2COKA

Solution structure of brct domain of poly(adp-ribose) polymerase-1
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
113
structure length
113
Chain Sequence
GSSGSSGDKPLSNMKILTLGKLSRNKDEVKAMIEKLGGKLTGTANKASLCISTKKEVEKMNKKMEEVKEANIRVVSEDFLQDVSASTKSLQELFLAHILSSWGAEVKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Poly [ADP-ribose] polymerase-1
publication title Solution structure of BRCT domain of poly(ADP-ribose) polymerase-1
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 21
structure length 113
sequence length 113
ec nomenclature ec 2.4.2.30: NAD(+) ADP-ribosyltransferase.
pdb deposition date 2005-05-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.10190 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold BRCT domain 2cokA00
3EF0A 2LE0A 4Y2GA 4N40A 3AL3A 4ID3A 2M2IA 4OFBA 3PXBA 2HTFA 3PC8C 1T2VA 3PC7A 2WT8A 2K7FA 3L40A 3I0MA 4XPZA 3HUFA 3SHTA 2JW5A 2AZMA 3PXEA 2COKA 4IGKA 3PD7A 3L46A 1Z56C 2NTEA 3SQDA 3I0NA 2DUNA 1WF6A 3L41A 2EP8A 3FA2A 2EBUA 1T29A 2XNKA 3QVGB 1JNXX 1IN1A 1OQAA 2VXCA 3PXAA 2R1ZA 3QVGA 2INGX 3PC8A 3PXDA 3K15A 4BMDA 2COEA 1IMOA 2COUA 2XNHA 3K16A 2D8MA 4XQ0A 3KTFA 3EF1A 2L42A 3JVEA 1KZYC 4JLUA 4IFIA 3SHVA 3II6X 2E2WA 3PC6A 3OLCX 3SZMA 5ECGC 2ETXA 1Y98A 3COJA 4BMCA 4BU0A 2VXBA 3T7KA 3T7IA 1N5OX 3T1NA 3UENA 4Y18A 4U4AA 3PXCX 1GZHB 3K05A 1T15A 2EBWA 1T2UA 3T7JA 2ADOA 2K6GA 1L0BA 3U3ZA 3AL2A 3K0HA 1CDZA 3K0KA 3PA6A 3HUEA 1L7BA 3UEOA 4BU1A
chains in the Genus database with same CATH superfamily
3MCTA 3A1VA 3ASUA 3AHDA 1DI0A 5HE9A 3RREA 4A1FA 3SQXA 3B3AA 3F71A 3JD4A 1CY4A 3G02A 5B1SA 4Z3DA 2HHAA 1JECA 3FMGA 1UPAA 4YRDA 3TAUA 1FUUA 3R9XB 4NL4H 1NRIA 1WCWA 2QM3A 3ZE9A 4GKVA 4FHZA 3SEAA 1SXJA 4QM7A 2F1JA 5EUMA 1H1TA 1OD6A 4V3CA 2F8SA 4JEMA 2XSZA 4K8OA 2JANA 5JSKA 2R4QA 1WW2A 4WUTA 5A7FA 5JCZA 1E3LA 2J7KA 3NYWA 2PL3A 2YHAA 3KKMA 3SWWA 2VSXA 1T2EA 2CCKA 2V8BA 3GA7A 1Z0AA 1T9CA 2QN7A 1F38A 2QUBA 5DHAA 2PO5A 4UCWA 3MJRA 2P91A 2C59A 4KQKA 2DEUA 2J0SA 3QG5A 1X9IA 4C7XA 2JGDB 3ZH9B 1Q92A 2OHVA 2V03A 4HEA1 4IFBA 5IC4A 3T1HB 3I2YX 1CJBA 1ISHA 3AR9A 7MDHA 4AICA 3A6PC 1OASA 2WI8A 5EC8A 5GY7A 4OL0A 4ARIA 3BZUA 3BXHA 1YGYA 4Y2SA 3NNNA 3QJ5A 4MVWA 1NXPA 5LD2C 4FOSA 4QTTB 3AUFA 2OUIA 4AJ1A 5HRCA 4N0EA 3B3JA 3LVQE 4W63A 2CFIA 2IC5A 3WKCA 4KXFB 4CL2A 3IESA 1JIQA 4DMHA 4BTEA 2O5VA 3LUBA 1ZNWA 4HLUC 2M1XA 1E32A 1AKYA 1H8EA 1J8YF 4DYHA 2JFWA 3JCZA 3CWCA 4J4TA 3KBBA 1OFUX 1L7VC 4Q7JB 4PNZA 1Y5LA 5ESWA 5JMWA 2IEIA 3BD7A 3KO8A 1W36B 4AFNA 4RE6A 4TYWA 2PRKA 4ZAYA 5DF1A 1EZ4A 3C3DA 1CP3A 3B6ZA 3SZGA 2BRUC 4ZPXA 4PTYA 5D01A 4B44A 4FOTA 3B1ZA 4NABA 1N5RA 4U0JA 4XGRA 3C41J 1GL3A 1Z36A 4EDFA 1NP6A 5KTTA 3MT0A 4J3NA 1JDSA 4BQEA 2XRZA 3R6TA 2PWPA 2PDAA 2V9PA 2J8ZA 3UB2A 4HI0E 1DOHA 2Q9UA 2EBFX 3P9NA 1QTIA 1EVZA 3RSCA 3RUDA 5JE8A 4EO9A 2DLNA 1ZBDA 1G21A 1QIMA 3A9TA 4GZMA 3A58B 3IKVA 4LXQA 4XDGA 1TVCA 4Z9YA 1OGJA 3QUCA 1JXAA 3FPAA 4J29A 1RBMA 3NWPA 5M04A 3TRFA 1L5OA 2AVNA 2D5BA 4ZU1X 1L2TA 3P9KA 2IYZA 4AMVA 4EPVA 4HVLA 5IUKC 4PSVA 2QG9A 4ESVA 2JCSA 2O50A 3X2SA 2JFYA 3K5WA 4H6WA 1SBQA 4PSAA 2FEKA 4KSYA 4PF1A 2W43A 1EIZA 3U4HA 4C29A 3HJFA 1FW8A 4JDUA 1SUPA 2TMGA 1YZUA 4TLEA 2WJVA 3ADOA 4WZBE 4X8LA 1XB2A 2ATEA 2O0MA 1C30B 2H4ZA 2R1TB 3EN0A 3EQZA 4PLHA 3AL0C 2OO3A 2HBYA 3IPLA 2NU9B 4P38A 4YY3B 2C9ZA 2P2YA 4CMCA 5I7AA 3GDHA 1XRNA 2ZYDA 3I23A 2QDKA 4MJ7A 3RHSA 3U19A 1LZLA 1WCV1 1K7CA 1TGYA 2QMHA 4QFCA 4G8JA 2BEWB 2C9OA 3HWRA 1Z4QA 3IQXA 1W4ZA 3OPYA 2WJ3A 3FYUC 2DBVO 1XYGA 2BM9A 4QWMA 2PUFA 4D4JA 5FPSA 5C5IA 5JO9A 4OHWA 4UTZA 3UUGA 5J43A 4KRGA 1AHPA 3HCNA 2QRNA 5ICFA 2F1OA 3FWZA 3AI3A 4UZSA 1YR6A 2NU7A 3BL6A 2QOEA 5BSTA 4B79A 3AFGA 2BHTA 2B1IA 4IIVA 1E4VA 1P1BA 1YR2A 2DHQA 4KGZA 3TR0A 5GM2A 4FE7A 4J0QA 2W7TA 3QFTA 2QLJA 5CDTA 1EZ1A 1N3BA 1NONA 1BHJA 1V47A 2X5KO 3P7MA 1A4IA 3JD1A 2HMVA 2QTZA 1I9CA 4IGKA 4AYXA 5KIAA 2GN0A 2C3PA 2DPLA 4K9MA 1U3WA 2FZWA 1J4AA 1Y7HA 3DL0A 3GGJA 4GPD1 5F4BA 3TLBA 5EHIA 3ZK7A 4B81A 5JW6A 2YNMA 1ENPA 5HK9A 1N0VC 3VR5A 3G0CA 1V1MB 3FX2A 5GGYA 2C2XA 3ZE6A 2UKDA 2JCXA 1PP4A 3KR2A 3NBUA 3PCXA 4ND6A 4MUMA 1LFDB 1AV7A 2GCOB 3RODA 3EG9B 1KFJB 1M8JA 3MGBA 4G41A 5DM2A 2YMQA 1QIDA 4MSUA 3S7ZA 2I5PO 2K2QB 4KFCA 3TLAA 1I4TD 1EAYA 2EZ9A 2Q6LA 2Z3VA 3O0DA 4LRXA 3RYHA 1KRXA 2QROA 3QLVA 3VOTA 3OT1A 1TGVA 4HGRA 5IAOA 4B3MB 4H0CA 3ST7A 4AMYA 3V6MA 4OH7A 4B8YA 4C0BA 4W5WA 1M0EA 4KE7A 4HSEA 1IWBB 2RH9B 2J07A 4YFVA 1ORVA 2P5UA 4W4TA 4WKBA 3SJCA 4E21A 1ZNYA 1GGMA 2M6KA 2PFSA 1RYFA 3MEQA 3N0XA 4XTCS 5BV7A 2ERCA 4RIEA 2C00A 5E9WA 3CVJA 4O2BB 4YP7A 4OP3A 3CLTD 3GH1A 3EFOB 5AJUA 3RIEA 2VZEA 4QQRA 1VE9A 3TX2A 5K45A 3NHYA 4AKIA 1H2RS 3S5JA 2G4CA 4U6NA 3GB9A 4RKRA 3VMFA 4OQYA 3R74A 1KSHA 4Z9FA 3VOBA 4P34A 4DIUA 5KTKA 1JFRA 2ACKA 3OQBA 5K4GA 6CHYA 4Y9UA 1GKUB 3Q41A 4MIEA 4UASA 3T7KA 3RWOA 3ZCVA 4WXHA 4BFSA 5KTYA 1M8PA 1QZTA 4FQ8A 4AMZA 5FFNA 1E3MA 3ZS9A 3ZCQA 4EGJA 4FHEA 4G26A 5IABA 1BX3A 4PBRA 3PEVA 2H3EA 3H5NA 5CLGA 2Z58A 3HLKA 3R7LA 4TS9A 4Y2UA 2CNKA 1SURA 2WJ6A 1QGZA 1EX1A 2JJ8A 3F3SA 2L18A 4DCCA 4FP9A 1EG7A 3LS2A 1JZTA 5A03A 4RIFA 2VCYA 1JHXA 3OM1A 3S99A 4L22A 3W34A 