2COCA

Solution structure of the c-terminal ph domain of fyve, rhogef and ph domain containing protein 3 (fgd3) from human
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
112
structure length
112
Chain Sequence
b'GSSGSSGSLLCGPLRLSESGETWSEVWAAIPMSDPQVLHLQGGSQDGRLPRTIPLPSCKLSVPDPEERLDSGHVWKLQWAKQSWYLSASSAELQQQWLETLSTAAHSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FYVE, RhoGEF and PH domain containing protein 3
publication title Solution structure of the C-terminal PH domain of FYVE, RhoGEF and PH domain containing protein 3 (FGD3) from human
rcsb
source organism Homo sapiens
molecule tags Signaling protein
total genus 13
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 2cocA01
1ZC3B 1WI1A 1V5UA 3AU5A 2VKIA 1UEFA 3ML4A 4WVFB 1PFJA 3AJ4A 3ZVRA 5L81A 2YT1A 3HQCA 1OY2A 1WVHA 1OQNA 1XD4A 2W2WA 1GG3A 2W2XC 3KSYA 2NZ8B 1NTYA 5KQ1A 1ISNA 2D9ZA 2EJ8A 2MFQA 4GZUA 1V88A 1XCGA 1U27A 5DHAB 4GMVA 4HB3B 2XQNM 3HW2B 2ELAA 3BINA 3LJUX 2P0DA 1I7AA 1MK7B 3PEGA 4A6FA 5C5BB 1TQZA 3G9WA 2M38A 4GPTB 3N7CA 3PG7A 1AQCA 4L6EA 5CLQB 2KGXB 5HE3A 4F7UP 3M1IB 1GC6A 1W1GA 2Y8FA 4KAXB 5DI9B 3SUZA 3U8ZA 2PZ1A 5FI0A 3TFMA 2DKPA 2Z0QA 1J19A 2J0KA 4CHMA 4H8SA 2ADZA 2DA0A 2YS1A 1RRPB 2MWNB 5EFXA 3TO1A 1UNPA 1U5GA 5D3YA 4K81A 2K00A 1X1FA 3HK0A 1UPQA 1XODA 3D8DA 1I2HA 4HDQA 1UNQA 1V5PA 2K2JA 5J3TA 1PLSA 2DFKA 2DYQA 1P3RA 2I1KA 2RVBB 4HB4B 1WG7A 5HE2A 1WGQA 1KI1B 3PZDA 2EMTA 5JHGA 1FOEA 2W2XD 2Y8GA 1Q67A 2AL6A 2COAA 1FGZA 2EC1A 3KZ1A 3ODWA 3X23A 1DYNA 2HE7A 3PVUA 2BCJA 3F5RA 2CAYA 2Z0OA 1FHOA 3D8FA 5C79A 3WYFB 2ROVA 2COCA 1U2BA 1DBHA 3ULCA 2VRWB 3SO6A 4HAUB 3TCAA 2D9XA 2IFSA 3SYXA 1EAZA 3PP2A 2LOZA 4K17A 3GYPA 1Y19B 4EKUA 5DHFB 2YRYA 1KZ7A 3V5WA 4C0AA 1LW3A 2DTCA 1AWEA 3ULBA 1XR0B 1U29A 1N3HA 2QKLA 1J0WA 1PMSA 1DDMA 1XX0A 1P5TA 2I5FA 2J0MA 3SNHA 5D27A 1H10A 4WSFA 4DX90 1NI2A 4IFSA 3ODXA 2DX5A 4A6FB 3CIKA 4A6KA 4K2PA 1BTKA 1W1DA 1K5DB 1H4RA 1NTVA 5KCVA 2KUPA 2Y7BA 1FAOA 4DBBA 2RLOA 4Z2MB 4CYEA 5D3XA 3TW1A 1MK9B 1UNRA 1X11A 4CHJA 3TVVA 1MKEA 5JLJB 2RGNB 2G35A 2IYBA 4DX8A 2LKOA 2AEHA 2D4QA 3AU4A 1B55A 1SHCA 1M7RA 5HE1A 2RNRB 1SGHA 3MPXA 4A5KA 5C5BA 2GCLA 4GN1A 2N23A 4KHBB 4HDOA 1EF1A 4HAZB 5LOPB 2OQBA 1MIZB 1ZSQA 2KCJA 3CXBB 2DKQA 1Y5OA 2LYDA 2DX1A 4F7GA 2MKRA 3DXCA 5J3YA 3DXEA 1K5GB 3PVLA 2UZSA 2VSZA 2EMSA 2GS0A 3KY9A 2YT0A 1WJ1A 2I1JA 2GCJA 4EJNA 3FM8C 1FB8A 2Z0PA 3QIJA 1GC7A 5D3VA 1V5MA 3PVWA 4HAWB 2NMBA 4GXBA 2J59M 2I5CA 5D3WA 2YS3A 4IOYX 1M7EA 3PSCA 2FJLA 4MK0A 1V61A 2DN6A 3ODOA 2DLWA 2COFA 3DXDA 3KRXA 3FSSA 4F7HA 1E5WA 2ZPYA 4PQ0A 2J0JA 1UPRA 2DHIA 1BTNA 2DHJA 5FI1A 2H7EA 4Z2NA 5JHHA 3OANA 1BWNA 2YS5A 1W1HA 1ZVRA 3GYOA 5GOWB 2P0HA 1FHXA 2N0YA 1WJMA 2V76A 3D8EA 2LG1A 2OTXA 2HTHB 2CRFA 1MIXA 4XWXA 2ELBA 4KHAA 1V89A 1QC6A 4YONA 4EMOA 3A8PA 2RSGA 4HATB 1OMWA 3RCPA 2YSZA 4IAPA 4ZRIA 3MDBC 1FHWA 2R09A 2R0DA 4HHVA 1Z87A 2D10A 3KRWA 2P8VA 1X05A 2LULA 2QKMA 2M14A 2D11A 5HE0A 4NY0A 