2COCA

Solution structure of the c-terminal ph domain of fyve, rhogef and ph domain containing protein 3 (fgd3) from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
112
structure length
112
Chain Sequence
GSSGSSGSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLSTAAHSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the C-terminal PH domain of FYVE, RhoGEF and PH domain containing protein 3 (FGD3) from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
molecule keywords FYVE, RhoGEF and PH domain containing protein 3
total genus 13
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cocA01
1UNPA 3QWMA 2DLWA 2UZSA 3ZVRA 1IRSA 4DX90 1FHXA 3FSSA 2YS1A 2EMSA 1MK9B 1AWEA 1TXDA 1V5PA 3MPXA 3PVLA 2COAA 5HE3A 1FOEA 2Z0OA 3IVFA 3DXEA 2DN6A 2GCLA 2MWNB 3FM8C 2CAYA 4HAXB 2D9YA 4F7HA 2XQNM 1X05A 4IAPA 4HB4B 1DBHA 1X1GA 3CIKA 4B6HA 1NI2A 1GC6A 2ELBA 2HTHB 1GC7A 4GN1A 2DX1A 5C79A 1LW3A 2I5FA 3PP2A 3BINA 1WJMA 3G9WA 4KAXB 4Z2MB 4K81A 2CY4A 2I5CA 2QKLA 4PNKA 2R09A 2D9VA 3WYFB 3PSCA 1P3RA 5L81A 3P6AA 1KZGA 4C0AA 1KI1B 3X23A 1DDVA 2MDXA 4ZRJA 1NTVA 1NU2A 4DBBA 3ULBA 1ZM0A 4HB0B 5D3WA 2KCJA 3KRXA 2E2XA 2P0DA 1U5FA 4CHJA 1WGUA 3D8FA 2D10A 1X1FA 2YT0A 5DHAB 4WVFB 5CLLB 4IFSA 4DX8A 1U5DA 5DH9B 2D2QA 2RUKB 2LOZA 3ODOA 1OMWA 1Y19B 3SV1A 3TFMA 3AJ4A 4GXBA 1Q67A 2W2XD 2D4QA 1RRPB 1H4RA 1TJ6A 5D3VA 1QQGA 2Z0QA 3U7DA 2KUPA 1OY2A 5EFXA 1V5UA 2ADZA 4Z2NA 4HB2B 1SGHA 4HDQA 3CXBB 1I2HA 3U8ZA 5C6RA 3V5WA 1UEFA 1K5DB 4K2PA 3UZTA 3KY9A 1FHOA 2EMTA 4WJ7A 1WVHA 2RNRB 2OTXA 3T06A 2J59M 3ML4A 1RJ2A 2EJ8A 1DDMA 5D27A 5KCVA 2D11A 5HE2A 3F0WA 2L1CA 1ZSQA 1QC6A 3NSUA 4NSWA 2NMBA 2LKOA 5CLQB 1XD4A 2VSZA 3VOQA 5JLJB 4GMVA 2DYNA 5D3XA 2DTCA 2LULA 2H7DA 4Y94A 5HE0A 4HAYB 3PG7A 3SUZA 2P0FA 3A8PA 3HK0A 2Q13A 2DHIA 2UVMA 2LYDA 5GOWB 3WA0A 2VRWB 4D0NB 2IYBA 2I1JA 1EGXA 2X18A 1DROA 2QKMA 2GCJA 2DA0A 2ELAA 4HAVB 5J3TA 3A8QA 1NTYA 2RSGA 4L6EA 1PLSA 2P8VA 1K5GB 1MK7B 4BBKA 3OANA 1U5GA 2W2XC 2DHKA 5KQ1A 1DDWA 2JP2A 2Y8FA 2YF0A 4XWXA 3MDBC 1P6SA 2DHJA 1DYNA 1ZVRA 2LG1A 1W1DA 3KRWA 3PVWA 4K2OA 2KGXB 3VIAA 3ODXA 5DI9B 2NZ8B 2CRFA 1U5EA 1XCGA 3SNHA 1AQCA 1TQZA 4ZRIA 3PEGA 2DYQA 5HE1A 4HHVA 1BTKA 2YT1A 1EAZA 4NY0A 3A98B 1BWNA 1U29A 4HDOA 2AL6A 4KHOA 1ISNA 2ROVA 3P7ZA 1P5TA 2RVBB 2DFKA 2J0MA 1J19A 2GS0A 4HATB 1Z87A 1FHWA 4HAZB 4MY6A 1WJ1A 2YS5A 2MFQA 2YRYA 4IOYX 2AEHA 2D9XA 3N7CA 3PZDA 3ODWA 1MIXA 2G35A 3D8EA 4MT7A 4KHBB 4TYZA 1MAIA 2N0YA 1FGYA 4EKUA 1H10A 5J3YA 3KSYA 2K00A 2PZ1A 1V61A 2YSZA 1PMSA 3D8DA 2GJYA 2J0JA 1MPHA 4DXAB 4GZUA 4F7GA 4A6FB 4CHMA 4KVGB 1E5WA 1UPRA 1XR0B 1WI1A 4P7IA 3HW2B 4YL8A 5JP4A 1U27A 3QIJA 3GYPA 5FI0A 1PFJA 2D9ZA 5JHGA 1M7RA 2W2WA 4HAWB 5C5BB 1W1HA 5FI1A 1B55A 2YS3A 1WGQA 2H7EA 2K2JA 3AU4A 2K2UA 1J0WA 4MK0A 5J3QA 2BCJA 4ZRKA 3DXCA 1XODA 1M7EA 1X11A 1U2BA 4H8SA 3TVVA 5KQ4A 2RGNB 1LB1A 2COCA 3KZ1A 3TW1A 5JHHA 3HQCA 1WG7A 2DX5A 1XKEA 5D3YA 1ZC4B 4A6HA 2OQBA 1UPQA 4GPTB 