4FEAA 1H0RA 3UJ6A 4DLVA 3BH0A 3CVOA 3I9KA 5JI2E 2CNWA 1NMZA 4H27A 1C8LA 2JFNA 4H35A 4H6XA 3B5EA 1LNZA 2BFMA 3FZYA 1JSXA 3H7AA 2GRJA 4OLJA 1GXSB 4GSKA 4RU1A 1Z83A 1PS9A 1WV1A 2NZVG 2ZAMA 3I6MA 1B41A 2X2EA 1SOUA 2ES4A 3TL3A 1U0NA 3ESYA 4DSZA 1NMXA 4IQGA 4IG4A 1G0OA 1Y34E 1UC4B 2HTFA 1TYDE 3CWQA 4FZ5A 2ZRIA 2YFHA 5HKKA 2QP4A 4UUBA 2XKBA 1UR5A 2WJ4A 3ESZA 4J0GA 4ZO4A 1L5GB 1C1DB 1KFCB 1U7PA 1NT4A 2QV0A 1FS4A 3I2JA 3TB4A 1UKYA 4PZUA 1FYEA 3VR3D 1ZHHA 2W58A 3EZGA 2IYLD 4J1NA 3E7FA 3U6KA 3HDTA 1R5JA 4UHEA 4C4AA 2OQRA 4M9ZA 1KJJA 3RUEA 5JXWA 4JXZA 5C46F 3FFWA 2BFWA 2GCEA 3LC7O 1SIBE 1RLUA 2VUTA 1H94A 2IVZA 2FA9A 4TGLA 3A05A 5CBPA 2N75A 5AXAA 1KQOA 2FQWA 4QXMA 3TRDA 4Z7NB 2GSDA 3GRAA 1QF9A 2YXBA 1EWVA 1Y1TA 4GVXA 3KTOA 4A0HA 2YS7A 2BMWA 3KG2A 4Y9DA 2Q0SA 1PV4A 3MT7A 1X8LA 2ZT8A 1EFLA 1ZVVA 3C3XA 3ROXA 5DIZA 3KOYA 4EKIA 1JDPA 3D2AA 1PW5A 3MHPA 4GWLA 2Q7XA 3H3XA 4TVOA 4UE6A 2EF0A 3RSZA 3VR4D 1A1VA 2WT4A 1AUPA 1S02A 2JAQA 1EJ6A 2NU8A 2XPCA 4RADA 4W5TA 2G28A 2DT5A 4PAOA 4EI9A 2G1PA 3KXDA 4V0ME 3C6MA 4X7PA 2D1SA 2ZWOA 1TAHA 5CEEA 1OI3A 4JL8A 4EM6A 3KTAB 4F5DA 4EENA 2Y05A 4ROTA 1EB8A 1X1CA 1F5SA 2ZU6A 3W5VA 5ALPA 4HQRA 3MGKA 2I80A 4DIBA 2BP7B 1C1YA 4LKOA 3H1BA 4DMRA 1QYXA 4UUPA 1SKQA 2HPAA 4RGYA 4Z9AA 5TJHA 2D54A 3KSUA 5TE9A 4GC9A 4P4UA 4J8PA 3DKVA 3MJHA 5FNVA 3W3AH 4DQVA 4H7EA 4LPSA 4IDBA 3U13A 4CQLB 2A7QA 2JKYA 5KWIA 4M9XA 1DQYA 5AMXA 1Z8FA 4OHBA 1Y1RA 4S1NA 4R0MA 3PQ5A 3H2YA 5SYAA 1E6WA 1RM4A 3Q2KA 1JDBC 2ZWPA 2A9RA 4DC0A 3FCSB 5KMGB 2W8ZA 1J2UA 2WF7A 3MHTA 2FZEA 2GM4A 3SCZA 3W5AA 3WSWA 5F76A 1KYQA 3EZ7A 2RI0A 5COQA 1CUIA 3BYZA 1DO0A 4N65A 2PT7A 2XV1A 3ADKA 1U0TA 2PL9A 3PS9A 4L5CA 3W2EA 1V8FA 1D2GA 3OPVA 4MVJG 4MEBA 3OQHA 4PCVA 3QFRA 1JA9A 2EIHA 3T4UA 4NZOA 5BWLA 2PUEA 3OQNA 3NAQA 1G5TA 3N8NA 2AMJA 4LRWA 5ADVA 3EODA 1R10A 3CKKA 3HKCB 1GCAA 3TOSA 3VSEA 1C7ZA 4J3JA 4XDYA 3VV3A 1JHAA 4HOYA 5ERGB 1D5WA 2WJYA 4PVDA 4BKRA 2C2ZA 5E4FA 3ZHSA 5DNEA 5B1EA 1EM8B 3L1JA 4EECA 3NIBA 1CQIA 2CF5A 4JBYA 3DOEA 3NKLA 4ZT2A 3PUIA 1CLEA 2AG6A 1VECA 3L7IA 3FYDA 4U39A 3B1XA 3LT1A 1UMDB 1V48A 2E4ZA 2O3UA 2X13A 4NCNA 4WZZA 3I6BA 1H6DA 4DCOA 3FSGD 1ZN8A 4GXNA 2VWGA 2XQFA 3C5WP 3BFKA 1UXGA 3QHQA 5F21A 4J9UE 1VGRA 1PZFA 2C3YA 2ZJ6A 4OFBA 3QGMA 1QQAA 2XWBF 1BN7A 1W2WB 1GKIA 2HJGA 3N2EA 1SHTX 1GY8A 4MWDA 3HU2A 3D9QX 4X3CA 3F8SA 4WBNB 2HZBA 1DTWB 4PWYA 5FTWA 3T4XA 4BJ3A 1E1CB 2Q3LA 4H08A 5BSMA 5KSZA 2DBQA 3AFMA 4D9NA 1NA5A 2C42A 1GVNB 2HGSA 4GPIB 5DLPA 4LTNA 4ENPA 2AZMA 4FX5A 4CIWA 1TIKA 1FRZA 1YL7A 2JJ1A 1X19A 2PA3A 3LXRA 4MWOA 1IOZA 4ZCMA 3KQKA 2QQ5A 3NVAA 1DX4A 2EYUA 2H9AA 4IRUB 4LJ9A 1SEVA 3RU3A 3DKRA 2JI6A 2DHRA 4MPJA 3FIJA 2B4RO 4MA4A 2QHXA 2R60A 3F2VA 3M4ZA 1SD5A 3BMCA 1TC1A 3H4VA 2ZIUB 2OAGA 3NGXA 1F51E 1KO4A 1O4WA 4ND5A 4B6RA 1SMKA 4DSUA 1NGSA 1Y5RA 4JOQA 2IXTA 4G5XA 4LSMA 5FF9A 4V0RA 2QL5A 1Y3FE 3O8OA 4W9NA 4YK7A 1J0XO 4NBVA 2IOYA 1SN7A 5H82A 4QUIA 1CRWG 3ZIUA 1OIWA 3IELA 3O95A 4LA4A 4O5AA 3UA4A 5JAPA 1HE5A 1F8UA 3OHPA 4DQLA 4IKOA 3S2EA 4FCVA 2H2WA 1JVBA 1V26A 3DZIA 3K9GA 4XKJA 1ONPA 4KPFC 3RW9A 2PZMA 1KDYA 4PEVA 4X62B 5DWVA 4YRIA 4JC4A 1RRMA 3DNFA 1PR2A 4Y30A 1NJ2A 5ERXA 3KVRA 5J63A 3WLOA 2Q3JA 5H0IA 4D45A 1DIOB 1H2FA 4QOHA 1ML4A 1P72A 5IM4A 4RTNA 1N77A 2NWQA 3DM9B 4IFTA 3WL7A 1FP7A 1UWKA 2RGAA 3OURA 4DPKA 5M29A 1R4MA 2DFNA 1JHQA 4FWBA 1BWPA 2FVXA 3QPDA 4IQ4A 5KYUA 2CFOA 3G17A 2XMZA 3KCNA 3L0SA 3OX3A 5EQJB 4C43A 2R79A 3H2SA 1IZYA 3HMKA 1BXRA 2G9VA 1JDNA 2E55A 2OP0A 1WHTA 5JH7A 2B34A 4H7PA 2FDRA 4LAFA 1Q3KA 2P3LA 4DNFA 3C3JA 3TLMA 4LDQA 5KOJA 1YKFA 3E2PA 2ZRDA 4QTUB 2HWWA 2VAWA 2Y76A 5BRAA 1K7SN 2X5XA 5AKYA 5HQ3B 3EXFB 4PX3A 1B3BA 3W0LB 4ER7A 3AWDA 2QMZA 3KEFA 2EBWA 2G82A 1B4DA 1HH4A 3MS7A 3P0EA 4QUKA 3A9RA 5CT4A 3O84A 4Q6BA 3JD3A 3DL2A 5JZOA 1EMDA 4LK2A 1L0BA 1U3UA 3OO1A 1A2BA 4BAGA 4NDAA 4ALLA 5A0VA 2PLNA 2H5IA 4HQ6A 3WGKA 4BFWA 2BFAA 1H2XA 4OQPA 3G0OA 3T41A 4UVGA 4FXOA 4F2GA 5BV1A 1ZY2A 4BCBA 3VR6D 2I3BA 2Q3HA 3E9MA 2GTIA 1NV8A 1GTMA 4IRMA 5EHQA 1DHTA 3TLZA 3T3MB 3VKGA 4JEUA 3F47A 2FSVA 4C07A 2XAUA 1NBMD 4HDRA 2HWYA 1DG3A 4X8OA 1T2DA 1C3VA 4GDFA 1K08A 1BW9A 1CR0A 2F67A 3ORHA 2OORC 2AOVA 2IEGA 3D0RA 1W4RA 2ID9A 3Q87B 3VHXA 4K5QA 3MERA 4MUYA 4J0FA 4Q15A 5HGJA 2ZUVA 1JHOA 4IWYA 1UKBA 1PR0A 1R9GA 4OD0A 4ZYUA 3FOFC 4HNAA 2FW8A 1U8TA 1CVIA 3N2KA 2J0EA 4Q1EA 4LRYA 3R8FA 2VC2B 1OI7A 2GKGA 2HN9A 1JJAA 2H48A 2H4HA 3DZCA 4M87A 4U3JA 2YASA 4UBIA 4A9AA 4DVGA 4ZMBA 3ZGOA 1KEEA 3NHAA 1U02A 2VUUA 2ZB7A 1XTJA 3KB6A 2JFOA 1U2ZA 2HQ1A 1CF9A 1L8OA 2R6HA 3L1IA 4I1YA 4BO7A 4F3NA 4RH1A 3O3OB 4ZPJA 3OEED 1THGA 4GHWA 5A3VA 3B6IA 2OGSA 2WICA 3RVJA 4AKHA 1Q22A 1UQTA 5A05A 4PZCA 3U7GA 4PG7A 5E7QA 2ZJ3A 4LV8B 3B6KA 4JBHA 5I5GA 1GA6A 2ACVA 2WM9B 1OU0A 5D1HA 1BHQ1 1U0HC 3BICA 5HF9A 4GZ3A 1KBQA 5AVTA 1PSDA 4N5MA 4NG4A 4UATA 3ZE0B 3LC1O 4L1KA 4CDNA 7REQA 3JQFC 2Z4RA 2H85A 4WDQA 5EJ4A 3K15A 1GCOA 3IUSA 4DGSA 2HA3A 5LLDA 4Z86A 1E6EA 2UZIR 1W35A 3H18A 4OATA 3RFTA 2FG7C 5C37A 2Q7OE 1PV2A 1O6FA 5D6OA 5EG5A 5FBZA 1Y3DE 2PRZA 3DXZA 3IAUA 4KPUA 1CJKC 1AO3A 2RGDA 4L5JA 3UGKA 4H1VA 2YL2A 3O3NB 2PT6A 1IJFA 3KZNA 4KGDA 3TSZA 4D46A 