1DA 4E70A 3LL7A 1LB2A 4OU0A 1M1EB 1V5GA 3TOAA 1TWFJ 2R7UA 1AHDP 2MH2A 2HPIA 1GUUA 2VBZA 2LBFB 5K5OA 2EZHA 3GWZA 1BJAA 1V54H 3DTEA 5LRSA 2COBA 3A0BC 3OSGA 1G3WA 3BCAA 3BWGA 4E7JA 3MZHA 1DDNA 1MMAA 1FLIA 2VOPA 2HZTA 2K40A 4OIPF 1FMVA 3IKTA 4XLHA 4CCMA 4XKVA 2COMA 3ZQHA 4BEHB 4BU2A 2LKSA 3WU1B 3KP7A 3ERED 1IV6A 3JRIA 3M8JA 2KIFA 3KLNA 1FBSA 4WXCA 3ZGKA 1VQNI 3F72A 1ZGWA 1V5FA 1V3FA 2OZ6A 2A5YB 4HPQA 2LY9A 3QOEA 4ZDPA 5EYRA 1ZARA 1Y8QB 5LGUA 2JPBA 1I3QJ 5GAHJ 4XIDA 3OYCA 4GDFA 4ON0A 3ZMZA 2A6HF 3CCLI 3I55I 4G6TB 4AD9A 5J1YA 1TNSA 3IH4A 1TQMA 1A6QA 3H0GJ 3HEFA 3F23A 5EEHA 3HGYA 5E3OA 2CSOA 1P92A 2QQBA 2L01A 2Z2SB 2E1CA 2C6YA 5HNHA 2HR3A 1B4AA 2XDVA 1T98A 3A03A 1NG6A 4PJLA 4F55A 4YIIA 1J09A 1WGXA 3DBRB 4LLGF 3DTKA 3PNYA 4IQ4A 3FISA 3F6OA 4A3IJ 5JVTA 5IP6A 5FLVA 1BR1A 1FY7A 2HDWA 1HC8A 4S04A 3KP2A 4AWXB 4G7ZF 3TO9A 1DU0A 3LSMA 2Y30A 3M9AA 1E3HA 5CJ9A 2FNAA 2X1EA 3GTMJ 2XUBA 1UELB 1J9IA 1ITYA 1O7LA 3V8KA 2MH9A 2XAFA 2HTSA 4NBQA 1D5VA 4BJTA 4M3BA 3S14J 3TW6A 5FLMJ 1U78A 3PL8A 1J75A 3WTSC 2R7TA 3BJAA 3HRMA 3JRFA 1W4MA 2L0KA 4BQAA 2K9LA 2ADUA 3R61A 3QAHA 5IT9K 1U8RA 5J8FA 3QP5A 1LFUP 3M1CA 4HG2A 1PDNC 2P6TA 3AL0B 2IXSA 2MD0A 2PQ8A 1TBXA 3KLOA 5ILSA 2IEKA 3LFKA 2XAHA 3KZZA 2R7XA 4BEHA 4XLFA 4NQWA 3Q0WA 3O8HA 2CYYA 5FFXA 2ZNZA 3EUKL 1E0EA 3RI4A 2ZJPF 1POGA 4XR6A 3JREA 1C0WA 2GXAA 3CF2A 2VT2A 3M1EA 2V9PA 3FXKA 1WJAA 4YRVA 1E3OC 4BH9A 4B3AA 4B47A 1PYVA 1SFEA 3DU5A 3RPUA 4N4NB 4KITB 2L4AA 3JSOA 1ERDA 1KU3A 4XN0A 2X1CA 4M9SA 2GA2A 2DT7B 4CZCA 3MVPA 4NC7A 4Q4ZF 3HOXJ 1AKHA 3ZPLA 2AXTC 4F91B 2M7BA 2R7FA 5KVRA 2R7VA 1FIPA 3KZIC 4RLFA 1QPMA 5F1RA 1QZEA 2IA1A 5BMZA 4KMFA 2PX9A 5CLSA 3BTLA 1ZELA 3HKZN 3TP0A 2HGCA 1QO0D 1XMAA 2FBHA 1TQIA 5J4VA 3HOSA 2BY3A 3L2RA 4GFBA 2XVCA 4E4HA 3ABTA 1HA8A 2O0YA 3FK6A 3E1SA 4BS9A 2F5VA 3CCJI 3P7NA 2I5UA 1R1VA 2R93J 4DOZA 4EJWA 3CLOA 4L9NA 2BHZA 3M07A 2DOFA 5FD5A 3F0CA 4DJAA 2YU3A 1JHFA 2LP0A 2H1KA 3K6GA 1WI3A 3AAFA 2UXXA 3REOA 3LSRA 2RVCA 1BI1A 2A61A 5DD8A 3OS1A 2GOMA 3HSFA 3FXMA 3CCUI 2NRAC 4HV5A 4A93J 2K5CA 3PM1A 4PSXA 3Q9SA 4X6AJ 2H1LA 1Y1WJ 1E3PA 4XICA 5FKMA 4PDKA 5FLXZ 1HDPA 2XASA 5JR3A 1F5TA 2E5ZA 5KAIC 2E36A 3JRAA 4X1EA 4ZZDA 2DI3A 2W57A 1YFHA 5IT9Z 1SVOA 1IN7A 4XKCA 1GT0C 2HWVA 3R0AA 5ICCA 2EBIA 2IGOA 3LA7A 1VQMI 2W82A 3J81Z 2A6EF 3OR2C 1TWAJ 2CS3A 2XC7A 3P9IA 5CKTA 5HS9A 2XSDC 3BT9A 1OFCX 1SD4A 4Q47A 5FLXK 2BBYA 1ZAOA 4EV0A 5C4XJ 1R36A 5H2FC 1Z21A 9ANTA 4N0BA 1W7PD 1R23A 5LBQA 2V1UA 2BW3B 1MMDA 4G7HF 4BJ5C 3PO3J 1JGGA 1W5CC 2B9SA 2KL4A 5GAGJ 4M3DA 1PP8F 4UVCA 2DMQA 1V4RA 2E1NA 2RV8A 2AQFA 3EYIA 5D5XB 1KU2A 2X85A 3CCVI 2VKDA 1SFUA 4XLPF 1SD5A 3WHBA 2EILH 1IXCA 3MWMA 5GADJ 4OINF 1IG7A 3BJ6A 2IJLA 5J6XA 3BY6A 2D1VA 2FOWA 2VE8A 1FYKA 2D2WA 5GTIC 2CV1A 2YU9J 1SFXA 2CV2A 3A2KA 2H6BA 1GXPA 1WJFA 4FISA 2NVQJ 1IUYA 2ME0A 5L3CA 3TP3A 4BE0A 2BEOA 5D5WB 1TLHB 2DLLA 4F3QA 4WX9A 3ABKH 1USTA 4C30A 3WGGA 4KA4A 3GFLA 3BZCA 4RGRA 2HYGD 4A0XA 2BYVE 4CYCA 1TP4A 3S1QJ 2O5RA 2OU2A 1TW3A 1LQ1A 4OAZA 3FXUA 1AU7A 4OAYA 3ZMSA 1RI7A 5E3NA 2OF7A 4M3GA 5JLXA 4M74A 1Z7UA 1U0JA 2F5FA 5FB2A 2GZWA 1QBJA 2B7EA 2H94A 5H6QA 2E7XA 2VBXA 3QYEA 2DYSH 1XD7A 2K3FA 2DDBA 4D7MA 1U3EM 2DQRA 2O03A 3HPHA 2Z99A 3OY9A 3GXOA 3GMEA 4I02A 1MH3A 5LGNA 1MJBA 1LPQA 1FOKA 2DMTA 2ZXIA 3KPHA 5KHDA 3LSJA 3F22A 1B8IA 1X3WB 4NQWB 4EJUA 2V6CA 2IPQX 1YS6A 3ABUA 3CC4I 4XRSG 1OCCH 1R5GA 4AVPA 2F48A 5L3BA 3DKXA 3AG4H 3LWFA 4ANJA 2ZFUA 1KU9A 5EZHA 1MMNA 2NXNB 3L09A 4K2EA 1F36A 2VQCA 1J2XA 3OMYA 5DCMA 4KICA 1OJLA 2JRTA 4RGUA 3CJRB 3K2AA 4ZYEA 2FQ4A 1DQUA 2CQNA 3OIQA 4HW0A 3NARA 5TISC 4DW6A 1H88C 3J7ZI 1Z67A 3B6CA 1HW2A 1KONA 4Z6YA 1IGNA 4MFEA 2BHYA 1HSTA 2K9NA 2HQ5A 3CJTB 3CZ6A 3FXQA 4GYGA 4N9IA 3FIWA 1D8JA 2XSJC 3DU6A 4FETA 4UUTA 3CJNA 1OR7A 2WAEA 3W6KB 4XRSA 5M5WJ 1S72I 2RDPA 1G3TA 4CYDA 2D45A 1BOAA 1QVTA 2EA2A 2ZKZA 4AYBN 5F0FA 2VXDA 3N97A 3KP3A 3V4GA 1R58A 2P7VB 3E7LA 4LD5A 3EPZA 3OWTA 4U88A 3U1DA 3B73A 2L9RA 2Z1DA 1ENHA 2VOOA 1S3JA 1OYYA 2HFHA 2JZYA 1BIAA 3K1MA 2ZMEC 2ESNA 2O9LA 2UWMA 2GXBA 3CC2I 3RCOA 3FKIJ 2TCTA 5B3SH 4HF0A 4EM0B 3LA2A 5AONA 2IBDA 2KDZA 4A3BJ 2OZUA 3KIOA 3CCYA 3GX4X 3Q0UA 4A3JJ 5HODA 2R7OA 5EJCA 1F9NA 1YIOA 2VIXA 2XGCA 4CICA 1ZREA 3H9JA 4CUGA 2M0CA 2YX4A 3CDLA 2EV6A 2M34A 2IRFG 1AKHB 2PG4A 4ENMA 2P5VA 3FM5A 4UXNA 1I1GA 1J5YA 2M45A 2VI6A 1WRJA 5IY5H 2J5PA 3DCFA 4S05A 3WTXC 2OJED 2ZXHA 2DFFA 2KRHA 4HSRA 3IRRA 3M8EA 4PGHA 4HDVA 2Y75A 3CMMA 2QBYB 2JMWA 2M4GA 2LOOA 1CF7A 5BNGA 2X6YA 1MNMC 4UV8A 4AVZA 2UXNA 4ESFA 4HQMA 4LB5A 1YX5A 4D5FA 2H09A 3HRTA 4PFOA 2HVSA 4BY7J 1MW7A 1YO5C 1MJAA 2ZFWA 3HGGA 1SAXA 2CQXA 3JTHA 1ZLKA 4DYRA 4UNOA 3VYUB 2LNBA 4WWCA 4A2UA 2GIVA 1XMXA 2CH0A 2XGXA 3RKWA 3R4KA 3H3ZA 3AKZA 5HVQC 5A2QK 5AIPA 1HBXG 1X1BA 3ZQ7A 3M7GA 2CFXA 2Z3YA 3G4SI 1FBQA 1YW7A 2JA8J 4XKBA 3H5AA 2CUZA 1QA6A 4NNJA 5HLGA 4ZZLA 5EZGA 1YITI 2K4JA 3SXYA 3KP5A 2DQLA 1K78A 2KMUA 1ZN2A 3G2BA 4A69C 1KA8A 2G7UA 5JI6A 3QU6A 1E2XA 4KYWA 1S5LC 4KN4X 4ENKA 1XSDA 2QZ8A 4HLYA 3N4MA 4BXUA 5M3MJ 2DN0A 3J7AY 2W7NA 1NTCA 1A04A 4UB6C 1IXRC 4RAGA 5CYVA 3RPQA 2UZKA 1XSVA 1ZKGA 2DO7A 1UG0A 2OAZA 2VJ4A 4W1UA 2HOAA 2FEZA 1TZLA 2XB0X 4QPOA 1GLNA 1GV2A 3RZDJ 1X19A 1Z91A 3WU0A 4FTHA 2CGPA 3CDHA 2D1HA 2Q1ZB 5EGOA 2K86A 3J80Z 3S3NA 4O5VA 5IYCJ 1Z05A 2JT1A 1X3UA 1MDMB 3GTQJ 3MEXA 1U5TC 1B8IB 3L2CA 3OYBA 1GXQA 1S7EA 2IP2A 3DFGA 4RAZA 2EB7A 1UJ8A 2NAZA 4M6XA 1OMIA 1RR7A 5E1WA 3RYPA 1DGWY 4HOBA 4BYYA 1T39A 4YG2F 1TNTA 1JTXA 3ZN0A 1SMYF 2MA3A 1G4DA 4LJZF 3LAPA 1RNLA 2GLOA 4YIFA 2E19A 2EV0A 4PJNA 3ISPA 3A02A 5CVUA 2VPRA 2VASA 4MTEA 5ILUA 5CVVA 1D1BA 1S7AA 1DGRM 2VKHA 4IOAF 1MZBA 4MQ9F 1I1SA 3IL2A 3G1MA 1X58A 2DPDA 2CW7A 5K5RA 3DF8A 3LOCA 3WGIA 3OV8A 5L3EA 3KX2A 4XONA 3LA3A 4A0YA 1QHHD 1SAUA 3P9KA 1SC7A 4IX7A 1FJLA 3BR3A 5K7ZA 1U5TA 2KIMA 4CYCB 1YJWI 1APLC 3T8RA 2CQ7A 3R6SA 3Q3SA 3I4PA 4IHTA 4G94A 4Y52J 3OL3A 1FP2A 3J81K 5L3DA 5DDGA 3A01B 1UMQA 1W36D 4M72A 1U9NA 5C44J 4AYBA 2HNHA 2K3PA 2Y0SN 3I58A 2PJRA 4II2A 2OQGA 1XCVA 1VQPI 4IHSA 3PIOF 1HCRA 2OCEA 4PJMA 2DFEA 5LRRA 2PEXA 2QWWA 3LSTA 3NAUA 3EDPA 1YLFA 4DBRA 1QRYA 3BPVA 1LEBA 2N8GA 3G1OA 1LVAA 2JA2A 1K4TA 4Y4RA 3S93A 3S16J 1WH7A 2KKOA 3H92A 3I71A 4NC8A 1UCRA 2LSOA 4UHTA 2EFWA 2IA0A 1WFXA 2QSFX 4O6JA 1SFOJ 1FZPB 3I59A 2VJ5A 2HEOA 4LLNA 3F6VA 3QYBA 2V9VA 5HS7A 2LRDA 3BG6A 2XAJA 4JQFA 4WF2A 3S3MA 4L5EA 5D5VB 1H89C 2QA4I 4MEYF 4R8HA 2RN7A 3K9TA 3FKJA 2DOAA 5LHIA 3RQIA 4XQFA 2E35A 1FYLA 2NS7A 5F04A 2HTJA 1B1BA 2XPWA 4W97A 1Z0XA 4KJZA 4M9ZA 4ZDLA 1ZTRA 3V8LA 4DYQA 2NS0A 3HYIA 3H0DA 3S3OA 1B9MA 2JSCA 2WY7Q 1JKRC 3CCMI 1VI0A 2FMYA 4QLCU 3P9CA 2WTEA 4HNUA 1I5ZA 2DA4A 2DFIA 4F93B 4FX4A 1ZRFA 1KYZA 2GA1A 4QSHA 3J7AO 2A5WA 2LF7A 2P7CB 5E3MA 4DNCA 3SZGA 5J1UA 2XAQA 3CUOA 5DCFA 2JN6A 2XROA 2PJRB 5D4RA 1PP7U 3ERMA 4D5CA 1A35A 3JCUC 2OD5A 