1EVHA 1KZ7A 1MIZB 4K17A 3PVUA 2DKQA 1ZC3B 1MKEA 1XX0A 2R0DA 4GMXB 5LONB 3TO1A 2ZPYA 4A6KA 4YONA 5LOPB 4PQ0A 2MKRA 2DKPA 3ULCA 1FGZA 3DXDA 2YVCA 1V89A 5DIFB 1UNRA 2M38A 2RLOA 3FEHA 3ZDTA 1X86A 1GG3A 3AU5A 1OQNA 2UZRA 1SHCA 1V5MA 2Y8GA 2D9WA 1N3HA 4KHAA 1BTNA 2CODA 2LOXA 1EF1A 4CYEA 1FB8A 1V88A 2COFA 2VKIA 3BJIA 4F7UP 1FAOA 3O96A 3M1IB 3RCPA 2ROZB 1W1GA 4HAUB 3SO6A 3TCAA 2P0HA 4TKNA 2J0KA 1I7AA 2M14A 3LJUX 1UNQA 2Z0PA 2FJLA 3QBVB 1Y5OA 4WSFA 4A5KA 2HE7A 5C5BA 1BAKA 3SYXA 2V76A 3F5RA 2L2IA 5C16A 5DHFB 2EC1A 4EJNA 2IFSA 3GYOA 4A6FA 2N23A 2CY5A 4HB3B 2I1KA 2Y7BA 4EMOA
chains in the Genus database with same CATH superfamily
1UNPA 3QWMA 3HIEA 2DLWA 2UZSA 3ZVRA 1IRSA 4DX90 1FHXA 3FSSA 2YS1A 2EMSA 1MK9B 1AWEA 1TXDA 1V5PA 3MPXA 3PVLA 2COAA 5HE3A 4QJ3B 1FOEA 2Z0OA 3IVFA 5IRSA 3DXEA 2DN6A 2GCLA 2MWNB 4KHBA 3FM8C 2CAYA 4HAXB 2D9YA 4F7HA 2XQNM 1X05A 4IAPA 3U12A 4HB4B 1DBHA 1X1GA 3CIKA 4B6HA 1NI2A 1GC6A 2ELBA 2HTHB 1GC7A 4GN1A 2DX1A 5C79A 1LW3A 2I5FA 3PP2A 3BINA 1WJMA 5LG4B 3G9WA 4KAXB 4Z2MB 4K81A 2CY4A 2I5CA 2QKLA 4PNKA 2R09A 2D9VA 3WYFB 2RRFA 3PSCA 1P3RA 5L81A 3P6AA 1KZGA 4C0AA 1KI1B 3X23A 1DDVA 2MDXA 4ZRJA 1NTVA 1NU2A 4DBBA 3ULBA 1ZM0A 4HB0B 5D3WA 4OSNA 2KCJA 3B77A 3KRXA 2E2XA 2P0DA 1U5FA 4CHJA 1WGUA 3D8FA 2D10A 1X1FA 2YT0A 4OT1A 5DHAB 4WVFB 5CLLB 4IFSA 4DX8A 1U5DA 5DH9B 2D2QA 2RUKB 2LOZA 3ODOA 1OMWA 1Y19B 3SV1A 3TFMA 3AJ4A 4GXBA 1Q67A 2W2XD 2D4QA 1RRPB 1H4RA 1TJ6A 5D3VA 1QQGA 2Z0QA 3U7DA 2KUPA 1OY2A 5EFXA 1V5UA 2ADZA 4Z2NA 4HB2B 3NW8A 1SGHA 1ZYIA 4HDQA 3CXBB 1I2HA 3U8ZA 5C6RA 3V5WA 1UEFA 1K5DB 4K2PA 2R2YA 3UZTA 3KY9A 1FHOA 2EMTA 4WJ7A 1T77A 1WVHA 2RNRB 2OTXA 3T06A 2J59M 3ML4A 3DCXA 1RJ2A 2EJ8A 1DDMA 5D27A 5KCVA 2D11A 5HE2A 3F0WA 2L1CA 2Z4DA 1ZSQA 1QC6A 3NSUA 4NSWA 2NMBA 2LKOA 3NWDA 4HSIA 5CLQB 1XD4A 2VSZA 3VOQA 5JLJB 4GMVA 2DYNA 5D3XA 4QXAB 2DTCA 2LULA 2H7DA 4Y94A 5HE0A 4HAYB 3PG7A 3SUZA 2P0FA 3A8PA 2FJUB 2NBVA 3HK0A 2Q13A 2DHIA 2UVMA 2LYDA 5GOWB 3WA0A 2VRWB 4D0NB 2IYBA 2I1JA 1EGXA 2X18A 1DROA 2QKMA 2GCJA 2DA0A 2ELAA 4D6WA 4HAVB 5J3TA 3A8QA 1NTYA 2RSGA 4L6EA 1PLSA 2P8VA 1K5GB 1MK7B 4BBKA 3NWAA 3OANA 1U5GA 2W2XC 2DHKA 2KIGA 5KQ1A 1DDWA 2JP2A 2Y8FA 2YF0A 4XWXA 3MDBC 1P6SA 2DHJA 1DYNA 1ZVRA 2LG1A 1W1DA 3KRWA 3PVWA 4K2OA 2KGXB 3VIAA 3ODXA 5DI9B 2NZ8B 2CRFA 1U5EA 1XCGA 3SNHA 1AQCA 2GUMA 1TQZA 4ZRIA 3OHMB 3PEGA 2DYQA 1MI1A 5HE1A 4HHVA 1BTKA 2YT1A 1EAZA 2ZKMX 4NY0A 3A98B 1BWNA 1U29A 4HDOA 2AL6A 2Z14A 4KHOA 1ISNA 2ROVA 2KIEA 3P7ZA 1P5TA 2RVBB 3NWFA 2DFKA 2J0MA 1J19A 2GS0A 4HATB 1Z87A 1FHWA 4HAZB 4MY6A 1WJ1A 2YS5A 2MFQA 2YRYA 4IOYX 2AEHA 2D9XA 2Z59A 3N7CA 3PZDA 3ODWA 1MIXA 2G35A 3D8EA 4MT7A 4KHBB 5I2SA 4TYZA 1MAIA 2N0YA 1FGYA 4EKUA 4GNKB 1H10A 5J3YA 3KSYA 2K00A 2PZ1A 1V61A 2YSZA 3HSAA 1PMSA 3D8DA 4QJ4B 2GJYA 2J0JA 1MPHA 4DXAB 4GZUA 4F7GA 4GOUA 4A6FB 4CHMA 4KVGB 1E5WA 1UPRA 1XR0B 2YT2A 1WI1A 4P7IA 3HW2B 4YL8A 5JP4A 1U27A 3QIJA 3GYPA 5FI0A 1PFJA 2D9ZA 5JHGA 4QJ5B 