1ZM0A 3A8QA 4MT7A 4HAYB 5DH9B 4B6HA 1WGUA 4P7IA 4TKNA 1QQGA 1TXDA 1ZC4B 1BAKA 1MAIA 1EGXA 5KQ4A 5C16A 4ZRJA 4A6HA 2D9YA 2L1CA 2JP2A 5LONB 4HAXB 2X18A 4HB0B 3A98B 2RUKB 5J3QA 4MY6A 2D9WA 2YVCA 1U5FA 4KVGB 2H7DA 1NU2A 1RJ2A 4WJ7A 3BJIA 1DDVA 1FGYA 4NSWA 2UVMA 2D2QA 5C6RA 1KZGA 3WA0A 4Y94A 4ZRKA 3QBVB 2DYNA 3U7DA 3FEHA 3P7ZA 2CY4A 3QWMA 4DXAB 4HB2B 2YF0A 2ROZB 1IRSA 2D9VA 2E2XA 5JP4A 1EVHA 3IVFA 3UZTA 3P6AA 3T06A 5CLLB 1U5DA 1DROA 5DIFB 3O96A 3F0WA 2L2IA 2MDXA 4KHOA 3VIAA 2CY5A 4YL8A 3SV1A 1U5EA 2LOXA 4TYZA 4K2OA 2DHKA 2K2UA 1MPHA 3NSUA 4HAVB 1TJ6A 2GJYA 1X1GA 1P6SA 2CODA 1X86A 3VOQA 1DDWA 2UZRA 1LB1A 4BBKA 1XKEA 4GMXB 3ZDTA 4D0NB 2P0FA 4PNKA 2Q13A
chains in the Genus database with same CATH superfamily
1ZC3B 1WI1A 1V5UA 3AU5A 2VKIA 1T77A 1UEFA 3ML4A 4WVFB 1PFJA 3AJ4A 3ZVRA 5L81A 2YT1A 3HQCA 1OY2A 1WVHA 1OQNA 1XD4A 2W2WA 1GG3A 2W2XC 3KSYA 2NZ8B 1NTYA 5KQ1A 2K49A 1ISNA 2D9ZA 2EJ8A 2MFQA 4GZUA 1V88A 1XCGA 1U27A 5DHAB 4GMVA 4HB3B 2XQNM 3HW2B 2ELAA 3BINA 3LJUX 2P0DA 1I7AA 1MK7B 2Z4DA 3PEGA 4A6FA 5C5BB 1TQZA 3G9WA 2M38A 4GPTB 3N7CA 3PG7A 1AQCA 4L6EA 5CLQB 2KGXB 5HE3A 4F7UP 3M1IB 1GC6A 1W1GA 2Y8FA 4KAXB 5DI9B 3SUZA 3U8ZA 2PZ1A 5FI0A 3TFMA 2DKPA 2Z0QA 4DIXA 1J19A 2J0KA 2KIEA 4CHMA 4H8SA 2ADZA 2DA0A 4GOUA 2YS1A 1RRPB 2MWNB 5EFXA 3TO1A 1UNPA 1U5GA 5D3YA 4K81A 2K00A 1X1FA 3NWFA 3HK0A 1UPQA 1XODA 3D8DA 1I2HA 4HDQA 1UNQA 1V5PA 2K2JA 4GNKB 5J3TA 1PLSA 2DFKA 2DYQA 1P3RA 2I1KA 2RVBB 4HB4B 1WG7A 5HE2A 1WGQA 1KI1B 3PZDA 2Z14A 2EMTA 5JHGA 1FOEA 2W2XD 2Y8GA 1Q67A 2AL6A 2COAA 1FGZA 2EC1A 3KZ1A 3ODWA 3X23A 1DYNA 2HE7A 3PVUA 2BCJA 3F5RA 2CAYA 2Z0OA 1FHOA 3D8FA 5C79A 3WYFB 2ROVA 2COCA 1U2BA 2FJUB 1DBHA 3ULCA 2VRWB 3SO6A 4HAUB 4D6WA 3TCAA 2D9XA 2IFSA 3SYXA 1EAZA 3PP2A 2LOZA 2R2YA 4K17A 3GYPA 1Y19B 4EKUA 5DHFB 2YRYA 1KZ7A 3V5WA 4C0AA 1LW3A 2DTCA 1AWEA 4OT1A 2K8EA 3ULBA 1XR0B 2KIGA 1U29A 1N3HA 2QKLA 2YT2A 3FVCA 1J0WA 1PMSA 3NWDA 1DDMA 1XX0A 1P5TA 2I5FA 2J0MA 3SNHA 3OHMB 5D27A 1H10A 4WSFA 4DX90 1NI2A 4QJ3B 4IFSA 3ODXA 2DX5A 4A6FB 3CIKA 4A6KA 4K2PA 1BTKA 1W1DA 1K5DB 3A58A 1H4RA 1NTVA 5KCVA 2KUPA 2Y7BA 1FAOA 4DBBA 2RLOA 4Z2MB 3HSAA 4CYEA 5I2SA 5D3XA 3TW1A 1MK9B 1UNRA 1X11A 4CHJA 3TVVA 1MKEA 5JLJB 2RGNB 2G35A 2IYBA 4DX8A 2LKOA 2AEHA 2D4QA 3AU4A 1B55A 1SHCA 1M7RA 5HE1A 2RNRB 1SGHA 3MPXA 4A5KA 5C5BA 2GCLA 4GN1A 1MI1A 5IRSA 2N23A 4KHBB 4HDOA 1EF1A 4HAZB 5LOPB 2OQBA 1MIZB 1ZSQA 1ZYIA 2KCJA 3CXBB 2DKQA 1Y5OA 2LYDA 2DX1A 5M4YB 2Z59A 4F7GA 2MKRA 3DXCA 5J3YA 3DXEA 1K5GB 2ZKMX 3PVLA 2UZSA 2VSZA 2EMSA 2GS0A 3KY9A 2YT0A 1WJ1A 2I1JA 2GCJA 4EJNA 3FM8C 1FB8A 2Z0PA 3QIJA 1GC7A 5D3VA 1V5MA 4L1RA 3PVWA 4HAWB 2NMBA 4GXBA 3NW8A 2KUQA 4QXAB 2J59M 2I5CA 5D3WA 3B77A 2YS3A 4IOYX 1M7EA 3PSCA 3NWAA 2FJLA 4MK0A 4QJ4B 1V61A 2DN6A 3ODOA 2DLWA 2COFA 3DXDA 3KRXA 3FSSA 4F7HA 4OSNA 1E5WA 2ZPYA 4PQ0A 5LG4B 2J0JA 2RRFA 3DCXA 1UPRA 2DHIA 1BTNA 2DHJA 5FI1A 2H7EA 4Z2NA 5JHHA 3OANA 4CSQA 1BWNA 2YS5A 1W1HA 3HIEA 1ZVRA 3GYOA 5GOWB 