3VNBA 2CV2A 1XVAA 3PGJA 3Q9LA 3MFYA 5I3ZA 1SKMA 5CJ2A 4HX9A 5MFPA 1X94A 2GO7A 3W5CA 5EPEA 3UFXA 3V8BA 1G3UA 3KSAC 1EP9A 1YDFA 1JAYA 3WP1B 3WFJA 5B7GA 3AI1A 4KL8S 1PWYE 3G0BA 2ETXA 5HS4A 3ZGVA 2WRZA 2R6JA 2K4MA 3KK0A 1KY4A 5IBPA 4BUZA 2CGEA 2I6QA 2PYDA 3Q11A 4KMRA 1QZUA 2VAMA 2HK7A 5SZJA 2IDJA 5DXAA 2VAVA 4Q9LA 5T3UA 2DR2A 2RKOA 5IJ9A 4V03A 5IFKA 2PIAA 5E95A 2Y1KA 1GEEA 1SOVA 5H4GA 4JT9A 5KYYA 2VTDA 1O9GA 5CT6A 3KC2A 3C2QA 4HWPA 1EE1A 1V45E 2WB2A 1QHSA 1Q84A 1T9HA 5T3YA 5C3MA 4Q9IA 3L5OA 1FP4A 4KXLA 5GZ1A 4NFSA 3OEHD 5E1DA 4WLEA 2O7NA 4M53A 1CJVC 5DWQA 2VL7A 4JN6B 5GM1A 1J0AA 4H0FA 4AJOA 3K9FC 3E3MA 2XKKA 2YS6A 3M4XA 3PF8A 5KCMA 5WRFA 3M7IA 2WR8A 1JYEA 1TXGA 2NUAB 5KX5A 3N6XA 5FPPA 1G59A 1LSJA 3NXKA 3ZDRA 5SICE 3DHEA 3DGFC 4NPAA 1FJHA 3QSGA 2K2WA 5AHKA 4CEJB 2J9FB 3R6WA 5G40A 4DBZA 2FLKA 1NBAA 4FHFA 1IYZA 1UZMA 1R66A 3WHPA 2PO7A 1ZFNA 3PA8A 2QSUA 4PRKA 3JQ8A 1YBVA 1ZJJA 4EATA 3TQIA 1NXSA 4D99A 3QE2A 2QY9A 2VP5A 3CUWA 3STUA 1QV9A 3DO8A 5AVXA 2HOQA 1GIAA 4YMVA 2V1UA 1LVHA 1NRXA 3WL5A 2HWXA 4HAWA 2ZRAA 5IKXA 3C3EA 3NNSA 3QM1A 2JBAA 1NNLA 3HWSA 5B2EA 2KWIA 5FUMA 1PR4A 5H16A 2WVGA 1XJ5A 4QGGA 4DV0B 1WZ2A 3N07A 1FS5A 3QMWA 3S2UA 1VL8A 1Z0FA 1NX9A 1SCDA 3DUFA 3JWPA 4MIYA 3Q7QA 3T99A 1X1BA 2BE7A 1FL9A 1VJGA 1XZIA 3WHIA 5LL6P 2OFPA 1TQHA 5GOZA 3KT3A 4RY9A 4Z1MA 4U2CA 4CL3A 4YXFA 2G4VA 5F2NA 1DXYA 4MVYA 4K6CA 2HMSA 5TQ2B 4A1OA 2H3HA 2BBWA 3IL2A 4WPGA 3Q10A 4DV1B 4YV0A 4TTIA 1RI3A 3IV6A 5A9TA 4ETNA 1WQ3A 1LJ8A 4I6JA 1SIWA 2ZR9A 3EVDA 3DZGA 5F2OA 3MG9A 4J6FA 4EG0A 3AM1A 2WJGA 4ZT3A 4URWR 1HNZB 3IKJA 4RW0A 5CVDA 4YT5A 4DRYA 2VJPA 4FB4A 2UXCB 1BX0A 1Z4OA 3OQJA 5E3HA 3EIHA 1Y48E 3O5AA 4A4DA 4DG5A 2XVAA 4WIAA 5CBPB 1O6BA 4E3WA 1A9XB 3OEYA 4K6HA 4JP5A 2QW0X 4MS4A 5D8DA 5EIHA 3SKVA 1YDGA 2JJ2A 4IAOA 5F77A 2PE5A 1C4OA 2PD3A 1UJ5A 3BKXA 2OCKA 3VDNB 3GVPA 1AMOA 3DVQX 2YHBA 3QF4B 1XLTC 2ASVA 5CM8B 4F6LA 1GG2A 3H99A 3AIKA 1UT6A 4P4TA 3WNCA 3KOMA 3LT4A 3SM3A 1ZBQA 4HBGA 2PRSA 3PEWA 3ORSA 3RTDA 1SB8A 1FJ2A 1QHHA 1J0EA 1K7YA 1I5RA 1Y8CA 2ECFA 2P3SA 3RSSA 2PXCA 3DMTC 4OOFA 3AW8A 2KHZA 4KQGA 2LR0A 1GITA 1PAUA 3P0HA 1L5KA 3FHJA 4HVTA 3U3JA 5AW3A 1T3HA 1EP1B 4MQ6A 1LS6A 2JGIA 3O2QB 1U2GA 1LRKA 3HDVA 5BUQA 2W0MA 3RFUA 2I6XA 4S1VA 3HC7A 3BPSA 1ST2A 3UATA 3ZWMA 4OBEA 5EP4A 4X9XA 4F0JA 5LQCA 3RYCB 3NOVA 3CVUA 5EVJA 1SBNE 2SKEA 1PJAA 3LCVB 1MB0A 2FETA 4NU0A 4FFPA 1ID1A 1ZH6A 1TZ2A 4V1CI 5ESXA 1F2UA 4PC2A 1A7JA 4IJMA 5E6SB 3SYLA 4ND8B 1NRWA 2IZ7A 3P0FA 4NBTA 2D5IA 1E1RA 2CJWB 1DAKA 2H2GA 4CNQA 1GZ7A 5JANA 1U98A 4DVJA 2ATIA 4QECA 3ZDFA 3FMVA 3RK0A 5LBIA 2ZE8A 2DHCA 4OUDA 1EFRA 3QXCA 4F72A 1W8DA 4PQFA 1QCZA 3D3EA 4URXR 3WRXC 3RVDA 2J5KA 2H1RA 1CY8A 2DWOA 2PSEA 3GJYA 2ZIAA 3C48A 3C6QA 3V8EA 4EK9A 1VGQA 1NVKA 1PWHA 5CTAA 4UCXA 3HJBA 3PF9A 3ZKWB 1P0QA 2R6R1 4NI5A 4X94A 1E63A 4YAGA 1KU6A 2JVKA 2XMCA 1UH5A 3F96A 1IWPB 3OPMA 3H19A 4IY1A 3C4QA 4KXYA 4GD3Q 2F7SA 2GK4A 3CH7A 1C3JA 4ENVA 2GVNA 2NZWA 2XT6A 1MTZA 2VQFB 3SYMA 1SBZA 2FW6A 3AU9A 4R4JA 5EKUA 1YRBA 3L8DA 5C9ZA 4I55F 3B9BA 4TM7A 5IUNC 1CE8B 2ODEA 3K0FB 3L7KA 4B76A 2A9JA 3VKFA 2FZKA 5I7WA 1JPJA 2FR0A 4NXNB 2X8BA 2QVZX 2B61A 2I1WA 4U7TB 5JYCA 1C2TA 1CFJA 1YB6A 1ZLXA 4G5GA 4EW6A 2OO7A 3NH9A 2J9XB 3JASB 1K6JA 3EC2A 5CA1B 5B3AA 3ZWAA 1SBHA 1RHRA 1GQRA 2HLHA 3MF4A 1APBA 1HSOA 1KEWA 2N3ZA 4E51A 4LJLA 4FGLA 4TQUS 2J6CA 3H5WA 3PDCA 1DHRA 5EQFA 4LY0A 3U9LA 4MVJF 4J07A 5JS2A 3D7RA 5FX2A 2ILTA 1T6XA 1PFGA 2BGJA 2EYQA 2VHEA 2CBZA 3A0RB 4LZZA 3T5MA 2PZBA 2WWTA 3JWGA 1O94A 5FI1B 2GPSA 1WUTA 3LT5A 2WC1A 1HDRA 3K9WA 4XX0A 3U80A 3T6KA 3FVQA 4NOLA 3LFHA 3O91A 3HV0A 1JTFA 3QBVA 3WYDA 5KTPA 1A3CA 3LHSA 2VJMB 3GIWA 3PKJA 3O4JA 1KZ6A 1I2CA 1PT6A 1UUFA 3L9XA 3WAKA 3HWX1 5AM0A 2VTEA 3PQCA 3W7BA 4DIEA 4UPVA 5J4VA 3UXYA 4GL2A 3ASZA 5FLYA 3I5AA 4HMPA 3PKIA 1TZBA 5E7MA 1PR9A 2Y4NA 5BSRA 2IYVA 4M55A 5JNUA 1O96B 2HT6A 2JAOA 3O8LA 2X8JA 3QIVA 1NPYA 4OO3A 4OY3A 2HFJA 4E08A 1VB3A 1HE3A 1N78A 2GJAA 4I36A 5K0TA 2V5AA 3OZAA 3T7SA 3CLTC 4GFDA 3DSRA 3M34A 3F4LA 2GD0A 4AROA 1KK1A 3K4PA 4X95A 3LQKA 2VZ9A 3LKVA 4OQXA 5G4LA 3R5JA 1R4MB 1I7QB 3I9LA 2P9HA 3GFOA 4X90A 1J8FA 1XZGA 3ORRA 4OYYA 4TQAA 1XTTA 1MIOB 3F0TA 3GNLA 2UZ1A 2WYUA 4GBJA 5EIFA 3SOZA 3JZFA 4K6OA 1W5FA 5KVCA 3RBVA 4PLYA 1WHTB 4UMFA 3E4DA 4R9UC 4B1FA 3L93A 1V7PC 1JEDA 5AM5A 1IY8A 2PZEA 2YC4C 1OX4A 4GR5A 5CK4A 3TXYA 5FHQA 5EUCA 1BE1A 1EVYA 5KHOC 5JT1A 2V5UA 6Q21A 4I1SA 4FSXA 4HGZA 3SFZA 3WGOA 4TX1A 3WZ2A 4KIFA 5E9JA 4INJA 1GPNA 2C0QA 2VI5A 2YFKA 4HF7A 2HM7A 3HO6A 5H9WA 2KBFA 1GV1A 1G9TA 4RC9A 3MGGA 3UAXA 3LUFA 1L3BA 4OB8A 1IVNA 3SI7A 4F3YA 3RQIA 4IJVA 2AQ8A 5DPMA 4LOJA 4FNGA 2C84A 1JR3D 1N75A 1ZIDA 2BI7A 3BIFA 3F5DA 1VA5A 4P5PA 1LNQA 1YCGA 2I3ZA 2ZXUA 2Q8NA 2PX2A 1VPEA 1BH2A 2CXSA 3BQMB 621PA 3FNEA 4DV6B 2BV3A 2VSOA 3TS1A 3GVXA 4DMMA 2GT1A 5KQGA 2WQ7A 1OU4A 1KA9H 5JSUA 4L3WA 1LLFA 1YJXA 3RHFA 3CXUA 1K66A 3BDIA 3QU9A 1Y82A 4OHUA 1J8DA 1AK9A 4AU1A 1CNEA 1VJ0A 2VHYA 2ZBQA 1QO0A 3GA5A 1DXOA 2QI9C 3NYRA 3O1LA 4RE5A 2CMGA 3N2KB 1J56A 4PC1A 4WZAB 3T7DA 4WESA 2IP2A 2XADA 3UWMA 4EMTA 3AEXA 1EDOA 1OQAA 3U37A 1X1DA 4U3JB 2ARKA 2OVBA 2AMYA 1SBTA 