1M7RA 2W2WA 4HAWB 5C5BB 5I2MA 1W1HA 5FI1A 1B55A 2YS3A 2K49A 1WGQA 2H7EA 2K2JA 3AU4A 2K2UA 1J0WA 4MK0A 3FVCA 5J3QA 2BCJA 4ZRKA 3DXCA 1XODA 1M7EA 1X11A 1U2BA 2K8EA 4H8SA 3TVVA 5KQ4A 2RGNB 1LB1A 2Z13A 4DIXA 2COCA 3KZ1A 3TW1A 5JHHA 3HQCA 1WG7A 2DX5A 1XKEA 5D3YA 1ZC4B 4A6HA 2OQBA 1UPQA 4GPTB 1EVHA 1KZ7A 1MIZB 4K17A 3PVUA 2DKQA 1ZC3B 1MKEA 1XX0A 2R0DA 4GMXB 5LONB 3TO1A 2ZPYA 4A6KA 4YONA 5LOPB 4PQ0A 2MKRA 2DKPA 3ULCA 1FGZA 3DXDA 2YVCA 1V89A 5DIFB 3A58A 1UNRA 2M38A 2RLOA 3FEHA 3ZDTA 1X86A 1GG3A 3AU5A 2KR0A 1OQNA 2UZRA 1SHCA 1V5MA 2Y8GA 2D9WA 1N3HA 4KHAA 1BTNA 2CODA 2LOXA 1EF1A 4CYEA 1FB8A 4L1RA 1V88A 2COFA 2VKIA 3BJIA 4F7UP 1FAOA 3O96A 3M1IB 3RCPA 2ROZB 1W1GA 4HAUB 3SO6A 3TCAA 2P0HA 4TKNA 2J0KA 1I7AA 2M14A 3LJUX 1UNQA 2Z0PA 2KUQA 2FJLA 3QBVB 1Y5OA 4WSFA 4A5KA 2HE7A 5C5BA 1BAKA 3SYXA 2V76A 3F5RA 2L2IA 5C16A 5DHFB 2EC1A 5M4YB 4EJNA 2IFSA 3GYOA 4A6FA 2N23A 2CY5A 4HB3B 2I1KA 2Y7BA 4CSQA 4EMOA
chains in the Genus database with same CATH topology
1UNPA 3QWMA 2DLWA 2UZSA 3ZVRA 1IRSA 4DX90 1FHXA 3FSSA 2YS1A 2EMSA 1MK9B 1AWEA 1TXDA 1V5PA 3MPXA 3PVLA 2COAA 5HE3A 1FOEA 2Z0OA 3IVFA 3DXEA 2DN6A 2GCLA 2MWNB 3FM8C 2CAYA 4HAXB 2D9YA 4F7HA 2XQNM 1X05A 4IAPA 4HB4B 1DBHA 1X1GA 3CIKA 4B6HA 1NI2A 1GC6A 2ELBA 2HTHB 1GC7A 4GN1A 2DX1A 5C79A 1LW3A 2I5FA 3PP2A 3BINA 1WJMA 3G9WA 4KAXB 4Z2MB 4K81A 2CY4A 2I5CA 2QKLA 4PNKA 2R09A 2D9VA 3WYFB 3PSCA 1P3RA 5L81A 3P6AA 1KZGA 4C0AA 1KI1B 3X23A 1DDVA 2MDXA 4ZRJA 1NTVA 1NU2A 4DBBA 3ULBA 1ZM0A 4HB0B 5D3WA 2KCJA 3KRXA 2E2XA 2P0DA 1U5FA 4CHJA 1WGUA 3D8FA 2D10A 1X1FA 2YT0A 5DHAB 4WVFB 5CLLB 4IFSA 4DX8A 1U5DA 5DH9B 2D2QA 2RUKB 2LOZA 3ODOA 1OMWA 1Y19B 3SV1A 3TFMA 3AJ4A 4GXBA 1Q67A 2W2XD 2D4QA 1RRPB 1H4RA 1TJ6A 5D3VA 1QQGA 2Z0QA 3U7DA 2KUPA 1OY2A 5EFXA 1V5UA 2ADZA 4Z2NA 4HB2B 1SGHA 4HDQA 3CXBB 1I2HA 3U8ZA 5C6RA 3V5WA 1UEFA 1K5DB 4K2PA 3UZTA 3KY9A 1FHOA 2EMTA 4WJ7A 1WVHA 2RNRB 2OTXA 3T06A 2J59M 3ML4A 1RJ2A 2EJ8A 1DDMA 5D27A 5KCVA 2D11A 5HE2A 3F0WA 2L1CA 1ZSQA 1QC6A 3NSUA 4NSWA 2NMBA 2LKOA 5CLQB 1XD4A 2VSZA 3VOQA 5JLJB 4GMVA 2DYNA 5D3XA 2DTCA 2LULA 2H7DA 4Y94A 5HE0A 4HAYB 3PG7A 3SUZA 2P0FA 3A8PA 3HK0A 2Q13A 2DHIA 2UVMA 2LYDA 5GOWB 3WA0A 2VRWB 4D0NB 2IYBA 2I1JA 1EGXA 2X18A 1DROA 2QKMA 2GCJA 2DA0A 2ELAA 4HAVB 5J3TA 3A8QA 1NTYA 2RSGA 4L6EA 1PLSA 2P8VA 1K5GB 1MK7B 4BBKA 3OANA 1U5GA 2W2XC 2DHKA 5KQ1A 1DDWA 2JP2A 2Y8FA 2YF0A 4XWXA 3MDBC 1P6SA 2DHJA 1DYNA 1ZVRA 2LG1A 1W1DA 3KRWA 3PVWA 4K2OA 2KGXB 3VIAA 3ODXA 5DI9B 2NZ8B 2CRFA 1U5EA 1XCGA 3SNHA 1AQCA 1TQZA 4ZRIA 3PEGA 2DYQA 5HE1A 4HHVA 1BTKA 2YT1A 1EAZA 4NY0A 3A98B 1BWNA 1U29A 4HDOA 2AL6A 4KHOA 1ISNA 2ROVA 3P7ZA 1P5TA 2RVBB 2DFKA 2J0MA 1J19A 2GS0A 4HATB 1Z87A 1FHWA 4HAZB 4MY6A 1WJ1A 2YS5A 2MFQA 2YRYA 4IOYX 2AEHA 2D9XA 3N7CA 3PZDA 3ODWA 1MIXA 2G35A 3D8EA 4MT7A 4KHBB 4TYZA 1MAIA 2N0YA 1FGYA 4EKUA 1H10A 5J3YA 3KSYA 2K00A 2PZ1A 1V61A 2YSZA 1PMSA 3D8DA 2GJYA 2J0JA 1MPHA 4DXAB 4GZUA 4F7GA 4A6FB 4CHMA 4KVGB 1E5WA 