2P0HA 1FHXA 2N0YA 2Z13A 1WJMA 2V76A 3D8EA 2LG1A 2OTXA 2HTHB 2CRFA 1MIXA 4XWXA 2ELBA 4KHAA 1V89A 1QC6A 4YONA 4EMOA 3A8PA 2KR0A 2RSGA 4HATB 1OMWA 3RCPA 2YSZA 4IAPA 4ZRIA 1FHWA 3MDBC 2R09A 2R0DA 4HHVA 1Z87A 2D10A 3KRWA 2P8VA 1X05A 2LULA 2QKMA 2M14A 2D11A 5HE0A 4NY0A 1ZM0A 3A8QA 3U12A 4MT7A 4HAYB 5DH9B 4B6HA 1WGUA 4P7IA 4TKNA 1QQGA 1TXDA 2GUMA 1ZC4B 1BAKA 1MAIA 1EGXA 5KQ4A 5C16A 4ZRJA 4A6HA 2D9YA 5I2MA 2L1CA 2JP2A 5LONB 4HAXB 2X18A 4HB0B 3A98B 2RUKB 5J3QA 4MY6A 2D9WA 2YVCA 1U5FA 4KVGB 2H7DA 1NU2A 1RJ2A 4WJ7A 3BJIA 1DDVA 1FGYA 2NBVA 4NSWA 2UVMA 2D2QA 5C6RA 1KZGA 3WA0A 4Y94A 4KHBA 4ZRKA 3QBVB 2DYNA 3U7DA 3FEHA 3P7ZA 2CY4A 3QWMA 4DXAB 4HB2B 2YF0A 2ROZB 1IRSA 2D9VA 2E2XA 5JP4A 1EVHA 3IVFA 3UZTA 3P6AA 3T06A 5CLLB 1U5DA 1DROA 5DIFB 3O96A 3F0WA 2L2IA 2MDXA 4KHOA 3VIAA 2CY5A 4YL8A 3SV1A 1U5EA 2LOXA 4TYZA 4K2OA 2DHKA 2K2UA 1MPHA 3NSUA 4HAVB 1TJ6A 2GJYA 1X1GA 1P6SA 2CODA 1X86A 3VOQA 1DDWA 2UZRA 1LB1A 4BBKA 1XKEA 4GMXB 4QJ5B 4HSIA 3ZDTA 4D0NB 2P0FA 4PNKA 2Q13A
chains in the Genus database with same CATH topology
1ZC3B 1WI1A 1V5UA 3AU5A 2VKIA 1UEFA 3ML4A 4WVFB 1PFJA 3AJ4A 3ZVRA 5L81A 2YT1A 3HQCA 1OY2A 1WVHA 1OQNA 1XD4A 2W2WA 1GG3A 2W2XC 3KSYA 2NZ8B 1NTYA 5KQ1A 1ISNA 2D9ZA 2EJ8A 2MFQA 4GZUA 1V88A 1XCGA 1U27A 5DHAB 4GMVA 4HB3B 2XQNM 3HW2B 2ELAA 3BINA 3LJUX 2P0DA 1I7AA 1MK7B 3PEGA 4A6FA 5C5BB 1TQZA 3G9WA 2M38A 4GPTB 3N7CA 3PG7A 1AQCA 4L6EA 5CLQB 2KGXB 5HE3A 4F7UP 3M1IB 1GC6A 1W1GA 2Y8FA 4KAXB 5DI9B 3SUZA 3U8ZA 2PZ1A 5FI0A 3TFMA 2DKPA 2Z0QA 1J19A 2J0KA 4CHMA 4H8SA 2ADZA 2DA0A 2YS1A 1RRPB 2MWNB 5EFXA 3TO1A 1UNPA 1U5GA 5D3YA 4K81A 2K00A 1X1FA 3HK0A 1UPQA 1XODA 3D8DA 1I2HA 4HDQA 1UNQA 1V5PA 2K2JA 5J3TA 1PLSA 2DFKA 2DYQA 1P3RA 2I1KA 2RVBB 4HB4B 1WG7A 5HE2A 1WGQA 1KI1B 3PZDA 2EMTA 5JHGA 1FOEA 2W2XD 2Y8GA 1Q67A 2AL6A 2COAA 1FGZA 2EC1A 3KZ1A 3ODWA 3X23A 1DYNA 2HE7A 3PVUA 2BCJA 3F5RA 2CAYA 2Z0OA 1FHOA 3D8FA 5C79A 3WYFB 2ROVA 2COCA 1U2BA 1DBHA 3ULCA 2VRWB 3SO6A 4HAUB 3TCAA 2D9XA 2IFSA 3SYXA 1EAZA 3PP2A 2LOZA 4K17A 3GYPA 1Y19B 4EKUA 5DHFB 2YRYA 1KZ7A 3V5WA 4C0AA 1LW3A 2DTCA 1AWEA 3ULBA 1XR0B 1U29A 1N3HA 2QKLA 1J0WA 1PMSA 1DDMA 1XX0A 1P5TA 2I5FA 2J0MA 3SNHA 5D27A 1H10A 4WSFA 4DX90 1NI2A 4IFSA 3ODXA 2DX5A 4A6FB 3CIKA 4A6KA 4K2PA 1BTKA 1W1DA 1K5DB 1H4RA 1NTVA 5KCVA 2KUPA 2Y7BA 1FAOA 4DBBA 2RLOA 4Z2MB 4CYEA 5D3XA 3TW1A 1MK9B 1UNRA 1X11A 4CHJA 3TVVA 1MKEA 5JLJB 2RGNB 2G35A 2IYBA 4DX8A 2LKOA 2AEHA 2D4QA 3AU4A 1B55A 1SHCA 1M7RA 5HE1A 2RNRB 1SGHA 3MPXA 4A5KA 5C5BA 2GCLA 4GN1A 2N23A 4KHBB 4HDOA 1EF1A 4HAZB 5LOPB 2OQBA 1MIZB 1ZSQA 2KCJA 3CXBB 2DKQA 1Y5OA 2LYDA 2DX1A 4F7GA 2MKRA 3DXCA 5J3YA 3DXEA 1K5GB 3PVLA 2UZSA 2VSZA 2EMSA 2GS0A 3KY9A 2YT0A 1WJ1A 2I1JA 2GCJA 4EJNA 3FM8C 1FB8A 2Z0PA 3QIJA 1GC7A 5D3VA 1V5MA 3PVWA 4HAWB 2NMBA 4GXBA 2J59M 2I5CA 5D3WA 2YS3A 4IOYX 1M7EA 3PSCA 2FJLA 4MK0A 1V61A 2DN6A 3ODOA 2DLWA 2COFA 3DXDA 3KRXA 3FSSA 4F7HA 1E5WA 2ZPYA 4PQ0A 2J0JA 1UPRA 2DHIA 1BTNA 2DHJA 5FI1A 