3SSNA 3LRTA 3W8DA 3C6BA 5M2QA 1VCHA 4MA5A 2HREA 1M5TA 4MROA 2FRXA 4JJKA 1V6SA 3PUZA 1PLJA 2PGLA 5BNFA 1HDXA 3B12A 4Z7JA 5C8DA 4Z99A 3CX6A 2R8XA 5J2TF 3HU3A 1M2WA 1CJTC 1FVOA 2BH9A 2ZCVA 2BPOA 5BQPA 4UNPA 5DCWA 3TXAA 3VKWA 1JBKA 4QYMA 4DIMA 5J4HA 1UM9A 4KBFA 1YB7A 1KFBB 1XVTA 1EJ0A 3HYSA 3U31A 3HBJA 3CE6A 1YUMA 3G7SA 3CPHA 3HRKA 4QD3A 2GARA 3CO0S 3SLKA 3KJQA 3O2NA 5KVVA 1VBKA 4PICA 4A8PA 1XQVA 1NF2A 2P5SA 3BJEA 4L7VA 2F6RA 2NZUG 3L05A 5EMLA 5FADA 3DB2A 2Q2VA 5REQB 3O47A 1H65A 4QVIA 1YQDA 3A7DA 3MTBA 2V96A 2D5CA 3NCHA 1ABFA 2P79A 2Q4DA 3Q40A 1VPVA 4D4IA 3W1WA 2QJWA 1UDRA 4YAOA 4ZYXA 3EUWA 1GFZA 2DBRA 1HL7A 1XUOA 2K87A 1Z22A 2UZ4A 4GVLA 4MGIR 4WMLA 2IPNA 2QUZA 1R2QA 1Y4DE 2OCDA 3VR4H 2BKUA 4MXDA 3VYTB 1N2ZA 1NI4A 3MW8A 2XTMA 4PZPA 1EK0A 3QLTA 4TTJA 3R41A 1T2UA 1XLWA 3G2OA 2W9XA 3OMXA 4FFBA 1V6AA 5TF0A 1P7YA 2XSZD 3ILSA 2IOHA 3OP1A 3GLUA 1TQ6A 2WHYA 1UMKA 1M6NA 1YASA 4XYLA 1J7KA 2YINC 4PW0A 5ULLA 4ARBA 1G3QA 6YASA 4KLZA 2PN1A 1M73E 2B82A 4EJ0A 4UOZA 1SUIA 1T4MA 2OBBA 2AK2A 4TL7A 4WADA 4KNYA 1QHNA 1XIVA 3FCXA 4B8ZA 3O9ZA 4WT7A 3TW6A 5I4KA 2C5GA 2ZZMA 1UOEA 5IJ9B 2PSFA 2LTAA 4JJAA 1YRYE 5IMBA 1RDFA 2ZUDA 4WFQA 4N40A 1KEVA 3TMAA 4C7MA 3ZLBA 3Q8KA 4D8VA 1XTRA 5EXDA 1RJFA 1ZXXA 2RJ3A 5G3ZA 2C2KA 1AXRA 1M8KA 1PLKA 3OQ6A 3LY8A 1G6KA 4QBGB 4LYGA 1KVSA 4QODA 3PSHA 5L9AA 4HTFA 2GN2A 4NVRA 4I3FA 4UHHA 1BEEA 2GN9A 2FPPB 2O2CA 4G9EA 4AXBA 2JLXA 1JQDA 3RSHA 1HUQA 1GQFA 2XQKA 2X1HA 1H8ED 2ADFA 2G5PA 2WYHA 1FNSA 2Z4TA 1NW8A 2COKA 3FCCA 3GJ6A 3PCTA 4JENA 4C04A 2F3UA 2Z9CA 4ZXPA 3F6YA 5HA5A 2A86A 4YJ3B 4CUKA 3CHYA 3V7NA 1FYFA 4TUYA 4EA6A 1DGQA 3N5KA 1SD1A 3HPRA 3K20A 1HDYA 1LBIA 2NM0A 1UK8A 2NAFA 4OBWA 4BV8A 5HYVA 2G76A 3JAMA 1FTQA 3H97A 1QUEA 2H59A 2JBAB 2Y1WA 2HJVA 1DLJA 1O2DA 1ISPA 2B4AA 3LNTA 4Q4HB 5G1PA 3ROKA 4DR3B 1PJ2A 1NFQA 2VAPA 4RKQA 4F11A 1XLUA 4PPFA 2SCUA 3HACA 3AVQA 4U7PB 3WGYA 2P9YA 2WFAA 1KP3A 3CT4A 4WK2B 2I9PA 1K5HA 1LKZA 5ALJA 3NATA 2B83A 1EUDA 2P3OA 4IZIA 5BY2A 1MW8X 4TMYA 4F7WA 1KP9A 2QJFA 4FIDA 5I9SA 1KMNA 1DG9A 4F9EA 3FHCB 3NC4A 4QDXA 1CQXA 1A9ZA 1FRFS 2AN4A 3DEJA 3F3MA 1ZN7A 3I8SA 2QN1A 3OPXA 1LCIA 1ORRA 1CRQA 1NP7A 1RM5A 2O2XA 2R6GA 2XYGA 3FLBA 3OKFA 3BGDA 4IDFA 2ZVPX 4AW9A 4BEVA 5LLSA 4TQGA 2BH2A 1STOA 3CRQA 3TFWA 1HYHA 3NBYC 4UTOA 4DQ0A 5LCXA 1GAWA 2XVYA 1PL8A 5AOVA 1XPRA 5LQNA 2OFOA 3QEAZ 1L6RA 3EJ6A 1PJ3A 4CL0A 1H05A 4G65A 1V4VA 1YF3A 2JI4A 4QASA 5ITWA 1MH1A 2GQ0A 5ICCA 1NJFA 3WKBA 2JRLA 3ZX5A 3EGWA 1Y8RB 1YC5A 4EPYA 4ENTA 4F6RA 1ESZA 3PUHA 4L76A 3DDCA 1A5ZA 3HXTA 4WKPA 2RKWA 2XD9A 1NFRA 2XZPA 3HJTA 2GSWA 4I7EA 4MAAA 4CG1A 1XQ1A 1RLMA 4JP1A 3F5FA 3ZIAA 1E1LA 3OIWA 1MG5A 2EXXA 1LBSA 4HAZA 4RS3A 3D5TA 4OK6A 1T5SA 2LXNA 4YGXB 4UHCA 1Z5VA 3EDMA 2WSSD 5CVTA 3ZDQA 3PJEA 3UHFA 3LYUA 4MTCA 1W4BA 4WERA 4YALA 5B6IA 1JDJA 5TPWA 1IOVA 2ZVJA 1LY1A 4J6EA 4D8TA 2FEAA 5ALHA 3JY6A 3OT4A 2QN3A 4RPLA 3VHQA 1QHHB 1TYCA 1HZZC 1WXWA 1KOLA 2GM9A 4TSRA 3GUZA 1T4BA 4EY3A 1FJGB 1JI3A 3DCNA 5D3KA 3GJ7A 4YRQA 5EKTA 3QPBA 1Q0TA 1NDHA 1XZMA 4ZP1A 1GZUA 4GOJA 3RBXA 7ABPA 4FM9A 2FWBA 2IGBA 4HT3B 2A67A 2YNMD 1OBOA 1WMDA 4Z4FA 3E7WA 2GBFA 4NJMB 4Q82A 1ZO8A 1XX6A 3VR5D 4CT4B 3QE9Y 2V7VA 4TV8F 4YUVA 3N2YA 3G7NA 5AQ1A 1DPGA 1MZVA 2O2ZA 5ALWA 2C57A 1YONA 2OZKA 5JXGA 1FDSA 1I9GA 4GMHA 2HF2A 3AV3A 1R0WA 4CTKA 1CWUA 2A0FA 2R65A 2AHOA 1I14A 2C2BA 2Q1WA 1CHDA 1ND6A 2ZGVA 4O63O 4I4LA 1U28A 4YDRA 5DYNA 3UAGA 2BFDB 4LDNA 3T9AA 4G1EB 1OVGA 2YC2C 3S3TA 3VBCA 2J0QA 2F90A 3UW3A 5FPYA 3ICCA 3AR6A 3KRTA 4OX9Y 4PG8A 1M1YA 2ZRQA 1VJ5A 2ZIFA 1M7HA 3H86A 1HEUA 2W2MA 4CM9A 2O6HA 2PPLA 3RFCA 4LN1A 4F04A 1KAQA 4CEHB 4U7HA 2CF6A 4GU5A 3VR6H 2KE5A 3DBVO 4GMKA 4BVBA 1SM4A 5J9FA 1M75A 1TX4B 3PNYA 4KCGA 2IEDA 5KBYA 4U63A 1F9AA 1X0VA 2B6NA 3IOEA 2VJNA 4MVJM 1N2HA 2XCLA 4GDMA 4PQRA 2R7AA 4G4SO 3DOIA 5J5CA 4ZJUA 4XVQA 1M6YA 3UQZA 3QFCA 1X80B 1MDFA 1WUIS 1ZD3A 1MT0A 3DBRA 4OMDA 1T8PA 1T24A 5B1DA 1DQPA 3WIVA 4E31A 4RQTA 3OHSX 3UAOA 3RHZA 1TMGE 2OESA 1ESCA 2V5VA 1OR8A 2EJTA 1PG5A 4G0PA 4H18A 4D1YA 3D4IA 1HX7A 4RQAA 4G0NA 2ZWAA 4YR7A 1EE9A 1M8GA 1YZHA 1TK3A 3KVVA 2IELA 3BDVA 1KVQA 4KXUA 1Y0BA 5D3ZA 2C2OA 4HWOA 4JI8B 2WU4A 1JFSA 3G13A 1R6AA 3WDMA 2VG8A 2CLFB 2QVGA 1PBNA 2CNWD 4CR8A 2ZIZA 1U4NA 4OH1A 1XNGA 3BIWA 2H00A 1UOQA 5ALLA 1V8DA 5F5LA 1P0FA 2PKQP 4BCCA 3QYFA 4AYTA 2VDPB 1UJ4A 4LZPA 3VDRA 4Q3CA 3V4SA 2EX0A 3ZHUA 4F1WA 2B5OA 4JMLA 4C7KA 1CQPA 1RC0A 5ALQA 1GVHA 2CK3A 3AR5A 4S35A 4ZQGA 3U16A 1O1YA 3BD8A 4XYEA 1KWKA 3IQIX 1JFTA 3SQMA 4YLEA 4TT8A 5T64A 4ZEWA 1IU9A 1CUUA 3DDSA 3L0YA 3OF2A 2IODA 1RR6A 3CKMA 3HJNA 4RJIA 2H1CA 3F46A 1X7ZA 2CYBA 2X19A 2YDXA 3GEIA 3UWPA 4AJ2A 3GFPA 3G82C 4C6SA 1T2FA 5I4BA 2D1QA 4RF5A 3TIIA 2WYWA 5CD1A 2GCNA 3PL5A 4IZ6A 5JAZA 1YTUA 2QMEA 4KR6A 4YMHA 1ULUA 4OP1A 3TNYA 4BVFA 4C4PA 4OFZA 4OHKA 1CBUA 3G8DA 4DCTA 5AM3A 1U7HA 4G37A 4I3HA 1M2JA 3C3YA 5TT0A 3D0OA 3D6VA 3ADDA 1VIDA 2RHMA 3E9DA 1XZAA 2J9ZB 1JA1A 2QRGA 2WSIA 2OPBA 3NO4A 1JJVA 2RE8A 3NS7A 1IRXA 2CW5A 2LCIA 2Z98A 3LG2A 5AK0A 2XYPA 5A9SB 3GZTB 4CTMA 4DLNA 1E96A 1FTGA 3NHJA 4KQCA 3U26A 1MGOA 1F0KA 1K3FA 1HYBA 1MNQA 4EJ2A 2ZU0C 3N9IA 5JSYA 3ZE2B 1CTQA 