2CP5A

Solution structure of the 1st cap-gly domain in human clip-170/restin
Total Genus 7
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
7
sequence length
141
structure length
141
Chain Sequence
b'GSSGSSGMSMLKPSGLKAPTKILKPGSTALKTPTAVVAPVEKTISSEKASSTPSSETQEEFVDDFRVGERVWVNGNKPGFIQFLGETQFAPGQWAGIVLDEPIGKNDGSVAGVRYFQCEPLKGIFTRPSKLTRKVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Restin
publication title Solution structure of the 1st CAP-Gly domain in human CLIP-170/restin
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 7
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01302 CAP_GLY CAP-Gly domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.30.190 Mainly Beta Roll SH3 type barrels. CAP Gly-rich-like domain 2cp5A01
2Z0WA 3RDVA 2HL3A 2HKQB 1WHHA 1TXQA 2E4HA 2COZA 1WHGA 2COYA 2HKNA 2MPXC 1TOVA 2HL5C 3E2UA 1WHKA 2CP3A 3TQ7P 2CP0A 4B6MA 2CP2A 1IXDA 2COWA 2CP6A 2CP5A 2M02A 2E3HA 2E3IA 1WHMA 1LPLA 1WHLA 1WHJA 2HQHA 2QK0A 2CP7A
chains in the Genus database with same CATH superfamily
4AT1B 4OMMA 4M77E 2MYSA 1RUWA 4L6V5 2NUZA 2FG0A 1D1AA 5CKHA 4MZPA 2DPPB 4F7UF 1LOJA 1Q82R 1G3WA 2ZPHB 4C0DB 2EYXA 4E7SA 2I0NA 3UF4A 1K9MR 1LPLA 4N4HA 1AVZC 2DYIA 4KGXB 1KG1A 4E2FB 1S72A 2OTLA 4WTOB 4HCCA 1ARKA 2KBTA 1WHHA 2CZ0B 3CCEA 2X4XA 1IRXA 3KUFA 1YI2T 4FT2A 2CS7A 1NYGA 5LJ5g 1IXDA 2O4XB 1MMNA 1YJWA 4Z8AA 1AWWA 2DL4A 1BI1A 1KD1R 1UG1A 2K5IA 3D7SB 3PMIA 1WYXA 5IT9E 2EJ9A 5KCOA 1GRIA 2V1RA 2LNHB 1K1ZA 3M56A 5CQXA 1FMKA 2XDDA 1W2BP 2M02A 2NUTB 4C8QF 3RKXA 1UJ0A 3PVLA 1TG0A 4PNOA 4BI3A 4D8KA 2HSPA 5FWCA 4J9FA 4M78F 1VQ5T 2O31A 1QCOA 2IPOB 2RM4A 2DRMA 2ATCB 1WIEA 2EPDA 3SFMA 2PVGB 3EG3A 4QVZA 3OY9A 2EBPA 1B34B 1EFNA 2X4YA 5GMKi 1Y0MA 3MPUB 1VQ9Q 2CP5A 5GANe 2AZSA 1YNZA 1YWOA 3V8LA 3H8ZA 4F04B 2Z0WA 1WFWA 2VXEA 1GBRA 4XU1A 4FYYB 4V2SA 2OI3A 2LNVA 1QLYA 3THKA 