2H7EA 4Z2NA 5JHHA 3OANA 1BWNA 2YS5A 1W1HA 1ZVRA 3GYOA 5GOWB 2P0HA 1FHXA 2N0YA 1WJMA 2V76A 3D8EA 2LG1A 2OTXA 2HTHB 2CRFA 1MIXA 4XWXA 2ELBA 4KHAA 1V89A 1QC6A 4YONA 4EMOA 3A8PA 2RSGA 4HATB 1OMWA 3RCPA 2YSZA 4IAPA 4ZRIA 3MDBC 1FHWA 2R09A 2R0DA 4HHVA 1Z87A 2D10A 3KRWA 2P8VA 1X05A 2LULA 2QKMA 2M14A 2D11A 5HE0A 4NY0A 1ZM0A 3A8QA 4MT7A 4HAYB 5DH9B 4B6HA 1WGUA 4P7IA 4TKNA 1QQGA 1TXDA 1ZC4B 1BAKA 1MAIA 1EGXA 5KQ4A 5C16A 4ZRJA 4A6HA 2D9YA 2L1CA 2JP2A 5LONB 4HAXB 2X18A 4HB0B 3A98B 2RUKB 5J3QA 4MY6A 2D9WA 2YVCA 1U5FA 4KVGB 2H7DA 1NU2A 1RJ2A 4WJ7A 3BJIA 1DDVA 1FGYA 4NSWA 2UVMA 2D2QA 5C6RA 1KZGA 3WA0A 4Y94A 4ZRKA 3QBVB 2DYNA 3U7DA 3FEHA 3P7ZA 2CY4A 3QWMA 4DXAB 4HB2B 2YF0A 2ROZB 1IRSA 2D9VA 2E2XA 5JP4A 1EVHA 3IVFA 3UZTA 3P6AA 3T06A 5CLLB 1U5DA 1DROA 5DIFB 3O96A 3F0WA 2L2IA 2MDXA 4KHOA 3VIAA 2CY5A 4YL8A 3SV1A 1U5EA 2LOXA 4TYZA 4K2OA 2DHKA 2K2UA 1MPHA 3NSUA 4HAVB 1TJ6A 2GJYA 1X1GA 1P6SA 2CODA 1X86A 3VOQA 1DDWA 2UZRA 1LB1A 4BBKA 1XKEA 4GMXB 3ZDTA 4D0NB 2P0FA 4PNKA 2Q13A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZC3 B;  1WI1 A;  1V5U A;  3AU5 A;  2VKI A;  1UEF A;  3ML4 A;  4WVF B;  1PFJ A;  3AJ4 A;  3ZVR A;  5L81 A;  2YT1 A;  3HQC A;  1OY2 A;  1WVH A;  1OQN A;  1XD4 A;  2W2W A;  1GG3 A;  2W2X C;  3KSY A;  2NZ8 B;  1NTY A;  5KQ1 A;  1ISN A;  2D9Z A;  2EJ8 A;  2MFQ A;  4GZU A;  1V88 A;  1XCG A;  1U27 A;  5DHA B;  4GMV A;  4HB3 B;  2XQN M;  3HW2 B;  2ELA A;  3BIN A;  3LJU X;  2P0D A;  1I7A A;  1MK7 B;  3PEG A;  4A6F A;  5C5B B;  1TQZ A;  3G9W A;  2M38 A;  4GPT B;  3N7C A;  3PG7 A;  1AQC A;  4L6E A;  5CLQ B;  2KGX B;  5HE3 A;  4F7U P;  3M1I B;  1GC6 A;  1W1G A;  2Y8F A;  4KAX B;  5DI9 B;  3SUZ A;  3U8Z A;  2PZ1 A;  5FI0 A;  3TFM A;  2DKP A;  2Z0Q A;  1J19 A;  2J0K A;  4CHM A;  4H8S A;  2ADZ A;  2DA0 A;  2YS1 A;  1RRP B;  2MWN B;  5EFX A;  3TO1 A;  1UNP A;  1U5G A;  5D3Y A;  4K81 A;  2K00 A;  1X1F A;  3HK0 A;  1UPQ A;  1XOD A;  3D8D A;  1I2H A;  4HDQ A;  1UNQ A;  1V5P A;  2K2J A;  5J3T A;  1PLS A;  2DFK A;  2DYQ A;  1P3R A;  2I1K A;  2RVB B;  4HB4 B;  1WG7 A;  5HE2 A;  1WGQ A;  1KI1 B;  3PZD A;  2EMT A;  5JHG A;  1FOE A;  2W2X D;  2Y8G A;  1Q67 A;  2AL6 A;  2COA A;  1FGZ A;  2EC1 A;  3KZ1 A;  3ODW A;  3X23 A;  1DYN A;  2HE7 A;  3PVU A;  2BCJ A;  3F5R A;  2CAY A;  2Z0O A;  1FHO A;  3D8F A;  5C79 A;  3WYF B;  2ROV A;  2COC A;  1U2B A;  1DBH A;  3ULC A;  2VRW B;  3SO6 A;  4HAU B;  3TCA A;  2D9X A;  2IFS A;  3SYX A;  1EAZ A;  3PP2 A;  2LOZ A;  4K17 A;  3GYP A;  1Y19 B;  4EKU A;  5DHF B;  2YRY A;  1KZ7 A;  3V5W A;  4C0A A;  1LW3 A;  2DTC A;  1AWE A;  3ULB A;  1XR0 B;  1U29 A;  1N3H A;  2QKL A;  1J0W A;  1PMS A;  1DDM A;  1XX0 A;  1P5T A;  2I5F A;  2J0M A;  3SNH A;  5D27 A;  1H10 A;  4WSF A;  4DX9 0;  1NI2 A;  4IFS A;  3ODX A;  2DX5 A;  4A6F B;  3CIK A;  4A6K A;  4K2P A;  1BTK A;  1W1D A;  1K5D B;  1H4R A;  1NTV A;  5KCV A;  2KUP A;  2Y7B A;  1FAO A;  4DBB A;  2RLO A;  4Z2M B;  4CYE A;  5D3X A;  3TW1 A;  1MK9 B;  1UNR A;  1X11 A;  4CHJ A;  3TVV A;  1MKE A;  5JLJ B;  2RGN B;  2G35 A;  2IYB A;  4DX8 A;  2LKO A;  2AEH A;  2D4Q A;  3AU4 A;  1B55 A;  1SHC A;  1M7R A;  5HE1 A;  2RNR B;  1SGH A;  3MPX A;  4A5K A;  5C5B A;  2GCL A;  4GN1 A;  2N23 A;  4KHB B;  4HDO A;  1EF1 A;  4HAZ B;  5LOP B;  2OQB A;  1MIZ B;  1ZSQ A;  2KCJ A;  3CXB B;  2DKQ A;  1Y5O A;  2LYD A;  2DX1 A;  4F7G A;  2MKR A;  3DXC A;  5J3Y A;  3DXE A;  1K5G B;  3PVL A;  2UZS A;  2VSZ A;  2EMS A;  2GS0 A;  3KY9 A;  2YT0 A;  1WJ1 A;  2I1J A;  2GCJ A;  4EJN A;  3FM8 C;  1FB8 A;  2Z0P A;  3QIJ A;  1GC7 A;  5D3V A;  1V5M A;  3PVW A;  4HAW B;  2NMB A;  4GXB A;  2J59 M;  2I5C A;  5D3W A;  2YS3 A;  4IOY X;  1M7E A;  3PSC A;  2FJL A;  4MK0 A;  1V61 A;  2DN6 A;  3ODO A;  2DLW A;  2COF A;  3DXD A;  3KRX A;  3FSS A;  4F7H A;  1E5W A;  2ZPY A;  4PQ0 A;  2J0J A;  1UPR A;  2DHI A;  1BTN A;  2DHJ A;  5FI1 A;  2H7E A;  4Z2N A;  5JHH A;  3OAN A;  1BWN A;  2YS5 A;  1W1H A;  1ZVR A;  3GYO A;  5GOW B;  2P0H A;  1FHX A;  2N0Y A;  1WJM A;  2V76 A;  3D8E A;  2LG1 A;  2OTX A;  2HTH B;  2CRF A;  1MIX A;  4XWX A;  2ELB A;  4KHA A;  1V89 A;  1QC6 A;  4YON A;  4EMO A;  3A8P A;  2RSG A;  4HAT B;  1OMW A;  3RCP A;  2YSZ A;  4IAP A;  4ZRI A;  3MDB C;  1FHW A;  2R09 A;  2R0D A;  4HHV A;  1Z87 A;  2D10 A;  3KRW A;  2P8V A;  1X05 A;  2LUL A;  2QKM A;  2M14 A;  2D11 A;  5HE0 A;  4NY0 A;  1ZM0 A;  3A8Q A;  4MT7 A;  4HAY B;  5DH9 B;  4B6H A;  1WGU A;  4P7I A;  4TKN A;  1QQG A;  1TXD A;  1ZC4 B;  1BAK A;  1MAI A;  1EGX A;  5KQ4 A;  5C16 A;  4ZRJ A;  4A6H A;  2D9Y A;  2L1C A;  2JP2 A;  5LON B;  4HAX B;  2X18 A;  4HB0 B;  3A98 B;  2RUK B;  5J3Q A;  4MY6 A;  2D9W A;  2YVC A;  1U5F A;  4KVG B;  2H7D A;  1NU2 A;  1RJ2 A;  4WJ7 A;  3BJI A;  1DDV A;  1FGY A;  4NSW A;  2UVM A;  2D2Q A;  5C6R A;  1KZG A;  3WA0 A;  4Y94 A;  4ZRK A;  3QBV B;  2DYN A;  3U7D A;  3FEH A;  3P7Z A;  2CY4 A;  3QWM A;  4DXA B;  4HB2 B;  2YF0 A;  2ROZ B;  1IRS A;  2D9V A;  2E2X A;  5JP4 A;  1EVH A;  3IVF A;  3UZT A;  3P6A A;  3T06 A;  5CLL B;  1U5D A;  1DRO A;  5DIF B;  3O96 A;  3F0W A;  2L2I A;  2MDX A;  4KHO A;  3VIA A;  2CY5 A;  4YL8 A;  3SV1 A;  1U5E A;  2LOX A;  4TYZ A;  4K2O A;  2DHK A;  2K2U A;  1MPH A;  3NSU A;  4HAV B;  1TJ6 A;  2GJY A;  1X1G A;  1P6S A;  2COD A;  1X86 A;  3VOQ A;  1DDW A;  2UZR A;  1LB1 A;  4BBK A;  1XKE A;  4GMX B;  3ZDT A;  4D0N B;  2P0F A;  4PNK A;  2Q13 A; 
#chains in the Genus database with same CATH topology