1TC3C 3KETA 1LE8B 4L5IA 5HS8A 2KT0A 4BQQA 1XTAA 2JQ7A 2A68F 3ZN1A 4E7LA 1MBKA 3X2QH 1YIJI 3DKYA 2E5NA 1OCTC 4J01A 1VFCA 2H6CA 4ABZA 2CQQA 3NRVA 2ZXJA 3FBNB 3V7RA 3RDIA 5AIQA 2F4IA 2FMLA 4MQVA 3KCCA 4EM2A 4ZDOA 2OPTA 3F3XA 2FQ3A 3HL2A 4U0WA 5GPCA 4FQGA 2HS5A 2XIGA 3M8FA 2WADA 1IDZA 2ISYA 4M3EA 4XRFA 5BQTA 4KDPA 2VQLA 2WAQA 2RAEA 1MKMA 2F4OB 4LB6B 2HKXA 3QPHA 3VYTB 3BR2A 1WSUA 4C2MJ 1H9GA 3SEZA 1UG2A 2OTLI 3B02A 3K70C 2F2EA 2X51A 1Z3YA 3CESA 4E6KG 3VDXA 2XRLA 3F21A 1CF7B 1YG2A 2JPCA 2VBWA 1KQ8A 1ZHFA 5DTDA 1JKQC 2LDUA 1K6OA 3K4LA 3JAMK 2E71A 2PI0A 2ZJ2A 4GGGA 3T0YA 2K9QA 1FBUA 1WJBA 3RIRA 4EEFG 4OIQF 3OOPA 3KP6A 2TDXA 3A01A 3MFKA 4IHYA 1B59A 1W1WE 5FKNA 1UB9A 1LFBA 1WCMJ 2L54A 3CUQC 1ZRDA 3TDUC 2X6XA 3K4JA 2Y0SA 2W24A 1R6RA 1WJ5A 2WV0A 4MLOA 2LF8A 1BBYA 4DZPA 3QYFA 2VQGA 3E0JB 2VJJA 1I6XA 3JSPA 4AIJA 3F8MA 5EEAA 4OMYA 3PJRA 1HW1A 1W5SA 2KZVA 2DA1A 3KZYA 4XN3A 4Z2YA 4CCJA 2XGEA 1RETA 4PZJA 1MD0A 3ABMH 3O2PE 5LEJA 2M0MA 2K9MA 4XLAA 1ETQA 4P1WA 4ZC3A 3CMAI 1ZR2A 1R22A 5DM6F 2F5DA 5D8LB 1K61A 1MH4A 3CCRI 5E17F 4L0YB 2CG4A 1VQ5I 3NWTA 3ESWB 1HOMA 2EIMH 4L9VA 4NB5A 4CO8A 3SFIA 4HF1A 4IZZA 2Z5UA 4C2TA 3NWSA 4LMYA 4HF2A 2VJIA 3C18A 1ZG3A 4MIMA 1U9OA 1Y0UA 4P96A 1T95A 1X2MA 2AO9A 3E6BA 2CMPA 3DPUA 2K7LA 1BR4A 4G6QA 4ITVA 2YSRA 1IN6A 5EF6A 2VN2A 4Y17A 4L18B 1IUFA 4CSWA 1MDMA 2E2IJ 3V42A 2R3SA 1WI9A 2LD5A 4PSWA 2AHQA 1EV7A 5TJJA 3ELKA 2R7ZJ 1QZZA 2WB1A 5GP9A 1BI3A 3BP8A 2P6SA 3OIOA 2M87A 4HX7A 5ICFA 2HQRA 2NVYJ 1J7KA 1OCZH 2Y0MA 2HOTA 1TQPA 2KLOA 3GFMA 4B48A 3AG3H 4IL6C 5FO5A 5DEQA 5LLQA 5BOXA 2O61A 4Q48A 1UHWA 2ZMEA 3V7SA 4HRIA 2O7OA 1EH7A 4UVAA 4BY1J 3I56I 4AIKA 4BE1A 4A3GJ 2A6TA 4NDLA 2QM3A 1Y56A 1GVJA 4JOMA 2GM4A 5D8KB 1K4SA 3IV5A 3BZ6A 2W25A 4P5OA 1TL8A 2KJBA 3BTIA 1BL0A 5J47A 1UHSA 3GTJJ 1R1TA 2VKEA 3PSFA 4UV9A 4HNTA 3OYDA 3K1NA 5HLIA 2JUCA 2OC6A 3FMSA 3DLLF 2DMNA 3BR5A 3IP4B 4LITA 3I4NJ 1RUNA 3AG2H 5E8IA 4GO1A 3L2UA 5EGOB 2L4MA 1FNNA 3D5LA 3H3VK 1IZ1A 1Y1VJ 3PFIA 4B43A 2LYCA 3W2WA 2DMUA 3OSFA 3TKYA 3D1NI 1V5EA 3MKWB 5EG0B 1ZYRF 2DTZA 1LUJB
chains in the Genus database with same CATH topology
5C3EJ 2IBDA 5K7FA 2KDZA 2P81A 2GBYA 1RKWA 4A3BJ 3BTCA 3CCYA 1MBFA 3Q0UA 4A3JJ 2VKVA 1HF0A 3FK7A 5HODA 1ETXA 2FX0A 2R92J 2XGCA 3K7AJ 3ZQGA 2HYJA 2M0CA 1A5JA 3B6AA 3CDLA 5IOZA 2DA5A 2M34A 1U8BA 1F43A 5IP9J 1W0TA 3CMYA 2ECCA 1R9TJ 1Z77A 4IEJA 1AKHB 2DA3A 2D5VA 4MFDA 2JA5J 2VI6A 3BTJA 3BG9A 3DCFA 2Y2ZA 2WAQN 3CQZJ 3I4MJ 3BR6A 2CRGA 2DA2A 1IJWC 2IAIA 2JMWA 3S1RJ 3C2BA 2JA6J 1JUPA 2L7MP 3JRGA 5BNGA 1FIAA 4FCYA 3S1MJ 3PO2J 1MNMC 5IYDJ 3QPSA 3S2HJ 1P7IA 2HI3A 4D5FA 3HOWJ 1MBGA 4D7NA 4JX6A 3W6VA 4I6ZA 4BY7J 3HB9A 3HGGA 1OCPA 2CQXA 4DYRA 4A3MJ 4XRMA 1IRZA 2HDDA 4A3EJ 3GBGA 1K83J 3S2DJ 1P7JA 1TWFJ 1AHDP 2HOSA 1GUUA 2R5YB 2M2EA 1PUFB 2EZHA 2JA8J 5EDNA 3GTKJ 5EZGA 2COBA 5FKOA 3OSGA 3JRHA 4DZJA 4A69C 2K40A 2I10A 3OOUA 3ZQHA 5M3MJ 1IV6A 2CUFA 2DN0A 2HXIA 3JRIA 2WB1N 4I76A 2TCTA 1ZGWA 1NTCA 1ZK8A 2LY9A 4A3CJ 1B72B 5EYRA 4IHVA 1ZKGA 4W1UA 2ECBA 2HOAA 2XB0X 1I3QJ 3QPLA 4XIDA 1GV2A 3RZDJ 3UKGA 5J1YA 4FTHA 2QCOA 3IH4A 3ZQCA 5EGOA 1ZQ3P 5IYBJ 1G2HA 1I50J 2JK3A 3H0GJ 3HEFA 5IYCJ 1I6HJ 1ORKA 5M3FJ 1QVUA 3HGYA 5E3OA 3GTQJ 1B8IB 1S7EA 5DS9A 1T33A 5K7HA 3RZOJ 2PMZN 1RR7A 2LKXA 2FJ1A 2JJ7A 3A03A 4M3FA 1WGXA 5F27A 2FD5A 1JTXA 2E1OA 3FISA 3ZOBA 1YRNB 2XPVA 1GDTA 1JUSA 4A3IJ 3O8GA 2GLOA 4DYCA 3IH2A 5IP6A 5FLVA 5IPAA 2E19A 3A02A 2VPRA 2LTPA 1DU0A 5J3LA 4UUSB 1TWGJ 2Y30A 3LSGA 5IP7J 3G1MA 1X58A 3GTMJ 5FKLA 1QPIA 5F0HA 3LOCA 1ITYA 2ID3A 1NK3P 4QTRA 4M3BA 3S14J 1EF4A 3HM5A 1FJLA 3TW6A 5FLMJ 3BR3A 5K7ZA 1U78A 2W48A 4CYCB 3S1NJ 1D5YA 1APLC 3JRFA 3DEWA 2DA6A 2L0KA 3Q3SA 4HNVA 1W0UA 4Y52J 1ZR4A 3JR9A 3A01B 1UMQA 4XK4A 3RKQA 2EH3A 1U9NA 4S0HB 5C44J 1O4XA 1LFUP 2Y0SN 2H8RA 1T56A 2IEKA 1X2NA 5GPAA 1HCRA 4G12A 3ZQIA 4V2FA 3Q0VA 3NAUA 2NS8A 1QRYA 3Q0WA 3O8HA 4IHWA 2N8GA 5F08A 3G1OA 1HDDC 5C4JJ 3S16J 1WH7A 4AUXA 2M9HA 3GTGJ 1POGA 3JREA 3TW7A 2LFBA 3MKLA 1JT6A 1SFOJ 1E3OC 2LVSA 4B3AA 1BJZA 1HLVA 2EQRA 5M5XJ 2R5ZA 4M6VA 2L7ZA 2CU7A 4L5EA 3HOXJ 1AKHA 1H89C 3MVPA 1ETYA 2R5YA 1TWHJ 3QQAA 3GTOJ 3RQIA 1FIPA 3BG3A 3S15J 1MBJA 2NS7A 2E2JJ 5F04A 2YUSA 1GV5A 3L1PA 3BTLA 3JRDA 2XPWA 3HKZN 4W97A 1Z0XA 3TP0A 1H8AC 3GTLJ 5E3LA 1NK2P 4JX4A 1ZTRA 3SDGA 4GFBA 4DYQA 1JKPC 3FK6A 1JKRC 3HOYJ 3JRBA 2YS9A 1VI0A 2E2HJ 2DJNA 4MO7A 4C3JJ 2JA7J 3WHCA 2DA4A 3LSPA 5F0CA 4QSHA 2R93J 2XB5A 1DU6A 5E3MA 3F0CA 5J1UA 4JP0A 2LR8A 1RKTA 2JN6A 3MN2A 2LP0A 2H1KA 1XS9A 1WI3A 2LK2A 3LSRA 4D5CA 5EG0A 1TWCJ 2G0EA 1TC3C 4A93J 3IH3A 1LE8B 2KT0A 3TEDA 1RPWA 3PM1A 1MBKA 2HXOA 4X6AJ 1CQTA 1Y1WJ 4XICA 5FKMA 1OCTC 4V2GA 4AC0A 1VFCA 4Y7NJ 1HDPA 4ABZA 1MBHA 2CQQA 1RESA 4X1EA 3JRAA 5JLWA 1BA5A 2NOGA 1GT0C 2OPTA 4QIWN 4JX5A 2EBIA 3ZQLA 3ZQFA 5GPCA 1BW5A 4BXXJ 1IDZA 4RDUA 4M3EA 1TWAJ 2B63J 2RAEA 2R5ZB 2XSDC 3BT9A 1OFCX 2NVXJ 3BR2A 2MGQA 3VPRA 4C2MJ 5C4XJ 1UG2A 2EZKA 1ETVA 9ANTA 4A3LJ 4B1RA 2X9DA 2ZB9A 2CUEA 2XRLA 3PO3J 1JGGA 2MSYA 5DTDA 4C3HJ 2Y9YA 1JKQC 3GTPJ 4M3DA 1ETKA 3HDDA 2DMQA 2K9QA 2NVTJ 4EEFG 3A01A 4IHYA 4RBOA 5FKNA 1IC8A 1LFBA 1WCMJ 3WHBA 5FJ8J 3HOUJ 1IG7A 4BBRJ 1MSEC 2XGDA 4A3DJ 4BBSJ 1YRNA 1GVDA 4IHXA 2YU9J 4MLOA 2ELKA 2Y31A 4DZPA 1JJ8C 1VF9A 2VUMJ 1JKOC 4J19A 4FISA 2NVQJ 1VNDA 4FE7A 2ME0A 3BR1A 5EEAA 3G1LA 3TP3A 2DA1A 2XGEA 1RETA 1JT0A 2DA7A 4A3KJ 3HOZJ 1ETQA 1JUMA 1ZR2A 1WH5A 1Q1VA 3BG5A 2K9SA 4C3IJ 1MH4A 4CYCA 4A3FJ 1K61A 2Y9ZA 3S1QJ 1AU7A 5F1JA 1HOMA 2M8GX 4FE4A 2OF7A 5E3NA 4M3GA 1B72A 3SFIA 5JLXA 4LOCA 1JTYA 3S17J 3M3YJ 3BR0A 1FTZA 4MIMA 4D7MA 2LLKA 3HOVJ 1BW6A 1U9OA 4B4CA 1X2MA 2AO9A 1MH3A 2CJJA 1A6IA 2DMTA 2EZLA 3SJMA 3LSJA 5EF6A 1B8IA 1IUFA 2E2IJ 2LD5A 2MW8A 3BQZA 2AHQA 2R7ZJ 4XRSG 2R0QC 5GP9A 3OIOA 1ETWA 1JJ6C 5EZHA 2NVYJ 1SANA 1F36A 1PUFA 2TRTA 2HOTA 1OJLA 3K2AA 2ME6A 5J1RA 2FQ4A 2QF7A 4JYKA 4UUSA 1H88C 3NARA 1FEXA 4DW6A 3B6CA 1WPKA 1FTTA 1IGNA 2O7OA 4MFEA 4BY1J 1MSFC 2K9NA 2HQ5A 3FIWA 4A3GJ 4NDLA 5IOYA 4UUTA 2MG4A 2GM4A 4XRSA 2ID6A 3IV5A 5M5WJ 2O8KA 3JRCA 1QVTA 4AYBN 5F0FA 1LE8A 3BTIA 2EZIA 1BL0A 1UHSA 3GTJJ 2VKEA 1MBEA 3E7LA 1XC5A 2DMNA 1XG1A 3BR5A 3I4NJ 2X6OA 5M5YJ 2WV1A 5EGOB 2L7FP 1IDYA 2L9RA 4BKXA 1ENHA 2XPUA 3LNQA 3HBLA 5FKKA 3H3VK 2X48A 1Y1VJ 2O9LA 2JWTA 2DMUA 3OSFA 3D1NI 3BQYA 1ETOA 5EG0B 3M4OJ 3FKIJ 2DTZA 2DMPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C3E J;  2IBD A;  5K7F A;  2KDZ A;  2P81 A;  2GBY A;  1RKW A;  4A3B J;  3BTC A;  3CCY A;  1MBF A;  3Q0U A;  4A3J J;  2VKV A;  1HF0 A;  3FK7 A;  5HOD A;  1ETX A;  2FX0 A;  2R92 J;  2XGC A;  3K7A J;  3ZQG A;  2HYJ A;  2M0C A;  1A5J A;  3B6A A;  3CDL A;  5IOZ A;  2DA5 A;  2M34 A;  1U8B A;  1F43 A;  5IP9 J;  1W0T A;  3CMY A;  2ECC A;  1R9T J;  1Z77 A;  4IEJ A;  1AKH B;  2DA3 A;  2D5V A;  4MFD A;  2JA5 J;  2VI6 A;  3BTJ A;  3BG9 A;  3DCF A;  