2COMA

The solution structure of the swirm domain of human lsd1
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
124
structure length
124
Chain Sequence
GSSGSSGEEPSGVEGAAFQSRLPHDRMTSQEAACFPDIISGPQQTQKVFLFIRNRTLQLWLDNPKIQLTFEATLQQLEAPYNSDTVLVHRVHSYLERHGLINFGIYKRIKPLPTKKTGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the SWIRM domain of human histone demethylase LSD1
pubmed doi rcsb
source organism Homo sapiens
molecule tags Oxidoreductase
molecule keywords Lysine-specific histone demethylase 1
total genus 22
structure length 124
sequence length 124
ec nomenclature ec 1.-.-.-:
pdb deposition date 2005-05-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2comA00
3KP3A 3DFGA 2AXLA 3ULQB 4M71A 4EGYA 3D5LA 4BQAA 1TQPA 2L4AA 1XMAA 3QPTA 4OOIA 1WQ2A 1ZG5A 4L18B 4HF0A 3F8CA 1O3TA 2E7XA 2A61A 4HZFA 1FLIA 1USSA 2Z5UA 3IHUA 5AIQA 5F64A 4IJAA 1P4AA 1HQCA 1HKSA 2F5EA 2EFPA 3FM3A 4RGXA 3KP5A 1BI3A 4MNUA 2BYVE 5CJ9A 4MHGA 4RAZA 3E5XA 5K5RA 3P7NA 4Y13A 4UVAA 4H0EA 2VBYA 1B59A 2O03A 5K5OA 2Q8KA 3RDIA 3F72A 5F1RA 1U2WA 4RGUA 3KZYA 1F4KA 1B1BA 1MDMA 2FEZA 1ODDA 2DPUA 1Z9CA 1FBSA 4R79A 4YFKF 2NNNA 2EV0A 2XAJA 2PJPA 3BOQA 4XBFA 3RPUA 1MZBA 5JR3A 4RB3C 4GYGA 3TO7A 2QUFA 1FSHA 1HKQA 2ADUA 1FP1D 4G7HF 2VOPA 1USTA 1SFXA 3GFLA 3LA7A 1JHFA 2DAOA 2PMHA 4KNYA 1T38A 5E17F 1OYYA 3C7JA 1KQ8A 4PDKA 3HSFA 3BY6A 2XVCA 3F8MA 4BH9A 4Q47A 4WXHA 2W57A 4XSZF 3KP2A 2H6CA 3MZHA 4WXDA 3V7CA 2ZNYA 2HGCA 2W85A 1R1VA 1V3FA 2DI3A 2Z99A 5ERIA 4EQQA 3CUQC 1DP7P 5JI6A 3WU1B 3RKXA 4XSXF 1FNNA 4HLYA 2PMUA 3KEOA 5EEHA 4CZZA 5FFXA 4KA4A 2EV6A 1KA8A 2XHKA 2ZXJA 4M73A 5AONA 5LEJA 2DU9A 5ILVA 1JGSA 3IRRA 1SD7A 4A0YA 1P2FA 3T1BA 3LAPA 2VE8A 4CICA 4MGRA 3WTVC 5E18F 2VN2A 4EJOA 1SAXA 1FYKA 2NAZA 5CVJA 4HA8A 1GXQA 3P9IA 1P92A 3HRMA 2GA2A 4FX4A 1BM9A 2J5OA 3COAC 1YW7A 1LEBA 4ENMA 1WKMA 2G7UA 2Q2EA 3MEXA 4F7ZA 2NYXA 1CGPA 4WXCA 3CUQB 1I5ZA 2HWVA 4YFXF 2ZMEB 5ILSA 4EM1A 2OZ6A 5EEGA 2X4HA 5D8KB 4LMYA 2NNYA 4P9UA 1BBYA 2MD5A 3RYPA 2XGXA 1LJ9A 1U5TC 2V1DA 4AIKA 3FMSA 3IKTA 5FLXZ 5DUIA 3U1DA 3VEPA 4EVIA 1YG2A 3VOEA 1CF7B 1Y0UA 5KVRA 1MJ9A 1W7PB 1S6LA 4GCVA 1RI7A 4O3MA 5E1XA 2Q0OA 2A3SA 1W7PD 4RB2C 1J75A 5FB2A 5DCMA 3EETA 5BS6A 1G3YA 1E2XA 3BJOA 1G3TA 5LHGA 3GUDA 1T2KA 3ZMTA 3LAJA 4WWCA 2CG4A 4I0BA 1IZ1A 1J5YA 1MJBA 3U2RA 4LGWA 1JXSA 1TW2A 1JHHA 1YTYA 1BC7C 1XD7A 4A0ZA 2OU2A 5LRSA 1BN5A 4EJUA 2HS5A 1TQIA 4LK0F 1ZRCA 3CUOA 2M87A 4HQEA 2O0YA 3DV8A 1FY7A 2L01A 4GO1A 2W84A 1EV7A 1H0MA 3T8TA 3WGGA 2HR3A 2GXGA 3E97A 1P4WA 3EYYA 2P5KA 2P7VB 2OAZA 5TJJA 1O7FA 3QPHA 2DT5A 3J80Z 1YW8A 1O3RA 4ENNA 2QBYA 1WWXA 2LNBA 4LJZF 1XGSA 2XV4S 4Y17A 3C1DA 2JPBA 5LRRA 3B02A 2PG4A 4KIFA 3WGIA 2VC1A 4WX9A 3L7WA 3JTGA 5K5QA 2P5VA 4CDGA 2HZTA 1NHAA 4G6DA 1H9TA 1ZYRF 2ZO4A 3HSRA 4OINF 3WTTC 1STZA 1MJAA 3EDPA 2ZCWA 2R7FA 3ABUA 1KYWA 4Q5SF 5D5WB 3GX4X 4XLPF 2EWNA 2K7LA 5L3DA 2NS0A 3KP7A 3B73A 2DLLA 1FP2A 4M9XA 1TNTA 2XRNA 3I5UA 2A68F 1LDJA 1I1GA 2CSOA 4IRIA 3E5UA 3M1EA 3BZ6A 2YX4A 5FO5A 2QQBA 3HOSA 1LVAA 2CW0F 2QYOA 2K02A 4RGSA 4MTDA 1U6GA 4G9YA 4N0BA 4GGGA 4HYEA 4A2UA 2MH2A 2BV6A 2EA2A 4XRFA 2A6EF 3M8FA 4I09A 3DPLC 5D6EA 2W24A 1ONVA 1HW1A 2MBFA 3REOA 3SZPA 4U7DA 1R1TA 1LQ1A 1EH8A 3RKWA 3E6MA 2M8EA 1YO5C 1FC3A 1UFMA 3GFMA 3GEZA 1TBXA 2CO5A 3F8FA 2BBYA 4A6DA 2A69F 2RNJA 2DBBA 2HKOA 3BP8A 3K1PA 3IL2A 4D0PA 4NHJA 4BHPA 1RUNA 5FGMA 3KEQA 2UXNA 1S8NA 2IA2A 1K79A 1BIBA 2Z3YA 1D8KA 3RPQA 2HTSA 1HSTA 1I27A 2XUBA 4MQVA 2O8XA 4IXAA 3V7RA 1TTYA 1R5GA 5A2QK 4NQWA 3PQKA 3GZ5A 3QU3A 4ZH4F 3DPTA 5HDNA 3GLXA 2JPCA 1FZPB 4KN4X 1ON2A 4E70A 5J6XA 2MA3A 2EFNA 3HSEA 4U0VA 1IF1A 4Q4ZF 3O6BB 2PBIA 1XDUA 4A5MA 1D3YA 2L02A 4OIPF 1XB4A 1F5TA 4PGGA 2XIGA 4BHBA 4RB1A 2FMLA 4HV5A 1ZARA 1MD0A 3ZQ7A 3VODA 3KZZA 4IHSA 2QWWA 2FBIA 2D45A 1TW3A 2FA5A 3RTRA 2EB7A 1FBQA 5CVUA 5ED4A 1S29A 1U3EM 2DTRA 1V4RA 1Z1DA 1FT9A 3BPXA 5CVVA 2IJLA 5J8FA 3I54A 2XKPA 1PP8F 4ASNA 2P5LC 1ZRFA 2LDUA 2YU3A 1BI1A 1O7LA 4K2EA 4ENJA 5HLIA 3HIFA 2IP2A 5HLGA 1P4XA 2FOKA 1KYZA 1XSVA 3I4PA 1U5TB 5DCMB 3WTSC 2H09A 2OZUA 1U5TA 4KICA 3F21A 3ISPA 1WSUA 1U78A 2MLGA 2PEXA 2PN6A 3GZ6A 3DKWA 3E3VA 2L4MA 3GVAA 2R7DA 1SFUA 2HYFA 2A5YB 4OMYA 4MQ9F 5CVIA 2FBKA 2E7WA 2DPDA 5DEQA 6PAXA 5DV5A 3HTSB 4WCGA 4AD9A 1KU9A 2C6YA 4HQMA 1HXDA 2BE5F 2P6TA 1IN4A 4KN7X 2FU4A 1UCRA 2VBWA 3GFJA 5L3GA 4JK1X 5ICGA 2H6BA 4HDUA 4A5NA 2B0LA 3FZVA 3NQOA 4LG0B 1HSJA 1UHMA 3PFIA 5D4SA 2KJBA 2EFQA 2UZKA 3M9AA 2GXBA 1VTNC 1K78A 2ZKZA 3ZN0A 3TO6A 4HF2A 3Q5FA 1MKMA 2YPRA 3EYIA 2E1CA 4HF1A 2BGCA 3HOTA 2V79A 4QLCU 3W6JB 2KIFA 3FM5A 3HHHA 4KDPA 5ICFA 5DD8A 3GFIA 2G9WA 3V8LA 3K2ZA 2ZMEA 2DK8A 4YFNF 5HLHA 5LHHA 4MTEA 2V1XA 4P5OA 1GVJA 1QPMA 4L5JA 5FD6A 1S3JA 4IPAA 3L09A 1FBUA 1UHWA 1FX7A 1Z6RA 2VE9A 3FMRA 5FLXK 3R0AA 5H6QA 2HDCA 1RZ4A 5LEKA 4ESJA 1TNSA 3PQJA 3K9TA 2D1HA 3R0JA 4IRHA 4ZYDA 3WTXC 4TV7A 3H92A 4A6EA 2H27A 5J8CA 3WU0A 1R23A 5HDGA 2WWYA 1ZGAA 4ON0A 1B6AA 4OU0A 3EQLF 5IT9Z 1MDMB 1ZRDA 1HKTA 1O3QA 4M9ZA 2HTJA 3WTYC 1DUXC 2VC0A 4AVPA 1S7AA 1XGNA 1J2XA 1OYIA 1IW7F 3WODF 2V1UA 1GXPA 2RKHA 3AAFA 4R8HA 3TGNA 2VODA 1IXCA 3I64A 5D6FA 3M8EA 4EMSA 1T0FA 4CGZA 1OMIA 3I71A 5LGUA 3K69A 5HS8A 5BMZA 3HHGA 3KETA 2CYYA 3KCCA 2IVMA 2M5WA 5HDKA 3FXQA 3F8NA 3O2PE 2FMYA 1XSDA 4UV8A 1IXSB 1ZG3A 4EM0B 2YSRA 2GIVA 2YX7A 1DPUA 5DUKA 3J7AO 3NRVA 1G6NA 4Y15A 2EJRA 4HX4A 2XKOA 2OQRA 1XGMA 3BPVA 4ESBA 2A07F 3G73A 4FX0A 2Y75A 4DQ2A 2OBPA 3FXRA 4AIJA 2HQNA 4HX8A 2FBHA 5E1ZB 5BPDA 4ZZLA 5AIPA 1KU2A 1XGOA 2DO7A 3N4MA 4O6JA 4M9SA 3F22A 4CHUA 1YIOA 4M6YA 3TOAA 4Z2YA 2RV8A 1PP7U 3ZN1A 1Z05A 1KQ9A 3HRUA 4HOBA 3MAJA 1EH7A 5JHUA 4G7OF 1I6XA 2FSWA 2K27A 1L3LA 3JSPA 1PUEE 3SQNA 3ZMVA 2O6GE 3KLNA 1WRJA 3V7SA 1ZH5A 4BXUA 1B4AA 2JTVA 1LB2A 3IWFA 3F8BA 1AOYA 4UXNA 3O3KA 1B9MA 5D5XB 1XCBA 2P7CB 4UV9A 1OKRA 3F6OA 2ETHA 4A0XA 3IKVA 3ZMSA 1IN5A 2IPQX 2PI0A 3KE2A 1SFEA 1OR7A 1Z91A 3CO6C 3I59B 4XLNF 5LHIA 3E6DA 2LSOA 1GHCA 1O57A 4N9IA 2FNAA 5TRDA 5HOOA 1YS7A 4R1HA 2P8TA 2F2EA 5CVRA 2QZ8A 2DQRA 1IN6A 5L3EA 1QZZA 4L9VA 3HYIA 1ZHFA 4ETSA 2IT0A 5IT3A 2EFWA 3ZMZA 4HV6A 3OOPA 5D5UB 1R58A 4PZJA 5JVTA 2HEOA 1K7AA 4I2OA 1XCVA 1OPCA 2YR2A 3KP6A 4IF4A 3LWFA 2GAUA 3J80K 3M7GA 2ZBKA 3WE2A 1A04A 2MC3A 1SMYF 1YFHA 2JSCA 2ZFWA 2M45A 5E8IA 1QZYA 3BROA 2XAHA 1LNWA 3BJ6A 2PFBA 3SFZA 3KP4A 4KT5C 5FD5A 1DDNA 3RKYA 3LSTA 3E6BA 1R00A 2IRFG 5JFRA 2F5DA 3QP6A 3HRTA 4JBAA 1HBXG 3CTAA 1J7KA 2EK5A 1QBJA 4LB6B 2XASA 4BYYA 2QM3A 5DD4A 3L00A 2XROA 2GQQA 4QWQA 1YW9A 2KKOA 1BIAA 2D1VA 2VT2A 1LEAA 3ML6A 3FHZA 1YLFA 3RYRA 4L9TA 4U0YA 3HRSA 3JTHA 3LQRA 3E6CC 3R6SA 4B8XA 3FX3A 1QQIA 3S2WA 3F23A 4BAYA 3HUGA 1J59A 1L0OC 3C3WA 3MQ0A 4N9HA 4LD5A 4LK1F 2KJCA 2HFHA 5D5VB 1ZG1A 4YIFA 5DCFA 2HKXA 3ROUA 1R5HA 3H3ZA 3I0TA 3V8JA 2A6HF 3KFWX 5A2QZ 4RS8A 2NRAC 2RDPA 1X3UA 3H3UA 3D0SA 4BNCA 1Q1HA 1T39A 3CO7C 5LGTA 3VFZA 4YIIA 3FXUA 1UB9A 5D8LB 4CYDA 1XN7A 3HTUA 3WG9A 4ZYEA 3P9KA 5LGNA 1TLHB 4KYWA 2R3SA 2P4WA 2K4JA 1FYMA 1R22A 3JSOA 1ZREA 4DNCA 5ICEA 2RC4A 4WF2A 4EGZA 3T8RA 4G7ZF 1G3SA 3K0LA 3Q9VA 2ZNZA 3SXYA 2IA0A 3ZP5A 3R4KA 2MLKA 4UNOA 1FPQA 1QNTA 4ESFA 2WC2A 4OIRF 1O3SA 1XMKA 4G8XA 2XAFA 1YS6A 4G6QA 1HW5A 2ELHA 3ERED 1IN7A 5E20A 2FE3A 3QRFF 3BJAA 3EUHA 4RAYA 2UXXA 4GXOA 3R60A 1IN8A 4GYIA 2EA4A 3JAMK 1D8JA 4KFCA 4NB5A 1E17A 3BDDA 1R7JA 1W4MA 2KIMA 2VOOA 2DW4A 2QQ9A 1CF7A 1W5TA 2RN7A 1WI9A 2O3FA 5LBQA 1HW2A 2XAQA 2ACJA 2EFOA 5BPIA 5BOXA 1KGSA 4EV0A 2FNPA 5ILUA 2VBZA 3TQNA 4ZZDA 4LLGF 2ESNA 2OQGA 3GO5A 3TOBA 5FFZA 2L3DA 4JQFA 1P6RA 5L3BA 4UVBA 2STWA 1OYWA 3U9GA 1Z6TA 3DF8A 4UVCA 1ZLJA 5HS7A 1ZLKA 2E1NA 1H9GA 3DEUA 3JW4A 3IC7A 2ZJ2A 3ECOA 2HQRA 1BJAA 4M6XA 4ZYGA 1YYVA 3TO9A 4KMUX 2ISYA 1J0RA 2M30A 4WK8F 2F5CA 3QAHA 2BEOA 4U88A 2QVOA 2V9VA 2EV5A 3L9FA 3MFKA 3K1MA 3ZMDA 1FYLA 4OIQF 4I98B 5CLSA 3RIRA 2FRHA 3GWZA 2COMA 3K1NA 4L0ZB 3WTZA 2D2WA 3I58A 2RGVA 2JT1A 4RB0A 4IHTA 2LF7A 2WV0A 1YQAA 2JRTA 4MEXF 1FOKA 5DYMA 3CUQA 2VONA 2QLZA 2ISZA 4IRGA 4I01A 5K1YA 4CXFA 1Z7UA 3QOPA 2KRFA 4P9FA 1J9IA 2XAGA 1G3WA 3GXOA 4U7BA 2GZWA 1JE8A 3W6KB 2HOEA 5ICCA 4OIOF 4U0WA 2OD5A 4O5VA 4P55A 3RJPA 4EJWA 1QO0D 2HYGD 4EJVA 4A12A 2CGPA 4L5IA 4FT8A 1ON1A 2FXAA 1IRFA 1R1UA 1QGPA 4LB5A 3FMQA 3LFKA 4LG0A 2WTEA 3LQQA 5DDGA 2GA1A 3C18A 1C0WA 4M74A 4HDVA 5BQTA 1BOAA 3Q9SA 1ULYA 2STTA 2QENA 1SMTA 3LA2A 1BI0A 2ESHA 3T5XA 1K6OA 1B9NA 1RIOH 2DK5A 3F6VA 1KU7A 1D5VA 3QP5A 4HLXA 1W5SA 4M72A 5H6RA 1TQMA 1SD6A 2K86A 3ELKA 2Y0MA 4PCQA 4I0AA 5IT9K 1R36A 1IUYA 1SD5A 5LLQA 3I59A 4HW0A 3TKYA 2PQ8A 2P6SA 3WTUC 1LDKB 3ABTA 3RI4A 4LLNA 3MZYA 4OMZA 4CO8A 2Y48A 3T0YA 2PLYA 3R61A 4EM2A 1F1ZA 1IAWA 1DPRA 2DQLA 4L0YB 2UWMA 2RVCA 1K78B 2CQKA 1G4DA 3FWEA 1T98A 2Z33A 1XDSA 2V6CA 2IA1A 1RNLA 1KQ0A 4HAMA 4ENKA 5HS9A 3FF5A 1FSEA 2KIUA 1REPC 2F5FA 3GW2A 3J81Z 3L2CA 3WGHA 2MH9A 4UUVA 1PDNC 3WTWC 4YG2F 2Z9OA 4AWXB 4AIHA 2O61A 3V4GA 4FHTA 4HX7A 3MCZA 4HBLA 1BC8C 4RGRA 2DFIA 1ZAOA 2VXZA 2J5PA 3TDZC 2QQAA 1S7OA 1ZGJA 4IVNA 2X0LA 2QBYB 3ECHA 4I7HA 2IW5A 4KIGA 5E8GA 2AS5F 2H94A 5CYVA 4LLLA 5E1WA 2FF4A 4S05A 3CJNA 3I53A 5KK1A 2M1BA 2CFXA 3JAMZ 2W25A 3CDHA 1I1SA 5L3FA 5D4RA 2VT3A 1XSXA 4B09A 1RUOA 5H20A 1T6SA 3NEUA 2FQ3A 1MGTA 4UHTA 3IWZA 1AWCA 3CLOA 3SZTA 3DP7A 5L3CA 4MEYF 4P96A 3QU6A 3VB2A 1W7PA 4KIBA 1F9NA 3DQVC 3GF2A 2RQPA 3GYHX 5F6FA 3E5QA 2LF8A 5HVQC 4KMFA 3V8KA 3TDUC 1LDDA 4I02A 3LA3A 2TDXA 3IRQA 2LKPA 3SHFA 3N97A 2VBXA 1U8RA 3BWGA 4S04A 4LFUA 4EJTA 4Q48A 4ZYHA 2L54A 3WE3A 3G3ZA 3ZMUA 3OV8A 2CWEA 4BHCA 1ZN2A 1FWZA 3P9CA 1SD4A 3ZPLA 3KLOA 2K4BA 2GWRA 4KUMA 1IRGA 1BI2A 4L9NA 2G7HA 1EH6A 3J81K 1IXRC 4PGHA 3MWMA 2JZYA 1KU3A 4G94A 2OA4A 3F3XA 4L9JA 3DXJF
chains in the Genus database with same CATH superfamily
3KP3A 3DFGA 4ZJZA 2AXLA 3BTLA 3ULQB 4M71A 4EGYA 3D5LA 1LFBA 3ZQCA 2PX9A 4BQAA 1TQPA 3FKIJ 3PO2J 2L4AA 2R5YA 1XMAA 3QPTA 4OOIA 2CMPA 4B1RA 4MLOA 4QPQA 4CCOA 4YRVA 1WQ2A 1ZG5A 2ZC2A 3D1NI 4L18B 4HF0A 4M3FA 3F8CA 1O3TA 2E7XA 2A61A 3HG9A 4HZFA 2VXDA 1FLIA 4PJJA 1VZ0A 1USSA 1LUJB 2M8GX 4BJTA 2Z5UA 3IHUA 5AIQA 2R7UA 5F64A 3AL0B 4IJAA 2R0QC 1P4AA 1HQCA 1HKSA 2F5EA 4MFDA 2EFPA 3FM3A 2LBFB 1X2NA 4RGXA 3KP5A 2LOOA 1BI3A 4MNUA 4JYKA 2BYVE 5CJ9A 4MHGA 4RAZA 3HOZJ 1P7JA 3E5XA 5K5RA 3P7NA 2QCOA 4Y13A 1MH3A 3AKZA 4BJ5C 4UVAA 4H0EA 2VBYA 3NWSA 9ANTA 1W5CC 1B59A 2RQQA 1O4XA 2O03A 5K5OA 2Q8KA 3RDIA 1RRJA 2F5VA 4HRIA 3F72A 5F1RA 1H8AC 1U2WA 4RGUA 3S1QJ 3KZYA 1F4KA 1B1BA 2R7OA 1GUUA 2E2IJ 4BBRJ 3I9V2 1MDMA 2FEZA 1ODDA 2DPUA 3W2WA 2CQNA 2DT6A 4F55A 2JK3A 2KISA 3CDIA 1FBSA 4OWRB 4R79A 1Z9CA 2IGMA 4YFKF 2NNNA 3F9KA 2EV0A 3M3YJ 1W36D 2UV1A 2XAJA 2PJPA 4BGDA 2DODA 2NVQJ 4UB6C 3BOQA 1VQ4I 2ELJA 3OYAA 4LOCA 4F92B 1B72B 2BY3A 4XBFA 3RPUA 5EEAA 1D0YA 1MZBA 2EINH 5JR3A 2M4KA 4RB3C 1DGRM 4GYGA 4PSXA 3S2DJ 1DU6A 3GMEA 3LFUA 1ZQ3P 2GOXB 1LKXA 2QUFA 3TO7A 1HKQA 1FSHA 1UZCA 3ABLH 1FTZA 3A01A 2CW8A 2ADUA 1FP1D 3P5JA 4E7HA 1Y0NA 4G7HF 2VOPA 1USTA 2LFBA 1SFXA 3GFLA 5F08A 3LA7A 3BG5A 1JHFA 2DAOA 2PMHA 5IP7J 4KNYA 3PSIA 1T38A 2H8WA 4XRSA 1OYYA 3TP3A 5E17F 3C7JA 4A3MJ 3QYEA 1KQ8A 2V1NA 4PDKA 1EA3A 1Y1VJ 4JP0A 4JX6A 3HSFA 2PMZA 2TRTA 3K4BA 3BY6A 4M3GA 2XVCA 3DKYA 1VQLI 3F8MA 4MIMA 2L7MP 4BH9A 1SFKA 4Q47A 4WXHA 3KEYA 2W57A 4XSZF 2A6TA 3KP2A 2VJJA 2H6CA 3GTMJ 3MZHA 4WXDA 2OC6A 1FJLA 2WBMA 3V7CA 2ZNYA 5CQGA 4U87A 1R49A 5HNFA 2HGCA 1WHUA 4FE7A 3CCYA 2W85A 3SFIA 4G6TB 4A93J 4NC7A 3CDLA 1R1VA 1V3FA 2DI3A 2Z99A 4PK4A 2P0WA 5ERIA 2COBA 4EQQA 3CUQC 1DP7P 5JI6A 2K9SA 3WU1B 1JTXA 2VKDA 2CW7A 4JX4A 3RKQA 1X1CA 2TCTA 4XSXF 3RKXA 2Z2SB 3A0BC 3BR6A 1FNNA 4HLYA 4X0GA 2GM4A 2PMUA 3KEOA 3C2GA 5EEHA 4CZZA 5FFXA 3O8HA 3A02A 3TL4X 4KA4A 2EV6A 1KA8A 2XHKA 2ZXJA 2LKXA 4B3AA 2DMQA 4M73A 5AONA 5LEJA 2DU9A 2V26A 