5EHXA 1OX4B 3ONVA 1IQUA 2C83A 1PVDA 3DCIA 3C5EA 4X1IB 3LF1A 4XDZA 3BORA 1LQ2A 3AZPA 4P35A 4F4FA 5JSQA 5TQ0A 5F64A 3FCYA 2VFAA 1HLGA 3HABA 1YIDA 4L3OA 1KEKA 1DSSG 5MHTA 2PVCA 1RE1A 3GEMA 4RPCA 5FUVA 4E2FA 1MCZA 1KR2A 2DBYA 2ZJOA 1IY1A 4KDRA 3Q5EA 3K31A 1E7RA 4OHCA 1EBFA 1E59A 2HWKA 3V2GA 4BQFA 4YYZA 5FUYA 4E5VA 3PNVA 4TV9A 4TKUA 1I5OA 4Z4GA 4C2AA 2IU4A 2WWRA 4OBBA 1U2PA 2WPNA 3CR7A 5LQJA 4JJGA 3AEQB 3RVOA 5BV8A 3PX7A 1Z7YA 3LBAA 4BBZA 1ZD5A 4GKAA 4Q3DA 4TMXA 1DJLA 5K51A 4PCUA 2WU1A 2FFHA 4BMZA 1OC4A 4KO4S 5LB2A 4L08A 3UTDA 4LNHA 2AJCA 2VF4X 3L07A 3Q5DA 5IAJA 1KGDA 1XXHB 3GLQA 4U00A 3ZN2A 1UOPA 1ECFA 1THZA 2DULA 2GN4A 3PI7A 3O90A 2AZDA 1CB0A 3MYYA 4DRZA 3O26A 1TUBB 1DC4A 5P8WA 5C1PA 3COVA 3OZGA 6ABPA 1P8JA 4MGYR 4WESB 1RAEA 3JQEA 4JJEA 3WXMA 2RGWA 3FWHA 2PM8A 4NMMA 1CY6A 4OKIA 5H68A 3AEZA 2R85A 1P9OA 1I3NA 4AMGA 4Q4JA 3AF4A 3PR3A 4KQ9A 1ZUHA 4PWZA 5CCDA 2I67A 1QHFA 4MPDA 3DE3X 2R6CA 3WWEA 5EP1A 3RIMA 4XFJA 3FPFA 3GROA 4BMNA 4E2ZA 1BE0A 1RPJA 1WVGA 3MJVA 3L7MA 1UM9B 1BN6A 3EJWA 4C06A 2PRIA 3BXGA 1Y7LA 3ZGZA 2PX8A 1KSGA 2UYOA 8AT1A 1HQCA 1Z62A 2VRCA 3T52A 4H2DA 4KXQA 3I42A 4MAMA 2FN9A 3PDWA 1ZCJA 1EM6A 4D3DA 1QCYA 3COYA 3OOSA 1JU3A 1YU6A 1S7CA 2FMIA 2XDWA 3BIOA 3B5IA 3MAGA 4GAEA 4L5YA 4OQLA 4M0LA 3UT5A 1X86B 5FQOA 3IR7A 3NP9A 3PV0A 2G8NA 2ZSUA 4XLTA 4Q03A 5BN4B 3VFDA 5JASA 5KNBA 3A1SA 1WBJB 4J0IA 1J9GA 1QZZA 3G2MA 1N8NA 1I5EA 3LLUA 2C7PA 2FW0A 4MRMA 2JH3A 1RFLA 1VCOA 3IA2A 1L7BA 1F5NA 3ZJUA 2CHQA 5JISA 2VPIA 5DV9A 4B0OA 3IB3A 4L9SA 4Z53A 1AMUA 3AWIA 4YV7A 2EW8A 1X9GA 4X3PA 1Z2DA 4YDQA 2P6PA 4G23A 4PE5B 5HFJA 5BXQC 2IT1A 1VGVA 2H57A 2NVUA 2OQIA 2YHSA 5E6RB 1Q1EA 3JALA 3N7TA 3R7AA 1HG1A 2P2LA 4QA9A 1G5QA 1HZJA 2BE9A 1II8A 3H2ZA 4GOXA 3N39C 2ZRPA 2DCMA 3T7TA 1TJ5A 2A8YA 4AF6A 5HNKA 1EIWA 2O2HA 2ZS8A 3D2CA 4LTDA 1HPLA 3RWMB 2B8WA 1WE2A 4ER5A 4C2BA 2FFJA 1EGVB 4LZJA 2OWEA 2LIPA 4RVHA 4X93A 3VR0A 3ZHOA 3ZPXA 2IYTA 4LRTB 3FJ1A 4PN7A 1M2OA 2O4UX 3LFTA 3WE7A 1JLLA 1Q1BA 5DXJA 2FMTA 2H4YA 3BWBA 1FFCA 1DC5A 2H0RA 2HQBA 2VEOA 3LUJA 2PH7A 3F9RA 4CGZA 1OREA 4B7XA 1SHJA 2MWMA 3KZOA 3RV4A 5TMPA 5E4TA 1WHSA 4MMXB 2QR2A 3UO8B 1H2WA 4I55A 2JGAA 2VJCA 4BO2A 5C8YF 3U7FB 5TS3A 5KJEA 2CVQA 4N5DA 3MMPA 5I51A 4ZT4A 1SXJE 4ZJPA 2VS1A 1LPMA 3G9QA 2JA2A 2CLLB 4HDOB 4QELA 3HYRA 2DSTA 3W04A 2HRDA 1QBGA 3EYWA 4N7BA 1GZSA 1N5JA 3RUIA 5AOCA 4PYQA 1C7IA 1P74A 1YQEA 3DH0A 4QULA 3SC2A 2RHCA 3GD7A 4WQMA 1E6LA 4UPEA 4ZI7A 2PH3A 4KQEA 3OBBA 4IHJF 4M6WA 3I4LA 2QTCA 1E89A 4C4YA 3EF1A 1TIPA 2VHXA 1H8HA 3RS8A 1I6LA 3IQHX 3I09A 5KYGA 5DGXA 3MWJA 3OI7A 3TJRA 2ZZNA 4ZICA 3DT8A 5TIIA 3AUYA 2VUSA 4KN6A 5I8ZA 1ZG3A 5IDWA 5G1OA 5EIEA 2SCUB 3IDAA 4YRLA 3SJUA 3C8DA 4H16A 2YICA 4FDMA 1TVKA 1ONOA 5DYYA 3ZEIA 1IVYA 3N2GA 3A26A 1DINA 5I7UA 3GGOA 4IXWA 4O2AB 2JA1A 1JWAB 2CV1A 1XHLA 1FVXA 2VA8A 1L4GA 1PFYA 3I1YA 1EINA 1N2BA 5SZHB 4XCVA 4JL5A 2DX7A 2HNAA 1QE3A 2QZ4A 2GETA 2YYAA 3KUKA 1DAFA 4FJ1A 2L82A 3IP3A 3JWEA 4UCFA 3UM9A 5HIKA 4WKGA 3HBLA 4WEOA 1BE6A 1PDWA 1XQ6A 3EVTA 3LTEA 4HQKA 3GJZA 4HN2A 3PX2A 3PBKA 3IPXA 4U4AA 1UBUS 1KDRA 4ND1A 4AQDA 4WCFB 3AVYA 1P33A 5E3IA 2F3QA 1ULAA 2ZULA 3PYLA 1SCAA 2NZJA 3DMYA 1DL5A 2FSUA 2NIPA 4LXHA 4BNHA 3G89A 1ZJ6A 3WLTA 2IYFA 5L4NA 2WPDA 3NBZC 2YH2A 5GZ3A 2UUBB 1GAXA 2N46A 3ZBQA 4CQNA 5L7WA 1AGPA 1BVRA 5K8JB 2IHBA 1OLXB 5IF9A 3R23A 2OXRA 3TLKA 3A36A 4FW8A 3R9IA 3KYJB 5B6JA 1OAOC 1FMCA 5ALRA 2FPLA 3S1AA 4EW3A 4TKVA 3VZRA 1Z6ZA 3LCMA 4C4RA 1E9AA 3JVDA 1U65A 1CUYA 1K9SA 1H66A 1L8LA 2FV8A 3HBAA 4K6GA 5ILGA 1XNQB 1ZL0A 2G7MC 3N8DA 1BCSA 1LPNA 4WA7A 4ZQHA 5EI5A 2IW3A 3WA7A 1XVIA 3DP9A 4ND2A 4IILA 4Q9AA 4QFDA 4D41A 5LZ4A 1U31A 5M7EA 1V3QE 1I1QB 4ZVMA 4IVNA 1OLUA 1FUIA 3DLHA 1NV9A 1RAAA 4M60A 2J33A 2KPOA 2PXAA 1A9QA 1D0VA 1ZCZA 4WBSA 3AFOA 2B99A 4NAVA 2ZUCA 3K0AB 1Z0KA 2B78A 2ZT5A 3GLIB 2L69A 2V7GA 3Q2OA 3S29A 721PA 4R81A 4DJJA 4ESEA 2AG8A 3CZ4A 4FUQA 4LC1A 1GKKA 2FN8A 2FF5A 3FOAA 1IBLB 3RVKA 2YV2A 3V2UA 2PPVA 2V6GA 1QK3A 1T4GA 1U2TA 2Y1OA 3Q0EA 4GQAA 1K5DA 3C3WA 4BVJA 3LHFA 3MCZA 3NWEA 4NC9A 4EZIA 2W42A 1WXXA 3D8NA 5DYWA 4PLVA 2ODWA 4CIVA 4PAQA 3ZYCA 4MKXA 4D9EA 1TMKA 2EERA 5BR4A 2RG1A 4MYDA 1UP6A 2VEDA 4QU9A 2XY4A 4J91A 1ISSA 4UOQA 2HIAA 4HR7A 2BMAA 2GFQA 2EIXA 2VK8A 4KJXA 4KW7A 1R0KA 4L4SA 1AQIA 1GCUA 4YHBA 2FEXA 3MD0A 3G0HA 5ELMA 1XZFA 1XRLA 2OAEA 1M83A 2PBFA 2X6TA 3F5SA 4OQFA 4Y1RA 4YS6A 4CVNA 4YMLA 3U09A 4J0CA 2CXUA 5FYDA 3P97A 1TYZA 1CYDA 1LTKA 3GELA 4M9SA 4E5PA 4X6YA 1RQRA 3A31A 3G2QA 3R20A 4K86A 4AJ4A 5JTUA 4NOMA 5A4KA 4F3RA 4BJHB 3IBGA 3KVYA 4YUWA 2XNHA 2YVUA 5CA0B 5ARCA 3VDXA 5CH8A 4E0BA 3CF4A 3HG7A 3PLRA 1CULC 4TMKA 3JXEA 2OVFA 1L8AA 2OTCA 1F6BA 1TQ8A 3IOCA 2Q6OA 4IVRA 3NHFA 1N6OA 1IUNA 4PRYA 2JGEA 2B3TA 2EF1A 2NYVA 1YJBA 2HNKA 4BKPA 2NZ2A 5J2TA 2IU3A 3RJTA 1GJRA 2ZR7A 3IKMB 3KZKA 4W5QA 3QEMB 1RJGA 5IK2A 4OLFA 3MRXA 3F4KA 3PUYA 4YREA 4BKQA 2EX4A 1X3LA 4PO3X 5CDUA 1PUIA 2AOUA 3E2IA 4UFPA 4NKRA 4GZLA 5CBKA 4Q3AA 1OA0A 4Q47A 5E7IA 2PVSA 2HI0A 3EVCA 1A8HA 2FKNA 5IVIA 1W96A 2VDRB 5LZ8A 1S3SA 1QFMA 1XDGA 1DP4A 2VQ6A 4L6IA 4DQXA 1M67A 2CNDA 2H4FA 4JXXA 3EPHA 1KEZA 2WVJA 3WO1A 3LC0A 4LJRA 4DLXA 