2Y2Z A;  2WAQ N;  3CQZ J;  3I4M J;  3BR6 A;  2CRG A;  2DA2 A;  1IJW C;  2IAI A;  2JMW A;  3S1R J;  3C2B A;  2JA6 J;  1JUP A;  2L7M P;  3JRG A;  5BNG A;  1FIA A;  4FCY A;  3S1M J;  3PO2 J;  1MNM C;  5IYD J;  3QPS A;  3S2H J;  1P7I A;  2HI3 A;  4D5F A;  3HOW J;  1MBG A;  4D7N A;  4JX6 A;  3W6V A;  4I6Z A;  4BY7 J;  3HB9 A;  3HGG A;  1OCP A;  2CQX A;  4DYR A;  4A3M J;  4XRM A;  1IRZ A;  2HDD A;  4A3E J;  3GBG A;  1K83 J;  3S2D J;  1P7J A;  1TWF J;  1AHD P;  2HOS A;  1GUU A;  2R5Y B;  2M2E A;  1PUF B;  2EZH A;  2JA8 J;  5EDN A;  3GTK J;  5EZG A;  2COB A;  5FKO A;  3OSG A;  3JRH A;  4DZJ A;  4A69 C;  2K40 A;  2I10 A;  3OOU A;  3ZQH A;  5M3M J;  1IV6 A;  2CUF A;  2DN0 A;  2HXI A;  3JRI A;  2WB1 N;  4I76 A;  2TCT A;  1ZGW A;  1NTC A;  1ZK8 A;  2LY9 A;  4A3C J;  1B72 B;  5EYR A;  4IHV A;  1ZKG A;  4W1U A;  2ECB A;  2HOA A;  2XB0 X;  1I3Q J;  3QPL A;  4XID A;  1GV2 A;  3RZD J;  3UKG A;  5J1Y A;  4FTH A;  2QCO A;  3IH4 A;  3ZQC A;  5EGO A;  1ZQ3 P;  5IYB J;  1G2H A;  1I50 J;  2JK3 A;  3H0G J;  3HEF A;  5IYC J;  1I6H J;  1ORK A;  5M3F J;  1QVU A;  3HGY A;  5E3O A;  3GTQ J;  1B8I B;  1S7E A;  5DS9 A;  1T33 A;  5K7H A;  3RZO J;  2PMZ N;  1RR7 A;  2LKX A;  2FJ1 A;  2JJ7 A;  3A03 A;  4M3F A;  1WGX A;  5F27 A;  2FD5 A;  1JTX A;  2E1O A;  3FIS A;  3ZOB A;  1YRN B;  2XPV A;  1GDT A;  1JUS A;  4A3I J;  3O8G A;  2GLO A;  4DYC A;  3IH2 A;  5IP6 A;  5FLV A;  5IPA A;  2E19 A;  3A02 A;  2VPR A;  2LTP A;  1DU0 A;  5J3L A;  4UUS B;  1TWG J;  2Y30 A;  3LSG A;  5IP7 J;  3G1M A;  1X58 A;  3GTM J;  5FKL A;  1QPI A;  5F0H A;  3LOC A;  1ITY A;  2ID3 A;  1NK3 P;  4QTR A;  4M3B A;  3S14 J;  1EF4 A;  3HM5 A;  1FJL A;  3TW6 A;  5FLM J;  3BR3 A;  5K7Z A;  1U78 A;  2W48 A;  4CYC B;  3S1N J;  1D5Y A;  1APL C;  3JRF A;  3DEW A;  2DA6 A;  2L0K A;  3Q3S A;  4HNV A;  1W0U A;  4Y52 J;  1ZR4 A;  3JR9 A;  3A01 B;  1UMQ A;  4XK4 A;  3RKQ A;  2EH3 A;  1U9N A;  4S0H B;  5C44 J;  1O4X A;  1LFU P;  2Y0S N;  2H8R A;  1T56 A;  2IEK A;  1X2N A;  5GPA A;  1HCR A;  4G12 A;  3ZQI A;  4V2F A;  3Q0V A;  3NAU A;  2NS8 A;  1QRY A;  3Q0W A;  3O8H A;  4IHW A;  2N8G A;  5F08 A;  3G1O A;  1HDD C;  5C4J J;  3S16 J;  1WH7 A;  4AUX A;  2M9H A;  3GTG J;  1POG A;  3JRE A;  3TW7 A;  2LFB A;  3MKL A;  1JT6 A;  1SFO J;  1E3O C;  2LVS A;  4B3A A;  1BJZ A;  1HLV A;  2EQR A;  5M5X J;  2R5Z A;  4M6V A;  2L7Z A;  2CU7 A;  4L5E A;  3HOX J;  1AKH A;  1H89 C;  3MVP A;  1ETY A;  2R5Y A;  1TWH J;  3QQA A;  3GTO J;  3RQI A;  1FIP A;  3BG3 A;  3S15 J;  1MBJ A;  2NS7 A;  2E2J J;  5F04 A;  2YUS A;  1GV5 A;  3L1P A;  3BTL A;  3JRD A;  2XPW A;  3HKZ N;  4W97 A;  1Z0X A;  3TP0 A;  1H8A C;  3GTL J;  5E3L A;  1NK2 P;  4JX4 A;  1ZTR A;  3SDG A;  4GFB A;  4DYQ A;  1JKP C;  3FK6 A;  1JKR C;  3HOY J;  3JRB A;  2YS9 A;  1VI0 A;  2E2H J;  2DJN A;  4MO7 A;  4C3J J;  2JA7 J;  3WHC A;  2DA4 A;  3LSP A;  5F0C A;  4QSH A;  2R93 J;  2XB5 A;  1DU6 A;  5E3M A;  3F0C A;  5J1U A;  4JP0 A;  2LR8 A;  1RKT A;  2JN6 A;  3MN2 A;  2LP0 A;  2H1K A;  1XS9 A;  1WI3 A;  2LK2 A;  3LSR A;  4D5C A;  5EG0 A;  1TWC J;  2G0E A;  1TC3 C;  4A93 J;  3IH3 A;  1LE8 B;  2KT0 A;  3TED A;  1RPW A;  3PM1 A;  1MBK A;  2HXO A;  4X6A J;  1CQT A;  1Y1W J;  4XIC A;  5FKM A;  1OCT C;  4V2G A;  4AC0 A;  1VFC A;  4Y7N J;  1HDP A;  4ABZ A;  1MBH A;  2CQQ A;  1RES A;  4X1E A;  3JRA A;  5JLW A;  1BA5 A;  2NOG A;  1GT0 C;  2OPT A;  4QIW N;  4JX5 A;  2EBI A;  3ZQL A;  3ZQF A;  5GPC A;  1BW5 A;  4BXX J;  1IDZ A;  4RDU A;  4M3E A;  1TWA J;  2B63 J;  2RAE A;  2R5Z B;  2XSD C;  3BT9 A;  1OFC X;  2NVX J;  3BR2 A;  2MGQ A;  3VPR A;  4C2M J;  5C4X J;  1UG2 A;  2EZK A;  1ETV A;  9ANT A;  4A3L J;  4B1R A;  2X9D A;  2ZB9 A;  2CUE A;  2XRL A;  3PO3 J;  1JGG A;  2MSY A;  5DTD A;  4C3H J;  2Y9Y A;  1JKQ C;  3GTP J;  4M3D A;  1ETK A;  3HDD A;  2DMQ A;  2K9Q A;  2NVT J;  4EEF G;  3A01 A;  4IHY A;  4RBO A;  5FKN A;  1IC8 A;  1LFB A;  1WCM J;  3WHB A;  5FJ8 J;  3HOU J;  1IG7 A;  4BBR J;  1MSE C;  2XGD A;  4A3D J;  4BBS J;  1YRN A;  1GVD A;  4IHX A;  2YU9 J;  4MLO A;  2ELK A;  2Y31 A;  4DZP A;  1JJ8 C;  1VF9 A;  2VUM J;  1JKO C;  4J19 A;  4FIS A;  2NVQ J;  1VND A;  4FE7 A;  2ME0 A;  3BR1 A;  5EEA A;  3G1L A;  3TP3 A;  2DA1 A;  2XGE A;  1RET A;  1JT0 A;  2DA7 A;  4A3K J;  3HOZ J;  1ETQ A;  1JUM A;  1ZR2 A;  1WH5 A;  1Q1V A;  3BG5 A;  2K9S A;  4C3I J;  1MH4 A;  4CYC A;  4A3F J;  1K61 A;  2Y9Z A;  3S1Q J;  1AU7 A;  5F1J A;  1HOM A;  2M8G X;  4FE4 A;  2OF7 A;  5E3N A;  4M3G A;  1B72 A;  3SFI A;  5JLX A;  4LOC A;  1JTY A;  3S17 J;  3M3Y J;  3BR0 A;  1FTZ A;  4MIM A;  4D7M A;  2LLK A;  3HOV J;  1BW6 A;  1U9O A;  4B4C A;  1X2M A;  2AO9 A;  1MH3 A;  2CJJ A;  1A6I A;  2DMT A;  2EZL A;  3SJM A;  3LSJ A;  5EF6 A;  1B8I A;  1IUF A;  2E2I J;  2LD5 A;  2MW8 A;  3BQZ A;  2AHQ A;  2R7Z J;  4XRS G;  2R0Q C;  5GP9 A;  3OIO A;  1ETW A;  1JJ6 C;  5EZH A;  2NVY J;  1SAN A;  1F36 A;  1PUF A;  2TRT A;  2HOT A;  1OJL A;  3K2A A;  2ME6 A;  5J1R A;  2FQ4 A;  2QF7 A;  4JYK A;  4UUS A;  1H88 C;  3NAR A;  1FEX A;  4DW6 A;  3B6C A;  1WPK A;  1FTT A;  1IGN A;  2O7O A;  4MFE A;  4BY1 J;  1MSF C;  2K9N A;  2HQ5 A;  3FIW A;  4A3G J;  4NDL A;  5IOY A;  4UUT A;  2MG4 A;  2GM4 A;  4XRS A;  2ID6 A;  3IV5 A;  5M5W J;  2O8K A;  3JRC A;  1QVT A;  4AYB N;  5F0F A;  1LE8 A;  3BTI A;  2EZI A;  1BL0 A;  1UHS A;  3GTJ J;  2VKE A;  1MBE A;  3E7L A;  1XC5 A;  2DMN A;  1XG1 A;  3BR5 A;  3I4N J;  2X6O A;  5M5Y J;  2WV1 A;  5EGO B;  2L7F P;  1IDY A;  2L9R A;  4BKX A;  1ENH A;  2XPU A;  3LNQ A;  3HBL A;  5FKK A;  3H3V K;  2X48 A;  1Y1V J;  2O9L A;  2JWT A;  2DMU A;  3OSF A;  3D1N I;  3BQY A;  1ETO A;  5EG0 B;  3M4O J;  3FKI J;  2DTZ A;  2DMP A; 
#chains in the Genus database with same CATH topology