5ILVA 1JGSA 3IRRA 4AYBN 1SD7A 4A0YA 1P2FA 3T1BA 3LAPA 4FCYA 2DOFA 2VE8A 4CICA 4MGRA 3WTVC 2ZJPF 5E18F 2VN2A 4EJOA 1SAXA 1FYKA 2NAZA 5CVJA 3DLAA 4DZJA 3NARA 3LSJA 4HA8A 1ENHA 1GXQA 3S3NA 3P9IA 1P92A 1HC8A 3HRMA 4A3EJ 1D5YA 2GA2A 4FX4A 4AU7A 1BM9A 1LFUP 2J5OA 3COAC 1YW7A 1LEBA 4ENMA 1WKMA 2MSYA 4PJNA 2G7UA 2Q2EA 3MEXA 4F7ZA 2K9MA 2NYXA 2DA5A 1CGPA 4WXCA 3CUQB 1I5ZA 2HWVA 3HL2A 5FROA 2CH0A 4YFXF 3W2VA 2CS3A 1LPQA 2ZMEB 5ILSA 4EM1A 2OZ6A 2YS9A 1I3AA 3LSKA 5EEGA 3GTJJ 5FKNA 2X4HA 5D8KB 4LMYA 2NNYA 4P9UA 5K7HA 1TT0A 4JX5A 2FOWA 1BBYA 2XGCA 2MD5A 3RYPA 2XGXA 1TZLA 1KONA 2X51A 1LJ9A 1U5TC 3CCQI 3OYNA 2V1DA 4AIKA 3FMSA 3IKTA 5FLXZ 2KLOA 2VIXA 3JRGA 5DUIA 5EJCA 5FLMJ 3U1DA 2LC2A 3VEPA 3AG1H 4NQWB 1T8IA 4EVIA 4F52A 1YG2A 3VOEA 1CF7B 1Y0UA 1QVTA 5KVRA 1MJ9A 1W7PB 3LSHA 4CA0A 1QRYA 1S6LA 4OAZA 4GCVA 1RI7A 3U21A 1QHHD 4O3MA 5E1XA 2Q0OA 2E2HJ 2PJRB 2A3SA 4XICA 1W7PD 3PSFA 4RB2C 1J75A 3SDGA 5FB2A 1NG6A 2LMDA 5DCMA 3EETA 3H1CA 4DZPA 4Y7NJ 5BS6A 4BBSJ 3IH2A 1G3YA 1E2XA 3BJOA 3N05A 1G3TA 2MW8A 3GUDA 3DWLE 4RAGA 5LHGA 1T2KA 3ZMTA 3LAJA 4WWCA 2CG4A 4I0BA 1IZ1A 1MMSA 1J5YA 1DU0A 1MJBA 3Q0WA 5EG0A 3U2RA 1UELB 2QF7A 4LGWA 1JXSA 4CH7A 4CZCA 1TW2A 4PSWA 4XK4A 2E1MC 3CLQA 1JHHA 1YTYA 1BC7C 2XSJC 1XD7A 4A0ZA 4IHVA 2OU2A 3WG7H 5LRSA 1BN5A 4W97A 4BKXA 4EJUA 3VDXA 5GTIC 3OWTA 3FISA 3PJRA 2HS5A 1TQIA 3HOXJ 4LK0F 1ZRCA 1R4MB 3CUOA 2M87A 4HQEA 2O0YA 1YIJI 2W48A 3DV8A 3GTLJ 1FY7A 2L01A 4GO1A 2W84A 3OYLA 1W36C 1EV7A 3CCSI 1B8IA 1H0MA 2YU9J 3T8TA 3WGGA 2CFOA 3BG9A 2E1OA 2HR3A 3AL0C 3GTPJ 3PNTA 2GXGA 3E97A 1P4WA 3EYYA 3ASNH 2A05A 2P5KA 2P7VB 2OAZA 3GLLA 5TJJA 4A3JJ 3L2WA 1O7FA 3QPHA 1X3ZB 2DT5A 1V54H 3OIOA 3G6EI 4J19A 3J80Z 4BS9A 1YW8A 1O3RA 4XOPA 4N4NB 4ENNA 2QBYA 1BOBA 1WWXA 2LY1A 2HOTA 2LNBA 4LJZF 2DYRH 1XGSA 2K9NA 3ZQIA 2EIMH 2XV4S 4Y17A 3C2HA 3C1DA 2JPBA 3K4NA 2OTJI 1MMNA 2P81A 2OTLI 1S72I 3CCLI 5LRRA 3B02A 3DEEA 2PG4A 3JRBA 4KIFA 3M1CA 3OR2C 4Y4RA 2A5WA 3WGIA 3S8PA 2R93J 2VC1A 3G4SI 1MSEC 4WX9A 3L7WA 2AO9A 5K5QA 2P5VA 3JTGA 4CDGA 5C3EJ 3CJTB 3PL8A 5GADJ 4BE0A 3A01B 2HZTA 1NHAA 4G6DA 4BJ6C 1H9TA 3M07A 1ZYRF 2JMWA 3A4CA 3F0CA 2ZO4A 3HSRA 2ZXHA 2X1DA 4OINF 3WTTC 1STZA 4HG2A 5GP9A 1MJAA 3EDPA 4YIRX 3I56I 1YI2I 4V19K 5EDNA 2ZCWA 2R7FA 1ZELA 4M3BA 3ABUA 4MO7A 1KYWA 1TWCJ 4Q5SF 1ETWA 4XMYA 3L2UA 3KYDB 2F4MB 5D5WB 2RAEA 4XLPF 3JRHA 3GX4X 3HOWJ 2EWNA 4V2GA 1S5LC 2K7LA 2JN6A 2NS0A 3G1OA 5L3DA 2L7FP 3KP7A 1PUFB 3EUHC 3B73A 2DLLA 3H35A 1FP2A 4BDYA 5J1RA 4M9XA 2HVSA 1TNTA 2XRNA 3I5UA 2A68F 2KHMA 1LDJA 3HJEA 1I1GA 2CSOA 2XAUA 2OCCH 4IRIA 3E5UA 3M1EA 3BZ6A 2YX4A 4CCNA 5FO5A 2LYCA 4XKWA 4H4KC 1ORKA 2EIJH 3WU2C 1QHGA 4BDZA 2QQBA 3X2QH 3H3VK 4XORA 3OY9A 3BZCA 3CF5F 2IBDA 4YEJA 2M34A 2K40A 2VQCA 3HOSA 2GLOA 1LVAA 2CW0F 1FIAA 1B72A 2QYOA 3BCBA 5LD2C 3ESWB 2K02A 3SJMA 4RGSA 4MTDA 2ZJQF 1U6GA 2XSDC 3MKWB 2IAIA 2F48A 4G9YA 4N0BA 4GGGA 1VQOI 4XLAA 1BW5A 4HYEA 1ZK8A 4A2UA 2MH2A 3V42A 2BV6A 2EA2A 2R7QA 4XRFA 4B48A 2A6EF 2BY1A 3BTCA 3M8FA 4ZDPA 3FXMA 1S9HA 2W4SA 3O8GA 4I09A 3DPLC 3I3LA 3E1SA 5D6EA 1IC8A 4IO9F 2W24A 2WV1A 1ONVA 2XB0X 3M8JA 1HW1A 2OUMA 3IV5A 3SZGA 2EBIA 1XMXA 2H1LA 2MBFA 2NVUB 3REOA 3SZPA 4U7DA 2BOLA 2DA2A 1R1TA 5F27A 1LQ1A 1UJ8A 1EH8A 3RKWA 3PIOF 3E6MA 2L9SA 2M8EA 4CCLA 1YO5C 1FC3A 1UFMA 4C2TA 3EPZA 4AVZA 3GFMA 1Y56A 3ERMA 3GEZA 4M6VA 1Z3YA 3JCUC 4BEHA 1TBXA 2DOEA 2VJIA 3QODA 2CO5A 3F8FA 2BBYA 4A6DA 2IGNA 1X3WB 2A69F 2RNJA 3AFHA 5FRNA 2DBBA 2XB5A 2HKOA 4BXFA 3C2BA 2RREA 3BP8A 2EPFA 3K1PA 5KCMA 4AC0A 1RETA 4D0PA 3IL2A 4NHJA 1RR8C 3K4JA 4BHPA 1F36A 1RUNA 3CQZJ 5FKOA 5FGMA 3DTIA 3JRDA 1NK2P 2E19A 3KEQA 4IOAF 2UXNA 1S8NA 2IA2A 1ZTRA 3CCMI 1K79A 2R7TA 1BIBA 2Z3YA 5KAFC 3OYFA 2VKVA 1D8KA 2ME6A 3RPQA 3ZQLA 2HTSA 4S0HB 1HSTA 1Y1WJ 1I27A 2XGEA 1VNDA 2XUBA 1BW6A 1A6QA 2O8XA 2V7FA 4IXAA 4MQVA 2JVGA 3V7RA 1TTYA 1R5GA 2I8DA 5A2QK 2ZSHB 4DJAA 4NQWA 3JREA 3GTQJ 3DU5A 3PQKA 3CC4I 3GZ5A 4NUBA 3RCOA 4F91B 2KQRA 3QU3A 4ZH4F 1IRXA 5EGOB 3DPTA 5HDNA 3GLXA 2HNHA 2JPCA 1FZPB 4KN4X 5JVGF 1ON2A 3M4OJ 4E70A 5J6XA 2MA3A 2EFNA 2E71A 3HSEA 4U0VA 2KL4A 1IF1A 1R71A 4Q4ZF 3O6BB 2PBIA 2IS4A 4A3IJ 1XDUA 2QSFX 1D3YA 2L02A 4A5MA 4OIPF 1XB4A 1F5TA 2FX0A 4PGGA 2XIGA 4BHBA 5GAGJ 4RB1A 1H89C 1WJBA 2FMLA 4HV5A 1V55H 1ZARA 1SC7A 1JT0A 3L2QA 2ID3A 1DP3A 1MD0A 1FOWA 3ZQ7A 3VODA 3CCUI 3KZZA 4IHSA 4XR6A 2QWWA 2FBIA 2D45A 1WJDA 1TW3A 2EZKA 2FA5A 5J1UA 3RTRA 4XNFA 3CD6I 2HVQA 2V4JC 3KZIC 2EB7A 1FBQA 5CVUA 5ED4A 3L2VA 2OF7A 1S29A 1U3EM 2DTRA 3FXLA 1V4RA 1Z1DA 2R7VA 3OL3A 5FKKA 1FT9A 3BPXA 5CVVA 4A3FJ 2IJLA 5J8FA 3I54A 2XKPA 1PP8F 1FOXA 4ASNA 3GCMA 3LNQA 2P5LC 1ERDA 1ZRFA 2LDUA 2YU3A 3AG2H 1DGWY 4B47A 4Y52J 2M4GA 1WGXA 2WAQN 1BI1A 1RPWA 3EUKL 1O7LA 2MG4A 2QKLB 2DA1A 3K7AJ 3OYKA 2CV0A 4K2EA 2R5ZB 5HLIA 4ENJA 1K4SA 1DQUA 1OCOH 3HIFA 3RZOJ 2IP2A 5HLGA 2E1MB 1P4XA 4RM3A 2FOKA 5M5WJ 1KYZA 1XSVA 4J01A 4IOCF 3I4PA 4XKCA 3HOYJ 1YHQI 1U5TB 5DCMB 2VLAA 3WTSC 5M3MJ 2H09A 5C4JJ 4HNTA 2OZUA 2K3FA 1U5TA 4KICA 3F21A 3ISPA 5FKLA 1WSUA 1K83J 3DTKA 1U78A 1W1WE 2MLGA 1NTCA 2MABA 5E3MA 2PEXA 2MYSA 2PN6A 3HXLA 3GZ6A 3DKWA 3DCFA 3E3VA 1JKQC 2L4MA 2JA2A 4DYQA 4BU2A 4RM2A 3BQYA 1LE8A 1YE9A 1Y6IA 1OISA 4KJZA 1Z3XA 3GVAA 2R7DA 1SFUA 2JA8J 1EKEA 2JA5J 2NS7A 1JT6A 2HYFA 2A5YB 4OMYA 4MQ9F 1UHSA 5CVIA 2FBKA 2E7WA 1E3PA 2DPDA 5DEQA 6PAXA 1MBFA 1VQPI 5DV5A 1V5FA 5TISC 5JLWA 3HTSB 4WCGA 3H9GA 4AD9A 1VQ5I 1OCCH 1KU9A 5DM7F 2IXSA 3BLYA 2C6YA 1NG7A 4HQMA 1HXDA 5JHFA 2BE5F 2P6TA 1IN4A 4IX7A 2JSPA 2FD5A 2N8GA 4KN7X 4Y33A 1OR7C 2FU4A 3BG6A 1UCRA 1JI8A 2VBWA 1U9NA 3GFJA 5L3GA 1CQTA 4JK1X 4D5FA 5IOYA 5ICGA 2DMUA 2H6BA 3HBLA 4HDUA 4A5NA 4IHWA 1BA5A 3DPUA 2B0LA 1JUSA 3MKLA 3FZVA 3NQOA 1D1CA 4LG0B 1HSJA 4MFEA 1UHMA 1HA8A 3OYCA 3PFIA 4II2A 3H5RA 5D4SA 2KJBA 2EFQA 1Y39A 2UZKA 2LTPA 3M9AA 2NOGA 3IH4A 2GXBA 2DCEA 1VTNC 5J40A 1K78A 2ZKZA 1AHDP 1BR2A 3ZN0A 2CV2A 4RMNA 3TO6A 4HF2A 3Q5FA 1MKMA 2YPRA 4ZTJA 3EYIA 2E1CA 4ZDOA 2CQXA 4HF1A 2BGCA 2V79A 3HOTA 2X6XA 2O5RA 4QLCU 3W6JB 2HI3A 2KIFA 3FM5A 3LSPA 3HHHA 3CMYA 4KDPA 5ICFA 3DTEA 5DD8A 3GFIA 2G9WA 3V8LA 3K2ZA 2ZMEA 2DK8A 3QQAA 1BR1A 2Y0SN 4YFNF 5HLHA 3CMAI 5LHHA 4MTEA 2V1XA 4P5OA 1I3QJ 4RLQA 1GVJA 1XTAA 3L2RA 1QPMA 4L5JA 5FLVA 4XM3A 5FD6A 2KP6A 2BVLA 1S3JA 2X48A 4IPAA 3FK6A 3L09A 1FBUA 1UHWA 1FX7A 1Z6RA 2VE9A 1FTTA 1I6HJ 5JLXA 2DFFA 3FMRA 4JOMA 3JRCA 2KDZA 5FLXK 3R0AA 5H6QA 2OV7A 2NS8A 2HDCA 1GVDA 1RZ4A 5LEKA 1FIPA 4ESJA 2R5ZA 1TNSA 3PQJA 1YRNA 2JQ7A 3G71I 2L9NA 3K9TA 3DLLF 2D1HA 4CUGA 3R0JA 4IRHA 1Z67A 2GOMA 4DW6A 2VI6A 4ZYDA 2R92J 2Q1ZB 4N4OB 3WTXC 3ZQFA 3OS2A 1ETKA 4TV7A 3CC2I 3H92A 4A6EA 2H27A 5J8CA 1Y8QB 3WU0A 2CQ7A 2JA6J 1R23A 2F4IA 5HDGA 2VKHA 2WWYA 1ZKGA 2ELKA 1ZGAA 1MH4A 4ON0A 1B6AA 4UY8I 4CYCB 4BQOA 2LR8A 3CMMA 3W6VA 3S1NJ 3VSKA 1OCZH 2Y30A 3EQLF 4OU0A 5IT9Z 1Z7LA 1MBJA 1MDMB 1ZRDA 1HKTA 1O3QA 4M9ZA 2HTJA 2HDDA 2RNGA 3GTKJ 3WTYC 2X1EA 5EZGA 1U8BA 1DUXC 4X6AJ 2VC0A 1D0ZA 4PUSA 2JUGA 4AVPA 1S7AA 1XC5A 1XGNA 4PFPA 1H88C 1T0FC 1J2XA 1OYIA 1IW7F 1V5EA 3OMYA 3RQ4A 3WODF 2V1UA 3PUBA 2L0KA 1GXPA 2RKHA 4R8HA 3TGNA 3AAFA 2VODA 2BZTA 4BQNA 3HPHA 1IXCA 1WJEA 2V9PA 2XRLA 4FISA 2QA4I 3I64A 1K4TA 5D6FA 4DBQA 5B1BH 3M8EA 3AG4H 4EMSA 3HB9A 1T0FA 3VSLA 4CGZA 1OMIA 3I71A 3TW7A 5LGUA 3K69A 4AM3A 5HS8A 4BUPA 4PFOA 5BMZA 2EIKH 3HHGA 1SANA 3KETA 2CYYA 3KCCA 1BJZA 1TL8A 2IVMA 2M5WA 4BY1J 1YJWI 5HDKA 4ABZA 3ZQHA 3FXQA 3F8NA 3O2PE 3BR1A 2FMYA 1XSDA 4UV8A 1IXSB 1ZG3A 4EM0B 2YSRA 2GIVA 3JRIA 2YX7A 2WADA 1DPUA 5DUKA 3J7AO 1WPKA 3NRVA 4BACA 4D9JA 1G6NA 4Y15A 2EJRA 5CQEA 4DOZA 2GBYA 4ITVA 4HX4A 2XKOA 4M3DA 4RDUA 2OQRA 1XGMA 2W82A 2UUZA 1UMQA 3BPVA 4ESBA 3QOEA 3G73A 2GIZA 2A07F 4FX0A 2Y75A 2LRDA 5IY5H 4DQ2A 2OBPA 1WVRA 3LSMA 3S32A 2VASA 3FXRA 4C9YA 2KIQA 3GTOJ 4AIJA 2DJIA 2HQNA 2LP0A 3OS0A 4HX8A 2FBHA 5E1ZB 4NC6A 5BPDA 3OYHA 3OYJA 5HNHA 4ZZLA 3PFYA 5AIPA 2L7KA 1KU2A 1XGOA 2HDWA 1NK3P 2VPRA 3LSRA 2KPMA 3HEFA 2DO7A 3N4MA 4O6JA 1UAAA 4M9SA 3OYBA 3F22A 4CHUA 1YIOA 4M6YA 3HGGA 2HXOA 3TOAA 4Z2YA 3L1PA 5KAIC 2RV8A 1PP7U 1BL0A 3ZN1A 1Z05A 5F1JA 1KQ9A 2BW3A 3HRUA 4HOBA 3MAJA 1EH7A 5JHUA 2HVRA 4G7OF 5E3NA 1I6XA 2FSWA 3OSGA 1ETVA 3FBNB 2K27A 2O7OA 1YJNI 2DOAA 1L3LA 3JSPA 2WB1A 1OCPA 1J09A 4A3GJ 1PUEE 2LH9A 3SQNA 4BXXJ 3ZMVA 2KT0A 1ETQA 2O6GE 2CJJA 3CJRB 3BR3A 3EUAA 2HXIA 3KLNA 2AQFA 2E2JJ 2VQGA 1WRJA 2KRHA 3V7SA 1ZH5A 4BXUA 5HODA 4DYRA 1B4AA 2JTVA 1LB2A 3IWFA 4B44A 3F8BA 5B5EC 1AOYA 5BNGA 1JUMA 1SVMA 4UXNA 3O3KA 1B9MA 5D5XB 1XCBA 3ZQGA 2P7CB 4UV9A 1OKRA 2QKMB 4C2UA 4HSRA 4B4CA 2R7RA 3F6OA 2ETHA 4A0XA 3QPSA 1AA7A 2E5ZA 1Q1VA 2BHZA 3IKVA 3S1RJ 3ZMSA 4BEHB 1IN5A 1UG2A 2IPQX 2HZDA 2YUSA 2PI0A 3KE2A 3MD2A 1SFEA 1MNDA 2X85A 4XOTA 3DEWA 3WHCA 4IHXA 1OR7A 2EZHA 1Z91A 3CO6C 3I59B 3HC7A 4XLNF 5LHIA 5KNLA 1SVLA 3E6DA 2MD0A 2LSOA 1GHCA 1F43A 3B6AA 3MVPA 1O57A 4N9IA 3NAUA 2HYJA 2HQAA 3A03A 2FNAA 4XL9A 4CCKA 5TRDA 2NOJB 3SDBA 1OJLA 3G1LA 2JVHA 3BTIA 4CCMA 5HOOA 1YS7A 4R1HA 1QZEA 3UNGC 2P8TA 2GXAA 2F2EA 3OL4A 2XGDA 1ZGWA 5CVRA 2QZ8A 2DQRA 1IN6A 3ABMH 2FQ4A 2LBFA 1QZZA 2Y9YA 5L3EA 4L9VA 2DMPA 3OIQA 2DDAA 3HYIA 1ZHFA 4ETSA 3G2BA 5IT3A 2IT0A 5DM6F 2EFWA 3ZMZA 4HV6A 2FJ1A 1QA6A 3HM5A 3OOPA 5D5UB 1HLVA 1R58A 1OCTC 4HPQA 4PZJA 5JVTA 3FBIB 1R4NB 2HEOA 1K7AA 4I2OA 1GV5A 1XCVA 1A36A 4XKBA 2BY2A 3OYDA 1OPCA 2YR2A 3KP6A 4IF4A 3OIPA 4C3HJ 3LWFA 4FQGA 2GAUA 3S15J 3J80K 2ZMEC 3M7GA 1FOYA 2ZBKA 3WE2A 3HDDA 1A04A 1WJCA 4IQ4A 1A5JA 2MC3A 1EF4A 4GDFA 1SMYF 1YFHA 1ZR4A 3H0DA 2JSCA 1VI0A 2L2OA 4PJLA 2ZFWA 2M45A 5E8IA 3G1MA 3OS1A 3GBGA 4C30A 1SAUA 1N77A 1QZYA 3VYSB 1X1BA 3KYCB 3LMMA 3OYMA 4YELA 2HOSA 3BROA 5IP9J 2XAHA 1N75A 1LNWA 1KZHA 4XLCA 3BJ6A 2PFBA 3SFZA 3J7YJ 2DA3A 1OQYA 4E6KG 3KP4A 4A3BJ 4KT5C 5FD5A 4BY7J 4QSHA 3ABKH 4CSWA 3K4KA 1DDNA 3RKYA 3K4CA 2M0CA 3LSTA 2B63J 3E6BA 4II3A 1R00A 2IRFG 3VYTB 2HQ5A 3BR5A 5JFRA 3CCVI 2F5DA 1MBGA 3QP6A 4LITA 3HRTA 3PO3J 4JBAA 1HBXG 2JRMA 3Q0VA 3GTGJ 4EATA 3CTAA 1J7KA 2BXYA 2EK5A 3QPLA 1IG7A 1QBJA 1GDTA 4RA2A 3HOVJ 4LB6B 2BY0A 2NVXJ 2HPMA 2K9LA 2XASA 4BYYA 2QM3A 5DD4A 1R9TJ 2R7SA 3BTJA 3L00A 3W3CA 2XROA 4XRMA 4I6ZA 5GPAA 1X4PA 2ICWG 4IL6C 2GQQA 4FE4A 1RR7A 1TWHJ 1VQKI 4QWQA 1YW9A 1R5ID 3K4LA 2KKOA 1BIAA 4NC8A 5EG0B 4IKFA 2D1VA 4XN3A 2M7BA 4E4HA 2VT2A 3D5RC 3IH3A 1LEAA 3ML6A 3FHZA 1YLFA 3RYRA 4P1WA 4DYCA 4L9TA 4U0YA 3HRSA 3QYBA 3JTHA 3VYUB 4LIUA 3LQRA 3VPRA 3E6CC 3R6SA 4B8XA 3FX3A 1MMAA 1QQIA 3S2WA 2L5QA 2E5NA 2CQQA 3F23A 3U1KA 4BAYA 1W0TA 1TP4A 1VQ8I 3HUGA 3CZ6A 4HNVA 1J59A 4HEA2 1MSFC 1TT5B 1L0OC 1P7IA 3C3WA 3MQ0A 5KHDA 2OJED 3OYEA 3S14J 4N9HA 4LD5A 4LK1F 2KJCA 1OLTA 2HFHA 4E7IA 5J4YA 1FEXA 1T33A 4UUSB 5D5VB 1ZG1A 4YIFA 3FDYA 2OCEA 1QPIA 5DCFA 2HKXA 3ROUA 1R5HA 3H3ZA 2KMUA 3I0TA 3V8JA 2A6HF 3KFWX 5A2QZ 4XRSG 2ZFUA 4RS8A 2NRAC 2MGQA 2RDPA 3I4NJ 2FUG2 2B7EA 1X3UA 2DN0A 2X1CA 2VJ4A 2IEKA 4HNUA 1NH3A 3H3UA 3H5NA 3D0SA 1HDPA 4C3JJ 4BNCA 4HSTA 1Q1HA 2K3PA 2W1OA 2OPTA 1T39A 3ZGKA 3CO7C 5LGTA 3VFZA 3DBLB 4YIIA 3FXUA 4GRIA 1UB9A 2Q2EB 1TC3C 1T95A 2LVSA 3MN2A 5D8LB 2IGOA 2VB6A 1A31A 4CYDA 1XN7A 3BT9A 2MC4A 2LG4A 3HTUA 3WG9A 4ZYEA 3P9KA 5LGNA 3TW6A 1WJ5A 1TLHB 4KYWA 2R3SA 3FKJA 2I5UA 4UB8C 2P4WA 2K4JA 1FYMA 1R22A 1XX5A 3JSOA 4FTHA 4DNCA 1ZREA 2HU9A 2XF6A 4E7JA 4E7KA 1ETXA 2M2EA 5ICEA 2RC4A 2R4GA 4OAYA 4WF2A 4EGZA 3OSFA 2W7NA 1YJ9I 4DBRA 3T8RA 4G7ZF 3KYLA 4BE2A 5J47A 1G3SA 3K0LA 2VQHA 2ZNZA 3Q9VA 2IA0A 3SXYA 3ZP5A 3R4KA 1IGNA 4V2FA 2MLKA 2F4OB 2QQ8A 4UNOA 1FPQA 4A69C 2M3AA 2QSGX 1VQ7I 1QNTA 4ESFA 3I4MJ 1ETYA 2WC2A 4AIDA 4OIRF 1O3SA 1XG1A 1XMKA 2ZB9A 1VQ6I 4G8XA 2XAFA 3JR9A 2IS6A 1YS6A 2R7XA 4G6QA 1HW5A 1VQ9I 3S1MJ 2H8RA 2ELHA 3QWLA 5B66C 3J7AY 2JWTA 3ERED 1IN7A 2QEXI 3Q0UA 4EEFG 5E20A 3DU6A 4A3CJ 2FE3A 3QRFF 1PJRA 2KZVA 3BJAA 2DA4A 3EUHA 