 1ZC3 B;  1WI1 A;  1V5U A;  3AU5 A;  2VKI A;  1T77 A;  1UEF A;  3ML4 A;  4WVF B;  1PFJ A;  3AJ4 A;  3ZVR A;  5L81 A;  2YT1 A;  3HQC A;  1OY2 A;  1WVH A;  1OQN A;  1XD4 A;  2W2W A;  1GG3 A;  2W2X C;  3KSY A;  2NZ8 B;  1NTY A;  5KQ1 A;  2K49 A;  1ISN A;  2D9Z A;  2EJ8 A;  2MFQ A;  4GZU A;  1V88 A;  1XCG A;  1U27 A;  5DHA B;  4GMV A;  4HB3 B;  2XQN M;  3HW2 B;  2ELA A;  3BIN A;  3LJU X;  2P0D A;  1I7A A;  1MK7 B;  2Z4D A;  3PEG A;  4A6F A;  5C5B B;  1TQZ A;  3G9W A;  2M38 A;  4GPT B;  3N7C A;  3PG7 A;  1AQC A;  4L6E A;  5CLQ B;  2KGX B;  5HE3 A;  4F7U P;  3M1I B;  1GC6 A;  1W1G A;  2Y8F A;  4KAX B;  5DI9 B;  3SUZ A;  3U8Z A;  2PZ1 A;  5FI0 A;  3TFM A;  2DKP A;  2Z0Q A;  4DIX A;  1J19 A;  2J0K A;  2KIE A;  4CHM A;  4H8S A;  2ADZ A;  2DA0 A;  4GOU A;  2YS1 A;  1RRP B;  2MWN B;  5EFX A;  3TO1 A;  1UNP A;  1U5G A;  5D3Y A;  4K81 A;  2K00 A;  1X1F A;  3NWF A;  3HK0 A;  1UPQ A;  1XOD A;  3D8D A;  1I2H A;  4HDQ A;  1UNQ A;  1V5P A;  2K2J A;  4GNK B;  5J3T A;  1PLS A;  2DFK A;  2DYQ A;  1P3R A;  2I1K A;  2RVB B;  4HB4 B;  1WG7 A;  5HE2 A;  1WGQ A;  1KI1 B;  3PZD A;  2Z14 A;  2EMT A;  5JHG A;  1FOE A;  2W2X D;  2Y8G A;  1Q67 A;  2AL6 A;  2COA A;  1FGZ A;  2EC1 A;  3KZ1 A;  3ODW A;  3X23 A;  1DYN A;  2HE7 A;  3PVU A;  2BCJ A;  3F5R A;  2CAY A;  2Z0O A;  1FHO A;  3D8F A;  5C79 A;  3WYF B;  2ROV A;  2COC A;  1U2B A;  2FJU B;  1DBH A;  3ULC A;  2VRW B;  3SO6 A;  4HAU B;  4D6W A;  3TCA A;  2D9X A;  2IFS A;  3SYX A;  1EAZ A;  3PP2 A;  2LOZ A;  2R2Y A;  4K17 A;  3GYP A;  1Y19 B;  4EKU A;  5DHF B;  2YRY A;  1KZ7 A;  3V5W A;  4C0A A;  1LW3 A;  2DTC A;  1AWE A;  4OT1 A;  2K8E A;  3ULB A;  1XR0 B;  2KIG A;  1U29 A;  1N3H A;  2QKL A;  2YT2 A;  3FVC A;  1J0W A;  1PMS A;  3NWD A;  1DDM A;  1XX0 A;  1P5T A;  2I5F A;  2J0M A;  3SNH A;  3OHM B;  5D27 A;  1H10 A;  4WSF A;  4DX9 0;  1NI2 A;  4QJ3 B;  4IFS A;  3ODX A;  2DX5 A;  4A6F B;  3CIK A;  4A6K A;  4K2P A;  1BTK A;  1W1D A;  1K5D B;  3A58 A;  1H4R A;  1NTV A;  5KCV A;  2KUP A;  2Y7B A;  1FAO A;  4DBB A;  2RLO A;  4Z2M B;  3HSA A;  4CYE A;  5I2S A;  5D3X A;  3TW1 A;  1MK9 B;  1UNR A;  1X11 A;  4CHJ A;  3TVV A;  1MKE A;  5JLJ B;  2RGN B;  2G35 A;  2IYB A;  4DX8 A;  2LKO A;  2AEH A;  2D4Q A;  3AU4 A;  1B55 A;  1SHC A;  1M7R A;  5HE1 A;  2RNR B;  1SGH A;  3MPX A;  4A5K A;  5C5B A;  2GCL A;  4GN1 A;  1MI1 A;  5IRS A;  2N23 A;  4KHB B;  4HDO A;  1EF1 A;  4HAZ B;  5LOP B;  2OQB A;  1MIZ B;  1ZSQ A;  1ZYI A;  2KCJ A;  3CXB B;  2DKQ A;  1Y5O A;  2LYD A;  2DX1 A;  5M4Y B;  2Z59 A;  4F7G A;  2MKR A;  3DXC A;  5J3Y A;  3DXE A;  1K5G B;  2ZKM X;  3PVL A;  2UZS A;  2VSZ A;  2EMS A;  2GS0 A;  3KY9 A;  2YT0 A;  1WJ1 A;  2I1J A;  2GCJ A;  4EJN A;  3FM8 C;  1FB8 A;  2Z0P A;  3QIJ A;  1GC7 A;  5D3V A;  1V5M A;  4L1R A;  3PVW A;  4HAW B;  2NMB A;  4GXB A;  3NW8 A;  2KUQ A;  4QXA B;  2J59 M;  2I5C A;  5D3W A;  3B77 A;  2YS3 A;  4IOY X;  1M7E A;  3PSC A;  3NWA A;  2FJL A;  4MK0 A;  4QJ4 B;  1V61 A;  2DN6 A;  3ODO A;  2DLW A;  2COF A;  3DXD A;  3KRX A;  3FSS A;  4F7H A;  4OSN A;  1E5W A;  2ZPY A;  4PQ0 A;  5LG4 B;  2J0J A;  2RRF A;  3DCX A;  1UPR A;  2DHI A;  1BTN A;  2DHJ A;  5FI1 A;  2H7E A;  4Z2N A;  5JHH A;  3OAN A;  4CSQ A;  1BWN A;  2YS5 A;  1W1H A;  3HIE A;  1ZVR A;  3GYO A;  5GOW B;  2P0H A;  1FHX A;  2N0Y A;  2Z13 A;  1WJM A;  2V76 A;  3D8E A;  2LG1 