1UPRA 1XR0B 1WI1A 4P7IA 3HW2B 4YL8A 5JP4A 1U27A 3QIJA 3GYPA 5FI0A 1PFJA 2D9ZA 5JHGA 1M7RA 2W2WA 4HAWB 5C5BB 1W1HA 5FI1A 1B55A 2YS3A 1WGQA 2H7EA 2K2JA 3AU4A 2K2UA 1J0WA 4MK0A 5J3QA 2BCJA 4ZRKA 3DXCA 1XODA 1M7EA 1X11A 1U2BA 4H8SA 3TVVA 5KQ4A 2RGNB 1LB1A 2COCA 3KZ1A 3TW1A 5JHHA 3HQCA 1WG7A 2DX5A 1XKEA 5D3YA 1ZC4B 4A6HA 2OQBA 1UPQA 4GPTB 1EVHA 1KZ7A 1MIZB 4K17A 3PVUA 2DKQA 1ZC3B 1MKEA 1XX0A 2R0DA 4GMXB 5LONB 3TO1A 2ZPYA 4A6KA 4YONA 5LOPB 4PQ0A 2MKRA 2DKPA 3ULCA 1FGZA 3DXDA 2YVCA 1V89A 5DIFB 1UNRA 2M38A 2RLOA 3FEHA 3ZDTA 1X86A 1GG3A 3AU5A 1OQNA 2UZRA 1SHCA 1V5MA 2Y8GA 2D9WA 1N3HA 4KHAA 1BTNA 2CODA 2LOXA 1EF1A 4CYEA 1FB8A 1V88A 2COFA 2VKIA 3BJIA 4F7UP 1FAOA 3O96A 3M1IB 3RCPA 2ROZB 1W1GA 4HAUB 3SO6A 3TCAA 2P0HA 4TKNA 2J0KA 1I7AA 2M14A 3LJUX 1UNQA 2Z0PA 2FJLA 3QBVB 1Y5OA 4WSFA 4A5KA 2HE7A 5C5BA 1BAKA 3SYXA 2V76A 3F5RA 2L2IA 5C16A 5DHFB 2EC1A 4EJNA 2IFSA 3GYOA 4A6FA 2N23A 2CY5A 4HB3B 2I1KA 2Y7BA 4EMOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UNP A;  3QWM A;  2DLW A;  2UZS A;  3ZVR A;  1IRS A;  4DX9 0;  1FHX A;  3FSS A;  2YS1 A;  2EMS A;  1MK9 B;  1AWE A;  1TXD A;  1V5P A;  3MPX A;  3PVL A;  2COA A;  5HE3 A;  1FOE A;  2Z0O A;  3IVF A;  3DXE A;  2DN6 A;  2GCL A;  2MWN B;  3FM8 C;  2CAY A;  4HAX B;  2D9Y A;  4F7H A;  2XQN M;  1X05 A;  4IAP A;  4HB4 B;  1DBH A;  1X1G A;  3CIK A;  4B6H A;  1NI2 A;  1GC6 A;  2ELB A;  2HTH B;  1GC7 A;  4GN1 A;  2DX1 A;  5C79 A;  1LW3 A;  2I5F A;  3PP2 A;  3BIN A;  1WJM A;  3G9W A;  4KAX B;  4Z2M B;  4K81 A;  2CY4 A;  2I5C A;  2QKL A;  4PNK A;  2R09 A;  2D9V A;  3WYF B;  3PSC A;  1P3R A;  5L81 A;  3P6A A;  1KZG A;  4C0A A;  1KI1 B;  3X23 A;  1DDV A;  2MDX A;  4ZRJ A;  1NTV A;  1NU2 A;  4DBB A;  3ULB A;  1ZM0 A;  4HB0 B;  5D3W A;  2KCJ A;  3KRX A;  2E2X A;  2P0D A;  1U5F A;  4CHJ A;  1WGU A;  3D8F A;  2D10 A;  1X1F A;  2YT0 A;  5DHA B;  4WVF B;  5CLL B;  4IFS A;  4DX8 A;  1U5D A;  5DH9 B;  2D2Q A;  2RUK B;  2LOZ A;  3ODO A;  1OMW A;  1Y19 B;  3SV1 A;  3TFM A;  3AJ4 A;  4GXB A;  1Q67 A;  2W2X D;  2D4Q A;  1RRP B;  1H4R A;  1TJ6 A;  5D3V A;  1QQG A;  2Z0Q A;  3U7D A;  2KUP A;  1OY2 A;  5EFX A;  1V5U A;  2ADZ A;  4Z2N A;  4HB2 B;  1SGH A;  4HDQ A;  3CXB B;  1I2H A;  3U8Z A;  5C6R A;  3V5W A;  1UEF A;  1K5D B;  4K2P A;  3UZT A;  3KY9 A;  1FHO A;  2EMT A;  4WJ7 A;  1WVH A;  2RNR B;  2OTX A;  3T06 A;  2J59 M;  3ML4 A;  1RJ2 A;  2EJ8 A;  1DDM A;  5D27 A;  5KCV A;  2D11 A;  5HE2 A;  3F0W A;  2L1C A;  1ZSQ A;  1QC6 A;  3NSU A;  4NSW A;  2NMB A;  2LKO A;  5CLQ B;  1XD4 A;  2VSZ A;  3VOQ A;  5JLJ B;  4GMV A;  2DYN A;  5D3X A;  2DTC A;  2LUL A;  2H7D A;  4Y94 A;  5HE0 A;  4HAY B;  3PG7 A;  3SUZ A;  2P0F A;  3A8P A;  3HK0 A;  2Q13 A;  2DHI A;  2UVM A;  2LYD A;  5GOW B;  3WA0 A;  2VRW B;  4D0N B;  2IYB A;  2I1J A;  1EGX A;  2X18 A;  1DRO A;  2QKM A;  2GCJ A;  2DA0 A;  2ELA A;  4HAV B;  5J3T A;  3A8Q A;  1NTY A;  2RSG A;  4L6E A;  