4RAYA 2UXXA 1IDZA 2VQLA 1LVKA 2E36A 4GXOA 3R60A 1IN8A 2EQRA 3HKZA 4GYIA 5B1AH 2EA4A 1JGGA 3JAMK 4M3EA 1JTYA 1D8JA 4KFCA 2X6YA 4NB5A 1E17A 3BDDA 1WCMJ 1R7JA 1W4MA 2KIMA 2VOOA 1MMGA 2DW4A 3VYRB 5GAEJ 1Z0XA 2QQ9A 1CF7A 1W5TA 2RN7A 2XC7A 3CMEI 1OCRH 1WI9A 2EZLA 2O3FA 5LBQA 1AU7A 1HW2A 1X4OA 2XAQA 2ACJA 4I99C 4E7LA 2EFOA 5K7FA 5BPIA 5BOXA 1KGSA 4EV0A 1IO2A 2L9RA 2FNPA 1JKPC 3A2KA 3RSNA 5DTDA 5GTHC 5FRMA 5ILUA 2VBZA 1IDYA 3TQNA 4ZZDA 4LLGF 5H2FC 4XLFA 2ESNA 1A35A 4FETA 2OQGA 3GO5A 5J3LA 3SEQA 3TOBA 5FFZA 4C3IJ 2L3DA 4JQFA 1P6RA 5L3BA 5EYRA 4UVBA 5CKTA 2PMZN 2STWA 1OYWA 4ANJA 5M5XJ 4KISA 2XDVA 3U9GA 4CYCA 1MIJA 1Z6TA 3DF8A 4UVCA 1ZLJA 5HS7A 1ZLKA 3JRFA 1JJ8C 2DA6A 2E35A 3ZOBA 2E1NA 1VQNI 1H9GA 3DEUA 1U0JA 3JW4A 5IOZA 3JRAA 3IC7A 2ZJ2A 4F93B 3ECOA 2HQRA 4DIQA 1BJAA 1RESA 2WY7Q 3IAS2 4M6XA 1YYVA 4ZYGA 2R7ZJ 3TO9A 2XF7A 4KMUX 2ISYA 1J0RA 2M30A 2R5YB 3DBHB 1G8XA 4WK8F 4XN0A 5C4XJ 2F5CA 4RLFA 1POGA 1G2HA 1MW7A 3QAHA 2DT7B 2O9LA 2BEOA 4U88A 4KITB 1D1AA 4IQJA 2K9QA 3HPGA 1Z77A 2BW3B 3LSIA 1N78A 1K6YA 2IS2A 5GPCA 2QVOA 2V9VA 2EV5A 2EILH 3L9FA 5IYBJ 1HCRA 3S2HJ 3MFKA 3K1MA 2JA7J 2ZSIB 3ZMDA 1FYLA 1Z21A 4XLHA 4OIQF 1TWGJ 4UUTA 4I98B 5CLSA 1IJWC 3ZQQA 3RIRA 2FRHA 3GWZA 2COMA 1LFPA 3K1NA 4L0ZB 3WTZA 2D2WA 3I58A 4A3LJ 1WH7A 2RGVA 3CP8A 3CESA 5DS9A 1YOVB 2JT1A 4RB0A 4IHTA 3HOUJ 3BR2A 1YX5A 2F6CA 2LF7A 4XKVA 2WV0A 1YQAA 2JRTA 4E7SA 2B9SA 4MEXF 1FOKA 1SFOJ 1IV8A 3OYIA 1I39A 5DYMA 1SEUA 3CUQA 2VONA 1QVUA 3CCEI 2QLZA 2G0EA 5EZHA 2ISZA 3CP2A 4IRGA 2WAFA 3FXOA 1VFCA 4I01A 5K1YA 4CXFA 3MZ8A 1Z7UA 2EH3A 2HOAA 3QOPA 1N25A 3MKYB 2KRFA 4P9FA 1W0UA 1J9IA 2XAGA 1G3WA 3GXOA 3K6GA 5E3OA 2GZWA 4U7BA 2H1KA 3HUGB 1JE8A 2ME0A 3W6KB 2E34A 3LL7A 2HOEA 5ICCA 5B3SH 4OIOF 4U0WA 2KRCA 4CCJA 3GZNB 2OD5A 4O5VA 3QYFA 4P55A 2X6OA 1G59A 4ZTFA 3RJPA 4EJWA 1WJAA 4A3DJ 1QO0D 5E79C 1T08B 2HYGD 4EJVA 1PUFA 2V9KA 4A12A 1YITI 4PJ0C 1JJ6C 2CGPA 2LY2A 3BQZA 4L5IA 4FT8A 3K70D 1RKWA 4W1UA 1ON1A 2DFEA 2FXAA 2XPUA 1JKOC 1IRFA 1R1UA 3H36A 1QGPA 4LB5A 5M3FJ 5K7ZA 2LKSA 2Z1DA 5F0CA 3FMQA 3LFKA 1TWFJ 2DYSH 4LG0A 5LFAA 3PNVA 2WTEA 3LQQA 5DDGA 1EJ9A 1YX3A 4D5CA 2X9DA 2BHYA 2GA1A 3C18A 5TGTA 1C0WA 4M74A 4HDVA 5BQTA 1BOAA 4UUSA 1HF0A 3PUFA 3Q9SA 1ULYA 2STTA 2LLKA 2LREA 2QENA 1WZ2A 1SMTA 3LA2A 1BI0A 2ESHA 4ZDLA 3T5XA 1K6OA 1B9NA 1RIOH 2DK5A 5EGOA 3H5AA 3NWTA 3F6VA 1MBEA 1SVOA 3FHNA 1KU7A 1D5VA 4PJMA 3QP5A 4HLXA 1W5SA 3OR1C 4IZZA 5EF6A 4M72A 5H6RA 3TEDA 1TQMA 4NBQA 1SD6A 1FMVA 1X1AA 3UR3C 2K86A 3ELKA 2Y0MA 4PCQA 4B43A 5J4VA 3SEZA 4I0AA 5IT9K 1R36A 1IUYA 1SD5A 5LLQA 3I59A 3W2AA 3DBRB 4HW0A 3TKYA 1AKHB 5IYDJ 2KFDA 1MNEA 2PQ8A 2LD5A 2XF5A 1APLC 2P6SA 3WTUC 2LY9A 3TMOA 1LDKB 2EZIA 3ABTA 3K2AA 5CPRB 3RI4A 3MZYA 1MBHA 4LLNA 4IHYA 4OMZA 1IUFA 2MFZA 3LSGA 3S3OA 3B6CA 4I76A 4B3XA 4CO8A 2Y48A 3T0YA 2PLYA 3R61A 4EM2A 2L9VA 2BXZA 1F1ZA 1E3OC 1IAWA 1FMWA 1WJFA 2PJRA 5J1YA 1DPRA 2DQLA 4KT6A 4L0YB 3H0GJ 2AHQA 2UWMA 2VL8A 2RVCA 2Y9ZA 1K78B 2CQKA 1G4DA 3FWEA 1MNMC 1T98A 2Z33A 1XDSA 3FIWA 5HLTA 4LIVA 2V6CA 2IA1A 1RNLA 2IGKA 2O8KA 1KQ0A 3PIPF 3S16J 4HAMA 1WFXA 4ENKA 5HS9A 3CF2A 3FF5A 1FSEA 4AYBA 3J7ZI 2KIUA 1REPC 2F5FA 3GW2A 5F0FA 1YRNB 2KDOA 3J81Z 2X6WA 3S93A 2DDBA 3L2CA 3WGHA 2MH9A 4L5EA 3WHBA 1PDNC 2DMTA 3H9JA 3WTWC 4UUVA 4YG2F 2Z9OA 3ASOH 4AWXB 4BL0B 4AIHA 2AXTC 3HKZN 5E3LA 2O61A 3V4GA 4FHTA 3H9QA 3S3MA 3FXJA 4X1EA 1ACIA 2E60A 1GT0C 4QPOA 2ZXWH 1TWAJ 4HX7A 3CJQB 3MCZA 4HBLA 1BC8C 1X58A 4RGRA 2AQEA 1X19A 2DFIA 2M9HA 3K10A 1ZAOA 4AUXA 2NVTJ 3ZR8X 2VXZA 1LE8B 2J5PA 3TDZC 2CUEA 2QQAA 2VKEA 1XS9A 2L7ZA 3RPUD 1WI3A 3K70C 1S7OA 2KZGA 1D1BA 3E0JB 1ZGJA 2WA0A 4IVNA 3D5SC 3SYTA 1R6RA 1VQMI 1QU3A 2XPVA 1D0XA 2X0LA 2QBYB 3ECHA 4I7HA 1JUPA 2IW5A 3ZRGA 1Y8RB 4KIGA 1MMDA 5FJ8J 5E8GA 2AS5F 2H94A 5CYVA 2BVMA 5E1WA 4LLLA 4J00A 2FF4A 4S05A 4NNJA 3RQIA 2DJNA 2M0MA 3CJNA 1UG0A 2Y2ZA 3I53A 4XLEA 2M1BA 5KK1A 2WY8Q 4D7NA 3BG7A 4Y3OA 3BZKA 2CUJA 3I55I 2ZJRF 1I50J 2I10A 1X2MA 2Y69H 3A0HC 4QTRA 2CFXA 3FXKA 3JAMZ 1JKRC 2VPLA 2W25A 4NDLA 3TBIA 4C2MJ 3CDHA 4DGWB 2DMNA 1I1SA 5L3FA 5D4RA 1X1PA 5IPAA 2LK2A 1IV6A 2VT3A 1XSXA 4B09A 1RUOA 1V5GA 2VJ5A 2Y31A 4LG3A 2DTZA 2NXNB 1MBKA 5F0HA 5H20A 4D7MA 1T6SA 3NEUA 4RAFA 2FQ3A 1MGTA 4UHTA 4E7ZA 2ID6A 3KIOA 3IWZA 2WAEA 1AWCA 3CLOA 2WAQA 1U9OA 3SZTA 3KX2A 1ITYA 3DKXA 3DP7A 3UKGA 2IS1A 1AKHA 1BR4A 5L3CA 2D5VA 1IRZA 4MEYF 4P96A 3QU6A 1ZR2A 3MMYB 5C44J 3K4MA 2VUMJ 3TP0A 4XQFA 3VB2A 2CV1A 3HGYA 1W7PA 3CCJI 1A6IA 2CUFA 4KIBA 2JJ7A 1F9NA 3DQVC 1K61A 4F3QA 3GF2A 2CRGA 2RQPA 2DXIA 3E7LA 2XPWA 3GYHX 3AG3H 1RC9A 5F6FA 3E5QA 2W00A 5F04A 2DFHA 2LF8A 4QIWN 5HVQC 3BG3A 4KMFA 1X1DA 1PVEA 3V8KA 1T56A 2CUZA 4XONA 3TDUC 1PYVA 1LDDA 4I02A 3LA3A 2JUCA 1WH5A 1M1EB 2TDXA 3IRQA 2K5CA 2LKPA 4A3KJ 2QGUA 3ZCOA 3BR0A 3SHFA 3CCRI 1HDDC 2V6EA 3N97A 1E0EA 5FKMA 2VBXA 3A1YA 2K85A 3HZJA 1U8RA 3OYGA 3BWGA 4S04A 4LFUA 2Y0SA 4EJTA 3Q3SA 4ZC3A 4Q48A 3RZDJ 2DA7A 1GV2A 1ETOA 2L54A 4ZYHA 2NVYJ 2QSHX 3OOUA 4D1QA 1E3HA 4FASD 4ZYAA 3WE3A 3G3ZA 3ZXSA 3ZMUA 5IYCJ 3IP4B 3MKZA 3OV8A 2HPIA 4IEJA 3PM1A 5M5YJ 4XIDA 2CWEA 1RKTA 2WB1N 4BE1A 1S7EA 4BHCA 1ZN2A 1FWZA 3P9CA 2CU7A 2ECCA 1SD4A 3ZPLA 4RBOA 3CC7I 3IAM2 3KLOA 2K4BA 2GWRA 3BCAA 3S17J 2ECBA 4KUMA 3ONQA 1IRGA 5GAHJ 1BI2A 2ZXIA 1B8IB 4L9NA 2G7HA 1EH6A 2Z16A 3J81K 1OFCX 3KPHA 1IXRC 1VF9A 4Z6YA 4PGHA 1HOMA 3MWMA 3IUOA 4GFBA 4BQQA 2JZYA 3FK7A 5IP6A 3BC8A 1KU3A 3LOCA 4G94A 3VWBA 2OA4A 3PNYA 3F3XA 4L9JA 1XPXA 3DXJF 2R7WA 1P9QC 1GLNA 2M7AA 4G12A
chains in the Genus database with same CATH topology
3KP3A 3DFGA 2AXLA 3ULQB 4M71A 4EGYA 3D5LA 4BQAA 1TQPA 2L4AA 1XMAA 3QPTA 4OOIA 1WQ2A 1ZG5A 4L18B 4HF0A 3F8CA 1O3TA 2E7XA 2A61A 4HZFA 1FLIA 1USSA 2Z5UA 3IHUA 5AIQA 5F64A 4IJAA 1P4AA 1HQCA 1HKSA 2F5EA 2EFPA 3FM3A 4RGXA 3KP5A 1BI3A 4MNUA 2BYVE 5CJ9A 4MHGA 4RAZA 3E5XA 5K5RA 3P7NA 4Y13A 4UVAA 4H0EA 2VBYA 1B59A 2O03A 5K5OA 2Q8KA 3RDIA 3F72A 5F1RA 1U2WA 4RGUA 3KZYA 1F4KA 1B1BA 1MDMA 2FEZA 1ODDA 2DPUA 1Z9CA 1FBSA 4R79A 4YFKF 2NNNA 2EV0A 2XAJA 2PJPA 3BOQA 4XBFA 3RPUA 1MZBA 5JR3A 4RB3C 4GYGA 3TO7A 2QUFA 1FSHA 1HKQA 2ADUA 1FP1D 4G7HF 2VOPA 1USTA 1SFXA 3GFLA 3LA7A 1JHFA 2DAOA 2PMHA 4KNYA 1T38A 5E17F 1OYYA 3C7JA 1KQ8A 4PDKA 3HSFA 3BY6A 2XVCA 3F8MA 4BH9A 4Q47A 4WXHA 2W57A 4XSZF 3KP2A 2H6CA 3MZHA 4WXDA 3V7CA 2ZNYA 2HGCA 2W85A 1R1VA 1V3FA 2DI3A 2Z99A 5ERIA 4EQQA 3CUQC 1DP7P 5JI6A 3WU1B 3RKXA 4XSXF 1FNNA 4HLYA 2PMUA 3KEOA 5EEHA 4CZZA 5FFXA 4KA4A 2EV6A 1KA8A 2XHKA 2ZXJA 4M73A 5AONA 5LEJA 2DU9A 5ILVA 1JGSA 3IRRA 1SD7A 4A0YA 1P2FA 3T1BA 3LAPA 2VE8A 4CICA 4MGRA 3WTVC 5E18F 2VN2A 4EJOA 1SAXA 1FYKA 2NAZA 5CVJA 4HA8A 1GXQA 3P9IA 1P92A 3HRMA 2GA2A 4FX4A 1BM9A 2J5OA 3COAC 1YW7A 1LEBA 4ENMA 1WKMA 2G7UA 2Q2EA 3MEXA 4F7ZA 2NYXA 1CGPA 4WXCA 3CUQB 1I5ZA 2HWVA 4YFXF 2ZMEB 5ILSA 4EM1A 2OZ6A 5EEGA 2X4HA 5D8KB 4LMYA 2NNYA 4P9UA 1BBYA 2MD5A 3RYPA 2XGXA 1LJ9A 1U5TC 2V1DA 4AIKA 3FMSA 3IKTA 5FLXZ 5DUIA 3U1DA 3VEPA 4EVIA 1YG2A 3VOEA 1CF7B 1Y0UA 5KVRA 1MJ9A 1W7PB 1S6LA 4GCVA 1RI7A 4O3MA 5E1XA 2Q0OA 2A3SA 1W7PD 4RB2C 1J75A 5FB2A 5DCMA 3EETA 5BS6A 1G3YA 1E2XA 3BJOA 1G3TA 5LHGA 3GUDA 1T2KA 3ZMTA 3LAJA 4WWCA 2CG4A 4I0BA 1IZ1A 1J5YA 1MJBA 3U2RA 4LGWA 1JXSA 1TW2A 1JHHA 1YTYA 1BC7C 1XD7A 4A0ZA 2OU2A 5LRSA 1BN5A 4EJUA 2HS5A 1TQIA 4LK0F 1ZRCA 3CUOA 2M87A 4HQEA 2O0YA 3DV8A 1FY7A 2L01A 4GO1A 2W84A 1EV7A 1H0MA 3T8TA 3WGGA 2HR3A 2GXGA 3E97A 1P4WA 3EYYA 2P5KA 2P7VB 2OAZA 5TJJA 1O7FA 3QPHA 2DT5A 3J80Z 1YW8A 1O3RA 4ENNA 2QBYA 1WWXA 2LNBA 4LJZF 1XGSA 2XV4S 4Y17A 3C1DA 2JPBA 5LRRA 3B02A 2PG4A 4KIFA 3WGIA 2VC1A 4WX9A 3L7WA 3JTGA 5K5QA 2P5VA 4CDGA 2HZTA 1NHAA 4G6DA 1H9TA 1ZYRF 2ZO4A 3HSRA 4OINF 3WTTC 1STZA 1MJAA 3EDPA 2ZCWA 2R7FA 3ABUA 1KYWA 4Q5SF 5D5WB 3GX4X 4XLPF 2EWNA 2K7LA 5L3DA 2NS0A 3KP7A 3B73A 2DLLA 1FP2A 4M9XA 1TNTA 2XRNA 3I5UA 2A68F 1LDJA 1I1GA 2CSOA 4IRIA 3E5UA 3M1EA 3BZ6A 2YX4A 5FO5A 2QQBA 3HOSA 1LVAA 2CW0F 2QYOA 2K02A 4RGSA 4MTDA 1U6GA 4G9YA 4N0BA 4GGGA 4HYEA 4A2UA 2MH2A 2BV6A 2EA2A 4XRFA 2A6EF 3M8FA 4I09A 3DPLC 5D6EA 2W24A 1ONVA 1HW1A 2MBFA 3REOA 3SZPA 4U7DA 1R1TA 1LQ1A 1EH8A 3RKWA 3E6MA 2M8EA 1YO5C 1FC3A 1UFMA 3GFMA 3GEZA 1TBXA 2CO5A 3F8FA 2BBYA 4A6DA 2A69F 2RNJA 2DBBA 2HKOA 3BP8A 3K1PA 3IL2A 4D0PA 4NHJA 4BHPA 1RUNA 5FGMA 3KEQA 2UXNA 1S8NA 2IA2A 1K79A 1BIBA 2Z3YA 1D8KA 3RPQA 2HTSA 1HSTA 1I27A 2XUBA 4MQVA 2O8XA 4IXAA 3V7RA 1TTYA 1R5GA 5A2QK 4NQWA 3PQKA 3GZ5A 3QU3A 4ZH4F 3DPTA 5HDNA 3GLXA 2JPCA 1FZPB 4KN4X 1ON2A 4E70A 5J6XA 2MA3A 2EFNA 3HSEA 4U0VA 1IF1A 4Q4ZF 3O6BB 2PBIA 1XDUA 4A5MA 1D3YA 2L02A 4OIPF 1XB4A 1F5TA 4PGGA 2XIGA 4BHBA 4RB1A 2FMLA 4HV5A 1ZARA 1MD0A 3ZQ7A 3VODA 3KZZA 4IHSA 2QWWA 2FBIA 2D45A 1TW3A 2FA5A 3RTRA 2EB7A 1FBQA 5CVUA 5ED4A 1S29A 1U3EM 2DTRA 1V4RA 1Z1DA 1FT9A 3BPXA 5CVVA 2IJLA 5J8FA 3I54A 2XKPA 1PP8F 4ASNA 2P5LC 1ZRFA 2LDUA 2YU3A 1BI1A 1O7LA 4K2EA 4ENJA 5HLIA 3HIFA 2IP2A 5HLGA 1P4XA 2FOKA 1KYZA 1XSVA 3I4PA 1U5TB 5DCMB 3WTSC 2H09A 2OZUA 1U5TA 4KICA 3F21A 3ISPA 1WSUA 1U78A 2MLGA 2PEXA 2PN6A 3GZ6A 3DKWA 3E3VA 2L4MA 3GVAA 2R7DA 1SFUA 2HYFA 2A5YB 4OMYA 4MQ9F 5CVIA 2FBKA 2E7WA 2DPDA 5DEQA 6PAXA 5DV5A 3HTSB 4WCGA 4AD9A 1KU9A 2C6YA 4HQMA 1HXDA 2BE5F 2P6TA 1IN4A 4KN7X 2FU4A 1UCRA 2VBWA 3GFJA 5L3GA 4JK1X 5ICGA 2H6BA 4HDUA 4A5NA 2B0LA 3FZVA 3NQOA 4LG0B 1HSJA 1UHMA 3PFIA 5D4SA 2KJBA 2EFQA 2UZKA 3M9AA 2GXBA 1VTNC 1K78A 2ZKZA 3ZN0A 3TO6A 4HF2A 3Q5FA 1MKMA 2YPRA 3EYIA 2E1CA 4HF1A 2BGCA 3HOTA 2V79A 4QLCU 3W6JB 2KIFA 3FM5A 3HHHA 4KDPA 5ICFA 5DD8A 3GFIA 2G9WA 3V8LA 3K2ZA 2ZMEA 2DK8A 4YFNF 5HLHA 5LHHA 4MTEA 2V1XA 4P5OA 1GVJA 1QPMA 4L5JA 5FD6A 1S3JA 4IPAA 3L09A 1FBUA 1UHWA 1FX7A 1Z6RA 2VE9A 3FMRA 5FLXK 3R0AA 5H6QA 2HDCA 1RZ4A 5LEKA 4ESJA 1TNSA 3PQJA 3K9TA 2D1HA 3R0JA 4IRHA 4ZYDA 3WTXC 4TV7A 3H92A 4A6EA 2H27A 5J8CA 3WU0A 1R23A 5HDGA 2WWYA 1ZGAA 4ON0A 1B6AA 4OU0A 3EQLF 5IT9Z 1MDMB 1ZRDA 1HKTA 1O3QA 4M9ZA 2HTJA 3WTYC 1DUXC 2VC0A 4AVPA 1S7AA 1XGNA 1J2XA 1OYIA 1IW7F 3WODF 2V1UA 1GXPA 2RKHA 3AAFA 4R8HA 3TGNA 2VODA 1IXCA 3I64A 5D6FA 3M8EA 4EMSA 1T0FA 4CGZA 1OMIA 3I71A 5LGUA 3K69A 5HS8A 5BMZA 3HHGA 3KETA 2CYYA 3KCCA 2IVMA 2M5WA 5HDKA 3FXQA 3F8NA 3O2PE 2FMYA 1XSDA 4UV8A 1IXSB 1ZG3A 4EM0B 2YSRA 2GIVA 2YX7A 1DPUA 5DUKA 3J7AO 3NRVA 1G6NA 4Y15A 2EJRA 4HX4A 2XKOA 2OQRA 1XGMA 3BPVA 4ESBA 2A07F 3G73A 4FX0A 2Y75A 4DQ2A 2OBPA 3FXRA 4AIJA 2HQNA 4HX8A 2FBHA 5E1ZB 5BPDA 4ZZLA 5AIPA 1KU2A 1XGOA 2DO7A 3N4MA 4O6JA 4M9SA 3F22A 4CHUA 1YIOA 4M6YA 3TOAA 4Z2YA 2RV8A 1PP7U 3ZN1A 1Z05A 1KQ9A 3HRUA 4HOBA 3MAJA 1EH7A 5JHUA 4G7OF 1I6XA 2FSWA 2K27A 1L3LA 3JSPA 1PUEE 3SQNA 3ZMVA 2O6GE 3KLNA 1WRJA 3V7SA 1ZH5A 4BXUA 1B4AA 2JTVA 1LB2A 3IWFA 3F8BA 1AOYA 4UXNA 3O3KA 1B9MA 5D5XB 1XCBA 2P7CB 4UV9A 1OKRA 3F6OA 2ETHA 4A0XA 3IKVA 3ZMSA 1IN5A 2IPQX 2PI0A 3KE2A 1SFEA 1OR7A 1Z91A 3CO6C 3I59B 4XLNF 5LHIA 3E6DA 2LSOA 1GHCA 1O57A 4N9IA 2FNAA 5TRDA 5HOOA 1YS7A 4R1HA 2P8TA 2F2EA 5CVRA 2QZ8A 2DQRA 1IN6A 5L3EA 1QZZA 4L9VA 3HYIA 1ZHFA 4ETSA 2IT0A 5IT3A 2EFWA 3ZMZA 4HV6A 3OOPA 5D5UB 1R58A 4PZJA 5JVTA 2HEOA 1K7AA 4I2OA 1XCVA 1OPCA 2YR2A 3KP6A 4IF4A 3LWFA 2GAUA 3J80K 3M7GA 2ZBKA 3WE2A 1A04A 2MC3A 1SMYF 1YFHA 2JSCA 2ZFWA 2M45A 5E8IA 1QZYA 3BROA 2XAHA 1LNWA 3BJ6A 2PFBA 3SFZA 3KP4A 4KT5C 5FD5A 1DDNA 3RKYA 3LSTA 3E6BA 1R00A 2IRFG 5JFRA 2F5DA 3QP6A 3HRTA 4JBAA 1HBXG 3CTAA 1J7KA 2EK5A 1QBJA 4LB6B 2XASA 4BYYA 2QM3A 5DD4A 3L00A 2XROA 2GQQA 4QWQA 1YW9A 2KKOA 1BIAA 2D1VA 2VT2A 1LEAA 3ML6A 3FHZA 1YLFA 3RYRA 4L9TA 4U0YA 3HRSA 3JTHA 3LQRA 3E6CC 3R6SA 4B8XA 3FX3A 1QQIA 3S2WA 3F23A 4BAYA 3HUGA 1J59A 1L0OC 3C3WA 3MQ0A 4N9HA 4LD5A 4LK1F 2KJCA 2HFHA 5D5VB 1ZG1A 4YIFA 5DCFA 2HKXA 3ROUA 1R5HA 3H3ZA 3I0TA 3V8JA 2A6HF 3KFWX 5A2QZ 4RS8A 2NRAC 2RDPA 1X3UA 3H3UA 3D0SA 4BNCA 1Q1HA 1T39A 3CO7C 5LGTA 3VFZA 4YIIA 3FXUA 1UB9A 5D8LB 