2COKA

Solution structure of brct domain of poly(adp-ribose) polymerase-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
b'GSSGSSGDKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSSWGAEVKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of BRCT domain of poly(ADP-ribose) polymerase-1
rcsb
molecule keywords Poly [ADP-ribose] polymerase-1
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 113
sequence length 113
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2cokA00
1IMOA 2EBUA 2VXCA 3PC8C 3K15A 3SHTA 3SQDA 1OQAA 4ID3A 2K7FA 2COEA 2EBWA 2D8MA 1IN1A 3JVEA 3I0NA 1L0BA 3FA2A 2EP8A 2M2IA 1KZYC 3OLCX 4BU0A 3T7IA 1T15A 2COUA 3K05A 4BMDA 3QVGA 2R1ZA 3PC6A 3AL2A 3PXAA 3K0KA 3T7KA 2L42A 3U3ZA 2HTFA 3SHVA 2ADOA 4BU1A 3PXCX 3L40A 3PC7A 2AZMA 1Z56C 1GZHB 3PA6A 4IGKA 3QVGB 3AL3A 1N5OX 2XNKA 4N40A 3L41A 3PC8A 3UEOA 4XQ0A 4IFIA 3L46A 3SZMA 3PXBA 1JNXX 3EF0A 3T1NA 3UENA 3HUEA 1L7BA 3K16A 2DUNA 1Y98A 2WT8A 3K0HA 2ETXA 3COJA 2COKA 2JW5A 2VXBA 3II6X 1CDZA 3PD7A 4Y18A 3HUFA 4JLUA 4Y2GA 3KTFA 4U4AA 2INGX 1T2VA 3T7JA 1WF6A 2K6GA 3PXEA 1T2UA 1T29A 3PXDA 2XNHA 3EF1A 4BMCA 2LE0A 2NTEA 4OFBA 3I0MA 4XPZA 5ECGC 2E2WA
chains in the Genus database with same CATH superfamily
1BS1A 3ZJVA 2R8ZA 1XZJA 1NM5C 3FLAA 4O1HA 2OQ2A 4FSHA 1SOMA 3D6MA 4RLHA 3Q98A 4D79A 5CK5A 4H15A 2YV4A 2VJPA 2VCHA 3EH2A 5K6TA 1G6Q1 1FSFA 4JYPA 4RQUA 2ZE5A 5D2CA 4LNAA 2I9PA 3VR5D 2OEPA 1PWYE 1M1YE 2YRWA 4EB6A 1BW9B 2WF7A 4ZI7B 5KNDD 1NQVA 4M1MA 3UATA 1QQBA 1E4EA 4TWJA 2ONYA 3VAAA 3ZE7A 2PK3A 3AT1A 3NP9A 5JYEA 2OFFA 3T52A 1PNQA 1YR6A 4J75A 2WZDA 5HRUA 2AZ4A 2GN2A 2X23A 3UMRA 3KDSE 3JVUA 2QTWB 4HQ0A 5GJBA 2B4TO 1DC5A 2VDVE 3MYYA 4J94A 4L73A 4D4KA 3MEQA 3L8HA 2AOWA 5MGNA 1A69A 3I72A 4JI4B 3RUAA 3KB2A 3FCUB 1DBVO 1Y42X 1ZGZA 2JLRA 4HNRA 5LUAA 1G3RA 4ZEVA 4F71A 2JFVA 1CKEA 2BFBB 3GJ4A 2G7ZA 1DU4A 1UDCA 3GBPA 3ORHA 2HY7A 4TL7A 3B38A 4AULA 3RAEC 1C2TA 4MK4A 4CL2A 1CF4A 3ZDRA 1LWNA 3IB6A 3ABIA 5KQLA 3C4JA 4HVAA 3C1OA 1OJLA 4N3BA 1GR1A 4WXRA 4CEIB 1ZDMA 1NRIA 4LJ9A 3SDSA 5A0VA 1IOLA 5AKZA 2XV1A 2UU9B 4B3MB 5ED0A 5E9WA 1DEXA 1VC2A 2KM1A 2WTNA 3HCRA 2R7KA 2RFLA 3HMQA 2D0OB 3NYWA 2WMDA 2IUUA 3L43A 1BQ3A 3PC8A 3PKZA 3A9CA 5DJ5A 1Y4ZA 2C5GA 1JG3A 4GP7A 1AK9A 4IDNA 2AHOA 1ZIYA 1FDOA 1C1YA 3GJ3A 2EFHB 4L8YA 3T54A 2XCRB 3HLTA 2XTZA 3IESA 4XWGA 3WAKA 1TQ8A 2JIMA 4DQLA 4QXRA 2F4VB 2WVHA 2J30A 2Q4EA 1GGHA 1Y1RA 1X7XA 1P7CA 4L8WB 5TXGA 4LWOA 1SXJD 4FEYA 1CLEA 1D6NA 2FPKA 3U9SA 4DLPA 3AYXB 5REQB 3C8ZA 5TQ2B 4OHOA 3WB1A 1UC9A 2C3PA 4DR2B 2QI9C 2GD2A 2H5LA 4M0MA 2ECOA 1KBOA 1ZQ1A 2WF9A 3ENWA 3FFBA 3P27A 4MWCA 4WXPA 2Z4RA 2XUJA 3OMLA 3V5NA 3DV0A 2CCGA 3VR6A 1JQ5A 2BHTA 2Q9CA 1PR1A 3EXHA 1PS0A 2YN0A 4GWLA 1FNNA 4Q1EA 3RSLA 3TIVA 1DKLA 1ENZA 1FF9A 2RK4A 3GGGA 1QFZA 2ENWA 4R83A 5F76A 2IOFA 5LQMA 1G7TA 5CB6A 3EEYA 4DR4B 1L7EA 2OV2A 3PNSA 3F3YA 1PEDA 2HRCA 1JIJA 1YJXA 3AEQB 4PE5B 3R7SA 4B31A 1YKGA 4NR0A 2RG1A 1HDRA 4RTKA 2IUFA 3CIFA 3INGA 3COPA 3GCZA 3NHLA 2DFLA 2HQOA 5FFNA 3VKWA 1AXRA 2CNNA 4G8BA 4YAUA 5K51A 3K09A 4RGVA 1KOGA 1BFKA 5KB3A 4JX9A 5LPNA 3HUUA 5LWHA 5A4KA 1S6YA 1V5GA 3RC8A 5KWVA 2BIFA 3KJFA 2CLKB 3PPYA 3V2HA 2A3NA 1JDUA 2CFOA 1AC5A 3WNBA 4LOIA 5EOVA 2OZPA 2QDXA 4PCVA 1WMBA 3AR6A 4YUVA 1FSZA 1G16A 3DSRA 4DEXA 3CHYA 4UHKA 4R9VA 3TEMA 1JIXA 3PGMA 4JUFA 4O2BA 1K7EB 5D51S 2AI2A 2JAXA 4KBYA 3HA3A 3M1LA 4UJ5A 3ZN2A 4U7PB 3SIXA 2NZUG 4L5BA 4B84A 1QYCA 2XJ4A 1ZHFA 4KBFA 4OQ4A 1GSHA 1HE8B 2HH9A 3BB3A 1VLZA 2QORA 3KD3A 4H0CA 5DLEA 3U39A 4LTNA 4GQAA 1XMQB 1AQYA 1KSJA 3WTBA 1TRKA 2F1IA 2AN4A 3ONFA 4HNGA 3ZCUA 4YPVA 3JYQA 1EVKA 4RETA 2J3EA 5BYAA 1TCCA 4WOPA 1RDFA 1A4UA 5BN1A 2GAFA 2JJ2A 3K05A 4I50B 1WZCA 4JVLA 3O1LA 1P77A 1GKYA 3AFMA 2OFXA 3G0GA 3QVGA 5B1YA 5JDCA 3N0RA 3EG9A 4UXHA 4QOHA 4D4HA 3AL2A 3RNLA 5CNMA 2BFWA 4PYKA 2BFMA 1JHRA 3HKDA 4RMNA 1YXMA 1XCGB 1MX3A 4PIMA 3SHFA 5C80A 5AVWA 1KERA 1E2DA 2CZCA 3E2PA 4I5FA 4IIDA 4F38A 2Q28A 1QVRA 3QX8A 3IMCA 3VC2A 1HURA 2IODA 2DJIA 1TMKA 3KS9A 3PXCX 3PV0A 2IEZA 4YMSA 5DXFA 3K2BA 4CLEA 4B40A 5T3UA 3RUPA 3PJEA 4GX2A 3RTDA 3VTAA 1E3QA 2NN3C 4R98A 3DHWC 5HFNA 1CY1A 2Z5FA 4MWBA 4RJKA 4CI9A 4EHDA 3VNQA 4K7JA 3TTYA 4DDHA 4LQLA 2VJLA 3O8CA 3F67A 2YQ4A 3G0IA 4R8LA 1IUKA 5LNK1 4LXHA 3Q3VA 3NBUA 1YDFA 2Y1XA 5BNIA 3D6AA 4OQEA 3TQQA 3IA2A 2P1DA 1J0CA 3FMPB 1GRVA 4NOKA 2EBHX 1N2XA 5CIQA 3PCTA 4FJ2A 5F33A 1W4BA 1EE1A 2B94A 2DWPA 3KPYA 4QU9A 5DI3B 1TLTA 4E08A 1GNSA 1ECJA 1JUDA 2QTBA 3D3WA 3FAKA 3K53A 4E13A 1AQJA 4DCJA 1W36C 2FPMA 4W8GA 3ON5A 1AN0A 3P2EA 2JK1A 4YONB 2OZVA 1W581 4LZLA 4KIGA 4DXAA 1S0UA 1WZIA 3N76A 1TO1E 1MCZA 2DBYA 4GMGA 5ARCA 2C1XA 1WA5A 4F7DA 1L5HA 1R0ZA 2HOQA 3A6EA 4YYZA 1RMYA 4LSGA 2DWQA 4H2DA 4GEGA 3ZVKA 4ZPXA 3JY6A 2AGVA 2Q1SA 3NVMB 4ZI3A 3QSYA 3BS4A 4DNQA 1Z25A 1YULA 4RV5A 3KVVA 4HX5A 4QX6A 2XT9A 3IJPA 3L0BA 3C8DA 1D7OA 1FJ2A 2FOLA 1E0JA 1IHUA 3N6VA 1SBIA 1G41A 2DPGA 1JEQA 1GSOA 2EYUA 3I9MA 4AXBA 4QBFA 1MW8X 3AZOA 1BFDA 3KKOA 3ICWA 4Q7LA 4PSCA 2ZTHA 3QVVA 1USWA 5TJ9A 3TRJA 5IHXA 1EZ4A 3VH4A 5EWJB 2VRBA 4FGWA 1NP7A 3K9LA 2JFQA 3LRXA 4QHTA 2WWGA 3U4MA 