 5C3E J;  5K7F A;  2GBY A;  1RKW A;  3D5S C;  1MBF A;  2P4W A;  2MAB A;  1WHU A;  4LG0 B;  1E17 A;  4ASN A;  3UR3 C;  3SYT A;  3MZY A;  2DT6 A;  3K7A J;  4GYI A;  4Y15 A;  1G59 A;  3ZQQ A;  2G9W A;  4EJV A;  1A5J A;  4ZTF A;  5CQE A;  2DA5 A;  3K2Z A;  5IP9 J;  3KEQ A;  1T6S A;  3CMY A;  1VQO I;  2ECC A;  1S29 A;  1Z77 A;  1T2K A;  1PVE A;  2RKH A;  1H9T A;  3VSL A;  3ZMV A;  3SZP A;  3I4M J;  1R5I D;  3HKZ A;  1X4O A;  2O6G E;  1LDJ A;  4M6Y A;  1UAA A;  4ETS A;  2L5Q A;  2IAI A;  2JA6 J;  3C2B A;  1P4W A;  1Y0N A;  1YYV A;  4E7Z A;  2L7M P;  2A3S A;  5KCM A;  3DEU A;  3PO2 J;  2MC4 A;  4UUV A;  1DP7 P;  3S2H J;  1LDD A;  2M30 A;  4JX6 A;  5ED4 A;  2LRE A;  3J80 K;  4I6Z A;  2CUJ A;  3JW4 A;  3MQ0 A;  2ZO4 A;  4IRG A;  2Z33 A;  4BAC A;  1MJ9 A;  5J8C A;  2WA0 A;  1IO2 A;  2KIS A;  4KUM A;  3KP4 A;  5DD4 A;  1K83 J;  1OCO H;  1P7J A;  3VYR B;  3F8F A;  2HOS A;  4A5N A;  3ZP5 A;  2RRE A;  4KT5 C;  2R5Y B;  1T0F C;  3H35 A;  4BGD A;  5FRO A;  5EDN A;  4ZYD A;  1H0M A;  3GTK J;  2DK5 A;  2RQP A;  2GWR A;  1O3Q A;  3RKX A;  3CC7 I;  2KIQ A;  2XKP A;  2I10 A;  2RC4 A;  3DLA A;  1LNW A;  2MYS A;  2HXI A;  2E1M B;  2WB1 N;  4EQQ A;  4I76 A;  4IJA A;  3MKZ A;  2V4J C;  2PBI A;  4NC6 A;  3DPL C;  5CVR A;  5E20 A;  4BHP A;  3KYC B;  3LSK A;  4LK1 F;  4OOI A;  1ZK8 A;  1OYI A;  4IHV A;  2HZD A;  4HX8 A;  1D3Y A;  1BM9 A;  2V79 A;  3QPL A;  3IRQ A;  1JI8 A;  1S9H A;  2OQR A;  3IUO A;  4FAS D;  3SDB A;  1BIB A;  3DWL E;  2I8D A;  2X0L A;  3LSH A;  2FSW A;  4RMN A;  2QCO A;  1VZ0 A;  5H6R A;  3ZQC A;  1ZQ3 P;  2NYX A;  1P4X A;  1QU3 A;  1I50 J;  2FOK A;  2JK3 A;  5GTH C;  1I6H J;  1ORK A;  5M3F J;  3SHF A;  4HAM A;  4EJT A;  2LBF A;  5DS9 A;  2BV6 A;  3SQN A;  3RZO J;  2PMZ N;  1L0O C;  2FJ1 A;  2JJ7 A;  3NQO A;  5E18 F;  1D1A A;  2HU9 A;  3LFU A;  1G3S A;  2FD5 A;  2E1O A;  5DV5 A;  4KIG A;  2XPV A;  5DM7 F;  1JUS A;  5E8G A;  3O8G A;  4DYC A;  1FP1 D;  4KFC A;  2KJC A;  2EV5 A;  2E60 A;  5L3G A;  3E6D A;  2ESH A;  2OA4 A;  2LC2 A;  2LTP A;  3JAM Z;  3U1K A;  2G7H A;  4F92 B;  5IP7 J;  1LJ9 A;  5FKL A;  2GXG A;  4IO9 F;  1IN4 A;  3HTU A;  2ID3 A;  3R0J A;  5CPR B;  3T1B A;  3OYK A;  2STT A;  5B5E C;  1NK3 P;  1KQ9 A;  2QLZ A;  1EF4 A;  4IF4 A;  3PNV A;  1O3R A;  4N9H A;  3S1N J;  2FF4 A;  2IVM A;  3DEW A;  3DBH B;  3HUG B;  3U9G A;  1ZR4 A;  4XK4 A;  1UFM A;  4I01 A;  3IC7 A;  3FMR A;  4S0H B;  4D9J A;  3TO6 A;  2HOE A;  3HSR A;  3CME I;  2H8R A;  3GCM A;  1AA7 A;  1S8N A;  3WG7 H;  1XMK A;  1VQ4 I;  3T5X A;  3C7J A;  4PJ0 C;  2IGN A;  3OYE A;  3IWF A;  5JFR A;  2DBB A;  5GPA A;  2KQR A;  4G12 A;  1P9Q C;  2Z16 A;  3RPU D;  1STZ A;  4C9Y A;  4V2F A;  1XDS A;  3Q0V A;  3S8P A;  3BZK A;  3W2V A;  3I0T A;  5D6F A;  1RUO A;  4IHW A;  5F08 A;  3L00 A;  4AID A;  3E6C C;  4E7K A;  1IRF A;  4AUX A;  3TW7 A;  4IKF A;  5D4S A;  2LFB A;  3K70 D;  4RM2 A;  2BVM A;  2XAG A;  2DCE A;  1HXD A;  4KMU X;  1N25 A;  5TGT A;  4YFX F;  2WY8 Q;  1ZLJ A;  1YJN I;  3LSI A;  2V6E A;  3D0S A;  3EUH C;  3PUF A;  5M5X J;  2R5Z A;  3CP2 A;  3C2H A;  4M6V A;  2L7Z A;  3WTW C;  3JTG A;  3WTT C;  3TO7 A;  5H20 A;  4XL9 A;  2M7A A;  4HST A;  2W4S A;  2IGK A;  3L2V A;  4GXO A;  3EQL F;  1JHH A;  1ETY A;  5KK1 A;  1Z1D A;  2XF5 A;  3G73 A;  3G3Z A;  3HXL A;  5FFZ A;  1MBJ A;  2E2J J;  4UVB A;  3KEY A;  2X4H A;  4RGS A;  2E7W A;  3GTL J;  3OYA A;  2KHM A;  1QGP A;  5E3L A;  5K1Y A;  1H8A C;  1NK2 P;  2V1X A;  1X3Z B;  4RB1 A;  3HG9 A;  3JRB A;  1JXS A;  2E2H J;  1UZC A;  2KRC A;  2QQ9 A;  4MO7 A;  3CTA A;  2AQE A;  2JA7 J;  4I7H A;  2K85 A;  2XKO A;  1ODD A;  3GVA A;  2DK8 A;  3WHC A;  4UY8 I;  5JHF A;  2MLG A;  3LSP A;  2E34 A;  4BHB A;  1K78 B;  2IS1 A;  1D8K A;  3LQQ A;  4JP0 A;  2LR8 A;  3D5R C;  2IGM A;  3CF5 F;  3MN2 A;  4JK1 X;  3IAS 2;  3ZR8 X;  2LK2 A;  1N75 A;  3BG7 A;  4AU7 A;  2FBK A;  4LIV A;  5EG0 A;  4PGG A;  2G0E A;  2CW0 F;  3W2A A;  3F8N A;  3IH3 A;  5LHH A;  3QPT A;  1RC9 A;  1MMG A;  3S32 A;  3BC8 A;  4EMS A;  3I53 A;  2QEX I;  4PK4 A;  1Y6I A;  1CQT A;  1PUE E;  4EAT A;  4V2G A;  4A6E A;  4Y7N J;  3CUQ B;  1CGP A;  1MBH A;  1RES A;  2KIU A;  1N77 A;  4L0Z B;  3U2R A;  5FD6 A;  2BY1 A;  1KGS A;  4IQJ A;  1RR8 C;  1I3A A;  2NOG A;  4QIW N;  3HRS A;  4Y3O A;  5KNL A;  3ZQL A;  3CO7 C;  4NUB A;  1DUX C;  3TMO A;  3GZ6 A;  3I3L A;  1XPX A;  1YE9 A;  4RDU A;  2B63 J;  1JGS A;  2R5Z B;  4MHG A;  4BXF A;  2NVX J;  2MGQ A;  5GAE J;  2FA5 A;  2EZK A;  1WZ2 A;  4B1R A;  2X1D A;  2ZB9 A;  2CUE A;  2UV1 A;  2L9S A;  4OWR B;  4XSZ F;  5ERI A;  3U21 A;  1AWC A;  1F1Z A;  1WVR A;  4O3M A;  2F5E A;  5F64 A;  4C3H J;  3GTP J;  4A6D A;  3DBL B;  4B44 A;  2NVT J;  1OCR H;  3BCB A;  1PJR A;  3WU2 C;  4BDY A;  2GIZ A;  4EGY A;  1YI2 I;  1VQ6 I;  2XF6 A;  5FJ8 J;  1BI0 A;  4I2O A;  4LIU A;  3HOU J;  2NNY A;  2M8E A;  1WKM A;  5HNF A;  2XGD A;  2BZT A;  4BBS J;  2W85 A;  1GVD A;  3VYS B;  4IXA A;  3LAJ A;  4IHX A;  1WJC A;  3HZJ A;  3RYR A;  2BXZ A;  4XBF A;  4BE2 A;  2OTJ I;  4I0A A;  1JJ8 C;  4ESB A;  1VF9 A;  2OUM A;  1JKO C;  4J19 A;  5CVJ A;  1VND A;  4G8X A;  5E1X A;  2ELJ A;  3MD2 A;  3G1L A;  2VC0 A;  3ULQ B;  3WTV C;  1JT0 A;  1FSE A;  5DCM B;  1USS A;  4A3K J;  2Q2E B;  3MCZ A;  1DPR A;  2P0W A;  1JUM A;  1XN7 A;  4X0G A;  3OYH A;  1FYM A;  1QQI A;  3BG5 A;  3IAM 2;  3NEU A;  2PFB A;  3O6B B;  2Y9Z A;  3VFZ A;  2R7W A;  2BVL A;  5L3F A;  5A2Q Z;  2GOX B;  4FE4 A;  1SFK A;  5IT3 A;  4LOC A;  3QOP A;  3M3Y J;  4P55 A;  3KYL A;  1LKX A;  3BR0 A;  2M5W A;  4XOP A;  1FTZ A;  1VQ8 I;  1J59 A;  1T0F A;  2VE9 A;  2LLK A;  3HOV J;  4KIB A;  1YS7 A;  3HC7 A;  4WXH A;  3HSE A;  3R60 A;  3K10 A;  2ZC2 A;  1K7A A;  2K27 A;  2CJJ A;  1IN5 A;  2EZL A;  2X6W A;  5J40 A;  3ZMD A;  3BRO A;  3FXJ A;  1HSJ A;  3FBI B;  4CA0 A;  1A31 A;  4V19 K;  4AM3 A;  2MW8 A;  3O3K A;  1SVL A;  2JVG A;  1W5T A;  3KEO A;  4HBL A;  4E7H A;  2ZBK A;  2XV4 S;  1OYW A;  1ETW A;  2ZCW A;  4M73 A;  2EJR A;  4HYE A;  1SAN A;  1T8I A;  2VON A;  1XGS A;  3FF5 A;  2VPL A;  1NH3 A;  2ME6 A;  5J1R A;  2V1N A;  2E1M C;  1WPK A;  4L5J A;  4ZYA A;  1FTT A;  3K1P A;  4ENN A;  5DUI A;  5B1B H;  3KYD B;  4XOR A;  1MSF C;  2IT0 A;  4DIQ A;  1Z6R A;  3K4K A;  1EKE A;  2QQA A;  3QOD A;  2Q0O A;  2CWE A;  3TGN A;  2ID6 A;  1BN5 A;  2HYF A;  4XLE A;  1FC3 A;  3I9V 2;  3UNG C;  2FNP A;  2BW3 A;  2HQA A;  2QGU A;  3ECH A;  3W6J B;  3WOD F;  4RB2 C;  2BOL A;  2HVR A;  1B6A A;  1LE8 A;  1HQC A;  2EZI A;  3PIP F;  1W7P B;  1LDK B;  2FBI A;  3K4N A;  2ZSH B;  3TOB A;  3GFJ A;  1Q1H A;  2FXA A;  3RSN A;  4BQN A;  1DP3 A;  3WE3 A;  1ZGJ A;  1L3L A;  1QNT A;  1XB4 A;  2DJI A;  2WV1 A;  4BL0 B;  1Y8R B;  4HQE A;  2L7F P;  3E97 A;  1IDY A;  4BKX A;  2Q8K A;  2XPU A;  2JUG A;  3LNQ A;  2X48 A;  4I09 A;  3TL4 X;  6PAX A;  2JWT A;  4DQ2 A;  2CFO A;  2B0L A;  3BQY A;  3S2W A;  3DTI A;  4A3F J;  2DMP A;  3I64 A;  4KIF A;  3CCE I;  3AG1 H;  1U6G A;  3PQK A;  4U7B A;  2DOE A;  3OYN A;  5ICG A;  2YX7 A;  3VB2 A;  2VKV A;  3WTU C;  3FK7 A;  2VXZ A;  4HLX A;  3EUH A;  3CUQ A;  5FRM A;  2HPM A;  3ZQG A;  2HYJ A;  1REP C;  1HW5 A;  4Y33 A;  1AOY A;  1YW8 A;  4LG3 A;  1U8B A;  3H36 A;  1I39 A;  4HEA 2;  1F4K A;  1ON1 A;  4HX4 A;  2EFP A;  3VSK A;  1Y39 A;  3WGH A;  1ONV A;  1R9T J;  4IEJ A;  1D0X A;  2VQH A;  2DA3 A;  3GZN B;  4MFD A;  2F5C A;  2D5V A;  1X1C A;  2KP6 A;  4ZH4 F;  3G71 I;  3FHN A;  4N4O B;  2Y2Z A;  2WAQ N;  2L7K A;  3CQZ J;  2CRG A;  4R1H A;  4XLC A;  5HDN A;  2DA2 A;  2AS5 F;  5KAF C;  1IJW C;  4A5M A;  2P5L C;  3MAJ A;  3JRG A;  1IRX A;  1FIA A;  4ESJ A;  2OV7 A;  4BUP A;  3S1M J;  2KDO A;  1R00 A;  4CCL A;  3FDY A;  3IWZ A;  5IYD J;  1D0Y A;  3FM3 A;  3QU3 A;  3KFW X;  1MBG A;  4D7N A;  3CCS I;  3H1C A;  3E6M A;  2CV0 A;  1OCP A;  2OCC H;  2KRF A;  1WQ2 A;  4RGX A;  1XDU A;  2AXL A;  4XOT A;  4CH7 A;  3RTR A;  4RAF A;  3WTY C;  3S2D J;  1LVK A;  3FX3 A;  4A12 A;  1KU7 A;  4OIR F;  4P9U A;  3A1Y A;  2M2E A;  4ZYG A;  1PUF B;  1R49 A;  4RLQ A;  3GW2 A;  1TTY A;  3J7Y J;  1T08 B;  3ABL H;  2FU4 A;  3K4C A;  4FT8 A;  5FKO A;  1HKS A;  3JRH A;  2Y48 A;  4DZJ A;  2PJP A;  2V1D A;  1LFP A;  4WK8 F;  1IAW A;  2ACJ A;  2VBY A;  2K4B A;  3COA C;  2VT3 A;  3OOU A;  3GLL A;  2CUF A;  1ZG5 A;  2ELH A;  3ML6 A;  2HQN A;  4QPQ A;  4EVI A;  4RAY A;  1ZG1 A;  2QBY A;  4BDZ A;  5B1A H;  2OBP A;  1XGM A;  2KFD A;  4A3C J;  1BC8 C;  1B72 B;  1RZ4 A;  3HOT A;  2EA4 A;  3FXO A;  2F4M B;  1ON2 A;  3OYL A;  3HPG A;  2DW4 A;  5HDG A;  4J00 A;  2ECB A;  2ZME B;  2NVU B;  4CCN A;  1W36 C;  5K5Q A;  4E7I A;  1ZH5 A;  3UKG A;  2NOJ B;  3OS2 A;  1XGO A;  4NHJ A;  5CQG A;  1GHC A;  3ASO H;  5IYB J;  1G2H A;  2BE5 F;  3K4B A;  2V9K A;  1QVU A;  3MKY B;  1QHG A;  4I0B A;  4U0V A;  1T33 A;  5K7H A;  2ZJR F;  3DEE A;  1OQY A;  4P9F A;  4F52 A;  4M71 A;  2XRN A;  2LKX A;  2LH9 A;  2V7F A;  1EA3 A;  1Z9C A;  4M3F A;  2VOD A;  2LKP A;  4U7D A;  5F27 A;  5F6F A;  3ZOB A;  5LGT A;  1YRN B;  1XSX A;  2EWN A;  2JTV A;  1GDT A;  3F8C A;  1VTN C;  1VQK I;  2EK5 A;  1YOV B;  1YTY A;  3IH2 A;  5IPA A;  2FE3 A;  3TBI A;  3K0L A;  5BS6 A;  5DUK A;  1P2F A;  2LY2 A;  3PFY A;  4E7S A;  5J3L A;  5DYM A;  4UUS B;  1TWG J;  3E5U A;  1DPU A;  1R4N B;  3LSG A;  2FRH A;  3H9Q A;  1QPI A;  2DU9 A;  5F0H A;  4RM3 A;  4KT6 A;  3HRU A;  3FZV A;  5E1Z B;  3RJP A;  4QTR A;  1MIJ A;  4YEL A;  3HM5 A;  4G9Y A;  3OYM A;  5BPI A;  2W48 A;  3TDZ C;  4PFP A;  1D5Y A;  3ZRG A;  4F7Z A;  1ZRC A;  2DA6 A;  4HNV A;  3OYG A;  4WXD A;  5LD2 C;  1W0U A;  3I5U A;  4HV6 A;  3FMQ A;  3JR9 A;  2JRM A;  1WJD A;  4RB3 C;  1K79 A;  3RKQ A;  2EH3 A;  2QUF A;  1O4X A;  1VQ7 I;  2CO5 A;  2VL8 A;  5LFA A;  1W7P A;  2CW8 A;  4IOC F;  3ECO A;  4IRH A;  1T56 A;  4LG0 A;  4TV7 A;  1X2N A;  2MLK A;  1TW2 A;  2YPR A;  3Q9V A;  3ZQI A;  2W1O A;  1SD6 A;  1ACI A;  2QVO A;  2NS8 A;  3SEQ A;  3GF2 A;  1MGT A;  4WCG A;  1ULY A;  3E5X A;  2R4G A;  2UUZ A;  2W00 A;  1HDD C;  4Y13 A;  5C4J J;  2A05 A;  3F8B A;  3QP6 A;  3OS0 A;  2M9H A;  2JSP A;  2WBM A;  3EET A;  2V26 A;  3GTG J;  4HZF A;  4OIO F;  4CCO A;  1OKR A;  3H5N A;  3MKL A;  2IS2 A;  1IXS B;  1JT6 A;  2L3D A;  4B09 A;  2FUG 2;  2LVS A;  1BJZ A;  1HLV A;  3T8T A;  2EQR A;  4U87 A;  5CVI A;  2P5K A;  3CO6 C;  1HKT A;  2MFZ A;  1EH6 A;  5LEK A;  2CU7 A;  4IPA A;  3VOE A;  1BI2 A;  4XLN F;  1Z6T A;  4XM3 A;  4ZTJ A;  1SMT A;  2RNG A;  2Y69 H;  2R5Y A;  3CCQ I;  1TWH J;  3QQA A;  2R7Q A;  3GTO J;  3WTZ A;  2Q2E A;  3BG3 A;  2F6C A;  3LQR A;  3PUB A;  3S15 J;  1D0Z A;  4ZJZ A;  1FOY A;  1Z7L A;  4L9T A;  4IRI A;  2YUS A;  1SVM A;  1UHM A;  1GV5 A;  3L1P A;  3IHU A;  3JRD A;  3E5Q A;  3QRF F;  4JX4 A;  4L9J A;  2RNJ A;  2L2O A;  3SDG A;  3ONQ A;  1O3S A;  4H4K C;  1JKP C;  2DAO A;  2PMH A;  3HOY J;  3L7W A;  1FPQ A;  2YS9 A;  4YFN F;  1KZH A;  3IKV A;  2DJN A;  2EFN A;  1R71 A;  2O3F A;  3A0H C;  4R79 A;  3FXR A;  4FHT A;  4C3J J;  3OYF A;  3EUA A;  3E3V A;  4MGR A;  3GO5 A;  4PCQ A;  5F0C A;  2P8T A;  2CQK A;  5ICE A;  2XB5 A;  1DU6 A;  1FWZ A;  1P6R A;  1RKT A;  4GRI A;  4PJJ A;  3HJE A;  1XS9 A;  1EJ9 A;  4EGZ A;  1TWC J;  1TT5 B;  4LLL A;  4DBQ A;  1OIS A;  3DQV C;  4D1Q A;  3I59 B;  2R7S A;  2Z9O A;  2QEN A;  1O3T A;  3TED A;  5D5U B;  3LMM A;  1RPW A;  1IF1 A;  2HXO A;  2QQ8 A;  2PN6 A;  4GCV A;  4MTD A;  4HA8 A;  4AC0 A;  2IW5 A;  4D0P A;  3G6E I;  2WWY A;  3VEP A;  2ICW G;  4KN7 X;  5FRN A;  5JLW A;  3C2G A;  1OR7 C;  3DXJ F;  1KQ0 A;  1BA5 A;  2JVH A;  3FXL A;  4H0E A;  4JX5 A;  3RKY A;  3ZQF A;  4U0Y A;  1K6Y A;  2DDA A;  3HHH A;  1BW5 A;  3CJQ B;  1RRJ A;  4BXX J;  1EH8 A;  2KPM A;  4B8X A;  1R7J A;  2A07 F;  1MMS A;  3GZ5 A;  3AL0 C;  1NG7 A;  3VPR A;  3DV8 A;  4PUS A;  1ETV A;  4A3L J;  5E79 C;  2X9D A;  1IW7 F;  2IA2 A;  1VQL I;  3A4C A;  3H9G A;  2BY0 A;  3H5R A;  1HKQ A;  2MSY A;  4MNU A;  1N78 A;  2HVQ A;  2Y9Y A;  3HDD A;  1ETK A;  2DXI A;  2PMU A;  4ENJ A;  1FOX A;  2DFH A;  2DYR H;  3BJO A;  2A69 F;  1OLT A;  2MC3 A;  2H27 A;  2VC1 A;  4RBO A;  1IC8 A;  3V8J A;  4UB8 C;  2DT5 A;  2L9N A;  4BBR J;  1MSE C;  2HKO A;  5HOO A;  4A3D J;  5JHU A;  4XNF A;  1YRN A;  1X1D A;  4RB0 A;  3CD6 I;  3N05 A;  2ZNY A;  4M9X A;  4RS8 A;  5FGM A;  2ELK A;  2Y31 A;  1YW9 A;  2R7D A;  4G6D A;  3WE2 A;  3OYJ A;  1S6L A;  2VUM J;  2DTR A;  4FE7 A;  1X1P A;  3BR1 A;  2L02 A;  2XAU A;  1SEU A;  5BPD A;  4KNY A;  3VOD A;  3VWB A;  2YR2 A;  1WJE A;  2WAF A;  1YHQ I;  4I98 B;  1NHA A;  1JE8 A;  1BC7 C;  2DA7 A;  1BOB A;  2IS4 A;  5J4Y A;  3HOZ J;  4B3X A;  2GQQ A;  1WH5 A;  1Q1V A;  2K9S A;  4BJ6 C;  4C3I J;  2M3A A;  3MZ8 A;  2EFQ A;  3OYI A;  2LY1 A;  2M4K A;  5HDK A;  4EM1 A;  5F1J A;  2M8G X;  1B72 A;  3V7C A;  3OR1 C;  3OL4 A;  2H8W A;  1JTY A;  4BAY A;  3S17 J;  2RGV A;  2DOD A;  5ILV A;  5TRD A;  1D1C A;  1BW6 A;  1R1U A;  2LMD A;  4B4C A;  3HTS B;  1KYW A;  4XKW A;  2QKM B;  2QSG X;  1A6I A;  3SJM A;  3HIF A;  2VLA A;  2ETH A;  2PMZ A;  2ZXW H;  4ZYH A;  2EIN H;  3ASN H;  3BQZ A;  3K69 A;  3L2W A;  5HLT A;  1R5H A;  2ZJQ F;  3ROU A;  2K02 A;  2R0Q C;  2GAU A;  3WG9 A;  3EYY A;  1JJ6 C;  4AIH A;  1YJ9 I;  3F9K A;  1U5T B;  2RQQ A;  5D6E A;  3GLX A;  1XX5 A;  3K4M A;  3FHZ A;  3QWL A;  1PUF A;  2TRT A;  3BDD A;  1FOW A;  3PQJ A;  4RA2 A;  3PSI A;  1V55 H;  3GUD A;  3ZCO A;  1Z3X A;  1T38 A;  1J0R A;  2QF7 A;  4JYK A;  4UUS A;  1FEX A;  4MEX F;  1I27 A;  2BXY A;  4II3 A;  4DGW B;  3GEZ A;  3FWE A;  4QWQ A;  2QYO A;  3DPT A;  3CP8 A;  4EJO A;  1R4M B;  4HDU A;  1X4P A;  4CDG A;  2BGC A;  1OPC A;  3GFI A;  1FMW A;  5IOY A;  2LG4 A;  1A36 A;  1WWX A;  1G6N A;  4A0Z A;  2MG4 A;  2STW A;  5B66 C;  2BY2 A;  2EPF A;  4FX0 A;  3BOQ A;  5EEG A;  2O8K A;  2QKL B;  2MBF A;  3JRC A;  2XHK A;  3DKW A;  2KZG A;  2ZSI B;  2J5O A;  3KE2 A;  4CGZ A;  1XGN A;  4KIS A;  5HLH A;  4XMY A;  2WC2 A;  3BPX A;  1G3Y A;  1FSH A;  2ISZ A;  4LK0 F;  2QSH X;  1MBE A;  4CHU A;  1XC5 A;  4C2U A;  1XG1 A;  4CZZ A;  1QZY A;  2X6O A;  5M5Y J;  1B9N A;  4BQO A;  4CXF A;  3P5J A;  3HBL A;  5FKK A;  3ZMU A;  2EFO A;  4CCK A;  4IVN A;  3HHG A;  3PNT A;  1SD7 A;  2M1B A;  1ETO A;  3GYH X;  3M4O J;  1IRG A;  1IV8 A;  3ZMT A;  2W84 A;  1U2W A;  3AFH A;  3CLQ A;  3SZT A;  3SFZ A;  2P81 A;  2EIK H;  4YFK F;  3BTC A;  1YX3 A;  4YEJ A;  1HF0 A;  3ZXS A;  3RQ4 A;  3CDI A;  1ETX A;  2FX0 A;  2XF7 A;  2R92 J;  3L9F