A;  2OTX A;  2HTH B;  2CRF A;  1MIX A;  4XWX A;  2ELB A;  4KHA A;  1V89 A;  1QC6 A;  4YON A;  4EMO A;  3A8P A;  2KR0 A;  2RSG A;  4HAT B;  1OMW A;  3RCP A;  2YSZ A;  4IAP A;  4ZRI A;  1FHW A;  3MDB C;  2R09 A;  2R0D A;  4HHV A;  1Z87 A;  2D10 A;  3KRW A;  2P8V A;  1X05 A;  2LUL A;  2QKM A;  2M14 A;  2D11 A;  5HE0 A;  4NY0 A;  1ZM0 A;  3A8Q A;  3U12 A;  4MT7 A;  4HAY B;  5DH9 B;  4B6H A;  1WGU A;  4P7I A;  4TKN A;  1QQG A;  1TXD A;  2GUM A;  1ZC4 B;  1BAK A;  1MAI A;  1EGX A;  5KQ4 A;  5C16 A;  4ZRJ A;  4A6H A;  2D9Y A;  5I2M A;  2L1C A;  2JP2 A;  5LON B;  4HAX B;  2X18 A;  4HB0 B;  3A98 B;  2RUK B;  5J3Q A;  4MY6 A;  2D9W A;  2YVC A;  1U5F A;  4KVG B;  2H7D A;  1NU2 A;  1RJ2 A;  4WJ7 A;  3BJI A;  1DDV A;  1FGY A;  2NBV A;  4NSW A;  2UVM A;  2D2Q A;  5C6R A;  1KZG A;  3WA0 A;  4Y94 A;  4KHB A;  4ZRK A;  3QBV B;  2DYN A;  3U7D A;  3FEH A;  3P7Z A;  2CY4 A;  3QWM A;  4DXA B;  4HB2 B;  2YF0 A;  2ROZ B;  1IRS A;  2D9V A;  2E2X A;  5JP4 A;  1EVH A;  3IVF A;  3UZT A;  3P6A A;  3T06 A;  5CLL B;  1U5D A;  1DRO A;  5DIF B;  3O96 A;  3F0W A;  2L2I A;  2MDX A;  4KHO A;  3VIA A;  2CY5 A;  4YL8 A;  3SV1 A;  1U5E A;  2LOX A;  4TYZ A;  4K2O A;  2DHK A;  2K2U A;  1MPH A;  3NSU A;  4HAV B;  1TJ6 A;  2GJY A;  1X1G A;  1P6S A;  2COD A;  1X86 A;  3VOQ A;  1DDW A;  2UZR A;  1LB1 A;  4BBK A;  1XKE A;  4GMX B;  4QJ5 B;  4HSI A;  3ZDT A;  4D0N B;  2P0F A;  4PNK A;  2Q13 A; 
#chains in the Genus database with same CATH homology
 1ZC3 B;  1WI1 A;  1V5U A;  3AU5 A;  2VKI A;  1UEF A;  3ML4 A;  4WVF B;  1PFJ A;  3AJ4 A;  3ZVR A;  5L81 A;  2YT1 A;  3HQC A;  1OY2 A;  1WVH A;  1OQN A;  1XD4 A;  2W2W A;  1GG3 A;  2W2X C;  3KSY A;  2NZ8 B;  1NTY A;  5KQ1 A;  1ISN A;  2D9Z A;  2EJ8 A;  2MFQ A;  4GZU A;  1V88 A;  1XCG A;  1U27 A;  5DHA B;  4GMV A;  4HB3 B;  2XQN M;  3HW2 B;  2ELA A;  3BIN A;  3LJU X;  2P0D A;  1I7A A;  1MK7 B;  3PEG A;  4A6F A;  5C5B B;  1TQZ A;  3G9W A;  2M38 A;  4GPT B;  3N7C A;  3PG7 A;  1AQC A;  4L6E A;  5CLQ B;  2KGX B;  5HE3 A;  4F7U P;  3M1I B;  1GC6 A;  1W1G A;  2Y8F A;  4KAX B;  5DI9 B;  3SUZ A;  3U8Z A;  2PZ1 A;  5FI0 A;  3TFM A;  2DKP A;  2Z0Q A;  1J19 A;  2J0K A;  4CHM A;  4H8S A;  2ADZ A;  2DA0 A;  2YS1 A;  1RRP B;  2MWN B;  5EFX A;  3TO1 A;  1UNP A;  1U5G A;  5D3Y A;  4K81 A;  2K00 A;  1X1F A;  3HK0 A;  1UPQ A;  1XOD A;  3D8D A;  1I2H A;  4HDQ A;  1UNQ A;  1V5P A;  2K2J A;  5J3T A;  1PLS A;  2DFK A;  2DYQ A;  1P3R A;  2I1K A;  2RVB B;  4HB4 B;  1WG7 A;  5HE2 A;  1WGQ A;  1KI1 B;  3PZD A;  2EMT A;  5JHG A;  1FOE A;  2W2X D;  2Y8G A;  1Q67 A;  2AL6 A;  2COA A;  1FGZ A;  2EC1 A;  3KZ1 A;  3ODW A;  3X23 A;  1DYN A;  2HE7 A;  3PVU A;  2BCJ A;  3F5R A;  2CAY A;  2Z0O A;  1FHO A;  3D8F A;  5C79 A;  3WYF B;  2ROV A;  2COC A;  1U2B A;  1DBH A;  3ULC A;  2VRW B;  3SO6 A;  4HAU B;  3TCA A;  2D9X A;  2IFS A;  3SYX A;  1EAZ A;  3PP2 A;  2LOZ A;  4K17 A;  3GYP A;  1Y19 B;  