2WAAA 3COSA 3OZCA 1LBQA 1P2BA 1Y3CE 3D2AA 4IDHA 1A27A 1J2UA 4LK2A 1KXZA 2F3RA 4OLHA 1XT6A 2HA5A 2H9IA 4X54A 5G41A 5CD1A 4MCHA 3P9IA 2NU9A 4YJ2A 2WMOB 4BNDA 1ADGA 1PR3A 4F3CA 1IAVA 1LA2A 5LOVA 1DZIA 2VZ9A 2V6MA 4CIWA 3UMBA 2CEAA 4F60A 1M1ZA 2C3YA 2E3JA 1PV4A 2F9MA 3NV7A 3WI7A 1XKLA 1U9CA 5JE8A 3AOEA 1T6XA 2NTYC 1RYMA 1V16B 4HRVA 4IRUB 4YCDA 3T1OA 2GN9A 1YDHA 3ICCA 5A7HA 2ZIXA 1F8GA 2DC1A 4E88A 1M7BA 4XPIA 4IMJB 5CEFA 4OYLA 4IF6A 4XKJA 5KC9A 3AI2A 3FA2A 2PKWA 2HSGA 2JEOA 2M2IA 2XWSA 4MEJA 4YP0A 1I10A 3H9QA 2IDJA 2QQGA 4UOEA 3QY0A 1DV1A 3ZCTA 5AKGA 4LF4B 2JIDA 2YASA 4HAOA 2YQ5A 5A02A 4KN9S 5ALSA 2W2QA 1J8DA 2NTJA 2NW6A 2JRCA 1VI5A 2WKSA 1VXOA 3H87A 3IUNA 2CJPA 3VKVA 5B6JA 1DIGA 4AP6A 3RS5A 3ZDBA 4WGFA 1YVPA 2ZT6A 3R0JA 1D2EA 3F6YA 2HMUA 4D9HA 1O77A 3PLAE 3FR8A 5MN5A 3UGQA 1BU8A 3OC6A 1W4ZA 4PHFA 3LO8A 1QQTA 1FFXA 2GAOA 1WCYA 2QV7A 4EZBA 1XTBA 2D54A 3JQFA 5EP4A 3SIPA 4YREA 2VYVD 4F11A 2PLWA 1NLZA 3IT0A 2OFOA 4N6GA 5CCXA 1XJ0A 3PJFA 1P1KA 3KUXA 3CUYA 1SA0B 3CZ5A 3GH3A 4FCTA 3ZCXA 4FGUA 2TS1A 1CDEA 1Z0ZA 2R7MA 1SKUA 4CIAA 5CH5A 1G2OA 1JDZA 2FZEA 3NG1A 3TPCA 3WRYC 1M73E 1Z2DA 2GPTA 3EQ6A 3INRA 4HD8A 3LY5A 4IUYA 5GONA 5KJEA 4CG1A 1XMXA 4FFOA 4CLHA 4ZJZA 2WKRA 4YB8A 1ICEA 3KZNA 4F5DA 2BDUA 2P9JA 1Q95A 3FZYA 4NESA 2WFZA 3AHJA 4G85A 4ZYXA 3LOPA 3ET5A 3NWBA 3T4EA 5CUQA 2Q07A 4FCCA 4MRRA 3UJBA 1BC5A 1MOSA 4RA9A 1T4CA 3ODGA 3VI3B 4AZVA 1K6JA 4FT2A 4WY5A 5K0NA 4HEA1 4KN8A 2FV8A 2PKQP 3P0EA 4OI1A 1E1KA 4QYIB 1ECPA 3TLKA 1EZZA 2DKOA 3HRHA 3N70A 4HS4A 4C06A 4Z7OB 3JQ7B 1NV9A 2R6HA 4NNPA 1NLYA 2UYYA 5FIUA 1AO3A 2XUFA 4M6WA 4MEAA 5IVDA 7REQB 1SPBS 3CPHA 2Q2VA 3MCZA 4FZ5A 5DWQA 2GEKA 4URXR 1KZ6A 1G8MA 2CMGA 1QK3A 1WEKA 3COWA 5AICA 4YP1A 1RZVA 2ZBVA 3D0QA 3HGMA 2YKGA 1DOHA 4BIMA 3K30A 1S8NA 2DBVO 3U48A 4ZMRA 1XA0A 3C8UA 1XQ9A 2PN1A 3FKJA 3IQHX 4XCXA 4TTRA 1IVYA 1YZFA 1ZK4A 3ZOKA 3AEKA 3HXOA 4AQ7A 3DLBA 2E4XA 1PYDA 1JHUA 5KQRA 1BX1A 3CLUD 4F91B 1MENA 5L3VA 4C87A 1CVLA 1CR2A 1USIA 2B82A 3EEBA 4G8DA 5ABPA 2AJBA 2C1ZA 1XYYA 5BMOA 4EI8A 3NO4A 3QOWA 4X9XA 3IAEA 2FN4A 5FBQB 4C6TA 5HW0A 4JYCA 2CMDA 3ZBPA 2QMZA 4DMMA 1ODIA 2JFHA 3QPBA 4CMGA 4CN9A 1TMYA 3BWMA 1SKBA 4HAZA 4U2DA 3JRWA 3OUUA 2FZKA 2Q21A 3O93A 5FL7D 1S1MA 2ZP1A 5E7JA 2HBRA 3O1JC 5BSWA 5ERYA 5J1SB 3MJSA 4FQ5A 5AT1A 4QUAA 3J80A 1ZK0A 4DV1B 1PS8A 4FFBB 4U6QA 3AR3A 4YDSA 5F2KA 4UE2A 5JMPA 5EFOA 3U4AA 5AUNB 4MS3B 5D3KA 2Q8PA 3KAJA 3PIDA 4RIGA 5LQRA 2G17A 2VP5A 1FJGB 1BJTA 3F97A 1OFVA 2FX2A 5THQA 1UQUA 2DSTA 3FF4A 2J85A 3L7LA 4O4HF 3S99A 1UBRS 4P58A 2X0EA 2Z09A 1ZZEA 5C7IO 1BMFA 1ONPA 3EN0A 5HKKD 2DPXA 4M89A 3WL4A 1E4YA 1NW3A 1X8JA 3FUUA 5ITVA 3GAZA 4D0RA 2L82A 1PGJA 1PV1A 4PAQA 1TT7A 4DABA 3EWIA 5HTOA 3OETA 3G7UA 4FP9A 1JBEA 5BN3A 2CFIA 3PWSA 1OXXK 3BSWA 3TBKA 2R5NA 2OCKA 1H42A 1R37A 1V3UA 2BMJA 4Q01A 3RASA 1A77A 1ENOA 1VB5A 4KXUA 4R51A 3TW0A 1QX4A 1FQWA 3EGXA 3LA6A 3ORFA 3L41A 2I71A 3CG0A 5HK9A 1SU4A 4DJFC 4BKMA 1GL3A 4Z9FA 4KIUA 3PBKA 5JI3E 1Y6ZA 4AY5A 1AUQA 1GJRA 1EX9A 1YS9A 4UCXA 4CMAA 1R9JA 3EIXA 5AVTA 4BLUA 1DHTA 2B35A 2W2NA 1FSPA 5T3YA 2QY9A 1E79A 1GN8A 2EWWA 3EE6A 2I29A 4OREX 2QRGA 4C0HA 2XDYA 5CU7A 4CCWA 3AJ9A 1OLUB 2X0KA 2I6TA 2RB4A 1R4AA 3JVIA 5EIHA 5D3QA 4WKNA 4US0R 1AHIA 2MHCA 3QTLA 3NIFB 3G5LA 3UK7A 4F4DA 4ENRA 2GASA 4CTMA 1UAAA 4YJKA 4X1KB 4OJTA 2PKXA 1L8XA 4D80A 3K0HA 2H1VA 1QO9A 3E9EA 2QYTA 4KCGA 4M7WA 4RQBA 5JSYA 1LJUA 1GPYA 2FP4B 1SM4A 4NDAA 4V3BA 3KLBA 2GCPA 3GT3A 5DHSA 2XCTB 3P9ZA 3IA7A 1ZS9A 3DVAB 1ZC4A 4X20A 4HLUC 1ACLA 1BDMA 1ZH2A 2I03A 1X15A 3THYB 3EQZA 5AI6A 5JZ9A 3T7AA 1FTNA 2C5AA 2DFNA 3CKMA 4TWAA 5E4TA 4B3HA 2G5CA 1P8AA 4R1LA 1FFAA 2F8SA 2PU7A 2QMOA 1IMJA 3G2NA 3HBMA 4IFEA 3A9UA 4ACBA 5HS4A 1GRRA 2P27A 4WKBA 4BLWA 3LWDA 3R09A 3ICPA 5FAKA 1SKMA 3B6EA 3ZX4A 3F6CA 1KS2A 1C8LA 1DMRA 2CUNA 1JDNA 3DZDA 3EJ6A 1G1AA 2PSJA 4EQ6B 5LP6F 3GUUA 4ZREA 4KV7A 2I4RA 4LW8A 3H2GA 1T6YA 3L18A 4TMTA 4P82A 3O6VA 1IY8A 2J41A 2OAP1 2GLUA 1Y5LA 3WHIA 1E9CA 2ZRHA 3NT5A 2C4NA 3WB2A 3KYCA 2PKQO 4CDRA 1G9TA 3FDZA 1E4VA 4FDVA 5IYZA 3GLKA 5KNBH 1OX6A 3WK7A 2MJLA 2B30A 2OXFA 2QTFA 1JHZA 3MGGA 3DZFA 1L5SA 3I05A 3PXXA 1T13A 1C3JA 2F3PA 2C3MA 1LLUA 1QH1A 2OLKA 2ZT5A 4JUDX 4G09A 3RB8A 3U80A 3UPDA 5FX2A 3ZI7A 3I83A 3D4PA 1TTHA 3WDMA 2BFFB 4Y0VA 4XQ9A 1UODA 1X1QA 2E87A 3HFSA 4WN3A 2GDZA 4H4EA 5HKBA 1IWPB 1QPBA 4M9ZA 2YHBA 3TRIA 1P0FA 3I6BA 3CKKA 5IZCC 1JB9A 1LX6A 1BWSA 1ORTA 1U98A 1TUEA 2CXPA 2DUMA 4A6XA 1YRQA 5EIAA 3BZBA 1Y1LA 4PSAA 3HCNA 2HDWA 4E1BA 1MIOB 2ZYAA 4KQGA 2Q6KA 3QNUA 5FBHA 4MWOA 4MVJA 2FN9A 3P9RA 3WYAA 1P5JA 2IUYA 5KQGA 3OJEA 4OHYA 4LYAA 1GEGA 3MUEA 3U3RA 1UC4B 3GVPA 1MORA 4DJDC 2WMNB 2X76A 3K3PA 3ZS9A 1UZUA 1U0HC 1XTUA 2XUAA 4MKGA 5A3QA 3SSAA 3AFGA 3SFZA 1DJOA 3R7DA 1PKXA 5G53C 4R2IA 1XROA 3BK2A 5CBPB 3THXA 1P1JA 3DF9A 1C9JA 4WRRA 3KALA 2B4YA 4CEHA 4EO9A 1T8PA 2F3UA 3RPEA 3IAS1 5EJ9A 3FYDA 4KV9A 1I2BA 3RHSA 1HRDA 1GFSA 1F17A 1T3SA 3NBKA 5CYOA 4AECA 5KYUB 1A8UA 4TQGA 5E9JA 1H3NA 3H4TA 5TB5A 1G38A 1MJ5A 2ID9A 4X1IA 1YUBA 3A1TA 4II3A 3KQSA 2I9KA 4UHDA 1G2PA 1SGWA 2WT4A 4IO1A 4IQ8A 4Y6PA 1NZFA 3QK7A 