A;  1BR2 A;  2HDC A;  4OMZ A;  3B6A A;  1X1A A;  5IOZ A;  1F43 A;  1XCB A;  1W0T A;  2NNN A;  1P4A A;  1YQA A;  3BLY A;  3I54 A;  2JA5 J;  1O57 A;  1IN8 A;  3MMY B;  3BTJ A;  1ZGA A;  3TQN A;  3L2Q A;  2R7R A;  3BG9 A;  1LEA A;  4Q5S F;  2VB6 A;  1TT0 A;  4XSX F;  1S7O A;  2PLY A;  3BR6 A;  3C3W A;  3DP7 A;  5JVG F;  1MNE A;  3H3U A;  4LGW A;  1O7F A;  1FX7 A;  3OIP A;  1RIO H;  5LHG A;  4LFU A;  4BNC A;  1FT9 A;  3S1R J;  1G8X A;  3HUG A;  2EIJ H;  1JUP A;  2O8X A;  4G7O F;  2L9V A;  4FCY A;  3QPS A;  3W3C A;  1P7I A;  2HI3 A;  2IS6 A;  3HOW J;  4BHC A;  3W6V A;  3HB9 A;  1MND A;  4A3M J;  4XRM A;  2DPU A;  4I99 C;  1IRZ A;  2HDD A;  3Q5F A;  4A3E J;  3GBG A;  4YIR X;  4JBA A;  2MD5 A;  1VQ9 I;  3C1D A;  4E70 A;  3LL7 A;  1LB2 A;  4OU0 A;  1M1E B;  1V5G A;  3TOA A;  1TWF J;  2R7U A;  1AHD P;  2MH2 A;  2HPI A;  1GUU A;  2VBZ A;  2LBF B;  5K5O A;  2EZH A;  3GWZ A;  1BJA A;  1V54 H;  3DTE A;  5LRS A;  2COB A;  3A0B C;  3OSG A;  1G3W A;  3BCA A;  3BWG A;  4E7J A;  3MZH A;  1DDN A;  1MMA A;  1FLI A;  2VOP A;  2HZT A;  2K40 A;  4OIP F;  1FMV A;  3IKT A;  4XLH A;  4CCM A;  4XKV A;  2COM A;  3ZQH A;  4BEH B;  4BU2 A;  2LKS A;  3WU1 B;  3KP7 A;  3ERE D;  1IV6 A;  3JRI A;  3M8J A;  2KIF A;  3KLN A;  1FBS A;  4WXC A;  3ZGK A;  1VQN I;  3F72 A;  1ZGW A;  1V5F A;  1V3F A;  2OZ6 A;  2A5Y B;  4HPQ A;  2LY9 A;  3QOE A;  4ZDP A;  5EYR A;  1ZAR A;  1Y8Q B;  5LGU A;  2JPB A;  1I3Q J;  5GAH J;  4XID A;  3OYC A;  4GDF A;  4ON0 A;  3ZMZ A;  2A6H F;  3CCL I;  3I55 I;  4G6T B;  4AD9 A;  5J1Y A;  1TNS A;  3IH4 A;  1TQM A;  1A6Q A;  3H0G J;  3HEF A;  3F23 A;  5EEH A;  3HGY A;  5E3O A;  2CSO A;  1P92 A;  2QQB A;  2L01 A;  2Z2S B;  2E1C A;  2C6Y A;  5HNH A;  2HR3 A;  1B4A A;  2XDV A;  1T98 A;  3A03 A;  1NG6 A;  4PJL A;  4F55 A;  4YII A;  1J09 A;  1WGX A;  3DBR B;  4LLG F;  3DTK A;  3PNY A;  4IQ4 A;  3FIS A;  3F6O A;  4A3I J;  5JVT A;  5IP6 A;  5FLV A;  1BR1 A;  1FY7 A;  2HDW A;  1HC8 A;  4S04 A;  3KP2 A;  4AWX B;  4G7Z F;  3TO9 A;  1DU0 A;  3LSM A;  2Y30 A;  3M9A A;  1E3H A;  5CJ9 A;  2FNA A;  2X1E A;  3GTM J;  2XUB A;  1UEL B;  1J9I A;  1ITY A;  1O7L A;  3V8K A;  2MH9 A;  2XAF A;  2HTS A;  4NBQ A;  1D5V A;  4BJT A;  4M3B A;  3S14 J;  3TW6 A;  5FLM J;  1U78 A;  3PL8 A;  1J75 A;  3WTS C;  2R7T A;  3BJA A;  3HRM A;  3JRF A;  1W4M A;  2L0K A;  4BQA A;  2K9L A;  2ADU A;  3R61 A;  3QAH A;  5IT9 K;  1U8R A;  5J8F A;  3QP5 A;  1LFU P;  3M1C A;  4HG2 A;  1PDN C;  2P6T A;  3AL0 B;  2IXS A;  2MD0 A;  2PQ8 A;  1TBX A;  3KLO A;  5ILS A;  2IEK A;  3LFK A;  2XAH A;  3KZZ A;  2R7X A;  4BEH A;  4XLF A;  4NQW A;  3Q0W A;  3O8H A;  2CYY A;  5FFX A;  2ZNZ A;  3EUK L;  1E0E A;  3RI4 A;  2ZJP F;  1POG A;  4XR6 A;  3JRE A;  1C0W A;  2GXA A;  3CF2 A;  2VT2 A;  3M1E A;  2V9P A;  3FXK A;  1WJA A;  4YRV A;  1E3O C;  4BH9 A;  4B3A A;  4B47 A;  1PYV A;  1SFE A;  3DU5 A;  3RPU A;  4N4N B;  4KIT B;  2L4A A;  3JSO A;  1ERD A;  1KU3 A;  4XN0 A;  2X1C A;  4M9S A;  2GA2 A;  2DT7 B;  4CZC A;  3MVP A;  4NC7 A;  4Q4Z F;  3HOX J;  1AKH A;  3ZPL A;  2AXT C;  4F91 B;  2M7B A;  2R7F A;  5KVR A;  2R7V A;  1FIP A;  3KZI C;  4RLF A;  1QPM A;  5F1R A;  1QZE A;  2IA1 A;  5BMZ A;  4KMF A;  2PX9 A;  5CLS A;  3BTL A;  1ZEL A;  3HKZ N;  3TP0 A;  2HGC A;  1QO0 D;  1XMA A;  2FBH A;  1TQI A;  5J4V A;  3HOS A;  2BY3 A;  3L2R A;  4GFB A;  2XVC A;  4E4H A;  3ABT A;  1HA8 A;  2O0Y A;  3FK6 A;  3E1S A;  4BS9 A;  2F5V A;  3CCJ I;  3P7N A;  2I5U A;  1R1V A;  2R93 J;  4DOZ A;  4EJW A;  3CLO A;  4L9N A;  2BHZ A;  3M07 A;  2DOF A;  5FD5 A;  3F0C A;  4DJA A;  2YU3 A;  1JHF A;  2LP0 A;  2H1K A;  3K6G A;  1WI3 A;  3AAF A;  2UXX A;  3REO A;  3LSR A;  2RVC A;  1BI1 A;  2A61 A;  5DD8 A;  3OS1 A;  2GOM A;  3HSF A;  3FXM A;  3CCU I;  2NRA C;  4HV5 A;  4A93 J;  2K5C A;  3PM1 A;  4PSX A;  3Q9S A;  4X6A J;  2H1L A;  1Y1W J;  1E3P A;  4XIC A;  5FKM A;  4PDK A;  5FLX Z;  1HDP A;  2XAS A;  5JR3 A;  1F5T A;  2E5Z A;  5KAI C;  2E36 A;  3JRA A;  4X1E A;  4ZZD A;  2DI3 A;  2W57 A;  1YFH A;  5IT9 Z;  1SVO A;  1IN7 A;  4XKC A;  1GT0 C;  2HWV A;  3R0A A;  5ICC A;  2EBI A;  2IGO A;  3LA7 A;  1VQM I;  2W82 A;  3J81 Z;  2A6E F;  3OR2 C;  1TWA J;  2CS3 A;  2XC7 A;  3P9I A;  5CKT A;  5HS9 A;  2XSD C;  3BT9 A;  1OFC X;  1SD4 A;  4Q47 A;  5FLX K;  2BBY A;  1ZAO A;  4EV0 A;  5C4X J;  1R36 A;  5H2F C;  1Z21 A;  9ANT A;  4N0B A;  1W7P D;  1R23 A;  5LBQ A;  2V1U A;  2BW3 B;  1MMD A;  4G7H F;  4BJ5 C;  3PO3 J;  1JGG A;  1W5C C;  2B9S A;  2KL4 A;  5GAG J;  4M3D A;  1PP8 F;  4UVC A;  2DMQ A;  1V4R A;  2E1N A;  2RV8 A;  2AQF A;  3EYI A;  5D5X B;  1KU2 A;  2X85 A;  3CCV I;  2VKD A;  1SFU A;  4XLP F;  1SD5 A;  3WHB A;  2EIL H;  1IXC A;  3MWM A;  5GAD J;  4OIN F;  1IG7 A;  3BJ6 A;  2IJL A;  5J6X A;  3BY6 A;  2D1V A;  2FOW A;  2VE8 A;  1FYK A;  2D2W A;  5GTI C;  2CV1 A;  2YU9 J;  1SFX A;  2CV2 A;  3A2K A;  2H6B A;  1GXP A;  1WJF A;  4FIS A;  2NVQ J;  1IUY A;  2ME0 A;  5L3C A;  3TP3 A;  4BE0 A;  2BEO A;  5D5W B;  1TLH B;  2DLL A;  4F3Q A;  4WX9 A;  3ABK H;  1UST A;  4C30 A;  3WGG A;  4KA4 A;  3GFL A;  3BZC A;  4RGR A;  2HYG D;  4A0X A;  2BYV E;  4CYC A;  1TP4 A;  3S1Q J;  2O5R A;  2OU2 A;  1TW3 A;  1LQ1 A;  4OAZ A;  3FXU A;  1AU7 A;  4OAY A;  3ZMS A;  1RI7 A;  5E3N A;  2OF7 A;  4M3G A;  5JLX A;  4M74 A;  1Z7U A;  1U0J A;  2F5F A;  5FB2 A;  2GZW A;  1QBJ A;  2B7E A;  2H94 A;  5H6Q A;  2E7X A;  2VBX A;  3QYE A;  2DYS H;  1XD7 A;  2K3F A;  2DDB A;  4D7M A;  1U3E M;  2DQR A;  2O03 A;  3HPH A;  2Z99 A;  3OY9 A;  3GXO A;  3GME A;  4I02 A;  1MH3 A;  5LGN A;  1MJB A;  1LPQ A;  1FOK A;  2DMT A;  2ZXI A;  3KPH A;  5KHD A;  3LSJ A;  3F22 A;  1B8I A;  1X3W B;  4NQW B;  4EJU A;  2V6C A;  2IPQ X;  1YS6 A;  3ABU A;  3CC4 I;  4XRS G;  1OCC H;  1R5G A;  4AVP A;  2F48 A;  5L3B A;  3DKX A;  3AG4 H;  3LWF A;  4ANJ A;  2ZFU A;  1KU9 A;  5EZH A;  1MMN A;  2NXN B;  3L09 A;  4K2E A;  1F36 A;  2VQC A;  1J2X A;  3OMY A;  5DCM A;  4KIC A;  1OJL A;  2JRT A;  4RGU A;  3CJR B;  3K2A A;  4ZYE A;  2FQ4 A;  1DQU A;  2CQN A;  3OIQ A;  4HW0 A;  3NAR A;  5TIS C;  4DW6 A;  1H88 C;  3J7Z I;  1Z67 A;  3B6C A;  1HW2 A;  1KON A;  4Z6Y A;  1IGN A;  4MFE A;  2BHY A;  1HST A;  2K9N A;  2HQ5 A;  3CJT B;  3CZ6 A;  3FXQ A;  4GYG A;  4N9I A;  3FIW A;  1D8J A;  2XSJ C;  3DU6 A;  4FET A;  4UUT A;  3CJN A;  1OR7 A;  2WAE A;  3W6K B;  4XRS A;  5M5W J;  1S72 I;  2RDP A;  1G3T A;  4CYD A;  2D45 A;  1BOA A;  1QVT A;  2EA2 A;  2ZKZ A;  4AYB N;  5F0F A;  2VXD A;  3N97 A;  3KP3 A;  3V4G A;  1R58 A;  2P7V B;  3E7L A;  4LD5 A;  3EPZ A;  3OWT A;  4U88 A;  3U1D A;  3B73 A;  2L9R A;  2Z1D A;  1ENH A;  2VOO A;  1S3J A;  1OYY A;  2HFH A;  2JZY A;  1BIA A;  3K1M A;  2ZME C;  2ESN A;  2O9L A;  2UWM