4CYDA 1XN7A 3HTUA 3WG9A 4ZYEA 3P9KA 5LGNA 1TLHB 4KYWA 2R3SA 2P4WA 2K4JA 1FYMA 1R22A 3JSOA 1ZREA 4DNCA 5ICEA 2RC4A 4WF2A 4EGZA 3T8RA 4G7ZF 1G3SA 3K0LA 3Q9VA 2ZNZA 3SXYA 2IA0A 3ZP5A 3R4KA 2MLKA 4UNOA 1FPQA 1QNTA 4ESFA 2WC2A 4OIRF 1O3SA 1XMKA 4G8XA 2XAFA 1YS6A 4G6QA 1HW5A 2ELHA 3ERED 1IN7A 5E20A 2FE3A 3QRFF 3BJAA 3EUHA 4RAYA 2UXXA 4GXOA 3R60A 1IN8A 4GYIA 2EA4A 3JAMK 1D8JA 4KFCA 4NB5A 1E17A 3BDDA 1R7JA 1W4MA 2KIMA 2VOOA 2DW4A 2QQ9A 1CF7A 1W5TA 2RN7A 1WI9A 2O3FA 5LBQA 1HW2A 2XAQA 2ACJA 2EFOA 5BPIA 5BOXA 1KGSA 4EV0A 2FNPA 5ILUA 2VBZA 3TQNA 4ZZDA 4LLGF 2ESNA 2OQGA 3GO5A 3TOBA 5FFZA 2L3DA 4JQFA 1P6RA 5L3BA 4UVBA 2STWA 1OYWA 3U9GA 1Z6TA 3DF8A 4UVCA 1ZLJA 5HS7A 1ZLKA 2E1NA 1H9GA 3DEUA 3JW4A 3IC7A 2ZJ2A 3ECOA 2HQRA 1BJAA 4M6XA 4ZYGA 1YYVA 3TO9A 4KMUX 2ISYA 1J0RA 2M30A 4WK8F 2F5CA 3QAHA 2BEOA 4U88A 2QVOA 2V9VA 2EV5A 3L9FA 3MFKA 3K1MA 3ZMDA 1FYLA 4OIQF 4I98B 5CLSA 3RIRA 2FRHA 3GWZA 2COMA 3K1NA 4L0ZB 3WTZA 2D2WA 3I58A 2RGVA 2JT1A 4RB0A 4IHTA 2LF7A 2WV0A 1YQAA 2JRTA 4MEXF 1FOKA 5DYMA 3CUQA 2VONA 2QLZA 2ISZA 4IRGA 4I01A 5K1YA 4CXFA 1Z7UA 3QOPA 2KRFA 4P9FA 1J9IA 2XAGA 1G3WA 3GXOA 4U7BA 2GZWA 1JE8A 3W6KB 2HOEA 5ICCA 4OIOF 4U0WA 2OD5A 4O5VA 4P55A 3RJPA 4EJWA 1QO0D 2HYGD 4EJVA 4A12A 2CGPA 4L5IA 4FT8A 1ON1A 2FXAA 1IRFA 1R1UA 1QGPA 4LB5A 3FMQA 3LFKA 4LG0A 2WTEA 3LQQA 5DDGA 2GA1A 3C18A 1C0WA 4M74A 4HDVA 5BQTA 1BOAA 3Q9SA 1ULYA 2STTA 2QENA 1SMTA 3LA2A 1BI0A 2ESHA 3T5XA 1K6OA 1B9NA 1RIOH 2DK5A 3F6VA 1KU7A 1D5VA 3QP5A 4HLXA 1W5SA 4M72A 5H6RA 1TQMA 1SD6A 2K86A 3ELKA 2Y0MA 4PCQA 4I0AA 5IT9K 1R36A 1IUYA 1SD5A 5LLQA 3I59A 4HW0A 3TKYA 2PQ8A 2P6SA 3WTUC 1LDKB 3ABTA 3RI4A 4LLNA 3MZYA 4OMZA 4CO8A 2Y48A 3T0YA 2PLYA 3R61A 4EM2A 1F1ZA 1IAWA 1DPRA 2DQLA 4L0YB 2UWMA 2RVCA 1K78B 2CQKA 1G4DA 3FWEA 1T98A 2Z33A 1XDSA 2V6CA 2IA1A 1RNLA 1KQ0A 4HAMA 4ENKA 5HS9A 3FF5A 1FSEA 2KIUA 1REPC 2F5FA 3GW2A 3J81Z 3L2CA 3WGHA 2MH9A 4UUVA 1PDNC 3WTWC 4YG2F 2Z9OA 4AWXB 4AIHA 2O61A 3V4GA 4FHTA 4HX7A 3MCZA 4HBLA 1BC8C 4RGRA 2DFIA 1ZAOA 2VXZA 2J5PA 3TDZC 2QQAA 1S7OA 1ZGJA 4IVNA 2X0LA 2QBYB 3ECHA 4I7HA 2IW5A 4KIGA 5E8GA 2AS5F 2H94A 5CYVA 4LLLA 5E1WA 2FF4A 4S05A 3CJNA 3I53A 5KK1A 2M1BA 2CFXA 3JAMZ 2W25A 3CDHA 1I1SA 5L3FA 5D4RA 2VT3A 1XSXA 4B09A 1RUOA 5H20A 1T6SA 3NEUA 2FQ3A 1MGTA 4UHTA 3IWZA 1AWCA 3CLOA 3SZTA 3DP7A 5L3CA 4MEYF 4P96A 3QU6A 3VB2A 1W7PA 4KIBA 1F9NA 3DQVC 3GF2A 2RQPA 3GYHX 5F6FA 3E5QA 2LF8A 5HVQC 4KMFA 3V8KA 3TDUC 1LDDA 4I02A 3LA3A 2TDXA 3IRQA 2LKPA 3SHFA 3N97A 2VBXA 1U8RA 3BWGA 4S04A 4LFUA 4EJTA 4Q48A 4ZYHA 2L54A 3WE3A 3G3ZA 3ZMUA 3OV8A 2CWEA 4BHCA 1ZN2A 1FWZA 3P9CA 1SD4A 3ZPLA 3KLOA 2K4BA 2GWRA 4KUMA 1IRGA 1BI2A 4L9NA 2G7HA 1EH6A 3J81K 1IXRC 4PGHA 3MWMA 2JZYA 1KU3A 4G94A 2OA4A 3F3XA 4L9JA 3DXJF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KP3 A;  3DFG A;  2AXL A;  3ULQ B;  4M71 A;  4EGY A;  3D5L A;  4BQA A;  1TQP A;  2L4A A;  1XMA A;  3QPT A;  4OOI A;  1WQ2 A;  1ZG5 A;  4L18 B;  4HF0 A;  3F8C A;  1O3T A;  2E7X A;  2A61 A;  4HZF A;  1FLI A;  1USS A;  2Z5U A;  3IHU A;  5AIQ A;  5F64 A;  4IJA A;  1P4A A;  1HQC A;  1HKS A;  2F5E A;  2EFP A;  3FM3 A;  4RGX A;  3KP5 A;  1BI3 A;  4MNU A;  2BYV E;  5CJ9 A;  4MHG A;  4RAZ A;  3E5X A;  5K5R A;  3P7N A;  4Y13 A;  4UVA A;  4H0E A;  2VBY A;  1B59 A;  2O03 A;  5K5O A;  2Q8K A;  3RDI A;  3F72 A;  5F1R A;  1U2W A;  4RGU A;  3KZY A;  1F4K A;  1B1B A;  1MDM A;  2FEZ A;  1ODD A;  2DPU A;  1Z9C A;  1FBS A;  4R79 A;  4YFK F;  2NNN A;  2EV0 A;  2XAJ A;  2PJP A;  3BOQ A;  4XBF A;  3RPU A;  1MZB A;  5JR3 A;  4RB3 C;  4GYG A;  3TO7 A;  2QUF A;  1FSH A;  1HKQ A;  2ADU A;  1FP1 D;  4G7H F;  2VOP A;  1UST A;  1SFX A;  3GFL A;  3LA7 A;  1JHF A;  2DAO A;  2PMH A;  4KNY A;  1T38 A;  5E17 F;  1OYY A;  3C7J A;  1KQ8 A;  4PDK A;  3HSF A;  3BY6 A;  2XVC A;  3F8M A;  4BH9 A;  4Q47 A;  4WXH A;  2W57 A;  4XSZ F;  3KP2 A;  2H6C A;  3MZH A;  4WXD A;  3V7C A;  2ZNY A;  2HGC A;  2W85 A;  1R1V A;  1V3F A;  2DI3 A;  2Z99 A;  5ERI A;  4EQQ A;  3CUQ C;  1DP7 P;  5JI6 A;  3WU1 B;  3RKX A;  4XSX F;  1FNN A;  4HLY A;  2PMU A;  3KEO A;  5EEH A;  4CZZ A;  5FFX A;  4KA4 A;  2EV6 A;  1KA8 A;  2XHK A;  2ZXJ A;  4M73 A;  5AON A;  5LEJ A;  2DU9 A;  5ILV A;  1JGS A;  3IRR A;  1SD7 A;  4A0Y A;  1P2F A;  3T1B A;  3LAP A;  2VE8 A;  4CIC A;  4MGR A;  3WTV C;  5E18 F;  2VN2 A;  4EJO A;  1SAX A;  1FYK A;  2NAZ A;  5CVJ A;  4HA8 A;  1GXQ A;  3P9I A;  1P92 A;  3HRM A;  2GA2 A;  4FX4 A;  1BM9 A;  2J5O A;  3COA C;  1YW7 A;  1LEB A;  4ENM A;  1WKM A;  2G7U A;  2Q2E A;  3MEX A;  4F7Z A;  2NYX A;  1CGP A;  4WXC A;  3CUQ B;  1I5Z A;  2HWV A;  4YFX F;  2ZME B;  5ILS A;  4EM1 A;  2OZ6 A;  5EEG A;  2X4H A;  5D8K B;  4LMY A;  2NNY A;  4P9U A;  1BBY A;  2MD5 A;  3RYP A;  2XGX A;  1LJ9 A;  1U5T C;  2V1D A;  4AIK A;  3FMS A;  3IKT A;  5FLX Z;  5DUI A;  3U1D A;  3VEP A;  4EVI A;  1YG2 A;  3VOE A;  1CF7 B;  1Y0U A;  5KVR A;  1MJ9 A;  1W7P B;  1S6L A;  4GCV A;  1RI7 A;  4O3M A;  5E1X A;  2Q0O A;  2A3S A;  1W7P D;  4RB2 C;  1J75 A;  5FB2 A;  5DCM A;  3EET A;  5BS6 A;  1G3Y A;  1E2X A;  3BJO A;  1G3T A;  5LHG A;  3GUD A;  1T2K A;  3ZMT A;  3LAJ A;  4WWC A;  2CG4 A;  4I0B A;  1IZ1 A;  1J5Y A;  1MJB A;  3U2R A;  4LGW A;  1JXS A;  1TW2 A;  1JHH A;  1YTY A;  1BC7 C;  1XD7 A;  4A0Z A;  2OU2 A;  5LRS A;  1BN5 A;  4EJU A;  2HS5 A;  1TQI A;  4LK0 F;  1ZRC A;  3CUO A;  2M87 A;  4HQE A;  2O0Y A;  3DV8 A;  1FY7 A;  2L01 A;  4GO1 A;  2W84 A;  1EV7 A;  1H0M A;  3T8T A;  3WGG A;  2HR3 A;  2GXG A;  3E97 A;  1P4W A;  3EYY A;  2P5K A;  2P7V B;  2OAZ A;  5TJJ A;  1O7F A;  3QPH A;  2DT5 A;  3J80 Z;  1YW8 A;  1O3R A;  4ENN A;  2QBY A;  1WWX A;  2LNB A;  4LJZ F;  1XGS A;  2XV4 S;  4Y17 A;  3C1D A;  2JPB A;  5LRR A;  3B02 A;  2PG4 A;  4KIF A;  3WGI A;  2VC1 A;  4WX9 A;  3L7W A;  3JTG A;  5K5Q A;  2P5V A;  4CDG A;  2HZT A;  1NHA A;  4G6D A;  1H9T A;  1ZYR F;  2ZO4 A;  3HSR A;  4OIN F;  3WTT C;  1STZ A;  1MJA A;  3EDP A;  2ZCW A;  2R7F A;  3ABU A;  1KYW A;  4Q5S F;  5D5W B;  3GX4 X;  4XLP F;  2EWN A;  2K7L A;  5L3D A;  2NS0 A;  3KP7 A;  3B73 A;  2DLL A;  1FP2 A;  4M9X A;  1TNT A;  2XRN A;  3I5U A;  2A68 F;  1LDJ A;  1I1G A;  2CSO A;  4IRI A;  3E5U A;  3M1E A;  3BZ6 A;  2YX4 A;  5FO5 A;  2QQB A;  3HOS A;  1LVA A;  2CW0 F;  2QYO A;  2K02 A;  4RGS A;  4MTD A;  1U6G A;  4G9Y A;  4N0B A;  4GGG A;  4HYE A;  4A2U A;  2MH2 A;  2BV6 A;  2EA2 A;  4XRF A;  2A6E F;  3M8F A;  4I09 A;  3DPL C;  5D6E A;  2W24 A;  1ONV A;  1HW1 A;  2MBF A;  3REO A;  3SZP A;  4U7D A;  1R1T A;  1LQ1 A;  1EH8 A;  3RKW A;  3E6M A;  2M8E A;  1YO5 C;  1FC3 A;  1UFM A;  3GFM A;  3GEZ A;  1TBX A;  2CO5 A;  3F8F A;  2BBY A;  4A6D A;  2A69 F;  2RNJ A;  2DBB A;  2HKO A;  3BP8 A;  3K1P A;  3IL2 A;  4D0P A;  4NHJ A;  4BHP A;  1RUN A;  5FGM A;  3KEQ A;  2UXN A;  1S8N A;  2IA2 A;  1K79 A;  1BIB A;  2Z3Y A;  1D8K A;  3RPQ A;  2HTS A;  1HST A;  1I27 A;  2XUB A;  4MQV A;  2O8X A;  4IXA A;  3V7R A;  1TTY A;  1R5G A;  5A2Q K;  4NQW A;  3PQK A;  3GZ5 A;  3QU3 A;  4ZH4 F;  3DPT A;  5HDN A;  3GLX A;  2JPC A;  1FZP B;  4KN4 X;  1ON2 A;  4E70 A;  5J6X A;  2MA3 A;  2EFN A;  3HSE A;  4U0V A;  1IF1 A;  4Q4Z F;  3O6B B;  2PBI A;  1XDU A;  4A5M A;  1D3Y A;  2L02 A;  4OIP F;  1XB4 A;  1F5T A;  4PGG A;  2XIG A;  4BHB A;  4RB1 A;  2FML A;  4HV5 A;  1ZAR A;  1MD0 A;  3ZQ7 A;  3VOD A;  3KZZ A;  4IHS A;  2QWW A;  2FBI A;  2D45 A;  1TW3 A;  2FA5 A;  3RTR A;  2EB7 A;  1FBQ A;  5CVU A;  5ED4 A;  1S29 A;  1U3E M;  2DTR A;  1V4R A;  1Z1D A;  1FT9 A;  3BPX A;  5CVV A;  2IJL A;  5J8F A;  3I54 A;  2XKP A;  1PP8 F;  4ASN A;  2P5L C;  1ZRF A;  2LDU A;  2YU3 A;  1BI1 A;  1O7L A;  4K2E A;  4ENJ A;  5HLI A;  3HIF A;  2IP2 A;  5HLG A;  1P4X A;  2FOK A;  1KYZ A;  1XSV A;  3I4P A;  1U5T B;  5DCM B;  3WTS C;  2H09 A;  2OZU A;  1U5T A;  4KIC A;  3F21 A;  3ISP A;  1WSU A;  1U78 A;  2MLG A;  2PEX A;  2PN6 A;  3GZ6 A;  3DKW A;  3E3V A;  2L4M A;  3GVA A;  2R7D A;  1SFU A;  2HYF A;  2A5Y B;  4OMY A;  4MQ9 F;  5CVI A;  2FBK A;  2E7W A;  2DPD A;  5DEQ A;  6PAX A;  5DV5 A;  3HTS B;  4WCG A;  4AD9 A;  1KU9 A;  2C6Y A;  4HQM A;  1HXD A;  2BE5 F;  2P6T A;  1IN4 A;  4KN7 X;  2FU4 A;  1UCR A;  2VBW A;  3GFJ A;  5L3G A;  4JK1 X;  5ICG A;  2H6B A;  4HDU A;  4A5N A;  2B0L A;  3FZV A;  3NQO A;  4LG0 B;  1HSJ A;  1UHM A;  3PFI A;  5D4S A;  2KJB A;  2EFQ A;  2UZK A;  3M9A A;  2GXB A;  1VTN C;  1K78 A;  2ZKZ A;  3ZN0 A;  3TO6 A;  4HF2 A;  3Q5F A;  1MKM A;  2YPR A;  3EYI A;  2E1C A;  4HF1 A;  2BGC A;  3HOT A;  2V79 A;  4QLC U;  3W6J B;  2KIF A;  3FM5 A;  3HHH A;  4KDP A;  5ICF A;  5DD8 A;  3GFI A;  2G9W A;  3V8L A;  3K2Z A;  2ZME A;  2DK8 A;  4YFN F;  5HLH A;  5LHH A;  4MTE A;  2V1X A;  4P5O A;  1GVJ A;  1QPM A;  4L5J A;  5FD6 A;  1S3J A;  4IPA A;  3L09 A;  1FBU A;  1UHW A;  1FX7 A;  1Z6R A;  2VE9 A;  3FMR A;  5FLX K;  3R0A A;  5H6Q A;  2HDC A;  1RZ4 A;  5LEK A;  4ESJ A;  1TNS A;  3PQJ A;  3K9T A;  2D1H A;  3R0J A;  4IRH A;  4ZYD A;  3WTX C;  4TV7 A;  3H92 A;  4A6E A;  2H27 A;  5J8C A;  3WU0 A;  1R23 A;  5HDG A;  2WWY A;  1ZGA A;  4ON0 A;  1B6A A;  4OU0 A;  3EQL F;  5IT9 Z;  1MDM B;  1ZRD A;  1HKT A;  1O3Q A;  4M9Z A;  2HTJ A;  3WTY C;  1DUX C;  2VC0 A;  4AVP A;  1S7A A;  1XGN A;  1J2X A;  1OYI A;  1IW7 F;  3WOD F;  2V1U A;  1GXP A;  2RKH A;  3AAF A;  4R8H A;  3TGN A;  2VOD A;  1IXC A;  3I64 A;  5D6F A;  3M8E A;  4EMS A;  1T0F A;  4CGZ A;  1OMI A;  3I71 A;  5LGU A;  3K69 A;  5HS8 A;  5BMZ A;  3HHG A;  3KET A;  2CYY A;  3KCC A;  2IVM A;  2M5W A;  5HDK A;  3FXQ A;  3F8N A;  3O2P E;  2FMY A;  1XSD A;  4UV8 A;  1IXS B;  1ZG3 A;  4EM0 B;  2YSR A;  2GIV A;  2YX7 A;  1DPU A;  5DUK A;  3J7A O;  3NRV A;  1G6N A;  4Y15 A;  2EJR A;  4HX4 A;  2XKO A;  2OQR A;  1XGM A;  3BPV A;  4ESB A;  2A07 F;  3G73 A;  4FX0 A;  2Y75 A;  4DQ2 A;  2OBP A;  3FXR A;  4AIJ A;  2HQN A;  4HX8 A;  2FBH A;  5E1Z B;  5BPD A;  4ZZL A;  5AIP A;  1KU2 A;  1XGO A;  2DO7 A;  3N4M A;  4O6J A;  4M9S A;  3F22 A;  4CHU A;  1YIO A;  4M6Y A;  3TOA A;  4Z2Y A;  2RV8 A;  1PP7 U;  3ZN1 A;  1Z05 A;  1KQ9 A;  3HRU A;  4HOB A;  3MAJ A;  1EH7 A;  5JHU A;  4G7O F;  1I6X A;  2FSW A;  2K27 A;  1L3L A;  3JSP A;  1PUE E;  3SQN A;  3ZMV A;  2O6G E;  3KLN A;  1WRJ A;  3V7S A;  1ZH5 A;  4BXU A;  1B4A A;  2JTV A;  1LB2 A;  3IWF A;  3F8B A;  1AOY A;  4UXN A;  3O3K A;  1B9M A;  5D5X B;  1XCB A;  2P7C B;  4UV9 A;  1OKR A;  3F6O A;  2ETH A;  4A0X A;  3IKV A;  3ZMS A;  1IN5 A;  2IPQ X;  2PI0 A;  3KE2 A;  1SFE A;  1OR7 A;  1Z91 A;  3CO6 C;  3I59 B;  4XLN F;  5LHI A;  3E6D A;  2LSO A;  1GHC A;  1O57 A;  4N9I A;  2FNA A;  5TRD A;  5HOO A;  1YS7 A;  4R1H A;  2P8T A;  2F2E A;  5CVR A;  2QZ8 A;  2DQR A;  1IN6 A;  5L3E A;  1QZZ A;  4L9V A;  3HYI A;  1ZHF A;  4ETS A;  2IT0 A;  5IT3 A;  2EFW A;  3ZMZ A;  4HV6 A;  3OOP A;  5D5U B;  1R58 A;  4PZJ A;  5JVT A;  2HEO A;  1K7A A;  4I2O A;  1XCV A;  1OPC A;  2YR2 A;  3KP6 A;  4IF4 A;  3LWF A;  2GAU A;  3J80 K;  3M7G A;  2ZBK A;  3WE2 A;  1A04 A;  2MC3 A;  1SMY F;  1YFH A;  2JSC A;  2ZFW A;  2M45 A;  5E8I A;  1QZY A;  3BRO A;  2XAH A;  1LNW A;  3BJ6 A;  2PFB A;  3SFZ A;  3KP4 A;  4KT5 C;  5FD5 A;  1DDN A;  3RKY A;  3LST A;  3E6B A;  1R00 A;  2IRF G;  5JFR A;  2F5D A;  3QP6 A;  3HRT A;  4JBA A;  1HBX G;  3CTA A;  1J7K A;  2EK5 A;  1QBJ A;  4LB6 B;  2XAS A;  4BYY A;  2QM3 A;  5DD4 A;  3L00 A;  2XRO A;  2GQQ A;  4QWQ A;  1YW9 A;  2KKO A;  1BIA A;  2D1V A;  2VT2 A;  1LEA A;  3ML6 A;  3FHZ A;  1YLF A;  3RYR A;  4L9T A;  4U0Y A;  3HRS A;  3JTH A;  3LQR A;  3E6C C;  3R6S A;  4B8X A;  3FX3 A;  1QQI A;  3S2W A;  3F23 A;  4BAY A;  3HUG A;  1J59 A;  