4RVFA 3RAGA 2IKQA 4OYYA 3QWHA 4KLCA 2Y77A 4N03A 4K1LA 3DXYA 2C78A 1KH1A 1NL3A 5HJEA 3OEWA 5L4LA 3GDOA 1X2EA 4Q4AA 2WUEA 5BWCA 3ZD6A 2X4GA 3WYBA 3GCDA 1IBRA 3C5VA 4UBMA 3SICE 1B8VA 4O4IA 2DT5A 4PLVA 4HWTA 3ZHTA 4DADA 2HIAA 4KQ2A 4BXOA 2B83A 1PLKA 2IXGA 1TX4B 1WXGA 5IAEA 2ZR7A 5JCZA 1K5HA 2Q6TA 4E3ZA 2HHCA 4H08A 3V9AA 1X13A 3CT4A 3LE8A 4BECA 1ECLA 4FUQA 1KO8A 3NPMA 5J2TB 1Y5NA 4GNKA 3WIBA 2O8EA 1Q44A 1SO8A 3K70D 3BSFA 1EDBA 5FTNA 2LE0A 4XIIA 1IJEA 2GK6A 5KNDA 1SKQA 3T1TA 1XZCA 2HB6A 1UWKA 3CUUA 1JEJA 3R75A 1JQBA 4P0QB 2VDNB 4KPGA 3NHPA 2REXB 3QPAA 4BGUA 5DHAA 1NUPA 2QNRA 1L7AA 5CA0A 4MMZB 1U3TA 1PJ2A 1W6RA 1WY7A 1WW3A 1NOKA 2AHRA 3Q3CA 4Y2JA 2VP2A 4CI0B 1I9CA 1PR0A 2I2CA 2LRHA 3ASYA 3FCEA 4NI5A 4RHXA 1GGJA 3NPAA 4MULA 4YLGA 1RYZA 3FHJA 1M76A 3WBKA 1D4AA 1R4MB 5L45A 1UFKA 2FZWA 3DB2A 5KPJA 2XA9A 1OIVA 2AD5A 3HDVA 3STWA 1R27A 2QLFA 4YBRA 1E0KA 2KJQA 3OFVA 5M5BA 2ZTMA 2VHCA 1T2NA 3QBEA 4CKEB 3BEOA 4ZIRA 1GDDA 2W6OA 5BNFA 1YJ5A 1GT91 5JPIA 1R4NA 2A0UA 3QELB 5B2FA 4MYHA 1OXVA 2W8BB 4WFJA 1PK8A 3IBTA 5JADA 1TQ4A 5TGZA 5EJAA 4BVBA 2CCKA 2P0YA 2H4HA 3UAGA 4MB6A 3JQ8B 3GHYA 1DXOA 2ID8A 2AVDA 3CEHA 1HV8A 3WK4A 1I7DA 3VPCA 3WNQA 3IBGA 4BCCA 3H5WA 1VL2A 2AD1A 3K0CA 4IH9A 4WBSA 3BMNB 2WIDA 1XSEA 1TAHA 3C3JA 3TR0A 1X3SA 1LJLA 3LLCA 3QWBA 4ZO7A 3HJRA 4NIMA 1HK7A 3MC1A 3NTVA 4H3VA 2X0DA 5K4HA 3PC7A 2ZRBA 2QN7A 5KVCA 2SCUA 4X7BA 5LQKA 4D25A 2W71A 4ZJUA 4TSFD 4MP6A 4TXMA 1PYGA 4N5HX 3U0VA 4DA8A 2CSUA 4O6VA 3IKVA 2GWHA 4KWIA 3TSYA 4F5WA 4RVCA 1JH9A 2PD3A 2DERA 2J0EA 3CUKA 1N2CA 2HSJA 3OKPA 1G5TA 1PVDA 1ZCAA 4U7JA 3TQTA 4P80A 5DNVA 2ZB8A 4KAAA 5AR1A 3T94A 2YJ4A 5J4KA 2WJJA 4OYRA 3VZRA 1E1QA 1KQGA 1EK6A 1YQTA 5DBGA 1NXWA 4NYIQ 3TXYA 3LT0A 1XOIA 2VOJA 1Z5ZA 2B8NA 3F9RA 4Z0HO 1CUZA 5EKDA 4AUNA 5C8DA 4FR0A 1AOXA 1NVDA 4I5GA 4DZRA 1II9A 1E18A 3O4FA 4MPRA 3UTDA 5ISMA 5TEVA 2GCIA 4CCYB 4U7DA 3WZ2A 3N5KA 3C0KA 4UBIA 3OJXA 3MQ4A 4YK7A 1BCSA 2B4KA 2Y9MB 2DUNA 4JL6A 2GYVA 3FYUB 1LC0A 1RWVA 3H5IA 3V2IA 4Z7JA 1HFEL 1PZXA 4PBSA 4ZQGA 2WIKA 4OMCA 1SXQA 3E2MA 3L9WA 4KOEC 2O8BB 1JTEA 3A26A 4XJTA 2V96A 4IUBS 2ETVA 3QLJA 5DM4A 4I46A 2WJZB 1KHHA 5JZOA 2VNJA 4W7IA 3R7BA 2H1FA 1E64A 2OT3B 4DLXA 2AFHE 5BVHB 1GGEA 3H8WA 4R0VA 2PUDA 5EXPA 1RVV1 4EY3A 4KBGA 2OBYA 521PA 5TPWA 5T67A 5CCBA 1GT6A 1WOYA 2YWHA 3BPSA 1MRSA 3O8LA 5DE3A 5EZYB 4TVSA 4NCXA 4AZ0A 2OZKA 4AJ9A 5FTWA 4P3OA 5TGTA 3FOFC 4GVPA 4GSLA 4XASA 4LS3A 4HVLA 5JQGB 2GAIA 1DLIA 2Q6OA 5C8XA 3JD3A 4KAXA 2QXUA 1NNSA 3UUGA 4QWWA 1SCIA 3RVLA 2PZFA 3JX9A 2IGBA 4KQ1A 3A58B 2Z5LA 4M7PA 1JX6A 1BDHA 4EMBA 4UFOA 3K8YA 5BWBA 2IX9A 1IY0A 1R5BA 4R8SA 5A5EA 4L9RA 9ABPA 3KJIA 2PZEA 1ZOPA 2RBKA 1WXFA 4HUQA 5HMMA 1ML3A 2HJVA 3TE7A 1PT9A 3ZLBA 2BHLA 4XZ3A 1TQ6A 1E1MA 2H18A 1DL5A 1YB7A 2HK6A 2G3YA 2PWBA 3C7KA 4YCBA 1VYTA 4G8JA 4X0EA 5EP1A 2D3TA 2BE7A 1ZXLA 2ATCA 4OQXA 4OQLA 3KWLA 4WEQA 4MW2A 3A2KA 1KVTA 1UEJA 3GNTA 5ICCA 4ZO4A 1S3IA 5F2NA 2FF7A 1QH8A 3ZV5A 2EP8A 4OMUA 3HRKA 1GA6A 2VDWB 4G1UC 4X8OA 4HSEA 1V7PC 4OUKX 1FMFA 1GPKA 3KSMA 4NYMQ 2Y1OA 1QGOA 5HRAA 1KVRA 5FI0B 5LKRA 2OGUA 2XKBA 4G0XA 3K94A 1I0ZA 4MQLA 1X80A 1KQNA 2JZNA 2VPWA 2W4QA 3WY9A 3LT4A 5CYPA 1T36A 4S1PA 4F45A 2ZJ3A 1Z2PX 1B6GA 2WYIA 3B2EA 3I37X 4H1HA 3V4LA 5JV5A 2R6AA 1PV2A 3TVTA 2D62A 3TTWA 3LKZA 3JVVA 2LUOA 1RP7A 2IV3A 3TMKA 4PVCA 1E6KA 4TKVB 3AF5A 4XE5A 5LMNB 3DXZA 1GYRA 3HVRA 3EEFA 3GGDA 1YIOA 3LY8A 4LYEA 5JNTA 4AMVA 3VSBA 5HNKA 4F3YA 2P69A 4V0KA 4EVRA 2VTBB 1GRCA 4KAJA 5CG1A 4ARZB 3IHWA 4ZCQA 3W3AA 1JG4A 3LXUX 1QHFA 3QTTA 4LOKA 3WDKA 4D3SA 1PDOA 3RVKA 2R8XA 1Z2OX 2PGJA 5IBRA 3PJRA 4GYKA 1C2YA 2NTNA 2J0VA 1OTYA 4RF4A 1F3LA 5IT5A 5DM60 2DFKB 1CFJA 1H1LB 4EPXA 4NEGA 3UZUA 1RCTE 3TRKA 5C7YA 5AESA 3D43A 3WFIA 4YP9A 1EUCA 1CULC 1RE0A 5LXTA 3VKUA 1M2VA 2X1LA 4R2KA 5TY0A 3EPPA 4IHAA 3DCJA 4JENA 3SBXA 2ICAA 3ZJ4A 1EAYA 4X6LA 3W2TA 3W9SA 1MJGM 3T06B 4CZ2A 1WBJB 2CNBA 3BD9A 1ZW6A 2OZEA 3O4JA 3OMWA 1WJGA 3M4YA 4M0LA 4M87A 4ZU3A 4LCEA 3H5AA 4I4LA 4W8HA 4X3PA 1PEAA 4FHFA 4XYBA 2BYTA 5BQXA 3M1AA 1ZUIA 1ADBA 4NJEB 4WL0A 1RXWA 2FR8A 4PRKA 5C5DA 1UM9A 3DD1A 4I5EA 2W2KB 2Z6VA 3UKDA 4BTLA 3UN1A 4ZDIA 3IHTA 3IUYA 4JGGA 4MRMB 4PNZA 2VHYA 2I33A 1U2RA 1QH0A 2FEMA 4Q4HB 3LGAA 1YR3A 2A5GA 2WLSA 1TLLA 3LY7A 3N2LA 4B6FA 2Q5LA 3O3NB 3REGA 2GN0A 4JLBA 5KDDA 1A97A 5A4AA 1PCXA 2RKBA 2C99A 5KTMA 5CIYA 3C3EA 1M3SA 2ZVDA 5E3HA 5EY5B 3BWVA 1ZIDA 1KH2A 5EZSA 3EMVA 3WL8A 3TQHA 3OMXA 2ZRGA 3CTMA 3DVSX 3N8DA 3K1YA 2O19A 4WUVA 3RREA 5J4LA 2XQGA 3F7TA 3QLVC 1EX1A 1UPFA 1BN7A 3GPBA 5HMLA 4YO7A 1DRVA 1WE2A 2GTHA 5GZ1A 1U5AA 1XLWA 5SY6A 1OQAA 4MGZR 1Y9AA 4EYOA 3TDKA 5I4IA 4AUMA 2V3WA 1TEHA 3ZI4A 3CZRA 1OXUA 1E77A 5FBKA 1IN1A 3BXPA 1FS6A 4QDZA 5EP2A 5CLHA 1XZNA 1G60A 2P3SA 3G9XA 4RS4A 1UC5B 2G7MC 3LSYA 1KIFA 1P60A 2Z8XA 3GVHA 1TZMA 5FV7A 1PSDA 3EC2A 1G3UA 4MQUA 3HP4A 2QUIA 1NVWQ 2C8LA 2VH5R 4H6PA 4WOCA 5F3RA 1UKZA 3JALB 4L6CA 3JZFA 3I23A 1BO6A 3DB1A 3MCTA 5JAOA 1XO1A 3O94A 2IU0A 1G9XA 4AYWA 4JC8A 1WQ3A 3DG9A 3ZKWA 2CJXA 2IPAB 4RXUA 1Z4MA 4TS4A 3UT5B 1IZ0A 4MWDA 2FDRA 4AF7A 1WM1A 2QAGA 1RPZA 3WS7A 4RHFA 4MA5A 2WOOA 