A;  2GXB A;  3CC2 I;  3RCO A;  3FKI J;  2TCT A;  5B3S H;  4HF0 A;  4EM0 B;  3LA2 A;  5AON A;  2IBD A;  2KDZ A;  4A3B J;  2OZU A;  3KIO A;  3CCY A;  3GX4 X;  3Q0U A;  4A3J J;  5HOD A;  2R7O A;  5EJC A;  1F9N A;  1YIO A;  2VIX A;  2XGC A;  4CIC A;  1ZRE A;  3H9J A;  4CUG A;  2M0C A;  2YX4 A;  3CDL A;  2EV6 A;  2M34 A;  2IRF G;  1AKH B;  2PG4 A;  4ENM A;  2P5V A;  3FM5 A;  4UXN A;  1I1G A;  1J5Y A;  2M45 A;  2VI6 A;  1WRJ A;  5IY5 H;  2J5P A;  3DCF A;  4S05 A;  3WTX C;  2OJE D;  2ZXH A;  2DFF A;  2KRH A;  4HSR A;  3IRR A;  3M8E A;  4PGH A;  4HDV A;  2Y75 A;  3CMM A;  2QBY B;  2JMW A;  2M4G A;  2LOO A;  1CF7 A;  5BNG A;  2X6Y A;  1MNM C;  4UV8 A;  4AVZ A;  2UXN A;  4ESF A;  4HQM A;  4LB5 A;  1YX5 A;  4D5F A;  2H09 A;  3HRT A;  4PFO A;  2HVS A;  4BY7 J;  1MW7 A;  1YO5 C;  1MJA A;  2ZFW A;  3HGG A;  1SAX A;  2CQX A;  3JTH A;  1ZLK A;  4DYR A;  4UNO A;  3VYU B;  2LNB A;  4WWC A;  4A2U A;  2GIV A;  1XMX A;  2CH0 A;  2XGX A;  3RKW A;  3R4K A;  3H3Z A;  3AKZ A;  5HVQ C;  5A2Q K;  5AIP A;  1HBX G;  1X1B A;  3ZQ7 A;  3M7G A;  2CFX A;  2Z3Y A;  3G4S I;  1FBQ A;  1YW7 A;  2JA8 J;  4XKB A;  3H5A A;  2CUZ A;  1QA6 A;  4NNJ A;  5HLG A;  4ZZL A;  5EZG A;  1YIT I;  2K4J A;  3SXY A;  3KP5 A;  2DQL A;  1K78 A;  2KMU A;  1ZN2 A;  3G2B A;  4A69 C;  1KA8 A;  2G7U A;  5JI6 A;  3QU6 A;  1E2X A;  4KYW A;  1S5L C;  4KN4 X;  4ENK A;  1XSD A;  2QZ8 A;  4HLY A;  3N4M A;  4BXU A;  5M3M J;  2DN0 A;  3J7A Y;  2W7N A;  1NTC A;  1A04 A;  4UB6 C;  1IXR C;  4RAG A;  5CYV A;  3RPQ A;  2UZK A;  1XSV A;  1ZKG A;  2DO7 A;  1UG0 A;  2OAZ A;  2VJ4 A;  4W1U A;  2HOA A;  2FEZ A;  1TZL A;  2XB0 X;  4QPO A;  1GLN A;  1GV2 A;  3RZD J;  1X19 A;  1Z91 A;  3WU0 A;  4FTH A;  2CGP A;  3CDH A;  2D1H A;  2Q1Z B;  5EGO A;  2K86 A;  3J80 Z;  3S3N A;  4O5V A;  5IYC J;  1Z05 A;  2JT1 A;  1X3U A;  1MDM B;  3GTQ J;  3MEX A;  1U5T C;  1B8I B;  3L2C A;  3OYB A;  1GXQ A;  1S7E A;  2IP2 A;  3DFG A;  4RAZ A;  2EB7 A;  1UJ8 A;  2NAZ A;  4M6X A;  1OMI A;  1RR7 A;  5E1W A;  3RYP A;  1DGW Y;  4HOB A;  4BYY A;  1T39 A;  4YG2 F;  1TNT A;  1JTX A;  3ZN0 A;  1SMY F;  2MA3 A;  1G4D A;  4LJZ F;  3LAP A;  1RNL A;  2GLO A;  4YIF A;  2E19 A;  2EV0 A;  4PJN A;  3ISP A;  3A02 A;  5CVU A;  2VPR A;  2VAS A;  4MTE A;  5ILU A;  5CVV A;  1D1B A;  1S7A A;  1DGR M;  2VKH A;  4IOA F;  1MZB A;  4MQ9 F;  1I1S A;  3IL2 A;  3G1M A;  1X58 A;  2DPD A;  2CW7 A;  5K5R A;  3DF8 A;  3LOC A;  3WGI A;  3OV8 A;  5L3E A;  3KX2 A;  4XON A;  3LA3 A;  4A0Y A;  1QHH D;  1SAU A;  3P9K A;  1SC7 A;  4IX7 A;  1FJL A;  3BR3 A;  5K7Z A;  1U5T A;  2KIM A;  4CYC B;  1YJW I;  1APL C;  3T8R A;  2CQ7 A;  3R6S A;  3Q3S A;  3I4P A;  4IHT A;  4G94 A;  4Y52 J;  3OL3 A;  1FP2 A;  3J81 K;  5L3D A;  5DDG A;  3A01 B;  1UMQ A;  1W36 D;  4M72 A;  1U9N A;  5C44 J;  4AYB A;  2HNH A;  2K3P A;  2Y0S N;  3I58 A;  2PJR A;  4II2 A;  2OQG A;  1XCV A;  1VQP I;  4IHS A;  3PIO F;  1HCR A;  2OCE A;  4PJM A;  2DFE A;  5LRR A;  2PEX A;  2QWW A;  3LST A;  3NAU A;  3EDP A;  1YLF A;  4DBR A;  1QRY A;  3BPV A;  1LEB A;  2N8G A;  3G1O A;  1LVA A;  2JA2 A;  1K4T A;  4Y4R A;  3S93 A;  3S16 J;  1WH7 A;  2KKO A;  3H92 A;  3I71 A;  4NC8 A;  1UCR A;  2LSO A;  4UHT A;  2EFW A;  2IA0 A;  1WFX A;  2QSF X;  4O6J A;  1SFO J;  1FZP B;  3I59 A;  2VJ5 A;  2HEO A;  4LLN A;  3F6V A;  3QYB A;  2V9V A;  5HS7 A;  2LRD A;  3BG6 A;  2XAJ A;  4JQF A;  4WF2 A;  3S3M A;  4L5E A;  5D5V B;  1H89 C;  2QA4 I;  4MEY F;  4R8H A;  2RN7 A;  3K9T A;  3FKJ A;  2DOA A;  5LHI A;  3RQI A;  4XQF A;  2E35 A;  1FYL A;  2NS7 A;  5F04 A;  2HTJ A;  1B1B A;  2XPW A;  4W97 A;  1Z0X A;  4KJZ A;  4M9Z A;  4ZDL A;  1ZTR A;  3V8L A;  4DYQ A;  2NS0 A;  3HYI A;  3H0D A;  3S3O A;  1B9M A;  2JSC A;  2WY7 Q;  1JKR C;  3CCM I;  1VI0 A;  2FMY A;  4QLC U;  3P9C A;  2WTE A;  4HNU A;  1I5Z A;  2DA4 A;  2DFI A;  4F93 B;  4FX4 A;  1ZRF A;  1KYZ A;  2GA1 A;  4QSH A;  3J7A O;  2A5W A;  2LF7 A;  2P7C B;  5E3M A;  4DNC A;  3SZG A;  5J1U A;  2XAQ A;  3CUO A;  5DCF A;  2JN6 A;  2XRO A;  2PJR B;  5D4R A;  1PP7 U;  3ERM A;  4D5C A;  1A35 A;  3JCU C;  2OD5 A;  1TC3 C;  3KET A;  1LE8 B;  4L5I A;  5HS8 A;  2KT0 A;  4BQQ A;  1XTA A;  2JQ7 A;  2A68 F;  3ZN1 A;  4E7L A;  1MBK A;  3X2Q H;  1YIJ I;  3DKY A;  2E5N A;  1OCT C;  4J01 A;  1VFC A;  2H6C A;  4ABZ A;  2CQQ A;  3NRV A;  2ZXJ A;  3FBN B;  3V7R A;  3RDI A;  5AIQ A;  2F4I A;  2FML A;  4MQV A;  3KCC A;  4EM2 A;  4ZDO A;  2OPT A;  3F3X A;  2FQ3 A;  3HL2 A;  4U0W A;  5GPC A;  4FQG A;  2HS5 A;  2XIG A;  3M8F A;  2WAD A;  1IDZ A;  2ISY A;  4M3E A;  4XRF A;  5BQT A;  4KDP A;  2VQL A;  2WAQ A;  2RAE A;  1MKM A;  2F4O B;  4LB6 B;  2HKX A;  3QPH A;  3VYT B;  3BR2 A;  1WSU A;  4C2M J;  1H9G A;  3SEZ A;  1UG2 A;  2OTL I;  3B02 A;  3K70 C;  2F2E A;  2X51 A;  1Z3Y A;  3CES A;  4E6K G;  3VDX A;  2XRL A;  3F21 A;  1CF7 B;  1YG2 A;  2JPC A;  2VBW A;  1KQ8 A;  1ZHF A;  5DTD A;  1JKQ C;  2LDU A;  1K6O A;  3K4L A;  3JAM K;  2E71 A;  2PI0 A;  2ZJ2 A;  4GGG A;  3T0Y A;  2K9Q A;  1FBU A;  1WJB A;  3RIR A;  4EEF G;  4OIQ F;  3OOP A;  3KP6 A;  2TDX A;  3A01 A;  3MFK A;  4IHY A;  1B59 A;  1W1W E;  5FKN A;  1UB9 A;  1LFB A;  1WCM J;  2L54 A;  3CUQ C;  1ZRD A;  3TDU C;  2X6X A;  3K4J A;  2Y0S A;  2W24 A;  1R6R A;  1WJ5 A;  2WV0 A;  4MLO A;  2LF8 A;  1BBY A;  4DZP A;  3QYF A;  2VQG A;  3E0J B;  2VJJ A;  1I6X A;  3JSP A;  4AIJ A;  3F8M A;  5EEA A;  4OMY A;  3PJR A;  1HW1 A;  1W5S A;  2KZV A;  2DA1 A;  3KZY A;  4XN3 A;  4Z2Y A;  4CCJ A;  2XGE A;  1RET A;  4PZJ A;  1MD0 A;  3ABM H;  3O2P E;  5LEJ A;  2M0M A;  2K9M A;  4XLA A;  1ETQ A;  4P1W A;  4ZC3 A;  3CMA I;  1ZR2 A;  1R22 A;  5DM6 F;  2F5D A;  5D8L B;  1K61 A;  1MH4 A;  3CCR I;  5E17 F;  4L0Y B;  2CG4 A;  1VQ5 I;  3NWT A;  3ESW B;  1HOM A;  2EIM H;  4L9V A;  4NB5 A;  4CO8 A;  3SFI A;  4HF1 A;  4IZZ A;  2Z5U A;  4C2T A;  3NWS A;  4LMY A;  4HF2 A;  2VJI A;  3C18 A;  1ZG3 A;  4MIM A;  1U9O A;  1Y0U A;  4P96 A;  1T95 A;  1X2M A;  2AO9 A;  3E6B A;  2CMP A;  3DPU A;  2K7L A;  1BR4 A;  4G6Q A;  4ITV A;  2YSR A;  1IN6 A;  5EF6 A;  2VN2 A;  4Y17 A;  4L18 B;  1IUF A;  4CSW A;  1MDM A;  2E2I J;  3V42 A;  2R3S A;  1WI9 A;  2LD5 A;  4PSW A;  2AHQ A;  1EV7 A;  5TJJ A;  3ELK A;  2R7Z J;  1QZZ A;  2WB1 A;  5GP9 A;  1BI3 A;  3BP8 A;  2P6S A;  3OIO A;  2M87 A;  4HX7 A;  5ICF A;  2HQR A;  2NVY J;  1J7K A;  1OCZ H;  2Y0M A;  2HOT A;  1TQP A;  2KLO A;  3GFM A;  4B48 A;  3AG3 H;  4IL6 C;  5FO5 A;  5DEQ A;  5LLQ A;  5BOX A;  2O61 A;  4Q48 A;  1UHW A;  2ZME A;  3V7S A;  4HRI A;  2O7O A;  1EH7 A;  4UVA A;  4BY1 J;  3I56 I;  4AIK A;  4BE1 A;  4A3G J;  2A6T A;  4NDL A;  2QM3 A;  1Y56 A;  1GVJ A;  4JOM A;  2GM4 A;  5D8K B;  1K4S A;  3IV5 A;  3BZ6 A;  2W25 A;  4P5O A;  1TL8 A;  2KJB A;  3BTI A;  1BL0 A;  5J47 A;  1UHS A;  3GTJ J;  1R1T A;  2VKE A;  3PSF A;  4UV9 A;  4HNT A;  3OYD A;  3K1N A;  5HLI A;  2JUC A;  2OC6 A;  3FMS A;  3DLL F;  2DMN A;  3BR5 A;  3IP4 B;  4LIT A;  3I4N J;  1RUN A;  3AG2 H;  5E8I A;  4GO1 A;  3L2U A;  5EGO B;  2L4M A;  1FNN A;  3D5L A;  3H3V K;  1IZ1 A;  1Y1V J;  3PFI A;  4B43 A;  2LYC A;  3W2W A;  2DMU A;  3OSF A;  3TKY A;  3D1N I;  1V5E A;  3MKW B;  5EG0 B;  1ZYR F;  2DTZ A;  1LUJ B; 