1L0O C;  3C3W A;  3MQ0 A;  4N9H A;  4LD5 A;  4LK1 F;  2KJC A;  2HFH A;  5D5V B;  1ZG1 A;  4YIF A;  5DCF A;  2HKX A;  3ROU A;  1R5H A;  3H3Z A;  3I0T A;  3V8J A;  2A6H F;  3KFW X;  5A2Q Z;  4RS8 A;  2NRA C;  2RDP A;  1X3U A;  3H3U A;  3D0S A;  4BNC A;  1Q1H A;  1T39 A;  3CO7 C;  5LGT A;  3VFZ A;  4YII A;  3FXU A;  1UB9 A;  5D8L B;  4CYD A;  1XN7 A;  3HTU A;  3WG9 A;  4ZYE A;  3P9K A;  5LGN A;  1TLH B;  4KYW A;  2R3S A;  2P4W A;  2K4J A;  1FYM A;  1R22 A;  3JSO A;  1ZRE A;  4DNC A;  5ICE A;  2RC4 A;  4WF2 A;  4EGZ A;  3T8R A;  4G7Z F;  1G3S A;  3K0L A;  3Q9V A;  2ZNZ A;  3SXY A;  2IA0 A;  3ZP5 A;  3R4K A;  2MLK A;  4UNO A;  1FPQ A;  1QNT A;  4ESF A;  2WC2 A;  4OIR F;  1O3S A;  1XMK A;  4G8X A;  2XAF A;  1YS6 A;  4G6Q A;  1HW5 A;  2ELH A;  3ERE D;  1IN7 A;  5E20 A;  2FE3 A;  3QRF F;  3BJA A;  3EUH A;  4RAY A;  2UXX A;  4GXO A;  3R60 A;  1IN8 A;  4GYI A;  2EA4 A;  3JAM K;  1D8J A;  4KFC A;  4NB5 A;  1E17 A;  3BDD A;  1R7J A;  1W4M A;  2KIM A;  2VOO A;  2DW4 A;  2QQ9 A;  1CF7 A;  1W5T A;  2RN7 A;  1WI9 A;  2O3F A;  5LBQ A;  1HW2 A;  2XAQ A;  2ACJ A;  2EFO A;  5BPI A;  5BOX A;  1KGS A;  4EV0 A;  2FNP A;  5ILU A;  2VBZ A;  3TQN A;  4ZZD A;  4LLG F;  2ESN A;  2OQG A;  3GO5 A;  3TOB A;  5FFZ A;  2L3D A;  4JQF A;  1P6R A;  5L3B A;  4UVB A;  2STW A;  1OYW A;  3U9G A;  1Z6T A;  3DF8 A;  4UVC A;  1ZLJ A;  5HS7 A;  1ZLK A;  2E1N A;  1H9G A;  3DEU A;  3JW4 A;  3IC7 A;  2ZJ2 A;  3ECO A;  2HQR A;  1BJA A;  4M6X A;  4ZYG A;  1YYV A;  3TO9 A;  4KMU X;  2ISY A;  1J0R A;  2M30 A;  4WK8 F;  2F5C A;  3QAH A;  2BEO A;  4U88 A;  2QVO A;  2V9V A;  2EV5 A;  3L9F A;  3MFK A;  3K1M A;  3ZMD A;  1FYL A;  4OIQ F;  4I98 B;  5CLS A;  3RIR A;  2FRH A;  3GWZ A;  2COM A;  3K1N A;  4L0Z B;  3WTZ A;  2D2W A;  3I58 A;  2RGV A;  2JT1 A;  4RB0 A;  4IHT A;  2LF7 A;  2WV0 A;  1YQA A;  2JRT A;  4MEX F;  1FOK A;  5DYM A;  3CUQ A;  2VON A;  2QLZ A;  2ISZ A;  4IRG A;  4I01 A;  5K1Y A;  4CXF A;  1Z7U A;  3QOP A;  2KRF A;  4P9F A;  1J9I A;  2XAG A;  1G3W A;  3GXO A;  4U7B A;  2GZW A;  1JE8 A;  3W6K B;  2HOE A;  5ICC A;  4OIO F;  4U0W A;  2OD5 A;  4O5V A;  4P55 A;  3RJP A;  4EJW A;  1QO0 D;  2HYG D;  4EJV A;  4A12 A;  2CGP A;  4L5I A;  4FT8 A;  1ON1 A;  2FXA A;  1IRF A;  1R1U A;  1QGP A;  4LB5 A;  3FMQ A;  3LFK A;  4LG0 A;  2WTE A;  3LQQ A;  5DDG A;  2GA1 A;  3C18 A;  1C0W A;  4M74 A;  4HDV A;  5BQT A;  1BOA A;  3Q9S A;  1ULY A;  2STT A;  2QEN A;  1SMT A;  3LA2 A;  1BI0 A;  2ESH A;  3T5X A;  1K6O A;  1B9N A;  1RIO H;  2DK5 A;  3F6V A;  1KU7 A;  1D5V A;  3QP5 A;  4HLX A;  1W5S A;  4M72 A;  5H6R A;  1TQM A;  1SD6 A;  2K86 A;  3ELK A;  2Y0M A;  4PCQ A;  4I0A A;  5IT9 K;  1R36 A;  1IUY A;  1SD5 A;  5LLQ A;  3I59 A;  4HW0 A;  3TKY A;  2PQ8 A;  2P6S A;  3WTU C;  1LDK B;  3ABT A;  3RI4 A;  4LLN A;  3MZY A;  4OMZ A;  4CO8 A;  2Y48 A;  3T0Y A;  2PLY A;  3R61 A;  4EM2 A;  1F1Z A;  1IAW A;  1DPR A;  2DQL A;  4L0Y B;  2UWM A;  2RVC A;  1K78 B;  2CQK A;  1G4D A;  3FWE A;  1T98 A;  2Z33 A;  1XDS A;  2V6C A;  2IA1 A;  1RNL A;  1KQ0 A;  4HAM A;  4ENK A;  5HS9 A;  3FF5 A;  1FSE A;  2KIU A;  1REP C;  2F5F A;  3GW2 A;  3J81 Z;  3L2C A;  3WGH A;  2MH9 A;  4UUV A;  1PDN C;  3WTW C;  4YG2 F;  2Z9O A;  4AWX B;  4AIH A;  2O61 A;  3V4G A;  4FHT A;  4HX7 A;  3MCZ A;  4HBL A;  1BC8 C;  4RGR A;  2DFI A;  1ZAO A;  2VXZ A;  2J5P A;  3TDZ C;  2QQA A;  1S7O A;  1ZGJ A;  4IVN A;  2X0L A;  2QBY B;  3ECH A;  4I7H A;  2IW5 A;  4KIG A;  5E8G A;  2AS5 F;  2H94 A;  5CYV A;  4LLL A;  5E1W A;  2FF4 A;  4S05 A;  3CJN A;  3I53 A;  5KK1 A;  2M1B A;  2CFX A;  3JAM Z;  2W25 A;  3CDH A;  1I1S A;  5L3F A;  5D4R A;  2VT3 A;  1XSX A;  4B09 A;  1RUO A;  5H20 A;  1T6S A;  3NEU A;  2FQ3 A;  1MGT A;  4UHT A;  3IWZ A;  1AWC A;  3CLO A;  3SZT A;  3DP7 A;  5L3C A;  4MEY F;  4P96 A;  3QU6 A;  3VB2 A;  1W7P A;  4KIB A;  1F9N A;  3DQV C;  3GF2 A;  2RQP A;  3GYH X;  5F6F A;  3E5Q A;  2LF8 A;  5HVQ C;  4KMF A;  3V8K A;  3TDU C;  1LDD A;  4I02 A;  3LA3 A;  2TDX A;  3IRQ A;  2LKP A;  3SHF A;  3N97 A;  2VBX A;  1U8R A;  3BWG A;  4S04 A;  4LFU A;  4EJT A;  4Q48 A;  4ZYH A;  2L54 A;  3WE3 A;  3G3Z A;  3ZMU A;  3OV8 A;  2CWE A;  4BHC A;  1ZN2 A;  1FWZ A;  3P9C A;  1SD4 A;  3ZPL A;  3KLO A;  2K4B A;  2GWR A;  4KUM A;  1IRG A;  1BI2 A;  4L9N A;  2G7H A;  1EH6 A;  3J81 K;  1IXR C;  4PGH A;  3MWM A;  2JZY A;  1KU3 A;  4G94 A;  2OA4 A;  3F3X A;  4L9J A;  3DXJ F; 
#chains in the Genus database with same CATH topology
 3KP3 A;  3DFG A;  4ZJZ A;  2AXL A;  3BTL A;  3ULQ B;  4M71 A;  4EGY A;  3D5L A;  1LFB A;  3ZQC A;  2PX9 A;  4BQA A;  1TQP A;  3FKI J;  3PO2 J;  2L4A A;  2R5Y A;  1XMA A;  3QPT A;  4OOI A;  2CMP A;  4B1R A;  4MLO A;  4QPQ A;  4CCO A;  4YRV A;  1WQ2 A;  1ZG5 A;  2ZC2 A;  3D1N I;  4L18 B;  4HF0 A;  4M3F A;  3F8C A;  1O3T A;  2E7X A;  2A61 A;  3HG9 A;  4HZF A;  2VXD A;  1FLI A;  4PJJ A;  1VZ0 A;  1USS A;  1LUJ B;  2M8G X;  4BJT A;  2Z5U A;  3IHU A;  5AIQ A;  2R7U A;  5F64 A;  3AL0 B;  4IJA A;  2R0Q C;  1P4A A;  1HQC A;  1HKS A;  2F5E A;  4MFD A;  2EFP A;  3FM3 A;  2LBF B;  1X2N A;  4RGX A;  3KP5 A;  2LOO A;  1BI3 A;  4MNU A;  4JYK A;  2BYV E;  5CJ9 A;  4MHG A;  4RAZ A;  3HOZ J;  1P7J A;  3E5X A;  5K5R A;  3P7N A;  2QCO A;  4Y13 A;  1MH3 A;  3AKZ A;  4BJ5 C;  4UVA A;  4H0E A;  2VBY A;  3NWS A;  9ANT A;  1W5C C;  1B59 A;  2RQQ A;  1O4X A;  2O03 A;  5K5O A;  2Q8K A;  3RDI A;  1RRJ A;  2F5V A;  4HRI A;  3F72 A;  5F1R A;  1H8A C;  1U2W A;  4RGU A;  3S1Q J;  3KZY A;  1F4K A;  1B1B A;  2R7O A;  1GUU A;  2E2I J;  4BBR J;  3I9V 2;  1MDM A;  2FEZ A;  1ODD A;  2DPU A;  3W2W A;  2CQN A;  2DT6 A;  4F55 A;  2JK3 A;  2KIS A;  3CDI A;  1FBS A;  4OWR B;  4R79 A;  1Z9C A;  2IGM A;  4YFK F;  2NNN A;  3F9K A;  2EV0 A;  3M3Y J;  1W36 D;  2UV1 A;  2XAJ A;  2PJP A;  4BGD A;  2DOD A;  2NVQ J;  4UB6 C;  3BOQ A;  1VQ4 I;  2ELJ A;  3OYA A;  4LOC A;  4F92 B;  1B72 B;  2BY3 A;  4XBF A;  3RPU A;  5EEA A;  1D0Y A;  1MZB A;  2EIN H;  5JR3 A;  2M4K A;  4RB3 C;  1DGR M;  4GYG A;  4PSX A;  3S2D J;  1DU6 A;  3GME A;  3LFU A;  1ZQ3 P;  2GOX B;  1LKX A;  2QUF A;  3TO7 A;  1HKQ A;  1FSH A;  1UZC A;  3ABL H;  1FTZ A;  3A01 A;  2CW8 A;  2ADU A;  1FP1 D;  3P5J A;  4E7H A;  1Y0N A;  4G7H F;  2VOP A;  1UST A;  2LFB A;  1SFX A;  3GFL A;  5F08 A;  3LA7 A;  3BG5 A;  1JHF A;  2DAO A;  2PMH A;  5IP7 J;  4KNY A;  3PSI A;  1T38 A;  2H8W A;  4XRS A;  1OYY A;  3TP3 A;  5E17 F;  3C7J A;  4A3M J;  3QYE A;  1KQ8 A;  2V1N A;  4PDK A;  1EA3 A;  1Y1V J;  4JP0 A;  4JX6 A;  3HSF A;  2PMZ A;  2TRT A;  3K4B A;  3BY6 A;  4M3G A;  2XVC A;  3DKY A;  1VQL I;  3F8M A;  4MIM A;  2L7M P;  4BH9 A;  1SFK A;  4Q47 A;  4WXH A;  3KEY A;  2W57 A;  4XSZ F;  2A6T A;  3KP2 A;  2VJJ A;  2H6C A;  3GTM J;  3MZH A;  4WXD A;  2OC6 A;  1FJL A;  2WBM A;  3V7C A;  2ZNY A;  5CQG A;  4U87 A;  1R49 A;  5HNF A;  2HGC A;  1WHU A;  4FE7 A;  3CCY A;  2W85 A;  3SFI A;  4G6T B;  4A93 J;  4NC7 A;  3CDL A;  1R1V A;  1V3F A;  2DI3 A;  2Z99 A;  4PK4 A;  2P0W A;  5ERI A;  2COB A;  4EQQ A;  3CUQ C;  1DP7 P;  5JI6 A;  2K9S A;  3WU1 B;  1JTX A;  2VKD A;  2CW7 A;  4JX4 A;  3RKQ A;  1X1C A;  2TCT A;  4XSX F;  3RKX A;  2Z2S B;  3A0B C;  3BR6 A;  1FNN A;  4HLY A;  4X0G A;  2GM4 A;  2PMU A;  3KEO A;  3C2G A;  5EEH A;  4CZZ A;  5FFX A;  3O8H A;  3A02 A;  3TL4 X;  4KA4 A;  2EV6 A;  1KA8 A;  2XHK A;  2ZXJ A;  2LKX A;  4B3A A;  2DMQ A;  4M73 A;  5AON A;  5LEJ A;  2DU9 A;  2V26 A;  5ILV A;  1JGS A;  3IRR A;  4AYB N;  1SD7 A;  4A0Y A;  1P2F A;  3T1B A;  3LAP A;  4FCY A;  2DOF A;  2VE8 A;  4CIC A;  4MGR A;  3WTV C;  2ZJP F;  5E18 F;  2VN2 A;  4EJO A;  1SAX A;  1FYK A;  2NAZ A;  5CVJ A;  3DLA A;  4DZJ A;  3NAR A;  3LSJ A;  4HA8 A;  1ENH A;  1GXQ A;  3S3N A;  3P9I A;  1P92 A;  1HC8 A;  3HRM A;  4A3E J;  1D5Y A;  2GA2 A;  4FX4 A;  4AU7 A;  1BM9 A;  1LFU P;  2J5O A;  3COA C;  1YW7 A;  1LEB A;  4ENM A;  1WKM A;  2MSY A;  4PJN A;  2G7U A;  2Q2E A;  3MEX A;  4F7Z A;  2K9M A;  2NYX A;  2DA5 A;  1CGP A;  4WXC A;  3CUQ B;  1I5Z A;  2HWV A;  3HL2 A;  5FRO A;  2CH0 A;  4YFX F;  3W2V A;  2CS3 A;  1LPQ A;  2ZME B;  5ILS A;  4EM1 A;  2OZ6 A;  2YS9 A;  1I3A A;  3LSK A;  5EEG A;  3GTJ J;  5FKN A;  2X4H A;  5D8K B;  4LMY A;  2NNY A;  4P9U A;  5K7H A;  1TT0 A;  4JX5 A;  2FOW A;  1BBY A;  2XGC A;  2MD5 A;  3RYP A;  2XGX A;  1TZL A;  1KON A;  2X51 A;  1LJ9 A;  1U5T C;  3CCQ I;  3OYN A;  2V1D A;  4AIK A;  3FMS A;  3IKT A;  5FLX Z;  2KLO A;  2VIX A;  3JRG A;  5DUI A;  5EJC A;  5FLM J;  3U1D A;  2LC2 A;  3VEP A;  3AG1 H;  4NQW B;  1T8I A;  4EVI A;  4F52 A;  1YG2 A;  3VOE A;  1CF7 B;  1Y0U A;  1QVT A;  5KVR A;  1MJ9 A;  1W7P B;  3LSH A;  4CA0 A;  1QRY A;  1S6L A;  4OAZ A;  4GCV A;  1RI7 A;  3U21 A;  1QHH D;  4O3M A;  5E1X A;  2Q0O A;  2E2H J;  2PJR B;  2A3S A;  4XIC A;  1W7P D;  3PSF A;  4RB2 C;  1J75 A;  3SDG A;  5FB2 A;  1NG6 A;  2LMD A;  5DCM A;  3EET A;  3H1C A;  4DZP A;  4Y7N J;  5BS6 A;  4BBS J;  3IH2 A;  1G3Y A;  1E2X A;  3BJO A;  3N05 A;  1G3T A;  2MW8 A;  3GUD A;  3DWL E;  4RAG A;  5LHG A;  1T2K A;  3ZMT A;  3LAJ A;  4WWC A;  2CG4 A;  4I0B A;  1IZ1 A;  1MMS A;  1J5Y A;  1DU0 A;  1MJB A;  3Q0W A;  5EG0 A;  3U2R A;  1UEL B;  2QF7 A;  4LGW A;  1JXS A;  4CH7 A;  4CZC A;  1TW2 A;  4PSW A;  4XK4 A;  2E1M C;  3CLQ A;  1JHH A;  1YTY A;  1BC7 C;  2XSJ C;  1XD7 A;  4A0Z A;  4IHV A;  2OU2 A;  3WG7 H;  5LRS A;  1BN5 A;  4W97 A;  4BKX A;  4EJU A;  3VDX A;  5GTI C;  3OWT A;  3FIS A;  3PJR A;  2HS5 A;  1TQI A;  3HOX J;  4LK0 F;  1ZRC A;  1R4M B;  3CUO A;  2M87 A;  4HQE A;  2O0Y A;  1YIJ I;  2W48 A;  3DV8 A;  3GTL J;  1FY7 A;  2L01 A;  4GO1 A;  2W84 A;  3OYL A;  1W36 C;  1EV7 A;  3CCS I;  1B8I A;  1H0M A;  2YU9 J;  3T8T A;  3WGG A;  2CFO A;  3BG9 A;  2E1O A;  2HR3 A;  3AL0 C;  3GTP J;  3PNT A;  2GXG A;  3E97 A;  1P4W A;  3EYY A;  3ASN H;  2A05 A;  2P5K A;  2P7V B;  2OAZ A;  3GLL A;  5TJJ A;  4A3J J;  3L2W A;  1O7F A;  3QPH A;  1X3Z B;  2DT5 A;  1V54 H;  3OIO A;  3G6E I;  4J19 A;  3J80 Z;  4BS9 A;  1YW8 A;  1O3R A;  4XOP A;  4N4N B;  4ENN A;  2QBY A;  1BOB A;  1WWX A;  2LY1 A;  2HOT A;  2LNB A;  4LJZ F;  2DYR H;  1XGS A;  2K9N A;  3ZQI A;  2EIM H;  2XV4 S;  4Y17 A;  3C2H A;  3C1D A;  2JPB A;  3K4N A;  2OTJ I;  1MMN A;  2P81 A;  2OTL I;  1S72 I;  3CCL I;  5LRR A;  3B02 A;  3DEE A;  2PG4 A;  3JRB A;  4KIF A;  3M1C A;  3OR2 C;  4Y4R A;  2A5W A;  3WGI A;  3S8P A;  2R93 J;  2VC1 A;  3G4S I;  1MSE C;  4WX9 A;  3L7W A;  2AO9 A;  5K5Q A;  2P5V A;  3JTG A;  4CDG A;  5C3E J;  3CJT B;  3PL8 A;  5GAD J;  4BE0 A;  3A01 B;  2HZT A;  1NHA A;  4G6D A;  4BJ6 C;  1H9T A;  3M07 A;  1ZYR F;  2JMW A;  3A4C A;  3F0C A;  2ZO4 A;  3HSR A;  2ZXH A;  2X1D A;  4OIN F;  3WTT C;  1STZ A;  4HG2 A;  5GP9 A;  1MJA A;  3EDP A;  4YIR X;  3I56 I;  1YI2 I;  4V19 K;  5EDN A;  2ZCW A;  2R7F A;  1ZEL A;  4M3B A;  3ABU A;  4MO7 A;  1KYW A;  1TWC J;  4Q5S F;  1ETW A;  4XMY A;  3L2U A;  3KYD B;  2F4M B;  5D5W B;  2RAE A;  4XLP F;  3JRH A;  3GX4 X;  3HOW J;  2EWN A;  4V2G A;  1S5L C;  2K7L A;  2JN6 A;  2NS0 A;  3G1O A;  5L3D A;  2L7F P;  3KP7 A;  1PUF B;  3EUH C;  3B73 A;  2DLL A;  3H35 A;  1FP2 A;  4BDY A;  5J1R A;  4M9X A;  2HVS A;  1TNT A;  2XRN A;  3I5U A;  2A68 F;  2KHM A;  1LDJ A;  3HJE A;  1I1G A;  2CSO A;  2XAU A;  2OCC H;  4IRI A;  3E5U A;  3M1E A;  3BZ6 A;  2YX4 A;  4CCN A;  5FO5 A;  2LYC A;  4XKW A;  4H4K C;  1ORK A;  2EIJ H;  3WU2 C;  1QHG A;  4BDZ A;  2QQB A;  3X2Q H;  3H3V K;  4XOR A;  3OY9 A;  3BZC A;  3CF5 F;  2IBD A;  4YEJ A;  2M34 A;  2K40 A;  2VQC A;  3HOS A;  2GLO A;  1LVA A;  2CW0 