1PLS A;  2P8V A;  1K5G B;  1MK7 B;  4BBK A;  3OAN A;  1U5G A;  2W2X C;  2DHK A;  5KQ1 A;  1DDW A;  2JP2 A;  2Y8F A;  2YF0 A;  4XWX A;  3MDB C;  1P6S A;  2DHJ A;  1DYN A;  1ZVR A;  2LG1 A;  1W1D A;  3KRW A;  3PVW A;  4K2O A;  2KGX B;  3VIA A;  3ODX A;  5DI9 B;  2NZ8 B;  2CRF A;  1U5E A;  1XCG A;  3SNH A;  1AQC A;  1TQZ A;  4ZRI A;  3PEG A;  2DYQ A;  5HE1 A;  4HHV A;  1BTK A;  2YT1 A;  1EAZ A;  4NY0 A;  3A98 B;  1BWN A;  1U29 A;  4HDO A;  2AL6 A;  4KHO A;  1ISN A;  2ROV A;  3P7Z A;  1P5T A;  2RVB B;  2DFK A;  2J0M A;  1J19 A;  2GS0 A;  4HAT B;  1Z87 A;  1FHW A;  4HAZ B;  4MY6 A;  1WJ1 A;  2YS5 A;  2MFQ A;  2YRY A;  4IOY X;  2AEH A;  2D9X A;  3N7C A;  3PZD A;  3ODW A;  1MIX A;  2G35 A;  3D8E A;  4MT7 A;  4KHB B;  4TYZ A;  1MAI A;  2N0Y A;  1FGY A;  4EKU A;  1H10 A;  5J3Y A;  3KSY A;  2K00 A;  2PZ1 A;  1V61 A;  2YSZ A;  1PMS A;  3D8D A;  2GJY A;  2J0J A;  1MPH A;  4DXA B;  4GZU A;  4F7G A;  4A6F B;  4CHM A;  4KVG B;  1E5W A;  1UPR A;  1XR0 B;  1WI1 A;  4P7I A;  3HW2 B;  4YL8 A;  5JP4 A;  1U27 A;  3QIJ A;  3GYP A;  5FI0 A;  1PFJ A;  2D9Z A;  5JHG A;  1M7R A;  2W2W A;  4HAW B;  5C5B B;  1W1H A;  5FI1 A;  1B55 A;  2YS3 A;  1WGQ A;  2H7E A;  2K2J A;  3AU4 A;  2K2U A;  1J0W A;  4MK0 A;  5J3Q A;  2BCJ A;  4ZRK A;  3DXC A;  1XOD A;  1M7E A;  1X11 A;  1U2B A;  4H8S A;  3TVV A;  5KQ4 A;  2RGN B;  1LB1 A;  2COC A;  3KZ1 A;  3TW1 A;  5JHH A;  3HQC A;  1WG7 A;  2DX5 A;  1XKE A;  5D3Y A;  1ZC4 B;  4A6H A;  2OQB A;  1UPQ A;  4GPT B;  1EVH A;  1KZ7 A;  1MIZ B;  4K17 A;  3PVU A;  2DKQ A;  1ZC3 B;  1MKE A;  1XX0 A;  2R0D A;  4GMX B;  5LON B;  3TO1 A;  2ZPY A;  4A6K A;  4YON A;  5LOP B;  4PQ0 A;  2MKR A;  2DKP A;  3ULC A;  1FGZ A;  3DXD A;  2YVC A;  1V89 A;  5DIF B;  1UNR A;  2M38 A;  2RLO A;  3FEH A;  3ZDT A;  1X86 A;  1GG3 A;  3AU5 A;  1OQN A;  2UZR A;  1SHC A;  1V5M A;  2Y8G A;  2D9W A;  1N3H A;  4KHA A;  1BTN A;  2COD A;  2LOX A;  1EF1 A;  4CYE A;  1FB8 A;  1V88 A;  2COF A;  2VKI A;  3BJI A;  4F7U P;  1FAO A;  3O96 A;  3M1I B;  3RCP A;  2ROZ B;  1W1G A;  4HAU B;  3SO6 A;  3TCA A;  2P0H A;  4TKN A;  2J0K A;  1I7A A;  2M14 A;  3LJU X;  1UNQ A;  2Z0P A;  2FJL A;  3QBV B;  1Y5O A;  4WSF A;  4A5K A;  2HE7 A;  5C5B A;  1BAK A;  3SYX A;  2V76 A;  3F5R A;  2L2I A;  5C16 A;  5DHF B;  2EC1 A;  4EJN A;  2IFS A;  3GYO A;  4A6F A;  2N23 A;  2CY5 A;  4HB3 B;  2I1K A;  2Y7B A;  4EMO A; 
#chains in the Genus database with same CATH topology
 1UNP A;  3QWM A;  3HIE A;  2DLW A;  2UZS A;  3ZVR A;  1IRS A;  4DX9 0;  1FHX A;  3FSS A;  2YS1 A;  2EMS A;  1MK9 B;  1AWE A;  1TXD A;  1V5P A;  3MPX A;  3PVL A;  2COA A;  5HE3 A;  4QJ3 B;  1FOE A;  2Z0O A;  3IVF A;  5IRS A;  3DXE A;  2DN6 A;  2GCL A;  2MWN B;  4KHB A;  3FM8 C;  2CAY A;  4HAX B;  2D9Y A;  4F7H A;  2XQN M;  1X05 A;  4IAP A;  3U12 A;  4HB4 B;  1DBH A;  1X1G A;  3CIK A;  4B6H A;  1NI2 A;  1GC6 A;  2ELB A;  2HTH B;  1GC7 A;  4GN1 