#chains in the Genus database with same CATH homology
 5C3E J;  2IBD A;  5K7F A;  2KDZ A;  2P81 A;  2GBY A;  1RKW A;  4A3B J;  3BTC A;  3CCY A;  1MBF A;  3Q0U A;  4A3J J;  2VKV A;  1HF0 A;  3FK7 A;  5HOD A;  1ETX A;  2FX0 A;  2R92 J;  2XGC A;  3K7A J;  3ZQG A;  2HYJ A;  2M0C A;  1A5J A;  3B6A A;  3CDL A;  5IOZ A;  2DA5 A;  2M34 A;  1U8B A;  1F43 A;  5IP9 J;  1W0T A;  3CMY A;  2ECC A;  1R9T J;  1Z77 A;  4IEJ A;  1AKH B;  2DA3 A;  2D5V A;  4MFD A;  2JA5 J;  2VI6 A;  3BTJ A;  3BG9 A;  3DCF A;  2Y2Z A;  2WAQ N;  3CQZ J;  3I4M J;  3BR6 A;  2CRG A;  2DA2 A;  1IJW C;  2IAI A;  2JMW A;  3S1R J;  3C2B A;  2JA6 J;  1JUP A;  2L7M P;  3JRG A;  5BNG A;  1FIA A;  4FCY A;  3S1M J;  3PO2 J;  1MNM C;  5IYD J;  3QPS A;  3S2H J;  1P7I A;  2HI3 A;  4D5F A;  3HOW J;  1MBG A;  4D7N A;  4JX6 A;  3W6V A;  4I6Z A;  4BY7 J;  3HB9 A;  3HGG A;  1OCP A;  2CQX A;  4DYR A;  4A3M J;  4XRM A;  1IRZ A;  2HDD A;  4A3E J;  3GBG A;  1K83 J;  3S2D J;  1P7J A;  1TWF J;  1AHD P;  2HOS A;  1GUU A;  2R5Y B;  2M2E A;  1PUF B;  2EZH A;  2JA8 J;  5EDN A;  3GTK J;  5EZG A;  2COB A;  5FKO A;  3OSG A;  3JRH A;  4DZJ A;  4A69 C;  2K40 A;  2I10 A;  3OOU A;  3ZQH A;  5M3M J;  1IV6 A;  2CUF A;  2DN0 A;  2HXI A;  3JRI A;  2WB1 N;  4I76 A;  2TCT A;  1ZGW A;  1NTC A;  1ZK8 A;  2LY9 A;  4A3C J;  1B72 B;  5EYR A;  4IHV A;  1ZKG A;  4W1U A;  2ECB A;  2HOA A;  2XB0 X;  1I3Q J;  3QPL A;  4XID A;  1GV2 A;  3RZD J;  3UKG A;  5J1Y A;  4FTH A;  2QCO A;  3IH4 A;  3ZQC A;  5EGO A;  1ZQ3 P;  5IYB J;  1G2H A;  1I50 J;  2JK3 A;  3H0G J;  3HEF A;  5IYC J;  1I6H J;  1ORK A;  5M3F J;  1QVU A;  3HGY A;  5E3O A;  3GTQ J;  1B8I B;  1S7E A;  5DS9 A;  1T33 A;  5K7H A;  3RZO J;  2PMZ N;  1RR7 A;  2LKX A;  2FJ1 A;  2JJ7 A;  3A03 A;  4M3F A;  1WGX A;  5F27 A;  2FD5 A;  1JTX A;  2E1O A;  3FIS A;  3ZOB A;  1YRN B;  2XPV A;  1GDT A;  1JUS A;  4A3I J;  3O8G A;  2GLO A;  4DYC A;  3IH2 A;  5IP6 A;  5FLV A;  5IPA A;  2E19 A;  3A02 A;  2VPR A;  2LTP A;  1DU0 A;  5J3L A;  4UUS B;  1TWG J;  2Y30 A;  3LSG A;  5IP7 J;  3G1M A;  1X58 A;  3GTM J;  5FKL A;  1QPI A;  5F0H A;  3LOC A;  1ITY A;  2ID3 A;  1NK3 P;  4QTR A;  4M3B A;  3S14 J;  1EF4 A;  3HM5 A;  1FJL A;  3TW6 A;  5FLM J;  3BR3 A;  5K7Z A;  1U78 A;  2W48 A;  4CYC B;  3S1N J;  1D5Y A;  1APL C;  3JRF A;  3DEW A;  2DA6 A;  2L0K A;  3Q3S A;  4HNV A;  1W0U A;  4Y52 J;  1ZR4 A;  3JR9 A;  3A01 B;  1UMQ A;  4XK4 A;  3RKQ A;  2EH3 A;  1U9N A;  4S0H B;  5C44 J;  1O4X A;  1LFU P;  2Y0S N;  2H8R A;  1T56 A;  2IEK A;  1X2N A;  5GPA A;  1HCR A;  4G12 A;  3ZQI A;  4V2F A;  3Q0V A;  3NAU A;  2NS8 A;  1QRY A;  3Q0W A;  3O8H A;  4IHW A;  2N8G A;  5F08 A;  3G1O A;  1HDD C;  5C4J J;  3S16 J;  1WH7 A;  4AUX A;  2M9H A;  3GTG J;  1POG A;  3JRE A;  3TW7 A;  2LFB A;  3MKL A;  1JT6 A;  1SFO J;  1E3O C;  2LVS A;  4B3A A;  1BJZ A;  1HLV A;  2EQR A;  5M5X J;  2R5Z A;  4M6V A;  2L7Z A;  2CU7 A;  4L5E A;  3HOX J;  1AKH A;  1H89 C;  3MVP A;  1ETY A;  2R5Y A;  1TWH J;  3QQA A;  3GTO J;  3RQI A;  1FIP A;  3BG3 A;  3S15 J;  1MBJ A;  2NS7 A;  2E2J J;  5F04 A;  2YUS A;  1GV5 A;  3L1P A;  3BTL A;  3JRD A;  2XPW A;  3HKZ N;  4W97 A;  1Z0X A;  3TP0 A;  1H8A C;  3GTL J;  5E3L A;  1NK2 P;  4JX4 A;  1ZTR A;  3SDG A;  4GFB A;  4DYQ A;  1JKP C;  3FK6 A;  1JKR C;  3HOY J;  3JRB A;  2YS9 A;  1VI0 A;  2E2H J;  2DJN A;  4MO7 A;  4C3J J;  2JA7 J;  3WHC A;  2DA4 A;  3LSP A;  5F0C A;  4QSH A;  2R93 J;  2XB5 A;  1DU6 A;  5E3M A;  3F0C A;  5J1U A;  4JP0 A;  2LR8 A;  1RKT A;  2JN6 A;  3MN2 A;  2LP0 A;  2H1K A;  1XS9 A;  1WI3 A;  2LK2 A;  3LSR A;  4D5C A;  5EG0 A;  1TWC J;  2G0E A;  1TC3 C;  4A93 J;  3IH3 A;  1LE8 B;  2KT0 A;  3TED A;  1RPW A;  3PM1 A;  1MBK A;  2HXO A;  4X6A J;  1CQT A;  1Y1W J;  4XIC A;  5FKM A;  1OCT C;  4V2G A;  4AC0 A;  1VFC A;  4Y7N J;  1HDP A;  4ABZ A;  1MBH A;  2CQQ A;  1RES A;  4X1E A;  3JRA A;  5JLW A;  1BA5 A;  2NOG A;  1GT0 C;  2OPT A;  4QIW N;  4JX5 A;  2EBI A;  3ZQL A;  3ZQF A;  5GPC A;  1BW5 A;  4BXX J;  1IDZ A;  4RDU A;  4M3E A;  1TWA J;  2B63 J;  2RAE A;  2R5Z B;  2XSD C;  3BT9 A;  1OFC X;  2NVX J;  3BR2 A;  2MGQ A;  3VPR A;  4C2M J;  5C4X J;  1UG2 A;  2EZK A;  1ETV A;  9ANT A;  4A3L J;  4B1R A;  2X9D A;  2ZB9 A;  2CUE A;  2XRL A;  3PO3 J;  1JGG A;  2MSY A;  5DTD A;  4C3H J;  2Y9Y A;  1JKQ C;  3GTP J;  4M3D A;  1ETK A;  3HDD A;  2DMQ A;  2K9Q A;  2NVT J;  4EEF G;  3A01 A;  4IHY A;  4RBO A;  5FKN A;  1IC8 A;  1LFB A;  1WCM J;  3WHB A;  5FJ8 J;  3HOU J;  1IG7 A;  4BBR J;  1MSE C;  2XGD A;  4A3D J;  4BBS J;  1YRN A;  1GVD A;  4IHX A;  2YU9 J;  4MLO A;  2ELK A;  2Y31 A;  4DZP A;  1JJ8 C;  1VF9 A;  2VUM J;  1JKO C;  4J19 A;  4FIS A;  2NVQ J;  1VND A;  4FE7 A;  2ME0 A;  3BR1 A;  5EEA A;  3G1L A;  3TP3 A;  2DA1 A;  2XGE A;  1RET A;  1JT0 A;  2DA7 A;  4A3K J;  3HOZ J;  1ETQ A;  1JUM A;  1ZR2 A;  1WH5 A;  1Q1V A;  3BG5 A;  2K9S A;  4C3I J;  1MH4 A;  4CYC A;  4A3F J;  1K61 A;  2Y9Z A;  3S1Q J;  1AU7 A;  5F1J A;  1HOM A;  2M8G X;  4FE4 A;  2OF7 A;  5E3N A;  4M3G A;  1B72 A;  3SFI A;  5JLX A;  4LOC A;  1JTY A;  3S17 J;  3M3Y J;  3BR0 A;  1FTZ A;  4MIM A;  4D7M A;  2LLK A;  3HOV J;  1BW6 A;  1U9O A;  4B4C A;  1X2M A;  2AO9 A;  1MH3 A;  2CJJ A;  1A6I A;  2DMT A;  2EZL A;  3SJM A;  3LSJ A;  5EF6 A;  1B8I A;  1IUF A;  2E2I J;  2LD5 A;  2MW8 A;  3BQZ A;  2AHQ A;  2R7Z J;  4XRS G;  2R0Q C;  5GP9 A;  3OIO A;  1ETW A;  1JJ6 C;  5EZH A;  2NVY J;  1SAN A;  1F36 A;  1PUF A;  2TRT A;  2HOT A;  1OJL A;  3K2A A;  2ME6 A;  5J1R A;  2FQ4 A;  2QF7 A;  4JYK A;  4UUS A;  1H88 C;  3NAR A;  1FEX A;  4DW6 A;  3B6C A;  1WPK A;  1FTT A;  1IGN A;  2O7O A;  4MFE A;  4BY1 J;  1MSF C;  2K9N A;  2HQ5 A;  3FIW A;  4A3G J;  4NDL A;  5IOY A;  4UUT A;  2MG4 A;  2GM4 A;  4XRS A;  2ID6 A;  3IV5 A;  5M5W J;  2O8K A;  3JRC A;  1QVT A;  4AYB N;  5F0F A;  1LE8 A;  3BTI A;  2EZI A;  1BL0 A;  1UHS A;  3GTJ J;  2VKE A;  1MBE A;  3E7L A;  1XC5 A;  2DMN A;  1XG1 A;  3BR5 A;  3I4N J;  2X6O A;  5M5Y J;  2WV1 A;  5EGO B;  2L7F P;  1IDY A;  2L9R A;  4BKX A;  1ENH A;  2XPU A;  3LNQ A;  3HBL A;  5FKK A;  3H3V K;  2X48 A;  1Y1V J;  2O9L A;  2JWT A;  2DMU A;  3OSF A;  3D1N I;  3BQY A;  1ETO A;  5EG0 B;  3M4O J;  3FKI J;  2DTZ A;  2DMP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...