1RAAB 3OYGA 3GOXA 2MWPA 1VQPQ 2MK5A 2AKLA 3WXMB 2BUDA 3EG2A 3TREA 2KNBB 5FWBA 2CDTA 4C92A 3CCLA 2Y4YA 2FZGB 2EWNA 4M77D 4RTWA 3CBPA 4LD6A 1JEGA 2ZZDA 4TVRA 1M9SA 2BKDN 4IUPA 2DNUA 2YT6A 1IGQA 2EJGA 1PCXA 3SHWA 4WF2A 4RKUE 5HY6A 3TVTA 4LDUA 4C8QA 1AZGB 1N9SA 3CC4Q 3PT9A 4Z88A 2XI9A 3OYNA 4M78A 2OTJA 1U8RA 1BBZA 4PJMA 3G71T 1YITT 1VQ5Q 1GL5A 2M1HA 4AFSC 5GAN4 2RQWA 5GAN8 3HHTB 4FM4B 2L3QA 2FPFA 2RHYA 2IIMA 2IG0A 1W2BA 4JJBA 4A63B 2VASA 4YTLA 1QW1A 1VUBA 4PFOA 2DM1A 2LMJA 1N8RC 1WA7A 2L3RA 1K9AA 3M0TA 3A5ZB 1PG5B 2X9HA 2O88A 4E7JA 1JBMA 3EGUA 1K0XA 3CBMA 1TOVA 1VQLA 4LNPA 1QCFA 4C92G 1X43A 2QYZA 3OYJA 2HBPA 3G7ZA 2AKKA 3UA7A 5GAOq 4R0KA 2O01E 2E5QA 3CCVT 3E19A 2D6FA 4CRIA 4RTVA 5HK0A 3CCJQ 2RQUA 2E6NA 2VGMA 2HQEA 4QQ6A 1WJSA 5EC7A 4J6WA 1NLOC 1YBYA 1FMWA 2YRCA 4BDYA 3DKMA 3M57A 4LDYA 3JCMV 1PRMC 4C8QG 1IHWA 4JRKA 4C5GA 4M78G 2QEXT 3J7AF 1D1CA 4IIOA 4HXJA 5LJ5e 2X4WA 2RJCA 1W4SA 2ZAEA 4RUGA 2K7AA 3MO8A 4M75A 3M54A 2EAYA 3DB3A 3TQ7P 1WJRA 1MMAA 2DILA 2DX1A 1U1SA 1BB9A 3S6WA 4LXCA 1YHQT 4EDUA 2LP5A 2LJ1A 4HVVA 3MKDA 5CKFA 2K5FA 2L2PA 3CCUT 4MMLA 1BU1A 5ECAA 2P0KA 2EGAA 2P4TA 2KI7A 3BDUA 3CPFA 1G5VA 3S3NA 4DOVA 3G6ET 2ZPFB 2JMCA 1MGQA 1M4ZA 2ROLA 4R56A 4II1A 2O4XA 1T0JA 1JB0E 5HKCA 2RHZA 5DLOA 1FMVA 3ASKA 3GF5A 4FYXB 3CCLQ 1VQ7T 2FL7A 1NE8A 2R5AA 1M1FA 1O9SA 3WVEB 1N8RU 2YRVA 2LC4A 3MEWA 2O9VA 1NPRA 3CXCS 5KE3A 1VQMT 1UGRB 2DXTA 1VQKT 2LQWA 1U1TA 1JRIA 4M75G 2EYYA 2NUTA 1VA7A 2KXDA 4M4ZA 5DY9A 2J6KA 3VS5A 3JB9D 3QZ5B 4Q5WA 3EG0A 3L2WA 3JB9H 1G3TA 2CP2A 1Q86R 3VUBA 1B34A 4DQ2A 3BDLA 2D0QB 3Q1JA 3CCRA 3EFRA 5DLQE 2JXBA 3RMSA 4JJNK 2RNAA 4C92C 1NEGA 2JM8A 1YHQQ 2CYZB 3C4SA 1N6AA 3OMGA 1R77A 2DJZA 4DBQA 2KE9A 3JCMb 2NUPB 4DBFA 4OGCA 5C6SA 2MWOA 1B3QA 4C8QC 1YWPA 5AT1B 3OYEA 2CH4W 2JW4A 3MEAA 2D1XA 3G1JA 4RG2A 1OI1A 3QYHB 4JRIA 1CSKA 4ANJA 2J6OA 3CPWP 4HT9A 5IHKA 