A;  2DX1 A;  5C79 A;  1LW3 A;  2I5F A;  3PP2 A;  3BIN A;  1WJM A;  5LG4 B;  3G9W A;  4KAX B;  4Z2M B;  4K81 A;  2CY4 A;  2I5C A;  2QKL A;  4PNK A;  2R09 A;  2D9V A;  3WYF B;  2RRF A;  3PSC A;  1P3R A;  5L81 A;  3P6A A;  1KZG A;  4C0A A;  1KI1 B;  3X23 A;  1DDV A;  2MDX A;  4ZRJ A;  1NTV A;  1NU2 A;  4DBB A;  3ULB A;  1ZM0 A;  4HB0 B;  5D3W A;  4OSN A;  2KCJ A;  3B77 A;  3KRX A;  2E2X A;  2P0D A;  1U5F A;  4CHJ A;  1WGU A;  3D8F A;  2D10 A;  1X1F A;  2YT0 A;  4OT1 A;  5DHA B;  4WVF B;  5CLL B;  4IFS A;  4DX8 A;  1U5D A;  5DH9 B;  2D2Q A;  2RUK B;  2LOZ A;  3ODO A;  1OMW A;  1Y19 B;  3SV1 A;  3TFM A;  3AJ4 A;  4GXB A;  1Q67 A;  2W2X D;  2D4Q A;  1RRP B;  1H4R A;  1TJ6 A;  5D3V A;  1QQG A;  2Z0Q A;  3U7D A;  2KUP A;  1OY2 A;  5EFX A;  1V5U A;  2ADZ A;  4Z2N A;  4HB2 B;  3NW8 A;  1SGH A;  1ZYI A;  4HDQ A;  3CXB B;  1I2H A;  3U8Z A;  5C6R A;  3V5W A;  1UEF A;  1K5D B;  4K2P A;  2R2Y A;  3UZT A;  3KY9 A;  1FHO A;  2EMT A;  4WJ7 A;  1T77 A;  1WVH A;  2RNR B;  2OTX A;  3T06 A;  2J59 M;  3ML4 A;  3DCX A;  1RJ2 A;  2EJ8 A;  1DDM A;  5D27 A;  5KCV A;  2D11 A;  5HE2 A;  3F0W A;  2L1C A;  2Z4D A;  1ZSQ A;  1QC6 A;  3NSU A;  4NSW A;  2NMB A;  2LKO A;  3NWD A;  4HSI A;  5CLQ B;  1XD4 A;  2VSZ A;  3VOQ A;  5JLJ B;  4GMV A;  2DYN A;  5D3X A;  4QXA B;  2DTC A;  2LUL A;  2H7D A;  4Y94 A;  5HE0 A;  4HAY B;  3PG7 A;  3SUZ A;  2P0F A;  3A8P A;  2FJU B;  2NBV A;  3HK0 A;  2Q13 A;  2DHI A;  2UVM A;  2LYD A;  5GOW B;  3WA0 A;  2VRW B;  4D0N B;  2IYB A;  2I1J A;  1EGX A;  2X18 A;  1DRO A;  2QKM A;  2GCJ A;  2DA0 A;  2ELA A;  4D6W A;  4HAV B;  5J3T A;  3A8Q A;  1NTY A;  2RSG A;  4L6E A;  1PLS A;  2P8V A;  1K5G B;  1MK7 B;  4BBK A;  3NWA A;  3OAN A;  1U5G A;  2W2X C;  2DHK A;  2KIG A;  5KQ1 A;  1DDW A;  2JP2 A;  2Y8F A;  2YF0 A;  4XWX A;  3MDB C;  1P6S A;  2DHJ A;  1DYN A;  1ZVR A;  2LG1 A;  1W1D A;  3KRW A;  3PVW A;  4K2O A;  2KGX B;  3VIA A;  3ODX A;  5DI9 B;  2NZ8 B;  2CRF A;  1U5E A;  1XCG A;  3SNH A;  1AQC A;  2GUM A;  1TQZ A;  4ZRI A;  3OHM B;  3PEG A;  2DYQ A;  1MI1 A;  5HE1 A;  4HHV A;  1BTK A;  2YT1 A;  1EAZ A;  2ZKM X;  4NY0 A;  3A98 B;  1BWN A;  1U29 A;  4HDO A;  2AL6 A;  2Z14 A;  4KHO A;  1ISN A;  2ROV A;  2KIE A;  3P7Z A;  1P5T A;  2RVB B;  3NWF A;  2DFK A;  2J0M A;  1J19 A;  2GS0 A;  4HAT B;  1Z87 A;  1FHW A;  4HAZ B;  4MY6 A;  1WJ1 A;  2YS5 A;  2MFQ A;  2YRY A;  4IOY X;  2AEH A;  2D9X A;  2Z59 A;  3N7C A;  3PZD A;  3ODW A;  1MIX A;  2G35 A;  3D8E A;  4MT7 A;  4KHB B;  5I2S A;  4TYZ A;  1MAI A;  2N0Y A;  1FGY A;  4EKU A;  4GNK B;  1H10 A;  5J3Y A;  3KSY A;  2K00 A;  2PZ1 A;  1V61 A;  2YSZ A;  3HSA A;  1PMS A;  3D8D A;  4QJ4 B;  2GJY A;  2J0J A;  1MPH A;  4DXA B;  4GZU A;  4F7G A;  4GOU A;  4A6F B;  4CHM A;  4KVG B;  1E5W A;  1UPR A;  1XR0 B;  2YT2 A;  1WI1 A;  4P7I A;  3HW2 B;  4YL8 A;  5JP4 A;  1U27 A;  3QIJ A;  3GYP A;  5FI0 A;  1PFJ A;  2D9Z A;  5JHG A;  