4EKU A;  5DHF B;  2YRY A;  1KZ7 A;  3V5W A;  4C0A A;  1LW3 A;  2DTC A;  1AWE A;  3ULB A;  1XR0 B;  1U29 A;  1N3H A;  2QKL A;  1J0W A;  1PMS A;  1DDM A;  1XX0 A;  1P5T A;  2I5F A;  2J0M A;  3SNH A;  5D27 A;  1H10 A;  4WSF A;  4DX9 0;  1NI2 A;  4IFS A;  3ODX A;  2DX5 A;  4A6F B;  3CIK A;  4A6K A;  4K2P A;  1BTK A;  1W1D A;  1K5D B;  1H4R A;  1NTV A;  5KCV A;  2KUP A;  2Y7B A;  1FAO A;  4DBB A;  2RLO A;  4Z2M B;  4CYE A;  5D3X A;  3TW1 A;  1MK9 B;  1UNR A;  1X11 A;  4CHJ A;  3TVV A;  1MKE A;  5JLJ B;  2RGN B;  2G35 A;  2IYB A;  4DX8 A;  2LKO A;  2AEH A;  2D4Q A;  3AU4 A;  1B55 A;  1SHC A;  1M7R A;  5HE1 A;  2RNR B;  1SGH A;  3MPX A;  4A5K A;  5C5B A;  2GCL A;  4GN1 A;  2N23 A;  4KHB B;  4HDO A;  1EF1 A;  4HAZ B;  5LOP B;  2OQB A;  1MIZ B;  1ZSQ A;  2KCJ A;  3CXB B;  2DKQ A;  1Y5O A;  2LYD A;  2DX1 A;  4F7G A;  2MKR A;  3DXC A;  5J3Y A;  3DXE A;  1K5G B;  3PVL A;  2UZS A;  2VSZ A;  2EMS A;  2GS0 A;  3KY9 A;  2YT0 A;  1WJ1 A;  2I1J A;  2GCJ A;  4EJN A;  3FM8 C;  1FB8 A;  2Z0P A;  3QIJ A;  1GC7 A;  5D3V A;  1V5M A;  3PVW A;  4HAW B;  2NMB A;  4GXB A;  2J59 M;  2I5C A;  5D3W A;  2YS3 A;  4IOY X;  1M7E A;  3PSC A;  2FJL A;  4MK0 A;  1V61 A;  2DN6 A;  3ODO A;  2DLW A;  2COF A;  3DXD A;  3KRX A;  3FSS A;  4F7H A;  1E5W A;  2ZPY A;  4PQ0 A;  2J0J A;  1UPR A;  2DHI A;  1BTN A;  2DHJ A;  5FI1 A;  2H7E A;  4Z2N A;  5JHH A;  3OAN A;  1BWN A;  2YS5 A;  1W1H A;  1ZVR A;  3GYO A;  5GOW B;  2P0H A;  1FHX A;  2N0Y A;  1WJM A;  2V76 A;  3D8E A;  2LG1 A;  2OTX A;  2HTH B;  2CRF A;  1MIX A;  4XWX A;  2ELB A;  4KHA A;  1V89 A;  1QC6 A;  4YON A;  4EMO A;  3A8P A;  2RSG A;  4HAT B;  1OMW A;  3RCP A;  2YSZ A;  4IAP A;  4ZRI A;  3MDB C;  1FHW A;  2R09 A;  2R0D A;  4HHV A;  1Z87 A;  2D10 A;  3KRW A;  2P8V A;  1X05 A;  2LUL A;  2QKM A;  2M14 A;  2D11 A;  5HE0 A;  4NY0 A;  1ZM0 A;  3A8Q A;  4MT7 A;  4HAY B;  5DH9 B;  4B6H A;  1WGU A;  4P7I A;  4TKN A;  1QQG A;  1TXD A;  1ZC4 B;  1BAK A;  1MAI A;  1EGX A;  5KQ4 A;  5C16 A;  4ZRJ A;  4A6H A;  2D9Y A;  2L1C A;  2JP2 A;  5LON B;  4HAX B;  2X18 A;  4HB0 B;  3A98 B;  2RUK B;  5J3Q A;  4MY6 A;  2D9W A;  2YVC A;  1U5F A;  4KVG B;  2H7D A;  1NU2 A;  1RJ2 A;  4WJ7 A;  3BJI A;  1DDV A;  1FGY A;  4NSW A;  2UVM A;  2D2Q A;  5C6R A;  1KZG A;  3WA0 A;  4Y94 A;  4ZRK A;  3QBV B;  2DYN A;  3U7D A;  3FEH A;  3P7Z A;  2CY4 A;  3QWM A;  4DXA B;  4HB2 B;  2YF0 A;  2ROZ B;  1IRS A;  2D9V A;  2E2X A;  5JP4 A;  1EVH A;  3IVF A;  3UZT A;  3P6A A;  3T06 A;  5CLL B;  1U5D A;  1DRO A;  5DIF B;  3O96 A;  3F0W A;  2L2I A;  2MDX A;  4KHO A;  3VIA A;  2CY5 A;  4YL8 A;  3SV1 A;  1U5E A;  2LOX A;  4TYZ A;  4K2O A;  2DHK A;  2K2U A;  1MPH A;  3NSU A;  4HAV B;  1TJ6 A;  2GJY A;  1X1G A;  1P6S A;  2COD A;  1X86 A;  3VOQ A;  1DDW A;  2UZR A;  1LB1 A;  4BBK A;  1XKE A;  4GMX B;  3ZDT A;  4D0N B;  2P0F A;  4PNK A;  2Q13 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...