F;  1FIA A;  1B72 A;  2QYO A;  3BCB A;  5LD2 C;  3ESW B;  2K02 A;  3SJM A;  4RGS A;  4MTD A;  2ZJQ F;  1U6G A;  2XSD C;  3MKW B;  2IAI A;  2F48 A;  4G9Y A;  4N0B A;  4GGG A;  1VQO I;  4XLA A;  1BW5 A;  4HYE A;  1ZK8 A;  4A2U A;  2MH2 A;  3V42 A;  2BV6 A;  2EA2 A;  2R7Q A;  4XRF A;  4B48 A;  2A6E F;  2BY1 A;  3BTC A;  3M8F A;  4ZDP A;  3FXM A;  1S9H A;  2W4S A;  3O8G A;  4I09 A;  3DPL C;  3I3L A;  3E1S A;  5D6E A;  1IC8 A;  4IO9 F;  2W24 A;  2WV1 A;  1ONV A;  2XB0 X;  3M8J A;  1HW1 A;  2OUM A;  3IV5 A;  3SZG A;  2EBI A;  1XMX A;  2H1L A;  2MBF A;  2NVU B;  3REO A;  3SZP A;  4U7D A;  2BOL A;  2DA2 A;  1R1T A;  5F27 A;  1LQ1 A;  1UJ8 A;  1EH8 A;  3RKW A;  3PIO F;  3E6M A;  2L9S A;  2M8E A;  4CCL A;  1YO5 C;  1FC3 A;  1UFM A;  4C2T A;  3EPZ A;  4AVZ A;  3GFM A;  1Y56 A;  3ERM A;  3GEZ A;  4M6V A;  1Z3Y A;  3JCU C;  4BEH A;  1TBX A;  2DOE A;  2VJI A;  3QOD A;  2CO5 A;  3F8F A;  2BBY A;  4A6D A;  2IGN A;  1X3W B;  2A69 F;  2RNJ A;  3AFH A;  5FRN A;  2DBB A;  2XB5 A;  2HKO A;  4BXF A;  3C2B A;  2RRE A;  3BP8 A;  2EPF A;  3K1P A;  5KCM A;  4AC0 A;  1RET A;  4D0P A;  3IL2 A;  4NHJ A;  1RR8 C;  3K4J A;  4BHP A;  1F36 A;  1RUN A;  3CQZ J;  5FKO A;  5FGM A;  3DTI A;  3JRD A;  1NK2 P;  2E19 A;  3KEQ A;  4IOA F;  2UXN A;  1S8N A;  2IA2 A;  1ZTR A;  3CCM I;  1K79 A;  2R7T A;  1BIB A;  2Z3Y A;  5KAF C;  3OYF A;  2VKV A;  1D8K A;  2ME6 A;  3RPQ A;  3ZQL A;  2HTS A;  4S0H B;  1HST A;  1Y1W J;  1I27 A;  2XGE A;  1VND A;  2XUB A;  1BW6 A;  1A6Q A;  2O8X A;  2V7F A;  4IXA A;  4MQV A;  2JVG A;  3V7R A;  1TTY A;  1R5G A;  2I8D A;  5A2Q K;  2ZSH B;  4DJA A;  4NQW A;  3JRE A;  3GTQ J;  3DU5 A;  3PQK A;  3CC4 I;  3GZ5 A;  4NUB A;  3RCO A;  4F91 B;  2KQR A;  3QU3 A;  4ZH4 F;  1IRX A;  5EGO B;  3DPT A;  5HDN A;  3GLX A;  2HNH A;  2JPC A;  1FZP B;  4KN4 X;  5JVG F;  1ON2 A;  3M4O J;  4E70 A;  5J6X A;  2MA3 A;  2EFN A;  2E71 A;  3HSE A;  4U0V A;  2KL4 A;  1IF1 A;  1R71 A;  4Q4Z F;  3O6B B;  2PBI A;  2IS4 A;  4A3I J;  1XDU A;  2QSF X;  1D3Y A;  2L02 A;  4A5M A;  4OIP F;  1XB4 A;  1F5T A;  2FX0 A;  4PGG A;  2XIG A;  4BHB A;  5GAG J;  4RB1 A;  1H89 C;  1WJB A;  2FML A;  4HV5 A;  1V55 H;  1ZAR A;  1SC7 A;  1JT0 A;  3L2Q A;  2ID3 A;  1DP3 A;  1MD0 A;  1FOW A;  3ZQ7 A;  3VOD A;  3CCU I;  3KZZ A;  4IHS A;  4XR6 A;  2QWW A;  2FBI A;  2D45 A;  1WJD A;  1TW3 A;  2EZK A;  2FA5 A;  5J1U A;  3RTR A;  4XNF A;  3CD6 I;  2HVQ A;  2V4J C;  3KZI C;  2EB7 A;  1FBQ A;  5CVU A;  5ED4 A;  3L2V A;  2OF7 A;  1S29 A;  1U3E M;  2DTR A;  3FXL A;  1V4R A;  1Z1D A;  2R7V A;  3OL3 A;  5FKK A;  1FT9 A;  3BPX A;  5CVV A;  4A3F J;  2IJL A;  5J8F A;  3I54 A;  2XKP A;  1PP8 F;  1FOX A;  4ASN A;  3GCM A;  3LNQ A;  2P5L C;  1ERD A;  1ZRF A;  2LDU A;  2YU3 A;  3AG2 H;  1DGW Y;  4B47 A;  4Y52 J;  2M4G A;  1WGX A;  2WAQ N;  1BI1 A;  1RPW A;  3EUK L;  1O7L A;  2MG4 A;  2QKL B;  2DA1 A;  3K7A J;  3OYK A;  2CV0 A;  4K2E A;  2R5Z B;  5HLI A;  4ENJ A;  1K4S A;  1DQU A;  1OCO H;  3HIF A;  3RZO J;  2IP2 A;  5HLG A;  2E1M B;  1P4X A;  4RM3 A;  2FOK A;  5M5W J;  1KYZ A;  1XSV A;  4J01 A;  4IOC F;  3I4P A;  4XKC A;  3HOY J;  1YHQ I;  1U5T B;  5DCM B;  2VLA A;  3WTS C;  5M3M J;  2H09 A;  5C4J J;  4HNT A;  2OZU A;  2K3F A;  1U5T A;  4KIC A;  3F21 A;  3ISP A;  5FKL A;  1WSU A;  1K83 J;  3DTK A;  1U78 A;  1W1W E;  2MLG A;  1NTC A;  2MAB A;  5E3M A;  2PEX A;  2MYS A;  2PN6 A;  3HXL A;  3GZ6 A;  3DKW A;  3DCF A;  3E3V A;  1JKQ C;  2L4M A;  2JA2 A;  4DYQ A;  4BU2 A;  4RM2 A;  3BQY A;  1LE8 A;  1YE9 A;  1Y6I A;  1OIS A;  4KJZ A;  1Z3X A;  3GVA A;  2R7D A;  1SFU A;  2JA8 J;  1EKE A;  2JA5 J;  2NS7 A;  1JT6 A;  2HYF A;  2A5Y B;  4OMY A;  4MQ9 F;  1UHS A;  5CVI A;  2FBK A;  2E7W A;  1E3P A;  2DPD A;  5DEQ A;  6PAX A;  1MBF A;  1VQP I;  5DV5 A;  1V5F A;  5TIS C;  5JLW A;  3HTS B;  4WCG A;  3H9G A;  4AD9 A;  1VQ5 I;  1OCC H;  1KU9 A;  5DM7 F;  2IXS A;  3BLY A;  2C6Y A;  1NG7 A;  4HQM A;  1HXD A;  5JHF A;  2BE5 F;  2P6T A;  1IN4 A;  4IX7 A;  2JSP A;  2FD5 A;  2N8G A;  4KN7 X;  4Y33 A;  1OR7 C;  2FU4 A;  3BG6 A;  1UCR A;  1JI8 A;  2VBW A;  1U9N A;  3GFJ A;  5L3G A;  1CQT A;  4JK1 X;  4D5F A;  5IOY A;  5ICG A;  2DMU A;  2H6B A;  3HBL A;  4HDU A;  4A5N A;  4IHW A;  1BA5 A;  3DPU A;  2B0L A;  1JUS A;  3MKL A;  3FZV A;  3NQO A;  1D1C A;  4LG0 B;  1HSJ A;  4MFE A;  1UHM A;  1HA8 A;  3OYC A;  3PFI A;  4II2 A;  3H5R A;  5D4S A;  2KJB A;  2EFQ A;  1Y39 A;  2UZK A;  2LTP A;  3M9A A;  2NOG A;  3IH4 A;  2GXB A;  2DCE A;  1VTN C;  5J40 A;  1K78 A;  2ZKZ A;  1AHD P;  1BR2 A;  3ZN0 A;  2CV2 A;  4RMN A;  3TO6 A;  4HF2 A;  3Q5F A;  1MKM A;  2YPR A;  4ZTJ A;  3EYI A;  2E1C A;  4ZDO A;  2CQX A;  4HF1 A;  2BGC A;  2V79 A;  3HOT A;  2X6X A;  2O5R A;  4QLC U;  3W6J B;  2HI3 A;  2KIF A;  3FM5 A;  3LSP A;  3HHH A;  3CMY A;  4KDP A;  5ICF A;  3DTE A;  5DD8 A;  3GFI A;  2G9W A;  3V8L A;  3K2Z A;  2ZME A;  2DK8 A;  3QQA A;  1BR1 A;  2Y0S N;  4YFN F;  5HLH A;  3CMA I;  5LHH A;  4MTE A;  2V1X A;  4P5O A;  1I3Q J;  4RLQ A;  1GVJ A;  1XTA A;  3L2R A;  1QPM A;  4L5J A;  5FLV A;  4XM3 A;  5FD6 A;  2KP6 A;  2BVL A;  1S3J A;  2X48 A;  4IPA A;  3FK6 A;  3L09 A;  1FBU A;  1UHW A;  1FX7 A;  1Z6R A;  2VE9 A;  1FTT A;  1I6H J;  5JLX A;  2DFF A;  3FMR A;  4JOM A;  3JRC A;  2KDZ A;  5FLX K;  3R0A A;  5H6Q A;  2OV7 A;  2NS8 A;  2HDC A;  1GVD A;  1RZ4 A;  5LEK A;  1FIP A;  4ESJ A;  2R5Z A;  1TNS A;  3PQJ A;  1YRN A;  2JQ7 A;  3G71 I;  2L9N A;  3K9T A;  3DLL F;  2D1H A;  4CUG A;  3R0J A;  4IRH A;  1Z67 A;  2GOM A;  4DW6 A;  2VI6 A;  4ZYD A;  2R92 J;  2Q1Z B;  4N4O B;  3WTX C;  3ZQF A;  3OS2 A;  1ETK A;  4TV7 A;  3CC2 I;  3H92 A;  4A6E A;  2H27 A;  5J8C A;  1Y8Q B;  3WU0 A;  2CQ7 A;  2JA6 J;  1R23 A;  2F4I A;  5HDG A;  2VKH A;  2WWY A;  1ZKG A;  2ELK A;  1ZGA A;  1MH4 A;  4ON0 A;  1B6A A;  4UY8 I;  4CYC B;  4BQO A;  2LR8 A;  3CMM A;  3W6V A;  3S1N J;  3VSK A;  1OCZ H;  2Y30 A;  3EQL F;  4OU0 A;  5IT9 Z;  1Z7L A;  1MBJ A;  1MDM B;  1ZRD A;  1HKT A;  1O3Q A;  4M9Z A;  2HTJ A;  2HDD A;  2RNG A;  3GTK J;  3WTY C;  2X1E A;  5EZG A;  1U8B A;  1DUX C;  4X6A J;  2VC0 A;  1D0Z A;  4PUS A;  2JUG A;  4AVP A;  1S7A A;  1XC5 A;  1XGN A;  4PFP A;  1H88 C;  1T0F C;  1J2X A;  1OYI A;  1IW7 F;  1V5E A;  3OMY A;  3RQ4 A;  3WOD F;  2V1U A;  3PUB A;  2L0K A;  1GXP A;  2RKH A;  4R8H A;  3TGN A;  3AAF A;  2VOD A;  2BZT A;  4BQN A;  3HPH A;  1IXC A;  1WJE A;  2V9P A;  2XRL A;  4FIS A;  2QA4 I;  3I64 A;  1K4T A;  5D6F A;  4DBQ A;  5B1B H;  3M8E A;  3AG4 H;  4EMS A;  3HB9 A;  1T0F A;  3VSL A;  4CGZ A;  1OMI A;  3I71 A;  3TW7 A;  5LGU A;  3K69 A;  4AM3 A;  5HS8 A;  4BUP A;  4PFO A;  5BMZ A;  2EIK H;  3HHG A;  1SAN A;  3KET A;  2CYY A;  3KCC A;  1BJZ A;  1TL8 A;  2IVM A;  2M5W A;  4BY1 J;  1YJW I;  5HDK A;  4ABZ A;  3ZQH A;  3FXQ A;  3F8N A;  3O2P E;  3BR1 A;  2FMY A;  1XSD A;  4UV8 A;  1IXS B;  1ZG3 A;  4EM0 B;  2YSR A;  2GIV A;  3JRI A;  2YX7 A;  2WAD A;  1DPU A;  5DUK A;  3J7A O;  1WPK A;  3NRV A;  4BAC A;  4D9J A;  1G6N A;  4Y15 A;  2EJR A;  5CQE A;  4DOZ A;  2GBY A;  4ITV A;  4HX4 A;  2XKO A;  4M3D A;  4RDU A;  2OQR A;  1XGM A;  2W82 A;  2UUZ A;  1UMQ A;  3BPV A;  4ESB A;  3QOE A;  3G73 A;  2GIZ A;  2A07 F;  4FX0 A;  2Y75 A;  2LRD A;  5IY5 H;  4DQ2 A;  2OBP A;  1WVR A;  3LSM A;  3S32 A;  2VAS A;  3FXR A;  4C9Y A;  2KIQ A;  3GTO J;  4AIJ A;  2DJI A;  2HQN A;  2LP0 A;  3OS0 A;  4HX8 A;  2FBH A;  5E1Z B;  4NC6 A;  5BPD A;  3OYH A;  3OYJ A;  5HNH A;  4ZZL A;  3PFY A;  5AIP A;  2L7K A;  1KU2 A;  1XGO A;  2HDW A;  1NK3 P;  2VPR A;  3LSR A;  2KPM A;  3HEF A;  2DO7 A;  3N4M A;  4O6J A;  1UAA A;  4M9S A;  3OYB A;  3F22 A;  4CHU A;  1YIO A;  4M6Y A;  3HGG A;  2HXO A;  3TOA A;  4Z2Y A;  3L1P A;  5KAI C;  2RV8 A;  1PP7 U;  1BL0 A;  3ZN1 A;  1Z05 A;  5F1J A;  1KQ9 A;  2BW3 A;  3HRU A;  4HOB A;  3MAJ A;  1EH7 A;  5JHU A;  2HVR A;  4G7O F;  5E3N A;  1I6X A;  2FSW A;  3OSG A;  1ETV A;  3FBN B;  2K27 A;  2O7O A;  1YJN I;  2DOA A;  1L3L A;  3JSP A;  2WB1 A;  1OCP A;  1J09 A;  4A3G J;  1PUE E;  2LH9 A;  3SQN A;  4BXX J;  3ZMV A;  2KT0 A;  1ETQ A;  2O6G E;  2CJJ A;  3CJR B;  3BR3 A;  3EUA A;  2HXI A;  3KLN A;  2AQF A;  2E2J J;  2VQG A;  1WRJ A;  2KRH A;  3V7S A;  1ZH5 A;  4BXU A;  5HOD A;  4DYR A;  1B4A A;  2JTV A;  1LB2 A;  3IWF A;  4B44 A;  3F8B A;  5B5E C;  1AOY A;  5BNG A;  1JUM A;  1SVM A;  4UXN A;  3O3K A;  1B9M A;  5D5X B;  1XCB A;  3ZQG A;  2P7C B;  4UV9 A;  1OKR A;  2QKM B;  4C2U A;  4HSR A;  4B4C A;  2R7R A;  3F6O A;  2ETH A;  4A0X A;  3QPS A;  1AA7 A;  2E5Z A;  1Q1V A;  2BHZ A;  3IKV A;  3S1R J;  3ZMS A;  4BEH B;  1IN5 A;  1UG2 A;  2IPQ X;  2HZD A;  2YUS A;  2PI0 A;  3KE2 A;  3MD2 A;  1SFE A;  1MND A;  2X85 A;  4XOT A;  3DEW A;  3WHC A;  4IHX A;  1OR7 A;  2EZH A;  1Z91 A;  3CO6 C;  3I59 B;  3HC7 A;  4XLN F;  5LHI A;  5KNL A;  1SVL A;  3E6D A;  2MD0 A;  2LSO A;  1GHC A;  1F43 A;  3B6A A;  3MVP A;  1O57 A;  4N9I A;  3NAU A;  2HYJ A;  2HQA A;  3A03 A;  2FNA A;  4XL9 A;  4CCK A;  5TRD A;  2NOJ B;  3SDB A;  1OJL A;  3G1L A;  2JVH A;  3BTI A;  4CCM A;  5HOO A;  1YS7 A;  4R1H A;  1QZE A;  3UNG C;  2P8T A;  2GXA A;  2F2E A;  3OL4 A;  2XGD A;  1ZGW A;  5CVR A;  2QZ8 A;  2DQR A;  1IN6 A;  3ABM H;  2FQ4 A;  2LBF A;  1QZZ A;  2Y9Y A;  5L3E A;  4L9V A;  2DMP A;  3OIQ A;  2DDA A;  3HYI A;  1ZHF A;  4ETS A;  3G2B A;  5IT3 A;  2IT0 A;  5DM6 F;  2EFW A;  3ZMZ A;  4HV6 A;  2FJ1 A;  1QA6 A;  3HM5 A;  3OOP A;  5D5U B;  1HLV A;  1R58 A;  1OCT C;  4HPQ A;  4PZJ A;  5JVT A;  3FBI B;  1R4N B;  2HEO A;  1K7A A;  4I2O A;  1GV5 A;  1XCV A;  1A36 A;  4XKB A;  2BY2 A;  3OYD A;  1OPC A;  2YR2 A;  3KP6 A;  4IF4 A;  3OIP A;  4C3H J;  3LWF A;  4FQG A;  2GAU A;  3S15 J;  3J80 K;  2ZME C;  3M7G A;  1FOY A;  2ZBK A;  3WE2 A;  3HDD A;  1A04 A;  1WJC A;  4IQ4 A;  1A5J A;  2MC3 A;  1EF4 A;  4GDF A;  1SMY F;  1YFH A;  1ZR4 A;  3H0D A;  2JSC A;  1VI0 A;  2L2O A;  4PJL A;  2ZFW A;  2M45 A;  5E8I A;  3G1M A;  3OS1 A;  3GBG A;  4C30 A;  1SAU A;  1N77 A;  1QZY A;  3VYS B;  1X1B A;  3KYC B;  3LMM A;  3OYM A;  4YEL A;  2HOS A;  3BRO A;  5IP9 J;  2XAH A;  1N75 A;  1LNW A;  1KZH A;  4XLC A;  3BJ6 A;  2PFB A;  3SFZ A;  3J7Y J;  2DA3 A;  1OQY A;  4E6K G;  3KP4 A;  4A3B J;  4KT5 C;  5FD5 A;  4BY7 J;  4QSH A;  3ABK H;  4CSW A;  3K4K A;  1DDN A;  3RKY A;  3K4C A;  2M0C A;  3LST A;  2B63 J;  3E6B A;  4II3 A;  1R00 A;  2IRF G;  3VYT B;  2HQ5 A;  3BR5 A;  5JFR A;  3CCV I;  2F5D A;  1MBG A;  3QP6 A;  4LIT A;  3HRT A;  3PO3 J;  4JBA A;  1HBX G;  2JRM A;  3Q0V A;  3GTG J;  4EAT A;  3CTA A;  1J7K A;  2BXY A;  2EK5 A;  3QPL A;  1IG7 A;  1QBJ A;  1GDT A;  4RA2 A;  3HOV J;  4LB6 B;  2BY0 A;  2NVX J;  2HPM A;  2K9L A;  2XAS A;  4BYY A;  2QM3 A;  5DD4 A;  1R9T J;  2R7S A;  3BTJ A;  3L00 A;  3W3C A;  2XRO A;  4XRM A;  4I6Z A;  5GPA A;  1X4P A;  2ICW G;  4IL6 C;  2GQQ A;  4FE4 A;  1RR7 A;  1TWH J;  1VQK I;  4QWQ A;  1YW9 A;  1R5I D;  3K4L A;  2KKO A;  1BIA A;  4NC8 A;  5EG0 B;  4IKF A;  2D1V A;  4XN3 A;  2M7B A;  4E4H A;  2VT2 A;  3D5R C;  3IH3 A;  1LEA A;  3ML6 A;  3FHZ A;  1YLF A;  3RYR A;  4P1W A;  4DYC A;  4L9T A;  4U0Y A;  3HRS A;  3QYB A;  3JTH A;  3VYU B;  4LIU A;  3LQR A;  3VPR A;  3E6C C;  3R6S A;  4B8X A;  3FX3 A;  1MMA A;  1QQI A;  3S2W A;  2L5Q A;  2E5N A;  2CQQ A;  3F23 A;  3U1K A;  4BAY A;  1W0T A;  1TP4 A;  1VQ8 I;  3HUG A;  3CZ6 A;  4HNV A;  1J59 A;  4HEA 2;  1MSF C;  1TT5 B;  1L0O C;  1P7I A;  3C3W A;  3MQ0 A;  5KHD A;  2OJE D;  3OYE A;  3S14 J;  4N9H A;  4LD5 A;  4LK1 F;  2KJC A;  1OLT A;  2HFH A;  4E7I A;  5J4Y A;  1FEX