4R3UC 3QNWA 4KRFA 4XGIA 4CTJA 5HOQA 3HU3A 1YSCA 3EVEA 5TQ0B 3EJWA 4JXZA 5BV7A 1WLSA 5T64A 4GW3A 3DJYA 4V0LA 4C7OA 1GDHA 3L0SA 2IY9A 3Q72A 3THWA 1TM4E 3QEJA 3L4BC 3Q7EA 1PBTA 4FI3C 4B48A 2QY6A 5I9MA 1P33A 4ICIA 1W4AA 4MV4A 2W42A 1DKRA 1JQKA 5IJ9A 3OVMA 2O06A 3D3KA 3DBHB 2J3QA 1EJ2A 2AMJA 1M6HA 3BFXA 2D5CA 3BIOA 4DQXA 4HDSB 2IZOA 1DBSA 4MA4A 5E95A 2UUBB 1D0SA 1T0IA 4Q3CA 2JLVA 4ND4A 1KK2A 3IUMA 3ZG6A 1K66A 3DW1X 1HYGA 1OXTA 3AJAA 1B76A 1ACJA 2Y66A 3N2YA 2ZDHA 4C0JA 3M3DA 3BF8A 3FKSD 4KW7A 4BLSA 2OYCA 1M9NA 1ONSA 1V37A 1E2QA 1ZNWA 4B73A 2ZIGA 2WT9A 2O14A 4GWGA 2F90A 2JATA 1J8QA 4TRJA 3PGA1 3S4YA 2GD6A 4FEEA 4DPKA 1EUDA 4NFYA 4QPJC 4U7GA 1X8XA 1U9YA 1VL1A 3T9DA 2CLHB 4Z0PA 2BEJA 5J1TB 3GGSA 3VPHA 3GV0A 1CRZA 1SZPA 3K70C 1MF7A 4MWTA 4D3XA 4C2TA 5LZ9A 4P22A 4E33A 2WKPA 1QRTA 3ZDAA 3LWZA 1UPXA 2Q1WA 4X85A 1U2DC 1N2HA 1LFDB 1AKUA 4DMHA 1VKHA 2CMHA 4P92A 4EHKA 3PEFA 5EJ7A 1R6DA 5TEWA 5JISA 3A10A 5DCYA 1RI3A 1URPA 1WSWA 4N0EA 2OWDA 4LYGA 4O33A 2GK4A 1MZPA 1UXIA 4FE4A 3RTEA 1X7DA 3N1UA 1J5PA 4Z4CA 5FWYA 1NTRA 3W6OA 2PQ0A 1TTTA 2AB0A 3IEKA 4UQPA 2XEDA 3TR5A 1BGXT 1N0WA 5ALFA 4E4TA 3L5KA 2OB1A 2PZAA 3B20A 3T1VA 2NZYA 2ZEJA 5ALLA 5A06A 2XKKA 1ULUA 2PLFA 3E27A 3EX7C 1AB5A 1QVWA 2ZE7A 4AZ3A 3AW9A 5BW5A 8MHTA 4OQYA 2VI5A 4BPBA 1EXMA 1II8B 5AXAA 5HM8A 5GIPE 3J81A 3CNQS 5A0TA 1Q12A 4GRDA 1IB6A 2XD4A 4EHFA 3KT0A 4ZT5A 2B4AA 2ZULA 1YNSA 1V9SA 1RHRA 3GLHB 2H4XA 5GVRA 2ZREA 4DZTA 4AI6A 2L17A 2D2FA 2YFYA 3PPVA 4BU0A 4EEXA 3BWEA 2GVZC 5K3EA 1P7WA 2ZJFA 3AIKA 3KJHA 5H5JA 4K8OA 4WKPA 3HBJA 1V7QA 2FUNB 2UVQA 2RGBA 3Q5DA 4NYJR 2NNLD 5LZ7A 4OJNA 4X91A 4UFPA 1XCLA 2ECQA 3MPOA 2WP8J 3C1UA 5TPZD 1DAGA 3VPSA 1O0SA 5FNZA 3HQ4O 4K6FA 3P2YA 3ZDFA 1JDBC 1OU0A 3H2IA 5KYXA 3BE6A 1E2KA 1GGFA 2WSSA 2FPRA 4OI4A 5MF6A 1CQIB 4ER5A 4N8EA 4EKNB 5FI1B 4MW5A 2JH3A 2GRJA 2OCXA 2P75A 2PZMA 2QYSA 1T9BA 3EQ9A 4J0FA 5CBKA 5HXAA 2VF4X 1SEVA 3MB8A 5KAMA 5ALGA 1VECA 3AL3A 4ZK6A 5D3MB 5KOHA 3BGIA 5BQFA 3RVOA 2A5LA 2BF4A 2ZBQA 3P9YA 4ND8A 2HWWA 4QXPA 4IUDS 2C0QA 4QTUB 1SU6A 5K8UA 3L1JA 2FEAA 1YZHA 3IUQA 4J0HA 3WBJA 1GUYA 4BWYA 3JQDA 1MJNA 4BRZA 5AKYA 4E5SA 5JNWA 1QRSA 1QHYA 2WJ4A 3DV2A 4U39A 4F5EA 3PTAA 2C4MA 3O26A 2DHCA 3PEYA 5SICE 1P91A 3I53A 4LSZA 4L95C 3D7SA 4PZ9A 3K92A 4FHGA 1XCMA 3TLXA 4AJOA 3FPJA 3P2IA 1IRIA 2WJIA 3G85A 5CXXA 3STYA 3WLOA 4YQZA 1HEYA 3DM5A 3FGPA 3JYOA 4FZRA 1ND5A 5LU8A 1XRQA 4NC9A 3BIFA 1U8UA 4X8HA 1RBQA 2QTVA 4P4SB 2PO5A 1N6HA 1QOPB 3WE7A 4YPFA 2CB9A 1MTZA 3AHCA 3CPSA 1DDGA 4PYRA 2V6JA 3BHJA 4ZQFA 4JXXA 4ZVSA 3DDWA 3Q3JB 4QTTB 1EFVB 4H0FA 3EBPA 2HU2A 1CJMA 5DK4A 1Z18A 4ZCSA 2ZE8A 4XM0A 1VCMA 3CRNA 1U7OA 5PNTA 2O8DB 4D4JA 2XKJE 4ASUA 1A9XB 3OCUA 1CQPA 3TNLA 4QL3A 2I22A 2FR1A 3GDFA 2A0WA 1ZM7A 1QU3A 1YMQA 4RPKA 2HJRA 4DDWA 2B2NA 3IQIX 1F3OA 3U31A 3WLHA 4DSNA 1KKLA 3HKEB 5JTTA 4OFBA 4XTCS 2QI9F 2HT1A 3MELA 1JXMA 1VKRA 2LNDA 1WV0A 2W83A 1OT5A 2LCIA 1Y5RA 3EY4A 3WYDA 3VH3A 1D1TA 2VHQA 1C0LA 3L1UA 3ZJTA 1G20B 4CKWA 3L8ZA 3I2FA 4AROA 4HB4A 2EBWA 2OZLB 1MO3A 3GGPA 4H1TA 4WY2A 5IUKC 4Q7QA 2G1UA 4C4YA 1N8KA 2D8MA 5DLQC 3FLBA 4AMGA 3A6FA 4JOCA 2CCJA 1NC3A 3WWEA 1VHQA 3A04A 3RYCB 3ZVRA 2YH2A 4DIUA 1XD9A 2IPNA 3B1JA 2VAPA 1FX1A 3C3PA 4JU8A 3CUSA 4N7MA 3CS3A 3F7OA 3IUBA 4BAZA 3A05A 5KYYA 3FOEC 3RF7A 2I4TA 1K3UB 1L5WA 3WYFA 2ZPUA 4OHBA 2JLBA 4D3DA 4BNJA 1QJCA 5ILOA 3QXHA 3TQRA 5HEKA 1EIWA 3W5HA 1JNYA 4E21A 1I8TA 1L7MA 1J39A 3M6WA 1CUFA 1ZM4A 2XDAA 2AC2A 4XRRA 1RXCA 4OA8A 4ZYYA 1R6VA 1BAPA 1S2NA 4K40A 3DE1X 5DMXA 1TM5E 1UMCB 2MIIA 2X0RA 3A06A 2XYPA 4GH5A 2AXNA 3K6SA 4O4HB 4YAOA 5CX4A 2WE8A 1NPYA 3GCXA 4FWIB 4LX0A 4BKQA 4EG3A 3IAUA 5JALA 3NUQA 3BTSA 1IK6A 1YL5A 2P4HX 2A0KA 2GYYA 3U4GA 3ELYA 4JFRA 4ZOLF 4GL2A 1KO1A 2QE6A 2YNMA 1ISGA 1T9AA 4H6WA 4A1OA 1T9HA 3ET4A 1LK0A 4MMYB 4YWJA 3T34A 4FHZA 2O5VA 1DJPA 1EGHA 2YRFA 5DGIA 4ZU1X 4A8HA 5KIAA 2P79A 1YJQA 4A0SA 4LY0A 3RARA 4FYYA 4BX8A 4Y6QA 3E7WA 3K9BA 1O95A 2AOXA 4XVRA 1H6DA 1OAAA 5I45A 5CNIA 3PQ2A 3L79A 3W6PA 3ZU4A 5HF9A 3V32A 3VDQA 2FB9A 5AXBA 1XU9A 1NXPA 2AOUB 5IBQA 4EA7A 1YF3A 2Z9BA 3JQGB 4NPAA 1A5SB 5BPFA 3UENA 3N2KA 5AHXA 3OKFA 4CQLA 3ZE1B 3AIIA 5JAZA 1AQUA 1ZO8A 2QL7A 5GV7A 3E15A 1E6WA 3LWBA 3GFRA 4B4VA 3UHFA 1GADO 4TMYA 3NHKA 1T1SA 4C7KA 1UBLS 3MRVA 4DIMA 5KQPA 3CH4B 2QUBA 4KXLA 4JLNA 2X1VA 4WDQA 1KH3A 3A1CA 3C3BA 5EJ6A 1XFAA 4R1NA 3JATA 2YXBA 3NS7A 3PGLA 3TOVA 2P91A 4ETWA 5KYVA 1NQ5A 3MIIA 4TXHA 1ZHHA 2R2GA 3CF0A 2R86A 2BZ0A 1XK7A 4E2WA 2RJ3A 5HF8A 2SKEA 3JQEA 4DW8A 3V4PB 2PFSA 3UK0A 1Z7WA 4OBXA 4UTNA 3CINA 2HA6A 1PT8A 5HZMA 3CNBA 1I1QB 3VGJA 1M0TA 3ZGVA 4OP3A 3W8RA 1YBFA 1RWPA 3TZBA 1EX6A 2BGMA 3Q15C 3PU6A 1XEXB 3QEMB 1JSXA 4K05A 1EVLA 1L4KA 1CS4C 1MEEA 2I80A 1LNQA 2JLCA 1MPTA 5CXUA 1NNUA 4IJVA 3D3QA 1FS4A 1KK0A 1T5BA 4YBZA 2Z2IA 2QEQA 3GQBA 2HNKA 4Y2HA 4UUOA 3V1LA 3C74A 1U7UA 2BSAA 3EZ2A 3IUEA 1Z0AA 3BD6A 2P2NA 3KYBA 4LNUA 4LYYA 4TTJA 1RJ9B 1T3GA 1ZUWA 1LLQA 3QU9A 1JQJC 2DHDA 2OM6A 2PSFA 2V7TA 3EIFA 5LP6B 1QHHA 2Z6AA 4J7XA 4RPCA 1SXIA 5FDFA 2QLNA 2BM0A 2HCFA 5DDIP 5T4HA 1HG0A 5KYWA 5BYBA 3RCBA 4DT1A 2YCBA 3FYHA 4LYHA 2P6NA 