5C8VA 3D3NA 1B00A 1PKXA 3WGLA 2ZTUA 2ST1A 1PT9A 4Y6PA 3CH4B 1ZD1A 3H17A 1LRJA 4X63A 1G8AA 1Z63A 3JU3A 1VI6A 2ETVA 4IQFA 1T5LA 5HUHA 3QEBZ 1J0CA 1WW3A 4WI1A 2WZDA 3L49A 3KVNA 4BRWA 1FLVA 4FFMA 4ILEA 5JCOA 3FB4A 3KR1A 4C78A 3KOXA 4FYXA 4DLAA 1DRVA 1C3OB 1GGNA 4HYEA 2R66A 3B6MA 2D06A 2ZBDA 2MR5A 1B8OA 3EYAA 3NHRA 3QITA 4JLBA 2POQX 3OJEA 1G6HA 3IQDB 1GPDG 3BMQA 4HAYA 4MR9B 1F8XA 1ITZA 2GUGA 4MK4A 4NY1A 1QNLA 3AHIA 3WXBA 5BSFA 4R05A 4Z1MD 1B1CA 4G67A 4W5NA 3KYDB 4LXYA 4C01A 1GGFA 1XU9A 2X7XA 4BN0A 3KVOA 2ZITA 1XPOA 3QVJA 4K3UA 4HWKA 5ETJA 1V95A 2NP7A 1N6IA 1N7JA 3GYGA 2C2HA 3OZEA 4ZC1A 2A9FA 2DE0X 4BL5A 4BO9A 1FCJA 5BVHA 2HB6A 2ZIWB 3DE4X 4OHFA 4M0EA 5CLIA 1PSZA 2RBEA 1YZKA 4JU8A 4E07A 3DCYA 4DJDC 4FMBB 1NPDA 1L5MA 1TT5A 3G79A 3L0PA 3QWBA 4ZDWA 4U9UA 4ERXA 3TLGA 1VRVA 4B2LA 1YQXA 5A4IS 2AFHA 4G4GA 1DTSA 1PQWA 2FPUA 4BNLA 3PEYA 4B6JA 1PJSA 3WR5A 4FK8A 2XUGA 5KTNA 1ZM7A 3A4MA 3B9QA 3DYVA 3NX4A 4H7FA 3K9NA 4H1HA 4F8YA 2JBHA 2EKZA 3I0NA 3SVZA 1IOLA 1UBSB 3UKJA 2G3YA 3PLNA 2J4CA 1DC3A 1W34A 3N2ZB 3WTCA 4QJ3A 3O73A 3HPQA 3C1TA 4Y6QA 2BJWA 1QKIA 4L4RA 4YCNA 5CB4B 3PNKA 4BIIA 1NATA 3TSOA 2MYUA 3T95A 3DPIA 1U7XA 5JMTA 1RAFA 3EDRA 3EEOA 1N2CA 2VXCA 3R6GA 1XEFA 1ADBA 3NV9A 5IN5A 1CUDA 1EFHA 3DL7A 1W19A 3MCWA 3TDKA 1BDIA 3CJTA 3IO5A 1QDLB 2VHJA 5AFSA 1A98A 1J99A 3U3XA 1N32B 4QPZA 3AOEC 4KKVA 1VZ2A 1DAMA 1ACMA 1EHCA 1QJ4A 1MG0A 4KQ1A 4NAUA 1MVOA 2HL6A 4RZXA 5BQ5A 1KDVA 1NMQA 3SIPA 3ZDEA 4HMOA 4JR0A 3GJSA 3RC9A 5A7GA 3MYRA 3T0FA 2J59A 3V34A 1PYOA 4PYLA 2ZUBA 1YO6A 4LF6B 3G5LA 1AUVA 2EWMA 1M72A 1SR8A 1PDVA 1VG1A 1XZPA 3OZCA 4D3XA 3ILYA 2MR6A 4B3BA 2IE8A 1B73A 3BZWA 5LN1A 3GYBA 3TLEA 1RJEA 4UQOA 1W4AA 3GARA 3V80A 1SC1A 3OE5A 3UPDA 4AJEA 3FB1A 3EW9A 5F3RA 1FLAA 2XMSA 1OX5A 3WS7A 3S81A 5E4JA 4GE0A 4R9RA 4BB6A 3RLIA 1X1AA 3RRBA 3ZTTA 5FBVB 2YZ7A 2ZUSA 1RABA 2JFQA 2QWXA 1KVRA 5I4CA 2OV8A 5FOUA 1WP9A 1U2DA 2QX7A 2C0CA 3QXHA 5B2ZA 1EFRD 1EXNA 3EGCA 1Q50A 1K27A 4ZOQI 5B64A 1KIMA 1XYYA 2WEKA 3UA3A 4C4XA 4KDFA 2WFMA 2RGRA 4C0JA 2GZ3A 1HEYA 3O1JC 2ZB2A 4M54A 1JR4A 4KDCA 1EDDA 1KZGB 1X7DA 3B20A 4OQZA 4PINA 1KXJA 4CTNA 1UPUA 4JYAB 1JALA 4W9RA 1L3CA 1DIBA 1JHUA 1FE8A 4QC2A 3TBHA 2WJIA 3F49S 3KZ1E 1RCUA 5HRAA 3P9SA 1B0PA 1GUZA 2G80A 4ARCA 5U4XA 1ZA2A 1LF0A 4Q48A 4DMCA 3D7SA 4R1NA 2V0CA 4X65B 3HUEA 4O8CA 1MC1A 2VJOA 1UINA 4XFKA 3EVFA 4WBXC 3OMLA 1I3LA 4G2TA 2OO5A 3H0EA 4LMPA 1NKVA 3HRHA 4TTAA 4YP1A 4GWGA 4MWCA 4D9HA 3H2JA 4YJGA 4CLOA 7AT1A 3D6AA 3IIMA 2BIFA 2E37A 4LIPD 2GZRA 3ESBA 3IIJA 3PXGA 1Z34A 1Y1PA 1N5LA 5H5JA 2ZUEA 5A02A 1VIYA 2HJ9A 4Q1DA 4BQOA 4DM4A 4MRMB 3A3OA 4TV8A 4UVHA 4DR1B 1OGYA 1W85A 1JEQA 2I7VA 3NFYA 4NJEA 4R7GA 4AUEA 4TRJA 5L3ZA 1SCJA 1GLNA 5BWBA 1D4FA 1O94D 4FN5A 4G0WA 3IOBA 4PAGA 2AMVA 2XUFA 1D3AA 2GZHA 4FX2A 4C3VA 5BWNA 3ER8A 3U49A 2H2FA 2YMMA 3IO3A 3ZI0A 2DVMA 4MDFA 4NU5A 1E2JA 3CTPA 1MB9A 1QB7A 2R1VB 1XMIA 3PX3A 3ENWA 3N3BC 4LHEA 4MAFA 4QPPA 1T1RA 3AFHA 2ZRNA 3E3AA 4XWOA 2NXNA 1U3DA 1VKJA 2P78A 3QLVC 4OHXA 1J8MF 5DU2A 2QLTA 1ZK3A 4GEGA 2X5JO 3W6OA 4Q00A 4PSUA 3R2JA 4QYTA 3BXOA 3VR5H 1V1JA 4ENQA 2C7RA 1W76A 4DT1B 1T6NA 4HAVA 2EW1A 2I55A 1HFKA 3CX4A 4PO8A 4XD2A 1DWOA 4JVMA 3ZWVA 2R2GA 3GY0A 5BN5A 4MGHA 1L8QA 1P0CA 5I7FA 3PDHA 3HZHA 3EEBA 3GD5A 4B4KA 3D6JA 3NHSA 3O8QB 3QNMA 2QQ0A 5CNMA 4UUNA 3V9AA 1QRRA 3GT7A 3OLVA 3RIHA 3RK1A 1BC5A 2FRDA 2ZAYA 1WHSB 1Y5IA 2ZT6A 3OEWA 1KMMA 4QGHA 1E2QA 4POOA 2Q50A 2JHFA 2ZPUA 4HUQB 5EJGA 4JR1A 3NDPA 1MW9X 5FORA 1QRSA 6AT1A 2DFLA 4JXKA 3ZD6A 4IMRA 1S89A 3N58A 3TKYA 4MWEA 1ZGZA 1KQGA 2O8EB 2CLDX 1H93A 1R18A 1BDBA 2Z1MA 4MKIA 3IDOA 2VPWA 4NV3A 2XF8A 2ZWIA 3QYAA 4MQMA 2G25A 4Q1BA 4DXDA 2Q0HA 3IVGA 4C7OB 4P54A 4D0GA 1RLTA 3H5LA 4OHRA 3FDXA 1KK0A 5C80A 1LK7A 4M6WB 4IS2A 3C3MA 3VAYA 3N6VA 2YWDA 4UREA 4B9AA 1ES9A 1XQXA 4L02A 5AVRA 2Z5FA 4EVRA 3NDBB 1CR2A 2YQZA 1ZS9A 4FYHA 3ZZMA 2W6JA 2ZRMA 3GJ3A 3AJ8A 4PZ9A 1KIFA 1P9RA 2JKZA 4U2EA 1ZKMA 1C9YA 5CW1A 2GLTA 1A4UA 4EGSA 2W6IA 1BVYF 1C14A 1TUGA 1TVKB 2FCRA 2QRPA 4EYKA 3LL4A 1YR3A 1GT91 2YX1A 3JATB 3WSVA 2W2QA 1LD3A 1E2MA 3NOXA 5ALYA 2W8BA 1ONBA 5KYNA 1R0XA 3OM0A 1OBCA 3C8MA 4R84A 1WBBA 1CQZA 2V58A 6REQB 1R5OA 1SBIA 1TAGA 1YJ5A 3CJQA 3NVDA 2O19A 2M6SA 1QR6A 1WCYA 2B1GA 2P9CA 2VDNB 2Q9CA 5HKLA 1N0WA 2P9QA 4V0NA 1I2ZA 3D6MA 1TJ3A 1DDOA 1GNRA 3MBKA 3TFQA 3U62A 2D3WA 3QKIA 3V2IA 5JU6A 2PKYX 4D0SA 5CB6A 3HA5A 4I50A 1TQDA 4OHYA 1FSZA 2B37A 1JKMA 2ZQZA 4MV5A 2OHHA 4UFOA 3TW0A 1GL7A 4QBIA 4ZCTA 4KIUA 3AUTA 1BKSB 1EE2A 2I33A 1IIRA 3EGDB 1YZFA 3IMGA 1MX5A 2KX7A 4IYRA 3DDWA 3DLPX 1L7EA 2YWHA 3I0MA 4H7JA 1C50A 1Z9BA 1ULHA 1X7WA 3I01M 1GA4A 2IW1A 2XX3A 3CB4A 1KI6A 3EOAI 1GSAA 3K9LA 4TMFA 3SHTA 2ZSFA 5LQMA 4F7DA 1DIGA 2I7CA 1HOXA 3NUZA 4JOCA 4UKDA 4IVQA 3BJIC 3LJKA 3SEQA 1W6UA 1P9NA 2ZBRA 5HXAA 1WO8A 3C1OA 4QYWA 4WLFA 1A77A 2WA2A 3NNDA 3JQBC 3FLEA 1I10A 1Q0ZA 1QF7A 4O4LF 3Q8LA 2JJMA 1FFYA 3OCVA 1E5VA 1P29A 3IP1A 4JZKA 2AIRA 4OK3A 4A73A 2XGJA 3JQRA 3C45A 1Z2AA 2VYVA 1P31A 4QJ5A 3DQQA 5BUZA 3NYIA 2J0UA 4CKBA 3LWBA 1Q77A 1CEEA 1HI9A 2A0WA 1D6JA 3X0DA 1C8VB 4GF5A 3HCFA 2OEPA 3FBTA 2TECE 4XB6B 4DV7B 2JZCA 3EB9A 1VHJA 2E1PA 