A;  1T33 A;  4UUS B;  5D5V B;  1ZG1 A;  4YIF A;  3FDY A;  2OCE A;  1QPI A;  5DCF A;  2HKX A;  3ROU A;  1R5H A;  3H3Z A;  2KMU A;  3I0T A;  3V8J A;  2A6H F;  3KFW X;  5A2Q Z;  4XRS G;  2ZFU A;  4RS8 A;  2NRA C;  2MGQ A;  2RDP A;  3I4N J;  2FUG 2;  2B7E A;  1X3U A;  2DN0 A;  2X1C A;  2VJ4 A;  2IEK A;  4HNU A;  1NH3 A;  3H3U A;  3H5N A;  3D0S A;  1HDP A;  4C3J J;  4BNC A;  4HST A;  1Q1H A;  2K3P A;  2W1O A;  2OPT A;  1T39 A;  3ZGK A;  3CO7 C;  5LGT A;  3VFZ A;  3DBL B;  4YII A;  3FXU A;  4GRI A;  1UB9 A;  2Q2E B;  1TC3 C;  1T95 A;  2LVS A;  3MN2 A;  5D8L B;  2IGO A;  2VB6 A;  1A31 A;  4CYD A;  1XN7 A;  3BT9 A;  2MC4 A;  2LG4 A;  3HTU A;  3WG9 A;  4ZYE A;  3P9K A;  5LGN A;  3TW6 A;  1WJ5 A;  1TLH B;  4KYW A;  2R3S A;  3FKJ A;  2I5U A;  4UB8 C;  2P4W A;  2K4J A;  1FYM A;  1R22 A;  1XX5 A;  3JSO A;  4FTH A;  4DNC A;  1ZRE A;  2HU9 A;  2XF6 A;  4E7J A;  4E7K A;  1ETX A;  2M2E A;  5ICE A;  2RC4 A;  2R4G A;  4OAY A;  4WF2 A;  4EGZ A;  3OSF A;  2W7N A;  1YJ9 I;  4DBR A;  3T8R A;  4G7Z F;  3KYL A;  4BE2 A;  5J47 A;  1G3S A;  3K0L A;  2VQH A;  2ZNZ A;  3Q9V A;  2IA0 A;  3SXY A;  3ZP5 A;  3R4K A;  1IGN A;  4V2F A;  2MLK A;  2F4O B;  2QQ8 A;  4UNO A;  1FPQ A;  4A69 C;  2M3A A;  2QSG X;  1VQ7 I;  1QNT A;  4ESF A;  3I4M J;  1ETY A;  2WC2 A;  4AID A;  4OIR F;  1O3S A;  1XG1 A;  1XMK A;  2ZB9 A;  1VQ6 I;  4G8X A;  2XAF A;  3JR9 A;  2IS6 A;  1YS6 A;  2R7X A;  4G6Q A;  1HW5 A;  1VQ9 I;  3S1M J;  2H8R A;  2ELH A;  3QWL A;  5B66 C;  3J7A Y;  2JWT A;  3ERE D;  1IN7 A;  2QEX I;  3Q0U A;  4EEF G;  5E20 A;  3DU6 A;  4A3C J;  2FE3 A;  3QRF F;  1PJR A;  2KZV A;  3BJA A;  2DA4 A;  3EUH A;  4RAY A;  2UXX A;  1IDZ A;  2VQL A;  1LVK A;  2E36 A;  4GXO A;  3R60 A;  1IN8 A;  2EQR A;  3HKZ A;  4GYI A;  5B1A H;  2EA4 A;  1JGG A;  3JAM K;  4M3E A;  1JTY A;  1D8J A;  4KFC A;  2X6Y A;  4NB5 A;  1E17 A;  3BDD A;  1WCM J;  1R7J A;  1W4M A;  2KIM A;  2VOO A;  1MMG A;  2DW4 A;  3VYR B;  5GAE J;  1Z0X A;  2QQ9 A;  1CF7 A;  1W5T A;  2RN7 A;  2XC7 A;  3CME I;  1OCR H;  1WI9 A;  2EZL A;  2O3F A;  5LBQ A;  1AU7 A;  1HW2 A;  1X4O A;  2XAQ A;  2ACJ A;  4I99 C;  4E7L A;  2EFO A;  5K7F A;  5BPI A;  5BOX A;  1KGS A;  4EV0 A;  1IO2 A;  2L9R A;  2FNP A;  1JKP C;  3A2K A;  3RSN A;  5DTD A;  5GTH C;  5FRM A;  5ILU A;  2VBZ A;  1IDY A;  3TQN A;  4ZZD A;  4LLG F;  5H2F C;  4XLF A;  2ESN A;  1A35 A;  4FET A;  2OQG A;  3GO5 A;  5J3L A;  3SEQ A;  3TOB A;  5FFZ A;  4C3I J;  2L3D A;  4JQF A;  1P6R A;  5L3B A;  5EYR A;  4UVB A;  5CKT A;  2PMZ N;  2STW A;  1OYW A;  4ANJ A;  5M5X J;  4KIS A;  2XDV A;  3U9G A;  4CYC A;  1MIJ A;  1Z6T A;  3DF8 A;  4UVC A;  1ZLJ A;  5HS7 A;  1ZLK A;  3JRF A;  1JJ8 C;  2DA6 A;  2E35 A;  3ZOB A;  2E1N A;  1VQN I;  1H9G A;  3DEU A;  1U0J A;  3JW4 A;  5IOZ A;  3JRA A;  3IC7 A;  2ZJ2 A;  4F93 B;  3ECO A;  2HQR A;  4DIQ A;  1BJA A;  1RES A;  2WY7 Q;  3IAS 2;  4M6X A;  1YYV A;  4ZYG A;  2R7Z J;  3TO9 A;  2XF7 A;  4KMU X;  2ISY A;  1J0R A;  2M30 A;  2R5Y B;  3DBH B;  1G8X A;  4WK8 F;  4XN0 A;  5C4X J;  2F5C A;  4RLF A;  1POG A;  1G2H A;  1MW7 A;  3QAH A;  2DT7 B;  2O9L A;  2BEO A;  4U88 A;  4KIT B;  1D1A A;  4IQJ A;  2K9Q A;  3HPG A;  1Z77 A;  2BW3 B;  3LSI A;  1N78 A;  1K6Y A;  2IS2 A;  5GPC A;  2QVO A;  2V9V A;  2EV5 A;  2EIL H;  3L9F A;  5IYB J;  1HCR A;  3S2H J;  3MFK A;  3K1M A;  2JA7 J;  2ZSI B;  3ZMD A;  1FYL A;  1Z21 A;  4XLH A;  4OIQ F;  1TWG J;  4UUT A;  4I98 B;  5CLS A;  1IJW C;  3ZQQ A;  3RIR A;  2FRH A;  3GWZ A;  2COM A;  1LFP A;  3K1N A;  4L0Z B;  3WTZ A;  2D2W A;  3I58 A;  4A3L J;  1WH7 A;  2RGV A;  3CP8 A;  3CES A;  5DS9 A;  1YOV B;  2JT1 A;  4RB0 A;  4IHT A;  3HOU J;  3BR2 A;  1YX5 A;  2F6C A;  2LF7 A;  4XKV A;  2WV0 A;  1YQA A;  2JRT A;  4E7S A;  2B9S A;  4MEX F;  1FOK A;  1SFO J;  1IV8 A;  3OYI A;  1I39 A;  5DYM A;  1SEU A;  3CUQ A;  2VON A;  1QVU A;  3CCE I;  2QLZ A;  2G0E A;  5EZH A;  2ISZ A;  3CP2 A;  4IRG A;  2WAF A;  3FXO A;  1VFC A;  4I01 A;  5K1Y A;  4CXF A;  3MZ8 A;  1Z7U A;  2EH3 A;  2HOA A;  3QOP A;  1N25 A;  3MKY B;  2KRF A;  4P9F A;  1W0U A;  1J9I A;  2XAG A;  1G3W A;  3GXO A;  3K6G A;  5E3O A;  2GZW A;  4U7B A;  2H1K A;  3HUG B;  1JE8 A;  2ME0 A;  3W6K B;  2E34 A;  3LL7 A;  2HOE A;  5ICC A;  5B3S H;  4OIO F;  4U0W A;  2KRC A;  4CCJ A;  3GZN B;  2OD5 A;  4O5V A;  3QYF A;  4P55 A;  2X6O A;  1G59 A;  4ZTF A;  3RJP A;  4EJW A;  1WJA A;  4A3D J;  1QO0 D;  5E79 C;  1T08 B;  2HYG D;  4EJV A;  1PUF A;  2V9K A;  4A12 A;  1YIT I;  4PJ0 C;  1JJ6 C;  2CGP A;  2LY2 A;  3BQZ A;  4L5I A;  4FT8 A;  3K70 D;  1RKW A;  4W1U A;  1ON1 A;  2DFE A;  2FXA A;  2XPU A;  1JKO C;  1IRF A;  1R1U A;  3H36 A;  1QGP A;  4LB5 A;  5M3F J;  5K7Z A;  2LKS A;  2Z1D A;  5F0C A;  3FMQ A;  3LFK A;  1TWF J;  2DYS H;  4LG0 A;  5LFA A;  3PNV A;  2WTE A;  3LQQ A;  5DDG A;  1EJ9 A;  1YX3 A;  4D5C A;  2X9D A;  2BHY A;  2GA1 A;  3C18 A;  5TGT A;  1C0W A;  4M74 A;  4HDV A;  5BQT A;  1BOA A;  4UUS A;  1HF0 A;  3PUF A;  3Q9S A;  1ULY A;  2STT A;  2LLK A;  2LRE A;  2QEN A;  1WZ2 A;  1SMT A;  3LA2 A;  1BI0 A;  2ESH A;  4ZDL A;  3T5X A;  1K6O A;  1B9N A;  1RIO H;  2DK5 A;  5EGO A;  3H5A A;  3NWT A;  3F6V A;  1MBE A;  1SVO A;  3FHN A;  1KU7 A;  1D5V A;  4PJM A;  3QP5 A;  4HLX A;  1W5S A;  3OR1 C;  4IZZ A;  5EF6 A;  4M72 A;  5H6R A;  3TED A;  1TQM A;  4NBQ A;  1SD6 A;  1FMV A;  1X1A A;  3UR3 C;  2K86 A;  3ELK A;  2Y0M A;  4PCQ A;  4B43 A;  5J4V A;  3SEZ A;  4I0A A;  5IT9 K;  1R36 A;  1IUY A;  1SD5 A;  5LLQ A;  3I59 A;  3W2A A;  3DBR B;  4HW0 A;  3TKY A;  1AKH B;  5IYD J;  2KFD A;  1MNE A;  2PQ8 A;  2LD5 A;  2XF5 A;  1APL C;  2P6S A;  3WTU C;  2LY9 A;  3TMO A;  1LDK B;  2EZI A;  3ABT A;  3K2A A;  5CPR B;  3RI4 A;  3MZY A;  1MBH A;  4LLN A;  4IHY A;  4OMZ A;  1IUF A;  2MFZ A;  3LSG A;  3S3O A;  3B6C A;  4I76 A;  4B3X A;  4CO8 A;  2Y48 A;  3T0Y A;  2PLY A;  3R61 A;  4EM2 A;  2L9V A;  2BXZ A;  1F1Z A;  1E3O C;  1IAW A;  1FMW A;  1WJF A;  2PJR A;  5J1Y A;  1DPR A;  2DQL A;  4KT6 A;  4L0Y B;  3H0G J;  2AHQ A;  2UWM A;  2VL8 A;  2RVC A;  2Y9Z A;  1K78 B;  2CQK A;  1G4D A;  3FWE A;  1MNM C;  1T98 A;  2Z33 A;  1XDS A;  3FIW A;  5HLT A;  4LIV A;  2V6C A;  2IA1 A;  1RNL A;  2IGK A;  2O8K A;  1KQ0 A;  3PIP F;  3S16 J;  4HAM A;  1WFX A;  4ENK A;  5HS9 A;  3CF2 A;  3FF5 A;  1FSE A;  4AYB A;  3J7Z I;  2KIU A;  1REP C;  2F5F A;  3GW2 A;  5F0F A;  1YRN B;  2KDO A;  3J81 Z;  2X6W A;  3S93 A;  2DDB A;  3L2C A;  3WGH A;  2MH9 A;  4L5E A;  3WHB A;  1PDN C;  2DMT A;  3H9J A;  3WTW C;  4UUV A;  4YG2 F;  2Z9O A;  3ASO H;  4AWX B;  4BL0 B;  4AIH A;  2AXT C;  3HKZ N;  5E3L A;  2O61 A;  3V4G A;  4FHT A;  3H9Q A;  3S3M A;  3FXJ A;  4X1E A;  1ACI A;  2E60 A;  1GT0 C;  4QPO A;  2ZXW H;  1TWA J;  4HX7 A;  3CJQ B;  3MCZ A;  4HBL A;  1BC8 C;  1X58 A;  4RGR A;  2AQE A;  1X19 A;  2DFI A;  2M9H A;  3K10 A;  1ZAO A;  4AUX A;  2NVT J;  3ZR8 X;  2VXZ A;  1LE8 B;  2J5P A;  3TDZ C;  2CUE A;  2QQA A;  2VKE A;  1XS9 A;  2L7Z A;  3RPU D;  1WI3 A;  3K70 C;  1S7O A;  2KZG A;  1D1B A;  3E0J B;  1ZGJ A;  2WA0 A;  4IVN A;  3D5S C;  3SYT A;  1R6R A;  1VQM I;  1QU3 A;  2XPV A;  1D0X A;  2X0L A;  2QBY B;  3ECH A;  4I7H A;  1JUP A;  2IW5 A;  3ZRG A;  1Y8R B;  4KIG A;  1MMD A;  5FJ8 J;  5E8G A;  2AS5 F;  2H94 A;  5CYV A;  2BVM A;  5E1W A;  4LLL A;  4J00 A;  2FF4 A;  4S05 A;  4NNJ A;  3RQI A;  2DJN A;  2M0M A;  3CJN A;  1UG0 A;  2Y2Z A;  3I53 A;  4XLE A;  2M1B A;  5KK1 A;  2WY8 Q;  4D7N A;  3BG7 A;  4Y3O A;  3BZK A;  2CUJ A;  3I55 I;  2ZJR F;  1I50 J;  2I10 A;  1X2M A;  2Y69 H;  3A0H C;  4QTR A;  2CFX A;  3FXK A;  3JAM Z;  1JKR C;  2VPL A;  2W25 A;  4NDL A;  3TBI A;  4C2M J;  3CDH A;  4DGW B;  2DMN A;  1I1S A;  5L3F A;  5D4R A;  1X1P A;  5IPA A;  2LK2 A;  1IV6 A;  2VT3 A;  1XSX A;  4B09 A;  1RUO A;  1V5G A;  2VJ5 A;  2Y31 A;  4LG3 A;  2DTZ A;  2NXN B;  1MBK A;  5F0H A;  5H20 A;  4D7M A;  1T6S A;  3NEU A;  4RAF A;  2FQ3 A;  1MGT A;  4UHT A;  4E7Z A;  2ID6 A;  3KIO A;  3IWZ A;  2WAE A;  1AWC A;  3CLO A;  2WAQ A;  1U9O A;  3SZT A;  3KX2 A;  1ITY A;  3DKX A;  3DP7 A;  3UKG A;  2IS1 A;  1AKH A;  1BR4 A;  5L3C A;  2D5V A;  1IRZ A;  4MEY F;  4P96 A;  3QU6 A;  1ZR2 A;  3MMY B;  5C44 J;  3K4M A;  2VUM J;  3TP0 A;  4XQF A;  3VB2 A;  2CV1 A;  3HGY A;  1W7P A;  3CCJ I;  1A6I A;  2CUF A;  4KIB A;  2JJ7 A;  1F9N A;  3DQV C;  1K61 A;  4F3Q A;  3GF2 A;  2CRG A;  2RQP A;  2DXI A;  3E7L A;  2XPW A;  3GYH X;  3AG3 H;  1RC9 A;  5F6F A;  3E5Q A;  2W00 A;  5F04 A;  2DFH A;  2LF8 A;  4QIW N;  5HVQ C;  3BG3 A;  4KMF A;  1X1D A;  1PVE A;  3V8K A;  1T56 A;  2CUZ A;  4XON A;  3TDU C;  1PYV A;  1LDD A;  4I02 A;  3LA3 A;  2JUC A;  1WH5 A;  1M1E B;  2TDX A;  3IRQ A;  2K5C A;  2LKP A;  4A3K J;  2QGU A;  3ZCO A;  3BR0 A;  3SHF A;  3CCR I;  1HDD C;  2V6E A;  3N97 A;  1E0E A;  5FKM A;  2VBX A;  3A1Y A;  2K85 A;  3HZJ A;  1U8R A;  3OYG A;  3BWG A;  4S04 A;  4LFU A;  2Y0S A;  4EJT A;  3Q3S A;  4ZC3 A;  4Q48 A;  3RZD J;  2DA7 A;  1GV2 A;  1ETO A;  2L54 A;  4ZYH A;  2NVY J;  2QSH X;  3OOU A;  4D1Q A;  1E3H A;  4FAS D;  4ZYA A;  3WE3 A;  3G3Z A;  3ZXS A;  3ZMU A;  5IYC J;  3IP4 B;  3MKZ A;  3OV8 A;  2HPI A;  4IEJ A;  3PM1 A;  5M5Y J;  4XID A;  2CWE A;  1RKT A;  2WB1 N;  4BE1 A;  1S7E A;  4BHC A;  1ZN2 A;  1FWZ A;  3P9C A;  2CU7 A;  2ECC A;  1SD4 A;  3ZPL A;  4RBO A;  3CC7 I;  3IAM 2;  3KLO A;  2K4B A;  2GWR A;  3BCA A;  3S17 J;  2ECB A;  4KUM A;  3ONQ A;  1IRG A;  5GAH J;  1BI2 A;  2ZXI A;  1B8I B;  4L9N A;  2G7H A;  1EH6 A;  2Z16 A;  3J81 K;  1OFC X;  3KPH A;  1IXR C;  1VF9 A;  4Z6Y A;  4PGH A;  1HOM A;  3MWM A;  3IUO A;  4GFB A;  4BQQ A;  2JZY A;  3FK7 A;  5IP6 A;  3BC8 A;  1KU3 A;  3LOC A;  4G94 A;  3VWB A;  2OA4 A;  3PNY A;  3F3X A;  4L9J A;  1XPX A;  3DXJ F;  2R7W A;  1P9Q C;  1GLN A;  2M7A A;  4G12 A; 
#chains in the Genus database with same CATH homology