4F06A 1PFKA 1GV0A 2JA1A 4EX7A 1VYVA 6REQB 3B8EA 5FULA 2RGAA 3OAAD 3ZDQA 3AETB 4C5BA 1CUDA 1MD9A 3DFFA 4TXNA 3MBIA 4C2AA 1USUA 4X41A 4LVNA 3WWZA 1JFRA 3TJZA 1JA0A 2SKCA 5GAJA 3T4XA 4ALJA 1RHQA 2NXEA 3MTEA 4DV6B 1VHWA 1CY6A 4UTXA 4YCNA 3CZAA 5DNWA 2G77B 1DBIA 3FOCA 3LQRA 3TVDA 1SNYA 2H1OA 1XPUA 1HYEA 2C54A 3SF8A 2IP4A 2ADOA 1B6RA 3Q6NA 1MX1A 2KLBA 2QRQA 2FMUA 1WP9A 4H16A 4BQEA 1OYWA 4PSUA 2V59A 4L27A 5CLGA 4HWGA 2O0JA 1K6MA 4CM3A 5LDHA 1VCNA 1KKUA 1P5ZB 2KHZA 4MGIR 2NV0A 1YNOA 5ALXA 2HIMA 1E5TA 1WXXA 3DZGA 3H5OA 3PDCA 4OH7A 5ER6A 3N58A 5IYZF 1Y48E 1YBHA 1N36B 1XZHA 3DWEX 2WQ6A 3IQGX 2ORVA 4J1QA 2WWIA 1Y3BE 1KA9H 2OLJA 5F21A 4AC9A 4AZSA 1EM8A 3VH1A 5AI8A 3C5EA 3RU9A 3DVQX 5I9NA 5LWQA 3E03A 1U0JA 4XIGS 2EZTA 3ZLVA 2BKEA 4E22A 2J6IA 4OB6A 3ZWPA 1RCFA 1AUPA 3BX1A 5ALUA 3ETNA 3LUGA 4Y2PA 3GJ7A 2C8KA 1N2GA 1CUGA 1MX9A 1W75A 2A94A 3KZXA 3QPWA 4KQJA 4UTPA 1V11A 3KKMA 1T35A 4QBGB 4OX9Y 2A67A 1TGYA 3K6RA 3P9CA 1O9GA 2J4CA 4QYWA 4WZBB 3A4VA 2CL5A 5IFKA 3NOQA 4B4KA 4UOZA 2PU5A 2ZUBA 2W2VA 4S1OA 1KL7A 1GXSA 2I0FA 5GV8A 2RHJA 3ZWCA 3KTFA 5FWXB 2DQKA 1F8YA 3TJRA 4BMPB 2BH9A 1E1YA 2CLEB 1Z07A 1HMPA 2D5LA 5JJLA 1J8VA 2CBZA 3GT7A 4N6OA 2JJYA 3M6XA 3WX0A 3BJEA 2YUTA 3PUXA 4IS2A 5KJ6A 3TAXA 3IDZA 3W2IA 1WEHA 4N8SA 2WQ7A 2CWWA 3TEJA 4B79A 1I3OA 1OE0A 1FTWA 4YJGB 2Y0EA 5IM4F 5JG7A 3ZNQA 1UWCA 1EWQA 5ESXA 1PHRA 4J4HA 3IBYA 3S81A 1DHRA 4QYSA 2P90A 3ETEA 2A33A 3C6QA 4JJKA 1A8PA 4DM7A 1Q0TA 3U60B 1ODSA 2Q29A 4K6CA 4NX2A 1QZXA 1ZJYA 5JNLA 1UXGA 5G0UA 4AJHA 3AB7A 5EYPA 1PBNA 5ADWA 4Z1OA 1T1RA 3VR4H 1C9EA 1ZX1A 1U9ZA 5ENDA 3VR4A 1HE3A 3EVDA 1J06A 4JBGA 4LMPA 2HXGA 1RZRA 1DT3A 3EW9A 3CNLA 2FZGA 1Z63A 2XCIA 3I04A 3C7DB 3KOOA 5EIWA 3WLRA 2O3QA 1J0BA 3NDBB 2J3LA 1FVOA 2IUEA 2QVCA 3KT8A 4HDMB 1PT6A 1Q83A 4NV1A 4RZ3A 1Q3TA 1QOQB 2UZ1B 2BE9A 3BH0A 1SC3A 3C3AA 3OOSA 3VR2A 1RYHA 5ALPA 4NBSA 1LLDA 5SYAA 1F5NA 4OL0A 5AVJA 1XVTA 4L51A 4IWNA 4W1QA 5DM70 3SYRA 3QF4B 1CP2A 1Z6TA 4EATA 2OYRA 5KNCH 1E3IA 4YV0A 1IULA 3WWYA 2BISA 5KNCA 4JD5A 4W5OA 4LZZA 2IP1A 4L3WA 3HXQA 5MGBA 4UVIA 3PR3A 3RIYA 1E9EA 3KEOA 2A78A 3DCIA 2V55B 3RTAA 4RIIA 3EHEA 4QGBA 4DB4A 1Z12A 1YHNA 2ZOSA 3LZ6A 1DTEA 3A4YA 4I6JA 1Z6AA 2EW2A 5JVDA 1NATA 1NJ1A 5DVZA 2Q1UA 3V3KA 3OCZA 2NP7A 5HGJA 1ZESA 2X8BA 5HZHA 1F0PA 1OH7A 4FBLA 1JFFB 2ZSDA 1Z82A 4K1XA 4RGYA 1YR9A 4B33A 1V9CA 1JI3A 4D46A 1H5NA 1R6UA 1Y5MA 2YIMA 4ML3A 4N01A 1P4RA 5E6UB 2A9KA 4JC0A 4LGVA 3AVUA 1PW5A 1ULAA 4WZAE 2G9QA 1RWOA 2QTZA 3PX3A 3QFCA 4MNTA 5IJZA 4E11A 4R71A 1A4IA 3F2VA 5FA5A 4DQDA 1ISRA 1ZIOA 3VYVA 3HFJA 5C37A 3M49A 3SJUA 3HXKA 3DR5A 2CV2A 1CU1A 2QD3A 3QGMA 4QO8A 1EZ1A 3EDQA 4GPD1 4H6VA 1B43A 2F67A 4R1TA 1XVUA 5E0OA 2XOKA 2DH6A 1S5PA 2XQFA 3FRIA 3O9ZA 4JMLA 4BRSA 2TMKA 3ZH2A 2BGKA 4WNAB 3NQ41 3RFVA 1A4RA 3EUAA 1ZGBA 5AI5A 4I1VA 1DZ3A 1IH8A 2HBZA 2K5UA 3MRTA 4YAFA 4FXOA 3BMXA 3ENQA 3GLTA 2FPPA 1KC3A 3G6WA 3GFTA 4I8IA 4M1KA 1KF0A 3LUBA 4QFBA 1PR4A 4YCCA 1DADA 2AN5A 3V8EA 1F6DA 1V1RB 1SG0A 2OGZA 2IE8A 4PPYA 3UJCA 1ADCA 1ZKDA 1OFUA 1R12A 3R76A 3RJTA 3VHXA 1R3DA 2ATEA 4OM7A 5AM3A 3HZRA 1SZDA 1V1MA 2WM2A 2QMUA 1EBUA 4GMXA 1UKAA 2OK8A 2KSQA 5JSQA 3W1EA 3OPNA 3K8QA 4XJVA 4RYLA 2IELA 1B4DA 4KYIB 4DS3A 4FFNA 4XRGA 3ITDA 4J2OA 3PENA 4HN9A 5DTIA 2OOSA 1AKNA 3LWNA 1G0NA 1NBAA 3A11A 3BM5A 3IDOA 5I7OA 1XPRA 3O4IA 3PDWA 1L6RA 1SVWA 3W5DA 2R65A 5DLPA 1Q7BA 3HE3A 4EHHA 1Z7BA 4TQAA 5IARA 4U2GA 3UK2A 2GN8A 1R0KA 4NXMB 1BN6A 3ZHUA 3AXTA 2I3GA 4EHBA 2VH1A 4UUAA 4AN1A 4Q16A 4P8RA 3ZWYA 4EYEA 2O8CB 5AW8A 1P0QA 2E48A 2OV3A 4HEHA 1BXGA 1JFLA 2XODA 3ELUA 3G5TA 1Q74A 3FPBA 3NC4A 3OT4A 1B3RA 4OXIA 5L7TA 4WJZA 1RT9A 3PNYA 4I1PA 1FDUA 3MJCA 3ABSB 3OLVA 3TM4A 4X92A 1I13A 2XMZA 1J20A 3GCGA 1EHYA 3LLMA 4OHZA 2JH8A 1PG5A 1LS1A 4IOMA 4MVJG 4MYUA 4D9IA 5BVGA 3ZNPA 1GAJA 2W2XA 4DQUA 2DY1A 5BOSB 1OZ0A 5LYJF 3R20A 2KE5A 4KN5A 1QZ3A 3WO0A 4QU5A 4GLFA 5L40A 4OGKA 4GVLA 1KOFA 4LRSB 3O8QB 4GEKA 4DCCA 2AX4A 2J7PD 5HF6A 4B3JA 3NHJA 1J7JA 1DOZA 2VYNA 1U8CB 3EEIA 4FYHA 4BNIA 2QVBA 1JGTA 1K89A 5FTMA 3RU7A 3G8AA 2J7KA 1KI3A 3HWX1 3H5LA 1CUUA 1KEKA 3V8PA 3KBOA 4LMBA 1ZUD1 3U44B 1PQYA 4WFIA 5DCUA 1WS6A 2YMMA 2X2OA 1NM5A 4MYRA 1S8AA 4M36A 2HBYA 3EVZA 2C9OA 2X8JA 5DF1A 2PX5A 1H93A 5CLLA 4E5YA 2J0UA 1TCVA 4HRXA 4YAJA 1ZK1A 5EIFA 5GOZA 1CWUA 4AJNA 4XFDA 1PZHA 3LXMA 2DUWA 1Q15A 1WDWB 3A3NA 4DYHA 2W2PA 3ABOB 1XN1A 3JAWA 4LZJA 3RHZA 4BVAA 4FS3A 5DT2A 2CVFA 5C35A 3P1JA 4MUYA 1E8DA 5COQA 1RS0A 1UEIA 3KEFA 2WWYA 3TECE 3K9GA 3DWIA 3NHWA 4Q1DA 3W2FA 4C78A 4PC1A 2AUNA 5LNK6 5ECWA 4JNCA 2OLEA 3G2PA 3OFSA 4FZJA 4BQQA 4G86A 1NLUA 1FYWA 3L4JA 2JW5A 4KQKA 3O7WA 3ZQ4A 4W5NA 2JDID 3CYFA 3F3SA 3SVTA 1V6SA 1PSZA 3TG8A 3RAPR 3I61A 1I4OA 2GJSA 3DXXA 3KLNA 4UASA 3UOGA 1H3FA 4DY4A 2Z56A 3LNTA 1NA5A 1L7XA 1ZICA 2B1QA 2R4TA 2EZ4A 1RIIA 2UAGA 2ZBDA 1A5AB 1RJGA 3L84A 5DTEA 2YIDA 2V5UA 2X7XA 4LJKA 1K4YA 2DH5A 1C0KA 4LOJA 1PSWA 1ODCA 2ARKA 3BTVA 2P9CA 5KKNB 3IMEA 2WUVA 4MKXA 4BTVA 1O87A 2ZVJA 5ALZA 3K9NA 3OWXA 1KPIA 3EXG1 1NQOA 1KYWA 1L6IA 1WV1A 1UCFA 1KRHA 1H5UA 1OGJA 2IQ5A 2X3UA 3AU8A 4DC9A 1Z37A 2QRJA 2R6JA 4MR7B 2Y27A 