2Q21A 1PZNA 4PRZA 1UKVY 5HK8A 4F21A 1JU9A 3RO7A 5JFTA 4KLCA 4LF5B 3P2OA 4RK5A 2CY0A 3SHOA 1ETUA 4AJHA 4INPA 5D85A 5DNAA 2COUA 4JB3A 2NQ2C 1NYTA 3QBEA 1VHWA 1HE2A 4YRPA 3EPPA 3GFGA 1UPXA 3EIOA 2JF0A 5AI0A 3EBLA 1QRAA 1D9XA 1NASA 2JAWA 3DZBA 3FTDA 4HO1X 5KINB 4CKYA 1VHQA 3U7JA 3VZQA 5IT0A 4QBFA 3L43A 2PBLA 3T5BA 3CE9A 1K06A 3PC2A 4BEBA 2V4UA 3H3JA 3DTTA 1RD4A 3PQ8A 3DBLA 3DC2A 2VKQA 3KR0A 4CKXA 2JBWA 2LPMA 1SVSA 2J31A 5IZCC 5DTEA 1O7JA 2CLOB 1BS9A 2DT8A 4HYYA 2PGAA 1QO9A 5KO2A 1XPJA 4MQEB 3T7AA 2QGNA 4EF6A 1YJAA 4B2YA 2XOKA 5K0FA 4HS9A 2FQXA 2IXAA 3T3PB 1GTSA 4AUKA 2EARA 4RXTA 4AJLA 4BMYA 4XLZA 4KYTA 2XXJA 4TYPA 3EWSA 5G3YA 2G67A 4CBVA 4K1XA 1WB4A 3KAPA 4DJTA 3LKBA 5J2TB 3I76A 4QSHA 3SC6A 4A6EA 2D7CA 1Y37A 2JEOA 4YP9A 5JEEA 5CDSA 2BFCA 3ZGNA 5H4HA 1BS1A 3EZ9A 1MEOA 5EKSA 1QHGA 4RZSA 3CRVA 1NYLA 3E3NA 5AI6A 4FHDA 4O59O 4BFTA 3RYFB 1SBYA 2HXYA 2LCFA 5B53A 1U2QA 5CVUA 1KORA 1G2IA 1B93A 5EL0A 2B7CA 1QFJA 4RBNA 3FHLA 4LE1A 2I1QA 4IP0A 2GZSA 1GPYA 4RETA 3VI4B 3Q3JB 3KQVA 1YHYA 1KO7A 1ZC4A 3BWDD 1FDOA 4GP9A 1XTIA 2Q1SA 1SVNA 3H6GA 3IXLA 3OT5A 4ZOLF 5HWSA 1ZNXA 3A3PA 4YXWA 4F96A 2WYOA 4JDPA 2RKBA 2I6SA 2XNCA 3SMVA 2Z2JA 3H6HA 4F12A 2QG4A 4FBGA 4KRXA 1X7XA 4M4SA 4UUQA 4P93A 5K0JA 3RGGA 1YZ3A 3WLQA 4A26A 2WHEA 3KPVA 3HKBA 1YIOA 3STTA 1U7ZA 2QJTA 2AS0A 4AKSA 3GC6A 1JPUA 3QOYA 5FUQA 2EFGA 1FZTA 3NHUA 2AC7A 4EHJA 5ECYA 3BF7A 3PFHA 3TZQA 3PNMA 4TOIA 4CN9A 3H5AA 2DUJA 2J5RA 2AEJA 4M0PA 1AMNA 1U5CA 1H1LA 2WJJA 1Z8NA 5BNTA 3P2KA 1N0HA 2CT8A 1KEUA 2YJ6A 4R98A 1WEKA 4WZBA 3STVA 2R96A 5IBRA 3W1VA 4A03A 4EUHA 5JS7A 4J3FA 1UF9A 4EHBA 4GLLA 5EGSA 4WXEA 3QX7A 1FU7A 4X20A 5AW6A 2X2PA 3H2GA 4V0QA 4I99A 5K05A 2WF5A 4O6VA 4BO3A 3WWPA 4ER3A 1VLQA 1SKBA 3ZK8A 2VWHA 1KU0A 3KQNA 1SUCA 1T4CA 2PMKA 4U7JA 3ZI7A 4D43A 2OKGA 2JHPA 3LIPA 2I34A 2JFHA 5C8YA 3HSSA 5AW0A 1A9SA 5B6PA 4EGQA 1YR9A 3SS8A 5K9ZA 5KJ6A 1IG0A 4HX5A 2QDXA 2Y1CA 1O97D 3EWAA 1P2GA 2FZCA 5SY9A 2RC5A 3DHWC 4BNVA 4EUNA 2EJUA 2ZUFA 3P9IA 3VPGA 5I7EA 3R7WA 1L1EA 3LXXA 3F97A 2DHEA 2EEZA 4NK4A 1XTUA 1J5EB 4MP6A 1I0ZA 1UIMA 4G0VA 3IE0A 1VJCA 3T15A 1N2CB 4Y8VA 3GCZA 4KODA 2GA8A 2H1WA 3QU2A 4IHJA 1WZCA 4A6XA 5HBRA 4OXIA 2BGMA 3GPBA 1ZM3A 3ZVRA 1RWXA 5FFFA 1TD9A 2O7RA 1XZBA 4P4LA 1WZIA 4BFCA 1XF9A 3HEAA 4F85A 1GSHA 5I5EA 3C43A 1HYEA 2GD2A 2CVZA 3LX5A 4BATA 3BWVA 4QTYA 2CHGA 4E32A 1XCPA 4EFKA 4B47A 1KKUA 2I2WA 4GI3A 2ZROA 1T10A 4P33A 4AZ3B 2LDXA 2CVHA 1YK1A 4WNIA 3H84A 4EG3A 3JQPA 4WNAA 1ZHOA 1E2LA 1MJHA 1SIOA 1DARA 2ZG6A 4R7TA 1EVIA 2AYZA 3CX8A 1SCNE 3ZWWA 1OHHA 4KQFA 3NHKA 1K8RA 3TAHA 5H81A 2ZJAA 1ONSA 1X14A 1BJRE 2HJWA 3GRVA 4G5OA 2GXSA 2A58A 2IXGA 2OCAA 4IEIA 4KLRA 1RYMA 3S68A 2MTBA 5CR9A 3U40A 2EKDA 2W2TA 5B4VA 1KSJA 3OQMA 2NUBA 3MELA 4A5SA 2H4XA 2RAVA 1DKQA 3B3QA 3IBSA 2BKXA 3UK6A 5KEIA 1V96A 4WK6A 1C9MA 3GT0A 1WKBA 1VDZA 2O1SA 5KREA 1KGSA 2AYXA 5G0UA 4TQ9A 3MTDA 5BPFA 5AW8A 1AM4D 1X39A 1JF8A 3UANA 3QV2A 3BF8A 4KR9A 2B4TO 4N6OA 1B8PA 4CM9D 1EA5A 2Y1LA 5CX1B 1FMLA 4L74A 4PV7A 2G5CA 3SYTA 4RTKA 1TLTA 1UBEA 1BYUA 2AE1A 1QOQB 3B7WA 3LOUA 4K9LA 4Q34A 1E9EA 3HL0A 4RHTA 4XJVA 2BUAA 1R8QA 3I2GA 4NE2A 3JRNA 1Z88A 1JNYA 1ZM9A 2MSKA 4NENB 2P2NA 4B2IA 4FE3A 4EPXA 2PYIA 1G8HA 1UBJS 3QKUA 4US0R 1VLLA 1R4NA 2M98A 3WMGA 2IZOA 3T1OA 2Y1EA 1NWHA 2AEMA 2NNLD 3L6BA 3OPYI 2FWRA 1P62B 2Z56A 3WDLA 5EA2A 1Q0PA 3ND7A 3ZXXA 4AKEA 4BUCA 4EKGA 3TECE 4ED9A 5AQEA 3I64A 1AKWA 2GJ4A 3R3HA 1JKJA 5JATA 4NCIA 4FLMA 2QPLA 1V5FA 2W4QA 4BLVA 4HDSA 3M89A 3O2SB 4W8GA 1E0JA 1AURA 2C7GA 3EXEA 1C7FA 4WLUA 2OGTA 1UZNA 2PK3A 1UZLA 4HN4B 3BE5A 3HJRA 1FA9A 4TV8B 3ES9A 4H3KB 3T3IA 5CEFA 3MWDA 1GGHA 4MWBA 4YAUA 2BBSA 2J46A 2XTZA 2JCGA 3HKEA 3M6FA 1UXKA 5L3QA 1YCFA 2XWSA 4OQMA 3WY9A 5K2OA 4YMSA 3H6KA 3LQQA 4ZCPA 2BEJA 2WQ6A 1K9VF 3GLKA 4FVTA 2AD5A 1GU1A 1M10A 2MOKA 1CZHA 4BO6A 4J7XA 1UJMA 2JGFA 3RBZA 2AOXA 3RT7A 4DLUA 1VSBA 2NLOA 5E3JA 5BMVB 1OC2A 1RAGA 1NAHA 3A2LA 3PRHA 2XDQA 4RXUA 4CFYA 2NQ8A 4MCHA 5IT4A 4WDRA 1JUDA 3RTGA 1RJWA 2GAJA 5EXEA 1SGWA 2RDMA 3PL1A 4K40A 4EGFA 5JNLA 5ILOA 2B4YA 1JHPA 3ZWDA 4P0QB 1Z5ZA 2YJZA 3OIUA 2QYOA 3P9CA 3RVPA 2CXHA 5CT9A 1MH9A 5K0LA 3AJDA 2QTBA 4GW3A 1TVMA 2JI7A 4OJMX 1VQ1A 4EI7A 2IYOA 2E2WA 1UDBA 1OFVA 3FKSA 1E4OA 3AEYA 1RKVA 2X4GA 4GX0A 5BN5B 1M2FA 2JAHA 1S1CA 1EWRA 3RNOA 1HFEL 1NVDA 2B8EA 3GX1A 3MPOA 1Y9ZA 2B5WA 5HF8A 3THOA 3UHPA 3T5PA 1S8AA 5K03A 2WJAA 1WWKA 3BCUA 1UQRA 2Q6VA 4X84A 4H31A 1AUQA 5DI9A 1GNTA 3IIIA 3ZNOA 4EFMA 1ML3A 3H1TA 3IYLW 3EQ9A 3PNBA 4HGYA 1XI2A 5IVKA 4GZ6A 2CHFA 4QDKA 2HA6A 3SNHA 1C0KA 4DCGA 1JG2A 1FXWF 4LXUA 2AN9A 1TM7E 5CLHA 1PF7E 3SYNA 2XNDA 3AHFA 2BGWA 3FETA 2F17A 3CLSC 1WZNA 1UJNA 4AP5A 1F3LA 3WK4A 3RKSA 1N3IA 1T3ZA 3HP4A 3ILVA 4V0MA 1QX3A 2AR0A 1QGUA 3O1HB 4D6PA 2BFEA 1ICIA 3IX7A 1KK3A 4R83A 3K1AA 2IP1A 1RU3A 3GRZA 4FNAA 2GNAA 4JUCA 4PQEA 1RQ2A 5FJJA 3LY9A 1EK6A 2CXQA 3VC1A 5EXXA 2EKLA 3ON5A 3KAQA 4NS1A 4CV0A 1IDN1 5A5DA 4ME6A 5E2BA 3S44A 1VMEA 5ITZA 1GRNA 3CZAA 1PJ8A 3B1VA 3PT9A 3COSA 3TRHA 5F7XA 4ZZIA 3PGVA 5CXSA 5TGZA 5JWOA 3GLFA 5KDOA 1GG5A 2OZLB 1D4AA 3BA1A 4RJTA 1DUIA 5F33A 3AVWA 1HM5A 1MC5A 4DILA 2W8BB 4WKOA 1YDEA 1Z2OX 