4QJ5 B;  1M7R A;  2W2W A;  4HAW B;  5C5B B;  5I2M A;  1W1H A;  5FI1 A;  1B55 A;  2YS3 A;  2K49 A;  1WGQ A;  2H7E A;  2K2J A;  3AU4 A;  2K2U A;  1J0W A;  4MK0 A;  3FVC A;  5J3Q A;  2BCJ A;  4ZRK A;  3DXC A;  1XOD A;  1M7E A;  1X11 A;  1U2B A;  2K8E A;  4H8S A;  3TVV A;  5KQ4 A;  2RGN B;  1LB1 A;  2Z13 A;  4DIX A;  2COC A;  3KZ1 A;  3TW1 A;  5JHH A;  3HQC A;  1WG7 A;  2DX5 A;  1XKE A;  5D3Y A;  1ZC4 B;  4A6H A;  2OQB A;  1UPQ A;  4GPT B;  1EVH A;  1KZ7 A;  1MIZ B;  4K17 A;  3PVU A;  2DKQ A;  1ZC3 B;  1MKE A;  1XX0 A;  2R0D A;  4GMX B;  5LON B;  3TO1 A;  2ZPY A;  4A6K A;  4YON A;  5LOP B;  4PQ0 A;  2MKR A;  2DKP A;  3ULC A;  1FGZ A;  3DXD A;  2YVC A;  1V89 A;  5DIF B;  3A58 A;  1UNR A;  2M38 A;  2RLO A;  3FEH A;  3ZDT A;  1X86 A;  1GG3 A;  3AU5 A;  2KR0 A;  1OQN A;  2UZR A;  1SHC A;  1V5M A;  2Y8G A;  2D9W A;  1N3H A;  4KHA A;  1BTN A;  2COD A;  2LOX A;  1EF1 A;  4CYE A;  1FB8 A;  4L1R A;  1V88 A;  2COF A;  2VKI A;  3BJI A;  4F7U P;  1FAO A;  3O96 A;  3M1I B;  3RCP A;  2ROZ B;  1W1G A;  4HAU B;  3SO6 A;  3TCA A;  2P0H A;  4TKN A;  2J0K A;  1I7A A;  2M14 A;  3LJU X;  1UNQ A;  2Z0P A;  2KUQ A;  2FJL A;  3QBV B;  1Y5O A;  4WSF A;  4A5K A;  2HE7 A;  5C5B A;  1BAK A;  3SYX A;  2V76 A;  3F5R A;  2L2I A;  5C16 A;  5DHF B;  2EC1 A;  5M4Y B;  4EJN A;  2IFS A;  3GYO A;  4A6F A;  2N23 A;  2CY5 A;  4HB3 B;  2I1K A;  2Y7B A;  4CSQ A;  4EMO A; 
#chains in the Genus database with same CATH homology
 1UNP A;  3QWM A;  2DLW A;  2UZS A;  3ZVR A;  1IRS A;  4DX9 0;  1FHX A;  3FSS A;  2YS1 A;  2EMS A;  1MK9 B;  1AWE A;  1TXD A;  1V5P A;  3MPX A;  3PVL A;  2COA A;  5HE3 A;  1FOE A;  2Z0O A;  3IVF A;  3DXE A;  2DN6 A;  2GCL A;  2MWN B;  3FM8 C;  2CAY A;  4HAX B;  2D9Y A;  4F7H A;  2XQN M;  1X05 A;  4IAP A;  4HB4 B;  1DBH A;  1X1G A;  3CIK A;  4B6H A;  1NI2 A;  1GC6 A;  2ELB A;  2HTH B;  1GC7 A;  4GN1 A;  2DX1 A;  5C79 A;  1LW3 A;  2I5F A;  3PP2 A;  3BIN A;  1WJM A;  3G9W A;  4KAX B;  4Z2M B;  4K81 A;  2CY4 A;  2I5C A;  2QKL A;  4PNK A;  2R09 A;  2D9V A;  3WYF B;  3PSC A;  1P3R A;  5L81 A;  3P6A A;  1KZG A;  4C0A A;  1KI1 B;  3X23 A;  1DDV A;  2MDX A;  4ZRJ A;  1NTV A;  1NU2 A;  4DBB A;  3ULB A;  1ZM0 A;  4HB0 B;  5D3W A;  2KCJ A;  3KRX A;  2E2X A;  2P0D A;  1U5F A;  4CHJ A;  1WGU A;  3D8F A;  2D10 A;  1X1F A;  2YT0 A;  5DHA B;  4WVF B;  5CLL B;  4IFS A;  4DX8 A;  1U5D A;  5DH9 B;  2D2Q A;  2RUK B;  2LOZ A;  3ODO A;  1OMW A;  1Y19 B;  3SV1 A;  3TFM A;  3AJ4 A;  4GXB A;  1Q67 A;  2W2X D;  2D4Q A;  1RRP B;  1H4R A;  1TJ6 A;  5D3V A;  1QQG A;  2Z0Q A;  3U7D A;  2KUP A;  1OY2 A;  5EFX A;  1V5U A;  2ADZ A;  4Z2N A;  4HB2 B;  1SGH A;  4HDQ A;  3CXB B;  1I2H A;  3U8Z A;  5C6R A;  3V5W A;  1UEF A;  1K5D B;  4K2P A;  3UZT A;  3KY9 A;  1FHO A;  2EMT A;  4WJ7 A;  1WVH A;  2RNR B;  2OTX A;  3T06 A;  2J59 M;  3ML4 A;  1RJ2 A;  2EJ8 A;  1DDM A;  5D27 A;  5KCV A;  2D11 A;  5HE2 A;  