5D1HA 5FLXA 3F6PA 1AG9A 1XZBA 1Y1PA 1LPPA 1SY7A 1NVVQ 2QPAA 4HH4A 3T38A 2XCOA 3LHSA 3UV3A 2Y3IA 5C53B 4P5DA 1KZHA 2IEAA 5KTRA 3UK1A 1LVUA 3AG6A 3P2JA 1PL0A 2DTDA 3H8SA 3ROPA 2X5JO 3DLCA 5KHAA 4BX9A 2X8LA 3K2IA 1X7XB 3PTLA 5DRYA 3EPRA 2HUPA 4P5PA 2C7OA 4OXYA 1ZJ6A 1M2FA 2VJOA 4O2AF 1RHJA 1FMLA 2QRNA 1T8WA 2XMSA 3LX4A 2ORYA 4YXWD 3L8MA 4QDXA 2PMKA 1L5GB 5KOJA 4ZOAA 4ZMBA 2VXOA 4TN5A 4O3MA 1VKZA 3OWOA 1RHUA 4QIHA 4B3FX 3EXHB 1AIPA 3ROXA 2BJHA 4W9NC 1JHQA 3RWOA 1ZM2A 1TO2E 4HNUA 2GK7A 1W85B 5BNZA 4ME6A 5A3JA 4HC4A 3LQFA 4BMZA 1QGYA 4AMZA 5JCOC 1G21E 1DKNA 1N34B 4I9NA 1ZITA 1SC6A 1X6VA 2ZR9A 3FETA 2H06A 2OMEA 5F2OA 3F8WA 4DLSA 3B6MA 5DI9A 2VSFA 3PX2A 5KX5F 2JHFA 2IU4A 1TC2A 3AIMA 3ROTA 1L4YA 3GH1A 4RVOA 5BVGB 2PQ2A 4F6RB 4ZHQA 3U7FB 3VX3A 1WSBA 3B2QA 3A32A 3DHEA 4YQYA 2JFBA 2HFKA 2XNKA 1DAIA 4KR6A 1E20A 3P9XA 5B30A 5K3AA 4FVTA 1BRTA 3BWCA 3FF1A 1SURA 1CJSA 3MZ0A 2E5WA 3WBBA 1TW3A 2FRDC 2HMAA 1EFLA 4C0XA 1RYEA 3RS7A 3TTUA 4KR7A 1GVHA 1FC0A 4GR5A 5EPEA 4N7RA 3TIIA 2OECA 4NK5A 4BUZA 3JQAD 4RACA 1SVUA 3S5UA 2Q2QA 3UHPA 1DWUA 3GDGA 3ZZ1A 5BMVF 1BH6A 2ZCJA 5B7PA 1L5OA 1X7HA 2N0SA 2Q0QA 2ZRMA 4DUGA 1N0HA 1P1IA 4MUBA 1JV2B 2FG6C 1GCGA 3WJAA 5EKXA 4US1R 1YS7A 1UM8A 3DQPA 3D2LA 4HRYA 3V97A 2F64A 3EXG2 2JI9A 3ODPA 3R9XB 2HHAA 3EDCA 2REBA 3ZXUB 2GBCA 4Q3LA 4AY3A 2B1GA 2F3QA 1UAGA 1XALA 4I81A 3EWAA 2XB8A 1L5ZA 1O4WA 5I3CA 1SBCA 1JR6A 1MVOA 3FDJA 1Z5UA 1NWCA 4HGPA 2N75A 3VTKA 2P4QA 3M83A 1ZBDA 4HXGA 4UVHA 2QX7A 3V1UA 3U7QB 1F60A 5KTTA 5C1PA 4JI8B 2FEXA 5K0LA 4EJ2A 3O5AA 1JMYA 5I7HA 4W9RA 1HDZA 5J47A 1BXKA 5CK4A 4I55A 3B7GA 3MSCA 3SF0A 4PR3A 2QAIA 4WKGA 3SIWA 4MS4A 1Z3IX 3ROKA 3KIPA 1OBVA 3CTPA 2Z8YA 2PBLA 3EZFA 3HJGA 4BP9A 4EY7A 2R4QA 1FU7A 1DTSA 5A62A 2ZGVA 4COKA 4LVUA 2XADA 1VLVA 4PX5A 3HG7A 2IL1A 3S1LA 3RS9A 1KAHA 2IOFK 3DT9A 3UUEA 3UJ8A 3KR9A 4XCVA 4YJHB 3WGHA 4GZ3A 4EGAA 13PKA 1YMUA 3H1EA 1EFDN 5ANRB 1D8TA 3R9WA 3BKXA 3V80A 2OORC 4JVOA 2PX8A 4G4SP 5EE9A 4LJLA 1CZUA 5A6SB 2W4MA 3D7RA 2JJ1D 4LDNA 1EBFA 1UKEA 2H92A 4LTDA 4YYEA 5A04A 2VYFA 4ZVMA 4GI5A 3VOSA 2FEPA 1E7RA 4YI5A 1N0UA 4C4SA 1L5HB 1LVGA 4RLFA 3G0HA 3OP1A 2EJUA 2AT1A 4J29A 1GPMA 3WDSA 5IN5A 2OV4A 4P32A 2Z43A 2HV9A 1FSGA 3UGTA 2OG1A 3W2HA 4CM9A 2WG2A 5I5EA 2Z2JA 1AUXA 3BTUA 3E82A 3OLXA 4TVBA 2Y05A 5J43A 1WDMA 2CNWA 1RD4A 2FSHA 2Q2OA 4MI3A 4KIJA 2PRYA 2W58A 4R84A 2XPCA 1KE2A 2CV1A 5JU6A 2P2GA 2DR0A 1JEQB 4FK8A 3FB4A 2MSLA 5HYVA 1CB7A 1OYVA 4KQXA 4B6RA 4B43A 2J6CA 3QKRA 4BB5A 1AK2A 3RROA 3WGTA 4YEDA 5JPCA 2PS9A 3ER8A 4E70A 3KCNA 3E1SA 3PDIA 2FMHA 1VPDA 3LNCA 4JL5A 4LEIA 1DDIA 2H7CA 5IC4A 5L6LB 3N0XA 1E1RD 3HJFA 1YRHA 3DE4X 2RGRA 4JODA 1G17A 4RVGA 2Q2NA 2X22A 3PE6A 1XWWA 2PQMA 2VHEA 4NU0A 3HCBA 1GNPA 4QPCA 4S35A 3E22B 4Q6BA 2LPMA 2CW5A 5CFMA 5ALJA 3TKYA 3D6UA 4I0WB 5F1PA 4LXTA 3LM8A 2MSEB 3K8OE 1Y6FA 1VSTA 4MCJA 5HK8A 3EZNA 1ADYA 4JLSA 3O1HB 2NG1A 3BCHA 4G1BA 3VTFA 4BP3A 4BEVA 2WJHA 2I2AA 4D6YA 4CE6A 1QQAA 2ZIXB 3VQTA 1KWGA 1KWKA 4B0PA 4MJXA 4B9EA 1YFJA 5JEEA 5IU6A 3CUWA 1A82A 1BDJA 3A2LA 5JSFA 3NTRA 1GLVA 1MU0A 5ES3A 4NCBA 4TLMB 2WUDA 4FINA 4FPXA 1B14A 2CNDA 3K16A 1EFKA 4D8UA 4ZYWA 3WRWA 3GMTA 4JJ6A 2AN9A 5E3IA 3VSEA 2X3FA 4IIJA 5EG5A 2Z2YA 2GXQA 4EARA 1GZVA 1ZNYA 4JQCA 4ALKA 2Q3JA 3ND7A 4FKBA 4EF6A 3H7IA 3STHA 3IVAA 4CNBA 3NGLA 4PHTA 1ULZA 1GKKA 2PS3A 3EZYA 2BR3A 1DO0A 4MRAA 5EHNA 5B3AA 3VO9A 2QNBA 3VU0A 5DLYA 3K0SA 2XQIA 4R7GA 1TUGA 3ZBTA 3GD7A 1H0HA 5T57A 3UMSA 3B6IA 2EC5A 4D6PA 3WGMA 4CFZA 3WYEA 1GN9A 3ZD7A 3B48A 3HGTA 4PLGA 3AI7A 5C4IA 3BGOS 3VBEA 1GRNA 3FSJX 2DG2A 3G7SA 2OESA 1GQQA 3RVDA 3ZC3A 2LTAA 3GLQA 4OHMA 4YT2A 1RZ3A 1IQUA 1BWPA 2NTEA 121PA 3CE6A 4CMIA 2V3CC 2OQRA 3BSYA 3N39C 3OHMA 2O0LA 1N6OA 3MUFA 2HLDA 3RYHA 3JWPA 4ZVQA 4K9SA 1ZMBA 2ZSKA 4A6EA 4QOIA 2YBDA 3FW1A 3H16A 1F14A 4DMCA 5JH7F 2J9YB 2JARA 1HE2A 3TAUA 2HW8A 4IFBA 4JU9A 5TE9A 2D1TA 1RAHA 4OLBA 2AYXA 1LPNA 4DAEA 1TDJA 2XHZA 4DIOA 1EXVA 1N57A 1E94E 2J07A 4LZPA 4NABA 1WCIB 5CD9A 1R6BX 3NU1A 1OAOC 1Z73A 4DC0A 4EPVA 1ZVVA 3DTVB 4TTIA 2J67A 4MW6A 1ZNQO 1EWTA 5ENVA 4WCVA 1U2GC 2EEZA 3VGPA 1NJ5A 1Z5GA 5FBLB 4QLAA 4KPEC 2XZLA 4KQ6A 3WRXC 4E6EA 1DQSA 5FNVF 1ONNA 5AVYA 1JAIA 1B93A 3GRKA 2PVPA 2VN8A 5A05A 3R8XA 4E32A 2WG1A 2VAXA 3JWGA 4KDFA 1MO6A 4UVDA 5TS3A 4MQBA 1N2BA 1IOZA 5K3CA 1B0ZA 4BLVA 3RC1A 3HGQA 2R84A 1ZIPA 1KO4A 1RJDA 4BFSA 4KZPA 3WMWA 1M2OB 2P6UA 2BELA 2CDCA 1VLJA 1Z56C 3DEIA 4FU0A 2ATVA 1YHZA 4Y9UA 1XNJA 2X14A 3BA1A 2VJMB 1X74A 1EGAA 3DEKA 4POAA 2PL9A 3JAMA 4M0PA 4G4SO 4JJAA 2H63A 3RC9A 3H9CA 3I9V1 3ZOZA 1H9AA 4UD6A 4IOKA 3U62A 3BCSA 4CF6A 2BGUA 3B6ZA 2CF5A 3EZXA 5DRTA 2QLMA 3MUOA 3RSQA 3I76A 1FP4B 1U1EA 4IMRA 4ZEXA 3U2QA 2KX7A 4BNHA 2DWOA 2QYHA 3ETLA 4C89A 1I4TD 1U7PA 3G1WA 3GUZA 3VSAA 1MO5A 1NR5A 2P68A 4D2IA 1HDCA 3AR2A 2WTXA 3CCFA 1BA2A 4EG8A 5CDSA 3BIJA 5TLSA 3ZDYB 1U8AA 3PHIA 1AMUA 3CLSD 3IBCA 2WT8A 4G5OA 4MARA 2RB5A 1U6IA 1J07A 1O7JA 4JQZA 1TQ2A 1GYQA 2D7CA 2VT6A 5ECDA 5G0WA 3AM4A 3IAS6 4IV5A 4FI3F 4RZIA 3CGGA 4ZTZB 2UZ0A 3HY6A 4Y18A 1FNDA 4TV9A 1NFRA 3CO5A 4KRGA 4KYUA 1DEAA 4LVCA 3IV9A 1P2FA 4TOIA 4LSWA 3FLEA 