2ONYA 2W2LA 1JHYA 2A88A 1PBTA 2MSNA 3JVIA 4RZHA 3VPDA 1BMTA 3WMRA 4EGCB 1FX0A 1QP7A 1E4EA 4HRVA 2JB9A 3CM0A 2ONCA 1P6XA 4WASA 3JR7A 1CRLA 4N48A 2JC3A 5T4HA 5I7RA 3SE0A 3VPCA 1Z56C 4MYTA 3VZPA 1N6KA 1FZQA 1WX1A 5EXSA 5FUXA 4EMBA 3UMMA 4FINA 3HM9A 5LP1A 4CQMA 1XMVA 4E94A 1KP2A 3V4LA 2QS9A 4HDCA 4DTCA 4ITUA 1OXTA 3VQTA 1WUHS 2YXDA 1Z6TA 4V0LA 4QHYA 4UEKA 1T3LA 5EFZA 3DFUA 3L1KA 4A82A 2BR3A 1PZGA 2QD4A 2QL6A 5TEVA 3UK1A 3O8DA 3E0XA 4MPRA 1GLVA 2G71A 1E3JA 3JPYA 5HKAA 4F3TA 3FNGA 4ISCA 3EDCA 1TUIA 3PJRA 4CMJA 3A2KA 1FLDA 4INZA 3ACCA 1GNSA 3PVSA 1TQ4A 3A04A 3D8RA 2B21A 4BYMA 4DANA 2UUOA 1AGRA 3NXSA 2I62A 3GFSA 4ZT6A 3TRJA 4ITVA 4KZKA 2ALJA 3OZRA 3KHTA 5D3MB 2XZLA 4R3WA 1KAHA 3IERA 4URVR 4N7RA 3RSOA 4RY0A 1QK4A 3KR9A 4UTXA 2OQ2A 3QKRA 1G20B 2IH4A 2GJ9A 2D8AA 3TOVA 2A5YB 2WF8A 3ZVLA 2PT5A 3IFSA 2VH5R 3GDFA 1V1RA 2BI8A 1SO8A 1LPSA 2ZJ8A 1FSFA 3VU1A 5C4IA 4V0OA 1W93A 1W44A 3ETCA 1NR1A 4AWBA 5KNBD 5JLJA 4I2NA 3RH0A 4RKFA 3HH8A 2DRIA 5IVPA 4IEEA 1I4LD 5AKXA 4D81A 2YJ5A 1QO7A 1KR5A 4RLQA 4V0KA 3DEAA 5IYZF 1DIAA 1MFPA 1ZI6A 1XO1A 2ZSAA 3AESA 1WIWA 5AUNB 1CZUA 4GMXA 2YJGA 1CB7A 5HFAA 4RMJA 2O0JA 1Q1GA 2GPAA 3EVBA 4PC3A 4E03A 3ANMA 4LY9A 4HPWA 5C7OO 1B8NA 2ZYSA 3M3HA 4ETIA 4E1AA 3GZJA 2IH5A 2X7JA 4IIGA 3SJBA 5L4LA 1MJGA 2X2OA 4LI0A 1EXWA 2YIMA 4CMIA 2I4LA 1HT0A 3O03A 3T5AA 4JNKA 4J43A 4UEQA 1E8NA 4X60A 3SC3A 2DKOA 1KDTA 1XZ8A 1I80A 3DBLB 5JDIA 1OY1A 1PQ4A 2QTRA 3BE8A 2X40A 3HUUA 3IAFA 3AL2A 3EEIA 1C1HA 3JQGB 4TM8A 4WLNA 4RZUA 2Z95A 4ZCRA 4RUKA 2E1RA 2DLDA 5I3CA 1G5IA 5D6NA 2WSYB 1I30A 3W1EA 3W9UA 5BWMA 1CY2A 1A76A 2BJHA 5F3DA 3VRHA 1FFWA 2H18A 1FFSA 4LHSA 2GVDC 1JFFB 3W2IA 4FONA 2BFBB 4V39A 2BGUA 3S2YA 2IL1A 3FLAA 4ZC8A 1UC9A 4ARZB 3KT0A 1N8KA 3EZFA 5G4KA 4BV9A 4C2TA 1C9NA 2Q5LA 3I0ZA 3OESA 4FN4A 4GM4A 3IPCA 5EPUA 2A92A 3WISA 1R4AA 4XUDA 2J7PA 3V1NA 4LJ4A 3MGAA 5CT8A 1JHVA 1GQYA 1T0BA 5AKLA 5F78A 4HDKA 3W06A 2WHQA 4LF4B 3MSCA 3VYUB 1N0UA 2JG3A 1XMXA 3ZR4B 2GDJA 3UMRA 1OI4A 1R64A 2HFKA 1VSTA 2F1RA 3E7PA 3GCDA 5AOBA 1ABBA 1P75A 1OB2A 2D1FA 1LV8A 4RMIA 3UCFA 3V1LA 3UN1A 4HAOA 2Z3WA 1J1ZA 5DSXA 3THRA 1UBMS 4DPLA 4BLTA 2QA5A 3KUXA 2WTXA 4D44A 1ZP6A 2RH8A 1ZJZA 1D6NA 4W99A 3UG7A 2FK7A 2CBGA 2DWQA 1M2EA 3IPRA 3S1LA 3TL2A 5F23A 2WNHA 1RRCA 1R8JA 5ALSA 1Z37A 2DU8A 1F8GA 1H8HD 1R9MA 2V7TA 1L5ZA 3GJ0A 1UK7A 3OZDA 3MLBA 4JITA 1FPQA 2CDBA 2WAYA 3CMMA 2VSYA 1EVLA 2PSDA 1ENOA 5T6BA 4QRDA 3GQBA 3FA2A 4DJAA 3DNMA 5K1ZA 5ALEA 5ALMA 1OYOA 3PP8A 1MO4A 2AOTA 3PFIA 3K4HA 4Q21A 5AVYA 3AY7A 5DM1A 4IWNA 1Q91A 4ETWA 1YFJA 4RMHA 4RVOA 4O1HA 4TXJA 3URKA 5JYDA 3FWYA 4OTZA 2W6OA 3F7NA 3K35A 3U2QA 4B43A 2PS1A 2XKJE 4JLOA 2RGNA 1A9OA 1XFDA 3UWDA 1YFZA 1JEYB 3AMVA 3SZ3A 5HZGA 1R50A 4CU5A 2R3SA 5TNXA 4CMAA 2GOYA 1AKEA 3R5HA 2PMWB 5ALTA 1F06A 3F6CA 2QLBA 2AQHA 2OHIA 3HVUA 5GV8A 3UGJA 1GZVA 3ND9A 2WIJA 3F1KA 5TPZA 4AN4A 3DB1A 3H0KA 3D3JA 2YCLA 1M34A 1GCIA 1XJ0A 5K3AA 3TMYA 4I4CA 1OUMA 5JD4A 1Z13A 2WPDD 3LSYA 2TRSB 2CXRA 3VMMA 4EA9A 5JEDA 3OOWA 4H7DA 3CH6A 3ZZ0A 3ORFA 5BUSA 2EG9A 1T4CB 3MTIA 1FDTA 1Z7WA 2Z2XA 2FWIA 3R5TA 4CT5A 2IZ6A 1N0IA 3WBBA 2XUOA 5C8YB 1US8A 2BC9A 3DJYA 5DTQA 3R5KA 4GM0A 4MQBA 3QX8A 3EWNA 3UUEA 4WL0A 5CW2A 4D9KA 2I65A 1RS0A 4PLZA 2QT1A 2JZNA 3R7WB 3UT6A 2ZYVX 4UPDA 3K05A 4YRNA 3GBPA 4TLLB 3TSAA 1L7QA 5A0FA 2IXBA 3OJXA 2QD2A 5CB8A 4N5NA 4I14A 1GZDA 1VKOA 2ZTLA 4IHJB 4YA6A 1ZUNB 1HXHA 3A06A 4JGBA 4PM4A 4R40A 5AVKA 4DC1A 4EW1A 2ZTMA 4B48A 2HHHB 4H0NA 1KF0A 1ZH8A 1NF8A 2PLFA 2JASA 1ZONA 3F5MA 3GVCA 3SBXA 1NUUA 1QIKA 1SK8A 4CM4A 4CZ2A 1EFPA 2D3TA 1XA3A 2FAXA 1NSFA 2O5CA 1JHRA 3HRIA 3WMEA 1NSYA 3L8YA 1E2KA 2XMDA 3DZHA 1MRSA 3AIMA 3M6WA 4WNAB 5LKRA 1PVOA 1ZLYA 1XU4A 3SD7A 1XVLA 1JB9A 3ESCA 4ZDIA 4ZQBA 2REOA 2Q4TA 1MOQA 1QNFA 4JBNA 1UEIA 3QNWA 3DLBA 1SOMA 2CN1A 4R31A 2Q2NA 1EI9A 3K8OE 3M2TA 4LPKA 1OROA 1U5BA 2VCHA 3L1UA 5FYQA 4LDAA 3GGCA 4XB2A 2PZ8A 1HNXB 3AX6A 4WGFA 1WDTA 4YXWD 1RI4A 1SUAA 2FHPA 1JLSA 4FGKA 2ZW9A 4OJNA 2VDQB 3DPSA 3E70C 4L4ZA 5ER9A 5SZKB 3TGPA 1Z74A 4G84A 4HNRA 1X15A 1LK5A 4GH5A 4DJ5X 3OUTA 1SWVA 5EJ9A 2OGWA 4QLOA 1TNDA 3KZVA 4O02B 4FWTA 1WY7A 1D8AA 2NYRA 5JSFA 4BLWA 3OZIA 4YX9A 1VB5A 3L4SO 2VT7A 3BERA 2XUKA 4II3A 4BXOB 4YCLA 1OLOA 1LB1B 1MO3A 3E3OA 2I66A 3I83A 1GPJA 4O4LA 3X1DA 5IK2D 4D80A 3R3XA 1E3TA 3I6ZA 2YIJA 2X1VA 3MOGA 3LVFO 5DNVA 2L0XA 1C4XA 2P9EA 3QVGA 2W4MA 3C1AA 3HCEA 2O8CA 4HDNA 3M9XA 3Q3GE 4UAUA 1U0BB 2VNJA 5CGZA 4BVGA 1ZWKA 1E7YA 1EXMA 2Z8YM 4IXDA 2RBKA 5K6AC 3U4CA 2GYUA 2PS3A 4M1MA 5EZYB 1MIHA 1NUAA 4CM3A 4A36A 3QQ5A 1U1DA 2RHWA 3UVEA 4HDSB 3ROMA 3P9RA 2OP1A 4RVNA 2GHRA 3JQ9A 4KIGA 1YB2A 3L3BA 1G42A 3R8XA 2O2DA 2Q27A 3PEEA 4PCAA 1RMQA 5DTMA 5LZ5A 1HR0B 2GKOA 2RMKA 2O48X 2VZ0A 1PFWA 2Y4OA 3VTFA 1FDVA 4V2IA 3RJ9A 2C3UA 2CJPA 4KI7A 4CL8A 2P2ZA 3HKEB 3KJFA 3A32A 3FMIA 3EY9A 5JRDS 1Y89A 1CC1S 1CLUA 4HK4A 3NIWA 3UV6A 2RIRA 3ESAA 3BD9A 4C0XA 1L7MA 1WM1A 2AA3A 3UJPA 5LVAA 2OK8A 3A9CA 4XOIA 3REGA 4L0MA 1COWD 1GP2A 1N5OX 2XDQB 3KE9A 3O75A 3BGWA 3ZHTA 4FYJA 2DP4E 4IV8A 5DJ5A 5ANRB 3SG0A 2XBUA 4RVGA 5KYXA 4P36A 7ADHA 4ND7A 1Y3CE 4EJFA 1G5RA 3UK0A 2PTGA 2HMWA 1Q11A 3STXA 4TTPA 1Z73A