3F0W A;  2L1C A;  1ZSQ A;  1QC6 A;  3NSU A;  4NSW A;  2NMB A;  2LKO A;  5CLQ B;  1XD4 A;  2VSZ A;  3VOQ A;  5JLJ B;  4GMV A;  2DYN A;  5D3X A;  2DTC A;  2LUL A;  2H7D A;  4Y94 A;  5HE0 A;  4HAY B;  3PG7 A;  3SUZ A;  2P0F A;  3A8P A;  3HK0 A;  2Q13 A;  2DHI A;  2UVM A;  2LYD A;  5GOW B;  3WA0 A;  2VRW B;  4D0N B;  2IYB A;  2I1J A;  1EGX A;  2X18 A;  1DRO A;  2QKM A;  2GCJ A;  2DA0 A;  2ELA A;  4HAV B;  5J3T A;  3A8Q A;  1NTY A;  2RSG A;  4L6E A;  1PLS A;  2P8V A;  1K5G B;  1MK7 B;  4BBK A;  3OAN A;  1U5G A;  2W2X C;  2DHK A;  5KQ1 A;  1DDW A;  2JP2 A;  2Y8F A;  2YF0 A;  4XWX A;  3MDB C;  1P6S A;  2DHJ A;  1DYN A;  1ZVR A;  2LG1 A;  1W1D A;  3KRW A;  3PVW A;  4K2O A;  2KGX B;  3VIA A;  3ODX A;  5DI9 B;  2NZ8 B;  2CRF A;  1U5E A;  1XCG A;  3SNH A;  1AQC A;  1TQZ A;  4ZRI A;  3PEG A;  2DYQ A;  5HE1 A;  4HHV A;  1BTK A;  2YT1 A;  1EAZ A;  4NY0 A;  3A98 B;  1BWN A;  1U29 A;  4HDO A;  2AL6 A;  4KHO A;  1ISN A;  2ROV A;  3P7Z A;  1P5T A;  2RVB B;  2DFK A;  2J0M A;  1J19 A;  2GS0 A;  4HAT B;  1Z87 A;  1FHW A;  4HAZ B;  4MY6 A;  1WJ1 A;  2YS5 A;  2MFQ A;  2YRY A;  4IOY X;  2AEH A;  2D9X A;  3N7C A;  3PZD A;  3ODW A;  1MIX A;  2G35 A;  3D8E A;  4MT7 A;  4KHB B;  4TYZ A;  1MAI A;  2N0Y A;  1FGY A;  4EKU A;  1H10 A;  5J3Y A;  3KSY A;  2K00 A;  2PZ1 A;  1V61 A;  2YSZ A;  1PMS A;  3D8D A;  2GJY A;  2J0J A;  1MPH A;  4DXA B;  4GZU A;  4F7G A;  4A6F B;  4CHM A;  4KVG B;  1E5W A;  1UPR A;  1XR0 B;  1WI1 A;  4P7I A;  3HW2 B;  4YL8 A;  5JP4 A;  1U27 A;  3QIJ A;  3GYP A;  5FI0 A;  1PFJ A;  2D9Z A;  5JHG A;  1M7R A;  2W2W A;  4HAW B;  5C5B B;  1W1H A;  5FI1 A;  1B55 A;  2YS3 A;  1WGQ A;  2H7E A;  2K2J A;  3AU4 A;  2K2U A;  1J0W A;  4MK0 A;  5J3Q A;  2BCJ A;  4ZRK A;  3DXC A;  1XOD A;  1M7E A;  1X11 A;  1U2B A;  4H8S A;  3TVV A;  5KQ4 A;  2RGN B;  1LB1 A;  2COC A;  3KZ1 A;  3TW1 A;  5JHH A;  3HQC A;  1WG7 A;  2DX5 A;  1XKE A;  5D3Y A;  1ZC4 B;  4A6H A;  2OQB A;  1UPQ A;  4GPT B;  1EVH A;  1KZ7 A;  1MIZ B;  4K17 A;  3PVU A;  2DKQ A;  1ZC3 B;  1MKE A;  1XX0 A;  2R0D A;  4GMX B;  5LON B;  3TO1 A;  2ZPY A;  4A6K A;  4YON A;  5LOP B;  4PQ0 A;  2MKR A;  2DKP A;  3ULC A;  1FGZ A;  3DXD A;  2YVC A;  1V89 A;  5DIF B;  1UNR A;  2M38 A;  2RLO A;  3FEH A;  3ZDT A;  1X86 A;  1GG3 A;  3AU5 A;  1OQN A;  2UZR A;  1SHC A;  1V5M A;  2Y8G A;  2D9W A;  1N3H A;  4KHA A;  1BTN A;  2COD A;  2LOX A;  1EF1 A;  4CYE A;  1FB8 A;  1V88 A;  2COF A;  2VKI A;  3BJI A;  4F7U P;  1FAO A;  3O96 A;  3M1I B;  3RCP A;  2ROZ B;  1W1G A;  4HAU B;  3SO6 A;  3TCA A;  2P0H A;  4TKN A;  2J0K A;  1I7A A;  2M14 A;  3LJU X;  1UNQ A;  2Z0P A;  2FJL A;  3QBV B;  1Y5O A;  4WSF A;  4A5K A;  2HE7 A;  5C5B A;  1BAK A;  3SYX A;  2V76 A;  3F5R A;  2L2I A;  5C16 A;  5DHF B;  2EC1 A;  4EJN A;  2IFS A;  3GYO A;  4A6F A;  2N23 A;  2CY5 A;  4HB3 B;  2I1K A;  2Y7B A;  4EMO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...