5FR2A 4EP1A 1BGWA 4LDJA 4MGHA 3G2MA 3EXEA 3OTGA 5FR1A 2PX6A 1M8KA 3F8TA 2UUPA 4CUKA 5K3OA 3BHIA 3PEWA 1YAHA 2ZUSA 3PFNA 3R44A 1KK1A 4NS1A 3UFXA 2XW6A 4HUTA 3R9IA 2ODNA 2PL3A 2CJWA 2Q9UA 4TYPA 4EA9A 1M34E 3KOYA 3IULA 1TJYA 1G42A 4CV2A 1PLJA 4FC7A 1T8RA 4OUDB 5KVVA 4DUPA 4KR2A 2C83A 3REQB 2FQXA 2IXAA 4QGHA 3FTPA 1YB1A 1N75A 5E9AA 1P0CA 3RLFA 1JAYA 3V8MA 3DFUA 1NVEA 1JG2A 1Q16A 4FR5A 4EUEA 1GGNA 1QAQA 1ULHA 4TKZA 3AUUA 2PRJA 1CZKA 1XJCA 3NC0C 5JSZA 1IONA 2OMKA 2HKIA 3H17A 5FUMA 2I3AA 5DWVA 1P5FA 1DRWA 1XEFA 2BFEB 1J5XA 3ACCA 1CRQA 3DO8A 1U2TA 4QBTA 3ISJA 3S1AA 1KRXA 5C32A 4XEUA 1N78A 4Q1VA 5CVEA 2QM0A 3RK0A 3UH1A 4CMEC 3T95A 2IIPA 5D6NA 4ZXPA 1PWZA 3X0DA 4CQMA 4QASA 4WBNA 1LZLA 3QXXA 2ZDQA 3SEFA 1HEIA 1UXOA 1UOQA 2XYRA 2YHSA 4HLUA 4L7VA 4LJ7A 2Q9AA 3ZGXA 2HX1A 4FWBA 4PNPA 1DVRA 3EVCA 2ERXA 2P78A 4H4DA 4Y1RB 3SN6A 1C1DA 1UJMA 1XF9A 2LR0A 3RTBA 3WQRA 2R4UA 4JVSB 4TYQA 3SXUB 3BRWA 3U1BA 2ZBGA 3B3JA 1C3XA 3GMIA 4YV2A 4OTZA 2R87A 5DV9A 2M6KA 5FH9A 3C6ZA 5L95A 3N7TA 2PFGA 2JD2A 3EZLA 2GD1O 5EHIA 1Z2AA 3BDAA 2LV8A 4ZP1A 5EHGA 4M0KA 4Z54A 1I30A 4TRMA 1E3DA 3CX8A 3PVZA 2D2VA 2V7EA 2IYLD 4MOWA 4PGGA 4PZEA 4UU1A 1KMMA 3WHPA 1XGKA 4M1WA 3AF2A 4N54A 4O29A 3TRDA 2AKEA 1YS1X 3A7DA 1CQZA 2QP9X 3KEMA 2JL1A 4C3OB 1XHEA 3IR5A 3L7YA 4FJ0A 1KPGA 4Q03A 5HQJA 3ZH9B 4L5IA 2PPVA 4YDQA 3FFTA 4OK3A 3WLTA 1CEYA 3FFAA 5IYZB 3EPLA 3EGWA 2HGZA 1EP9A 2NUPA 4W5JA 4HI0E 4G84A 4H7PA 2WM8A 4DBZA 1C50A 1EAMA 1B7GO 2RHCA 3HYNA 4MYTA 4PGMA 4ZQIA 1NC1A 1BXRB 1US8B 2Q3HA 2KYRA 3OQ1A 2NV6A 2C82A 3Q0IA 4RZSA 3PVCA 4YJ3F 1CEXA 1ZMOA 3MOGA 1JLKA 3H5NA 3JRXA 1FDSA 5G02A 5JBIA 1ZUNA 4MKFA 2ZRFA 3EDMA 1DBPA 1VBKA 2WWVD 2Z1DA 1QV9A 1NZDA 5FXMA 4RH0A 4EOGA 3CPEA 1VE9A 1JDPA 3UPTA 3AF0A 4BN0A 4OIMA 4ZCLA 2WY2D 1R0LA 4OQZA 1QBKC 3OZTA 4HN2A 3L7KA 4CV3A 1U8TA 2YFHA 2R9VA 2H85A 2HMYB 4OBWA 1MVLA 4CF4A 5JYCA 2B6HA 5EJGA 1TJ4A 1J09A 3OX2A 3V1YA 3KEGA 3DAGA 2QRLA 1X7GA 5K99A 3T35A 1AUOA 4KSCA 2FSGA 4UBNA 4BASA 1W88A 3WIVA 3JPWA 4EZEA 4ZCIA 5L3SA 2C2XA 3A3KA 4EJ6A 4US2R 2ID4A 5I9LA 1U90A 2FETA 1T4BA 1BQ4A 1UIMA 4H18A 2AH5A 5T5QA 2JFXA 2V6BA 1XLTC 3DO6A 1DWPA 1WXEA 5FLYA 2QSYA 3BHMA 2QIPA 4UM5A 5C1DA 4CEHB 4KHPB 2DPYA 2WWXA 4UHFA 3TKLA 4B17A 4R31A 2QXYA 1XNGA 3UV6A 3CZ9A 4CLRB 3CC8A 2HIHA 3KR0A 1X38A 3S2YA 4REQB 4TLDA 4GXRA 4RK7A 3L49A 5L3RA 4E51A 1DS6A 3CO0S 1N1GA 1W48A 2M6LA 1J49A 1P7PA 3WGIA 4IVQA 3DDNA 1QQ6A 3NWPA 4HDAA 2EHJA 9LDBA 3V8VA 4HTAA 1KI6B 3OX1A 4E3WA 3CURA 1IY9A 1KEUA 2XXAB 4PYLA 1Q57A 1SD1A 4CM8A 4Q4AB 1IXZA 3GJYA 3K9FC 4C76A 1OAKA 1UJCA 1YI0A 2IDZA 2IBMA 2VJYA 3PC6A 1DC7A 4JR2A 2XLBA 1B8UA 4WKCA 1GLGA 3TGLA 3HKBB 1WQ4A 5KVQA 3SQXA 1C9MA 5JCJD 1AKVA 2YJGA 1XR3A 4HQRA 1QONA 2W6NA 3RU2A 1SUEA 1P3DA 1N9GB 5BRNA 4J7CA 2O8EB 4UBKA 2ECKA 3EA0A 2Y4OA 3MGBA 4F46A 5GADl 4DUYB 1UOPA 4PSDA 3LHKA 3Q9UA 5TDHA 1ONOA 1X1RA 1ZL0A 2NSHA 3B85A 3ESCA 2AFIE 3OURA 1HYBA 1FX0A 4MQMA 4EX6A 4TYYA 1QB8A 2I6FA 4GLJA 3HJNA 3CY6A 1CQJA 4G5SA 3TGWA 3RSSA 5E8RA 3X43A 4NCJA 1QQ5A 3GFSA 3STUA 4BQNA 4YT8A 4MQFB 3LUPA 4OP1A 1O2DA 3A6KA 4XQ0A 1X1AA 2OBLA 1EEXB 3EFOB 3H13A 5HIJA 5BQ5A 4C07A 5EQFA 3MFYA 1L8LA 1YI8A 4H59A 4A15A 3NM4A 2HWYA 2XUHA 4C6HA 1WPRA 3GLFE 3SC2A 2Z04A 4NWIA 5FLEX 1ESZA 3LXRA 4CM4A 4GYYA 4BFCA 2RKWA 3CNNA 4IJKA 2VRWA 1O94D 3HFRA 1EFAA 3BGSA 1NN1A 1VYUA 3OCJA 1GU7A 3BWYA 1AQLA 3EXIB 4J4TA 3AEZA 3HNRA 2I62A 4R3NA 4W8OA 1UEXC 2E82A 4BWGA 3D64A 4CKCA 3RVPA 4F2GA 2RIRA 4GFDA 2I3ZA 2P67A 4R68A 2H4WA 3DVLA 4BFXA 1U9IC 2RCNA 3U19A 4ZANA 5A2QA 4JZKA 3FHLA 2HQRA 2R00A 3D0KA 3DF7A 2CXTA 3R0XA 5AW1A 1EUYA 1P9NA 2FP3A 2BLNA 1NBMA 2FOIA 2VLBA 3E7FA 3O4RA 5C1IA 2NMVA 3GP5A 4FDTA 1YZTA 4I1YA 3NRCA 2LW7A 5H3HA 4BBAA 2JGRA 2I5PO 2QLJA 3U61B 5HCNA 4OJQA 2VAMA 4EIWA 1I36A 4R05A 3UC9A 3PWKA 3V2UA 2IDKA 1JQEA 2X9NA 2BTEA 2XOEA 1JEDA 1GV1A 1U9JA 5LB2A 4OAQA 3TBHA 3TFOA 3UW1A 2PUBA 1BHSA 3H7AA 4YUWA 2WA2A 1N5DA 2WIJA 1SXJB 1UZNA 5EINA 1N2CB 5HWSA 5A5FA 3TUJC 2DM6A 3AW8A 2VT7A 1EINA 3IX7A 2HXSA 4PTLA 1FTGA 3L7CA 4PLHA 4ZCTA 2AWNA 3LU1A 1S2MA 3H9GA 4XLTA 4BO9A 1FYEA 1M7GA 4I5IA 4RE6A 1JEOA 3G9QA 1A9TA 2BGIA 2PMEA 2X3YA 4LY6A 4A8TA 3A1FA 1RC8A 2DXIA 5BSUA 2B0CA 4FYVA 4KFSA 1JECA 2QOEA 2A0XA 4K5QA 4EKYA 4GPZA 1OR8A 1XZDA 3KVRA 1DC3A 3AUXA 1EFRA 3WDLA 2X9GA 1HI9A 2C9ZA 2JH9A 2LDXA 3IBFA 4GXQA 1JLMA 1PP4A 2SHKA 1EE2A 2RCYA 2WK1A 1IHDA 4FDMA 4L3VA 3U3JA 2XSZA 3DLPX 4LJRA 1FDRA 5K8LA 3QBJA 1IOWA 1M8PA 1QLWA 2I2BA 2FH5B 1KY3A 2B2CA 3LDHA 1KYYA 4UNNA 4PZ0A 1G63A 5G4KB 3VZPA 4M98A 1E69A 2Y9PB 1NF8A 1SFRA 2H00A 4K46A 5F35A 1C9NA 1UK8A 3CW9A 3QUQA 1LW6E 3G13A 4BBJA 1ZVMA 3R9KA 3SC3A 2Z2XA 4RO0A 1U0GA 1EWRA 3DNPA 4C3ZA 4QGSA 3PJDA 3WHLA 5DHTA 3WXMA 3RV3A 2OHXA 4JLPA 4JP2A 3N2GB 3L77A 3BH7A 4HB0A 5JOQA 3T8YA 3S29A 4KUHA 3LLUA 1CRPA 1Q21A 3D4OA 3KVOA 2EDAA 4LWZA 2ZSEA 5LYJB 4A23A 4BU1A 2C5HA 2V7WA 1HYHA 4CV1A 5BRJA 3FHTA 3K9HA 3T0FA 1E3MA 3JD1A 5IULC 1I7LA 3RS0A 2IS4A 4MR9B 3VC3A 4ISBA 1DIHA 1U11A 4CU5A 3OPMA 2ZJAA 2CHUA 1RC0A 1AUVA 3RODA 1IQRA 1IPEA 2AR7A 4EAAA 2BL4A 4YUYA 4KK3A 3TW4A 2O8NA 2Z2KA 3BWDD 5AVOA 1C4XA 3OCVA 2XMBA 