 3KP3 A;  3DFG A;  2AXL A;  3ULQ B;  4M71 A;  4EGY A;  3D5L A;  4BQA A;  1TQP A;  2L4A A;  1XMA A;  3QPT A;  4OOI A;  1WQ2 A;  1ZG5 A;  4L18 B;  4HF0 A;  3F8C A;  1O3T A;  2E7X A;  2A61 A;  4HZF A;  1FLI A;  1USS A;  2Z5U A;  3IHU A;  5AIQ A;  5F64 A;  4IJA A;  1P4A A;  1HQC A;  1HKS A;  2F5E A;  2EFP A;  3FM3 A;  4RGX A;  3KP5 A;  1BI3 A;  4MNU A;  2BYV E;  5CJ9 A;  4MHG A;  4RAZ A;  3E5X A;  5K5R A;  3P7N A;  4Y13 A;  4UVA A;  4H0E A;  2VBY A;  1B59 A;  2O03 A;  5K5O A;  2Q8K A;  3RDI A;  3F72 A;  5F1R A;  1U2W A;  4RGU A;  3KZY A;  1F4K A;  1B1B A;  1MDM A;  2FEZ A;  1ODD A;  2DPU A;  1Z9C A;  1FBS A;  4R79 A;  4YFK F;  2NNN A;  2EV0 A;  2XAJ A;  2PJP A;  3BOQ A;  4XBF A;  3RPU A;  1MZB A;  5JR3 A;  4RB3 C;  4GYG A;  3TO7 A;  2QUF A;  1FSH A;  1HKQ A;  2ADU A;  1FP1 D;  4G7H F;  2VOP A;  1UST A;  1SFX A;  3GFL A;  3LA7 A;  1JHF A;  2DAO A;  2PMH A;  4KNY A;  1T38 A;  5E17 F;  1OYY A;  3C7J A;  1KQ8 A;  4PDK A;  3HSF A;  3BY6 A;  2XVC A;  3F8M A;  4BH9 A;  4Q47 A;  4WXH A;  2W57 A;  4XSZ F;  3KP2 A;  2H6C A;  3MZH A;  4WXD A;  3V7C A;  2ZNY A;  2HGC A;  2W85 A;  1R1V A;  1V3F A;  2DI3 A;  2Z99 A;  5ERI A;  4EQQ A;  3CUQ C;  1DP7 P;  5JI6 A;  3WU1 B;  3RKX A;  4XSX F;  1FNN A;  4HLY A;  2PMU A;  3KEO A;  5EEH A;  4CZZ A;  5FFX A;  4KA4 A;  2EV6 A;  1KA8 A;  2XHK A;  2ZXJ A;  4M73 A;  5AON A;  5LEJ A;  2DU9 A;  5ILV A;  1JGS A;  3IRR A;  1SD7 A;  4A0Y A;  1P2F A;  3T1B A;  3LAP A;  2VE8 A;  4CIC A;  4MGR A;  3WTV C;  5E18 F;  2VN2 A;  4EJO A;  1SAX A;  1FYK A;  2NAZ A;  5CVJ A;  4HA8 A;  1GXQ A;  3P9I A;  1P92 A;  3HRM A;  2GA2 A;  4FX4 A;  1BM9 A;  2J5O A;  3COA C;  1YW7 A;  1LEB A;  4ENM A;  1WKM A;  2G7U A;  2Q2E A;  3MEX A;  4F7Z A;  2NYX A;  1CGP A;  4WXC A;  3CUQ B;  1I5Z A;  2HWV A;  4YFX F;  2ZME B;  5ILS A;  4EM1 A;  2OZ6 A;  5EEG A;  2X4H A;  5D8K B;  4LMY A;  2NNY A;  4P9U A;  1BBY A;  2MD5 A;  3RYP A;  2XGX A;  1LJ9 A;  1U5T C;  2V1D A;  4AIK A;  3FMS A;  3IKT A;  5FLX Z;  5DUI A;  3U1D A;  3VEP A;  4EVI A;  1YG2 A;  3VOE A;  1CF7 B;  1Y0U A;  5KVR A;  1MJ9 A;  1W7P B;  1S6L A;  4GCV A;  1RI7 A;  4O3M A;  5E1X A;  2Q0O A;  2A3S A;  1W7P D;  4RB2 C;  1J75 A;  5FB2 A;  5DCM A;  3EET A;  5BS6 A;  1G3Y A;  1E2X A;  3BJO A;  1G3T A;  5LHG A;  3GUD A;  1T2K A;  3ZMT A;  3LAJ A;  4WWC A;  2CG4 A;  4I0B A;  1IZ1 A;  1J5Y A;  1MJB A;  3U2R A;  4LGW A;  1JXS A;  1TW2 A;  1JHH A;  1YTY A;  1BC7 C;  1XD7 A;  4A0Z A;  2OU2 A;  5LRS A;  1BN5 A;  4EJU A;  2HS5 A;  1TQI A;  4LK0 F;  1ZRC A;  3CUO A;  2M87 A;  4HQE A;  2O0Y A;  3DV8 A;  1FY7 A;  2L01 A;  4GO1 A;  2W84 A;  1EV7 A;  1H0M A;  3T8T A;  3WGG A;  2HR3 A;  2GXG A;  3E97 A;  1P4W A;  3EYY A;  2P5K A;  2P7V B;  2OAZ A;  5TJJ A;  1O7F A;  3QPH A;  2DT5 A;  3J80 Z;  1YW8 A;  1O3R A;  4ENN A;  2QBY A;  1WWX A;  2LNB A;  4LJZ F;  1XGS A;  2XV4 S;  4Y17 A;  3C1D A;  2JPB A;  5LRR A;  3B02 A;  2PG4 A;  4KIF A;  3WGI A;  2VC1 A;  4WX9 A;  3L7W A;  3JTG A;  5K5Q A;  2P5V A;  4CDG A;  2HZT A;  1NHA A;  4G6D A;  1H9T A;  1ZYR F;  2ZO4 A;  3HSR A;  4OIN F;  3WTT C;  1STZ A;  1MJA A;  3EDP A;  2ZCW A;  2R7F A;  3ABU A;  1KYW A;  4Q5S F;  5D5W B;  3GX4 X;  4XLP F;  2EWN A;  2K7L A;  5L3D A;  2NS0 A;  3KP7 A;  3B73 A;  2DLL A;  1FP2 A;  4M9X A;  1TNT A;  2XRN A;  3I5U A;  2A68 F;  1LDJ A;  1I1G A;  2CSO A;  4IRI A;  3E5U A;  3M1E A;  3BZ6 A;  2YX4 A;  5FO5 A;  2QQB A;  3HOS A;  1LVA A;  2CW0 F;  2QYO A;  2K02 A;  4RGS A;  4MTD A;  1U6G A;  4G9Y A;  4N0B A;  4GGG A;  4HYE A;  4A2U A;  2MH2 A;  2BV6 A;  2EA2 A;  4XRF A;  2A6E F;  3M8F A;  4I09 A;  3DPL C;  5D6E A;  2W24 A;  1ONV A;  1HW1 A;  2MBF A;  3REO A;  3SZP A;  4U7D A;  1R1T A;  1LQ1 A;  1EH8 A;  3RKW A;  3E6M A;  2M8E A;  1YO5 C;  1FC3 A;  1UFM A;  3GFM A;  3GEZ A;  1TBX A;  2CO5 A;  3F8F A;  2BBY A;  4A6D A;  2A69 F;  2RNJ A;  2DBB A;  2HKO A;  3BP8 A;  3K1P A;  3IL2 A;  4D0P A;  4NHJ A;  4BHP A;  1RUN A;  5FGM A;  3KEQ A;  2UXN A;  1S8N A;  2IA2 A;  1K79 A;  1BIB A;  2Z3Y A;  1D8K A;  3RPQ A;  2HTS A;  1HST A;  1I27 A;  2XUB A;  4MQV A;  2O8X A;  4IXA A;  3V7R A;  1TTY A;  1R5G A;  5A2Q K;  4NQW A;  3PQK A;  3GZ5 A;  3QU3 A;  4ZH4 F;  3DPT A;  5HDN A;  3GLX A;  2JPC A;  1FZP B;  4KN4 X;  1ON2 A;  4E70 A;  5J6X A;  2MA3 A;  2EFN A;  3HSE A;  4U0V A;  1IF1 A;  4Q4Z F;  3O6B B;  2PBI A;  1XDU A;  4A5M A;  1D3Y A;  2L02 A;  4OIP F;  1XB4 A;  1F5T A;  4PGG A;  2XIG A;  4BHB A;  4RB1 A;  2FML A;  4HV5 A;  1ZAR A;  1MD0 A;  3ZQ7 A;  3VOD A;  3KZZ A;  4IHS A;  2QWW A;  2FBI A;  2D45 A;  1TW3 A;  2FA5 A;  3RTR A;  2EB7 A;  1FBQ A;  5CVU A;  5ED4 A;  1S29 A;  1U3E M;  2DTR A;  1V4R A;  1Z1D A;  1FT9 A;  3BPX A;  5CVV A;  2IJL A;  5J8F A;  3I54 A;  2XKP A;  1PP8 F;  4ASN A;  2P5L C;  1ZRF A;  2LDU A;  2YU3 A;  1BI1 A;  1O7L A;  4K2E A;  4ENJ A;  5HLI A;  3HIF A;  2IP2 A;  5HLG A;  1P4X A;  2FOK A;  1KYZ A;  1XSV A;  3I4P A;  1U5T B;  5DCM B;  3WTS C;  2H09 A;  2OZU A;  1U5T A;  4KIC A;  3F21 A;  3ISP A;  1WSU A;  1U78 A;  2MLG A;  2PEX A;  2PN6 A;  3GZ6 A;  3DKW A;  3E3V A;  2L4M A;  3GVA A;  2R7D A;  1SFU A;  2HYF A;  2A5Y B;  4OMY A;  4MQ9 F;  5CVI A;  2FBK A;  2E7W A;  2DPD A;  5DEQ A;  6PAX A;  5DV5 A;  3HTS B;  4WCG A;  4AD9 A;  1KU9 A;  2C6Y A;  4HQM A;  1HXD A;  2BE5 F;  2P6T A;  1IN4 A;  4KN7 X;  2FU4 A;  1UCR A;  2VBW A;  3GFJ A;  5L3G A;  4JK1 X;  5ICG A;  2H6B A;  4HDU A;  4A5N A;  2B0L A;  3FZV A;  3NQO A;  4LG0 B;  1HSJ A;  1UHM A;  3PFI A;  5D4S A;  2KJB A;  2EFQ A;  2UZK A;  3M9A A;  2GXB A;  1VTN C;  1K78 A;  2ZKZ A;  3ZN0 A;  3TO6 A;  4HF2 A;  3Q5F A;  1MKM A;  2YPR A;  3EYI A;  2E1C A;  4HF1 A;  2BGC A;  3HOT A;  2V79 A;  4QLC U;  3W6J B;  2KIF A;  3FM5 A;  3HHH A;  4KDP A;  5ICF A;  5DD8 A;  3GFI A;  2G9W A;  3V8L A;  3K2Z A;  2ZME A;  2DK8 A;  4YFN F;  5HLH A;  5LHH A;  4MTE A;  2V1X A;  4P5O A;  1GVJ A;  1QPM A;  4L5J A;  5FD6 A;  1S3J A;  4IPA A;  3L09 A;  1FBU A;  1UHW A;  1FX7 A;  1Z6R A;  2VE9 A;  3FMR A;  5FLX K;  3R0A A;  5H6Q A;  2HDC A;  1RZ4 A;  5LEK A;  4ESJ A;  1TNS A;  3PQJ A;  3K9T A;  2D1H A;  3R0J A;  4IRH A;  4ZYD A;  3WTX C;  4TV7 A;  3H92 A;  4A6E A;  2H27 A;  5J8C A;  3WU0 A;  1R23 A;  5HDG A;  2WWY A;  1ZGA A;  4ON0 A;  1B6A A;  4OU0 A;  3EQL F;  5IT9 Z;  1MDM B;  1ZRD A;  1HKT A;  1O3Q A;  4M9Z A;  2HTJ A;  3WTY C;  1DUX C;  2VC0 A;  4AVP A;  1S7A A;  1XGN A;  1J2X A;  1OYI A;  1IW7 F;  3WOD F;  2V1U A;  1GXP A;  2RKH A;  3AAF A;  4R8H A;  3TGN A;  2VOD A;  1IXC A;  3I64 A;  5D6F A;  3M8E A;  4EMS A;  1T0F A;  4CGZ A;  1OMI A;  3I71 A;  5LGU A;  3K69 A;  5HS8 A;  5BMZ A;  3HHG A;  3KET A;  2CYY A;  3KCC A;  2IVM A;  2M5W A;  5HDK A;  3FXQ A;  3F8N A;  3O2P E;  2FMY A;  1XSD A;  4UV8 A;  1IXS B;  1ZG3 A;  4EM0 B;  2YSR A;  2GIV A;  2YX7 A;  1DPU A;  5DUK A;  3J7A O;  3NRV A;  1G6N A;  4Y15 A;  2EJR A;  4HX4 A;  2XKO A;  2OQR A;  1XGM A;  3BPV A;  4ESB A;  2A07 F;  3G73 A;  4FX0 A;  2Y75 A;  4DQ2 A;  2OBP A;  3FXR A;  4AIJ A;  2HQN A;  4HX8 A;  2FBH A;  5E1Z B;  5BPD A;  4ZZL A;  5AIP A;  1KU2 A;  1XGO A;  2DO7 A;  3N4M A;  4O6J A;  4M9S A;  3F22 A;  4CHU A;  1YIO A;  4M6Y A;  3TOA A;  4Z2Y A;  2RV8 A;  1PP7 U;  3ZN1 A;  1Z05 A;  1KQ9 A;  3HRU A;  4HOB A;  3MAJ A;  1EH7 A;  5JHU A;  4G7O F;  1I6X A;  2FSW A;  2K27 A;  1L3L A;  3JSP A;  1PUE E;  3SQN A;  3ZMV A;  2O6G E;  3KLN A;  1WRJ A;  3V7S A;  1ZH5 A;  4BXU A;  1B4A A;  2JTV A;  1LB2 A;  3IWF A;  3F8B A;  1AOY A;  4UXN A;  3O3K A;  1B9M A;  5D5X B;  1XCB A;  2P7C B;  4UV9 A;  1OKR A;  3F6O A;  2ETH A;  4A0X A;  3IKV A;  3ZMS A;  1IN5 A;  2IPQ X;  2PI0 A;  3KE2 A;  1SFE A;  1OR7 A;  1Z91 A;  3CO6 C;  3I59 B;  4XLN F;  5LHI A;  3E6D A;  2LSO A;  1GHC A;  1O57 A;  4N9I A;  2FNA A;  5TRD A;  5HOO A;  1YS7 A;  4R1H A;  2P8T A;  2F2E A;  5CVR A;  2QZ8 A;  2DQR A;  1IN6 A;  5L3E A;  1QZZ A;  4L9V A;  3HYI A;  1ZHF A;  4ETS A;  2IT0 A;  5IT3 A;  2EFW A;  3ZMZ A;  4HV6 A;  3OOP A;  5D5U B;  1R58 A;  4PZJ A;  5JVT A;  2HEO A;  1K7A A;  4I2O A;  1XCV A;  1OPC A;  2YR2 A;  3KP6 A;  4IF4 A;  3LWF A;  2GAU A;  3J80 K;  3M7G A;  2ZBK A;  3WE2 A;  1A04 A;  2MC3 A;  1SMY F;  1YFH A;  2JSC A;  2ZFW A;  2M45 A;  5E8I A;  1QZY A;  3BRO A;  2XAH A;  1LNW A;  3BJ6 A;  2PFB A;  3SFZ A;  3KP4 A;  4KT5 C;  5FD5 A;  1DDN A;  3RKY A;  3LST A;  3E6B A;  1R00 A;  2IRF G;  5JFR A;  2F5D A;  3QP6 A;  3HRT A;  4JBA A;  1HBX G;  3CTA A;  1J7K A;  2EK5 A;  1QBJ A;  4LB6 B;  2XAS A;  4BYY A;  2QM3 A;  5DD4 A;  3L00 A;  2XRO A;  2GQQ A;  4QWQ A;  1YW9 A;  2KKO A;  1BIA A;  2D1V A;  2VT2 A;  1LEA A;  3ML6 A;  3FHZ A;  1YLF A;  3RYR A;  4L9T A;  4U0Y A;  3HRS A;  3JTH A;  3LQR A;  3E6C C;  3R6S A;  4B8X A;  3FX3 A;  1QQI A;  3S2W A;  3F23 A;  4BAY A;  3HUG A;  1J59 A;  1L0O C;  3C3W A;  3MQ0 A;  4N9H A;  4LD5 A;  4LK1 F;  2KJC A;  2HFH A;  5D5V B;  1ZG1 A;  4YIF A;  5DCF A;  2HKX A;  3ROU A;  1R5H A;  3H3Z A;  3I0T A;  3V8J A;  2A6H F;  3KFW X;  5A2Q Z;  4RS8 A;  2NRA C;  2RDP A;  1X3U A;  3H3U A;  3D0S A;  4BNC A;  1Q1H A;  1T39 A;  3CO7 C;  5LGT A;  3VFZ A;  4YII A;  3FXU A;  1UB9 A;  5D8L B;  4CYD A;  1XN7 A;  3HTU A;  3WG9 A;  4ZYE A;  3P9K A;  5LGN A;  1TLH B;  4KYW A;  2R3S A;  2P4W A;  2K4J A;  1FYM A;  1R22 A;  3JSO A;  1ZRE A;  4DNC A;  5ICE A;  2RC4 A;  4WF2 A;  4EGZ A;  3T8R A;  4G7Z F;  1G3S A;  3K0L A;  3Q9V A;  2ZNZ A;  3SXY A;  2IA0 A;  3ZP5 A;  3R4K A;  2MLK A;  4UNO A;  1FPQ A;  1QNT A;  4ESF A;  2WC2 A;  4OIR F;  1O3S A;  1XMK A;  4G8X A;  2XAF A;  1YS6 A;  4G6Q A;  1HW5 A;  2ELH A;  3ERE D;  1IN7 A;  5E20 A;  2FE3 A;  3QRF F;  3BJA A;  3EUH A;  4RAY A;  2UXX A;  4GXO A;  3R60 A;  1IN8 A;  4GYI A;  2EA4 A;  3JAM K;  1D8J A;  4KFC A;  4NB5 A;  1E17 A;  3BDD A;  1R7J A;  1W4M A;  2KIM A;  2VOO A;  2DW4 A;  2QQ9 A;  1CF7 A;  1W5T A;  2RN7 A;  1WI9 A;  2O3F A;  5LBQ A;  1HW2 A;  2XAQ A;  2ACJ A;  2EFO A;  5BPI A;  5BOX A;  1KGS A;  4EV0 A;  2FNP A;  5ILU A;  2VBZ A;  3TQN A;  4ZZD A;  4LLG F;  2ESN A;  2OQG A;  3GO5 A;  3TOB A;  5FFZ A;  2L3D A;  4JQF A;  1P6R A;  5L3B A;  4UVB A;  2STW A;  1OYW A;  3U9G A;  1Z6T A;  3DF8 A;  4UVC A;  1ZLJ A;  5HS7 A;  1ZLK A;  2E1N A;  1H9G A;  3DEU A;  3JW4 A;  3IC7 A;  2ZJ2 A;  3ECO A;  2HQR A;  1BJA A;  4M6X A;  4ZYG A;  1YYV A;  3TO9 A;  4KMU X;  2ISY A;  1J0R A;  2M30 A;  4WK8 F;  2F5C A;  3QAH A;  2BEO A;  4U88 A;  2QVO A;  2V9V A;  2EV5 A;  3L9F A;  3MFK A;  3K1M A;  3ZMD A;  1FYL A;  4OIQ F;  4I98 B;  5CLS A;  3RIR A;  2FRH A;  3GWZ A;  2COM A;  3K1N A;  4L0Z B;  3WTZ A;  2D2W A;  3I58 A;  2RGV A;  2JT1 A;  4RB0 A;  4IHT A;  2LF7 A;  2WV0 A;  1YQA A;  2JRT A;  4MEX F;  1FOK A;  5DYM A;  3CUQ A;  2VON A;  2QLZ A;  2ISZ A;  4IRG A;  4I01 A;  5K1Y A;  4CXF A;  1Z7U A;  3QOP A;  2KRF A;  4P9F A;  1J9I A;  2XAG A;  1G3W A;  3GXO A;  4U7B A;  2GZW A;  1JE8 A;  3W6K B;  2HOE A;  5ICC A;  4OIO F;  4U0W A;  2OD5 A;  4O5V A;  4P55 A;  3RJP A;  4EJW A;  1QO0 D;  2HYG D;  4EJV A;  4A12 A;  2CGP A;  4L5I A;  4FT8 A;  1ON1 A;  2FXA A;  1IRF A;  1R1U A;  1QGP A;  4LB5 A;  3FMQ A;  3LFK A;  4LG0 A;  2WTE A;  3LQQ A;  5DDG A;  2GA1 A;  3C18 A;  1C0W A;  4M74 A;  4HDV A;  5BQT A;  1BOA A;  3Q9S A;  1ULY A;  2STT A;  2QEN A;  1SMT A;  3LA2 A;  1BI0 A;  2ESH A;  3T5X A;  1K6O A;  1B9N A;  1RIO H;  2DK5 A;  3F6V A;  1KU7 A;  1D5V A;  3QP5 A;  4HLX A;  1W5S A;  4M72 A;  5H6R A;  1TQM A;  1SD6 A;  2K86 A;  3ELK A;  2Y0M A;  4PCQ A;  4I0A A;  5IT9 K;  1R36 A;  1IUY A;  1SD5 A;  5LLQ A;  3I59 A;  4HW0 A;  3TKY A;  2PQ8 A;  2P6S A;  3WTU C;  1LDK B;  3ABT A;  3RI4 A;  4LLN A;  3MZY A;  4OMZ A;  4CO8 A;  2Y48 A;  3T0Y A;  2PLY A;  3R61 A;  4EM2 A;  1F1Z A;  1IAW A;  1DPR A;  2DQL A;  4L0Y B;  2UWM A;  2RVC A;  1K78 B;  2CQK A;  1G4D A;  3FWE A;  1T98 A;  2Z33 A;  1XDS A;  2V6C A;  2IA1 A;  1RNL A;  1KQ0 A;  4HAM A;  4ENK A;  5HS9 A;  3FF5 A;  1FSE A;  2KIU A;  1REP C;  2F5F A;  3GW2 A;  3J81 Z;  3L2C A;  3WGH A;  2MH9 A;  4UUV A;  1PDN C;  3WTW C;  4YG2 F;  2Z9O A;  4AWX B;  4AIH A;  2O61 A;  3V4G A;  4FHT A;  4HX7 A;  3MCZ A;  4HBL A;  1BC8 C;  4RGR A;  2DFI A;  1ZAO A;  2VXZ A;  2J5P A;  3TDZ C;  2QQA A;  1S7O A;  1ZGJ A;  4IVN A;  2X0L A;  2QBY B;  3ECH A;  4I7H A;  2IW5 A;  4KIG A;  5E8G A;  2AS5 F;  2H94 A;  5CYV A;  4LLL A;  5E1W A;  2FF4 A;  4S05 A;  3CJN A;  3I53 A;  5KK1 A;  2M1B A;  2CFX A;  3JAM Z;  2W25 A;  3CDH A;  1I1S A;  5L3F A;  5D4R A;  2VT3 A;  1XSX A;  4B09 A;  1RUO A;  5H20 A;  1T6S A;  3NEU A;  2FQ3 A;  1MGT A;  4UHT A;  3IWZ A;  1AWC A;  3CLO A;  3SZT A;  3DP7 A;  5L3C A;  4MEY F;  4P96 A;  3QU6 A;  3VB2 A;  1W7P A;  4KIB A;  1F9N A;  3DQV C;  3GF2 A;  2RQP A;  3GYH X;  5F6F A;  3E5Q A;  2LF8 A;  5HVQ C;  4KMF A;  3V8K A;  3TDU C;  1LDD A;  4I02 A;  3LA3 A;  2TDX A;  3IRQ A;  2LKP A;  3SHF A;  3N97 A;  2VBX A;  1U8R A;  3BWG A;  4S04 A;  4LFU A;  4EJT A;  4Q48 A;  4ZYH A;  2L54 A;  3WE3 A;  3G3Z A;  3ZMU A;  3OV8 A;  2CWE A;  4BHC A;  1ZN2 A;  1FWZ A;  3P9C A;  1SD4 A;  3ZPL A;  3KLO A;  2K4B A;  2GWR A;  4KUM A;  1IRG A;  1BI2 A;  4L9N A;  2G7H A;  1EH6 A;  3J81 K;  1IXR C;  4PGH A;  3MWM A;  2JZY A;  1KU3 A;  4G94 A;  2OA4 A;  3F3X A;  4L9J A;  3DXJ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...