4BNYA 3UB2A 3ESAA 1BCRB 5COBA 5H4GA 2V7BA 2O2GA 3CLSC 3B3QA 2O50A 3EG5A 4KO4S 4EVSA 3I9OA 4B5LA 5F5NA 3MGCA 4FBGA 3QI7A 1UPAA 1XTRA 2VCYA 1BVYF 4KQMA 2FK8A 3JZDA 3UAOA 3O4VA 1LQ2A 2FF5A 3WK6A 4OLAA 2FKNA 5F7ZA 2IE0A 2H11A 1M1NB 2ZYIA 5T7BA 4REQA 2C3UA 1E62A 4WD3A 1X80B 1OLXA 3K5PA 3R3XA 5CDHA 1ZCJA 2W00A 2BEWA 3WSWA 2YVKA 4YMTA 3DFZA 4F12A 1C8KA 4KMMA 5LZ4A 1NIJA 5AW5A 3L7JA 3TZEA 2UYQA 1GTZA 1U99A 3MBKA 5ITWA 3CH6A 4J07A 2PO7A 3GMDA 2QL5A 1L3BA 3BB1A 3U17A 3GLIB 2E4VA 2QE7A 2Q5OA 3H1AA 2V45A 3B13B 1G8FA 1PFWA 2DPLA 1FXUA 1H6BA 1W8DA 2C07A 1HBJA 2IF2A 2KWIA 3FBWA 4JHXA 3D6VA 3RBXA 4FSXA 2W6CX 3R3UA 2CMKA 3AQIA 1UK7A 3HCPA 3D0OA 4XDZA 4CG2A 4NHOA 1MX5A 1DCTA 1KVQA 3FCYA 3MBOA 1EVZA 4A0FA 2AI3A 3S2FA 1KFEB 2GZRA 4X7MA 2QRVB 3B12A 1IEWA 4HJRA 4U3JA 1HDIA 3ZWVA 2PKYX 4BFTA 4WUTA 2OE2A 5ELMA 3NOXA 4UBLA 4ECEA 2BUAA 3ND6A 4ENWA 4MEBA 2K7FA 3FVWA 1OASA 1V3TA 3Q0TA 2JI6A 1WXHA 5EGSA 3FNHA 4R1SA 1YDGA 3WLEA 3NWJA 3ERCA 5AKIA 4BQRA 4YMWA 2IU6A 4ERNA 1W34A 1B23P 1X7ZB 1O6CA 1R15A 1PR9A 3BFKA 4X66B 3HYRA 4AJKA 3OA0A 5BV8A 4O4LF 3R7NA 2D5IA 3OLCX 1ZQ9A 3NYQA 1GNRA 5LZ8A 4BQSA 821PA 5MN4A 1YA6A 1Y9DA 1RYDA 2GF9A 5GZ3A 2H1HA 4O2AB 2L19A 1S9HA 3L7NA 3PK0A 5K3FA 4B34A 2J0QA 3H4IA 1UXHA 1K2WA 2F43A 3JQ9C 4LAFA 1C4OA 3X2SA 4D97A 2PEYA 3AEXA 2H5EA 3GRUA 4KK4A 4EITA 4LV6A 2PUTA 4PINA 2P3QA 3PNOA 4IR7A 1V2HE 1ZMTA 1XRPA 5DU2A 1TZ2A 2HEGA 1EPUA 3V4ZA 3NXSA 3S2ZA 2H4FA 2ZUCA 1QANA 3EEOA 2WFLA 1TU0A 5BSVA 4KJXA 1EESA 2X8AA 3AUKA 3J7TA 1I3KA 2ZSJA 4BEJA 1GD1O 2PXXA 2AS0A 2F3SA 2AZMA 1SHTX 2OY0A 3LUKA 2O3SA 3G8DA 4UTOA 2OO5A 4V0RA 1YZ3A 1Y7LA 4QWMA 1Z4QA 7ADHA 4GVXA 4JB8A 5EMNA 1X94A 1PO7A 2J48A 4K88A 4BC0A 3TR6A 4Z5XA 4HWKA 1IHXA 3E4CA 1TKBA 2R1UA 4NH4A 4QECA 3ROZA 2JAHA 1W93A 3ILSA 5KX5B 4HX9A 3PC2A 4F3NA 7GPBA 4HWPA 1WPXA 2JHAA 2ACWA 3OZ7A 4NU8X 2Y1FA 1Q0PA 1N1EA 3DPSA 3CVOA 3PSAA 4Y6RA 4ZKEA 3EZ6A 2H4ZA 4W6QA 3VRHA 4X64B 3ZQUA 4P4LA 3D7LA 2QTTA 4PYJA 1C7EA 3JWJA 4MIOA 2X2FA 3E3LA 3JQPA 2HJ9A 5FBWB 1IHPA 5HUHA 2JI8A 2DHRA 5LA6F 4JLDA 4UAUA 2OGWA 3IOMA 3Q9NA 1NMEA 1T0BA 1IN6A 3EYAA 3URKA 3FTFA 2NO7A 4TV8A 3TPZA 4S3MA 2AJCA 3HB1A 5BMVB 3FGNA 3OOYA 4J43A 1Z6ZA 3A3YA 1IM2A 1MLDA 3WA6A 1Z74A 4CW7A 4N1AA 5D85A 2PGIA 1H2RS 3TOCA 1F06A 1H2WA 3ZKWB 1XMVA 1P19A 1I4LD 4H60A 5H8WA 1AMOA 1JIVA 4AO7A 4HYQA 1PFVA 5JATA 3KG2A 2IYUA 4BDSA 2AG8A 4CT5A 3GG2A 3TWOA 1VE3A 5LQNA 1Q7GA 3MCAA 1NBIA 1YT5A 2PZ8A 3SNHA 1ZVQA 2H2DA 3WADA 3NTLA 1FZQA 1KY2A 1YJCA 1CR0A 2GCEA 1XCOA 3AFHA 4W4TA 3VYTB 3DE6X 2ODEA 2IKSA 4HDRB 4JN6B 4UNQA 4ALLA 3NALA 1O8CA 3QIVA 1K3FA 4G5RA 3NWOA 2D4HA 1TIKA 3OEHD 3OQMA 3H3FA 5GOTA 1P6UA 1T3LA 3F5FA 2YXPX 4FOTA 4AW9A 4BX2A 3SSOA 4GLLA 3F3MA 4QD3A 4GKKB 4N48A 1U94A 3O74A 3RIMA 4NATA 1U3VA 2VHUA 5E1OA 1L5FA 1HTBA 1HSZA 4PX9A 1VPWA 2CDAA 4N49A 3PRJA 2WPDD 5TVGA 1H3EA 2G25A 4XX0A 3K1JA 4LY9A 4EUNA 4X8MA 3X1ZA 1RFLA 4EHIA 3MWDA 5IJWA 5KTNA 2ZSBA 3JVEA 4KAFA 2PD6A 1N1MA 2WE7A 1LKZA 2WWFA 3QEKA 4X45A 4E1AA 3HO1A 2V9ZA 2CB0A 4L3OA 2FEKA 2VPXA 5D5PA 1N32B 1RIFA 1J21A 3OQOA 3TJMA 1TMGE 1ZONA 5BSRA 3EIQA 1NUUA 1EUDB 3R7WA 3TD2A 3KSAC 1WCWA 4C5CA 1MAUA 1JAZA 1EFTA 1GEEA 2PCJA 1KFBB 2W48A 4CG3A 5C18A 3OZUA 1KEWA 3ZQKA 2VTEA 4OX9B 1RRCA 2V6GA 5HQ3B 2BKXA 3O8OA 3BDVA 2CZQA 3HFGA 2OFPA 1X1SA 3K1TA 3KJXA 3O73A 4WDRA 4W7HA 2ESRA 3W8EA 4EK9A 3UMCA 2VEOA 2YN2A 4KPFC 2A14A 1CJTC 2HJHA 4Y2TA 1GITA 3L0DA 5E7IA 2XMCA 1QR2A 1LBSA 1OKKA 5FOTA 1Y63A 2IYPA 3VOTA 4DWWA 5BW6B 5KTPA 2WEKA 2WIAA 1HNXB 5A9SB 1O08A 3I6IA 3G0CA 1V0JA 3WFZA 2YZGA 3Q7TA 4F6CA 3KJEA 5KNLA 1RI2A 4KC0A 3CR3C 3OQHA 3HKCB 1YL7A 1O94C 4I5DA 1KAMA 3ACDA 3N07A 1FBTA 3PFCA 4MVYA 5CJ2A 5LKAA 1JJ7A 4Z3DA 2HO5A 2XRFA 4KIWA 3BK7A 5D6OA 4H17A 1AHHA 3JZMA 1YTLA 5DSZA 1OB5A 1YDWA 2ZXUA 2GESA 4B81A 2JIZD 4J16C 4UE6A 4PWZA 4TL6A 2WYUA 2YS7A 4B7AA 3NVDA 4BQPA 4FLEA 4YWHA 1GR0A 2B7CA 2WSMA 2RGWA 3CB4A 2Q8QA 4DILA 3ANYB 3WLAA 1OBHA 1IBSA 1BVUA 1V41E 4M7RA 4F56A 4M1ZA 2YS6A 3O03A 1QRDA 4FMBB 2FCAA 4PCLA 4PZYA 3P94A 4EMTA 5CFPA 1SQ6A 4N9QA 5JSUA 3E9RA 2J09A 4WFKA 1YOVA 2G63A 1M1YB 2QUJA 5DBEX 5KTKA 3NM6B 4GGMX 2JFNA 4E30A 5F78A 4P2BA 3QUTA 2IY8A 5ELLA 1Z68A 3ZDEA 2C7GA 1F4LA 3RQIA 2K87A 3GHHA 5AO9A 5E7QA 1JHYA 4M0CA 1GHTA 2P9YA 4HFMA 4HV4A 4L5JA 2QIOA 5A3VA 1OB2A 1NNI1 1EXWA 5C81A 4XIYA 4X1YB 4B8YA 2VAVA 4JIMA 2RMKA 3O3OB 4J03A 4RADA 2HA3A 1X7WA 2BEVB 2H51A 3LFTA 2FPOA 3GAFA 2FW9A 3OT1B 4FEAA 3VVMA 5IT0A 3SR3A 3T61A 3R3HA 3IKMB 1EJ6A 1SC4A 2PX3A 1SUIA 3DFIA 4K8RB 5JAQA 1AO0A 4NCNA 2MINB 3WGKA 4DLVA 1YZGA 4ENUA 3IAM1 4JLJA 1SCUA 1PQPA 4PTYA 5J2UF 2DR3A 5HCUA 4EAQA 1P7YA 3FZNA 2PH5A 3OZGA 2GETA 2RGEA 4R9SA 1ZRHA 4X3OA 5JH7B 3ZZTA 1JHDA 1NI4B 1GKUB 1NW9B 4P4GA 2MCFA 1HZZC 5JC1A 5KU1A 1XNQB 3KHTA 3QVLA 1S8FA 2PYIA 4AYXA 4EJSA 2VCEA 2RC6A 2HSDA 1OV6A 1BIFA 3AERA 2B2XA 4NYIR 5CT5A 4BQOA 4H7KA 1ZVKA 5AKEA 1NXXA 3MGAA 2HM7A 4L2IA 4G0ZA 3EB9A 3RTCA 4OXKA 3FNGA 2ZBRA 3KTDA 3LMKA 4RU1A 3PXAA 3SQNA 5KI6A 3SX2A 2P8JA 4KREA 4ETMA 4OG2A 1P18A 5CDFA 3I62A 2BGGA 3N6XA 5EMJA 1O5IA 6ABPA 4O2RA 5H7XA 2PX2A 5ALRA 4YRJA 2G1JA 2R1TA 2VJCA 3WGGA 1FUEA