2YLBA 2KROA 5FW9A 1TUGB 1KFZA 2EJFA 1NJIC 1NM7A 1Q86U 3EH1A 2QA4Q 3QDRB 1SHGA 4JJDA 2EFIA 2JNGA 2X3WD 2GTJA 2CGHA 1T0HA 4PLIA 4RTZA 2QGGA 1HXDA 3EG9A 1WXUA 2OAUA 4PJOG 1WHMA 2F5KA 3RR6A 4BY6B 2KYBA 4FU6A 2V8JA 4R55A 1QVFP 2KRMA 2PZ1A 4HCKA 4D8DA 2VXFA 4KGVB 1K8AR 1K76A 3VS0A 3H9NA 2DO3A 1QVGP 4J9CA 2FRWA 4OB0B 3PGGA 4XTXA 2DMOA 2YLCA 3QZ9B 3SEMA 3TSWA 3CC2A 3MP1A 1VQNA 3JCMP 3X25B 3C94A 2XG8D 3H0HA 2K6DA 4JS5A 3CEYA 4QKUA 2AIRB 4M75C 4DEXA 4MDWA 5GANg 5KE2A 1D09B 3V7RA 1I8FA 5D7UA 2A3LA 5FU6B 3OA6A 3M0RA 1OQKA 4J9IA 3FEOA 3E9GA 5I11A 1UGPB 2RHUA 1D0YA 3A8GB 1XTDA 1RAIB 5IHNA 3UWNA 2CUDA 2XKOC 3CC7Q 4BE2A 3RUXA 2Y90A 1H3HA 3LYIA 2CP3A 3QJYA 4DOWA 1X6OA 1KJWA 5LL6S 3I9QA 1I07A 3L2VA 3VV0A 2BE7D 4IUUA 3MP8A 3OYAA 2DZCA 4J9EA 1VQ6Q 1K8AU 1UHCA 5GANj 4UC4A 4WCIA 2V26A 2X51A 1PKTA 2XDPA 4F7UE 3OYMA 4JZ4A 3CCSQ 1VQPA 3VYHB 3FLGA 5LJ3d 5GAN5 2DD4A 3CCQT 1NEBA 1Q81U 1UJYA 1M8VA 4X9CA 3JAME 1TU0B 2YUQA 2K3YA 3MP6A 3OSVA 3ME9A 2KYMA 3EFOB 1Q82C 4BE1A 1OZ2A 3E2UA 4DA4A 2GNCA 4XTYA 5LJ3h 1I5LA 1JU5C 2LT4A 1K9MC 2E5KA 1AWXA 1QVGA 1RI0A 2CT4A 1VQ4Q 4PLLA 4RMOA 3BE3A 1YIJT 2BIVA 4M75B 4C5HA 3CC4A 5GANf 2JMAA 5GMKe 1SKUB 3QDFA 1OEBA 3U23A 4PJOC 3SWNB 4E7HA 1YJNT 1MNEA 1VQ5A 3WVDB 4C5EA 2LRQA 3DLMA 3CBOA 4C8QE 2WACA 4J9GA 2K5LA 5CQYA 2DTOA 4E7ZA 3UPUA 1OYXA 4BE0A 1KC8C 4ZGJB 1YJ9T 4M78E 2GFUA 2HQHA 1WI7A 2CP7A 3EAEA 3L2UA 1WXBA 2VWFA 2COZA 2COYA 3X24B 1OZ3A 2XMFA 3CMEQ 4X34A 4EIKA 1GFCA 1M2VB 2RH2A 3KBGA 4C92F 3I55Q 2X35A 2ZGWA 1WHLA 3CC2Q 2QTXA 2A08A 1VQNQ 2NUPA 3G4ST 5CAIA 4ZN1A 3CCJA 2EW3A 5FRMA 2AHJB 1IGUA 4C0ZA 3M0SA 2RB6A 4C5IA 1VQOT 3L2ZA 2KAFA 2HDAA 3RKYA 2DERA 3DB4A 1K73C 2RJDA 2YXYA 3NHNA 2GF7A 2LQKA 3I5SA 4FYVB 3LLRA 3QG1A 3X26B 5L23A 4O6JA 3CCMT 2ZPEB 4KH0B 2R58A 2KVQG 2F2VA 4E47A 1I4K1 4A4FA 3PIPA 3I56T 1AWJA 3NTIA 4LDXA 3PNWC 5LJ5j 4B6MA 3SD4A 1D1BA 3REAB 1VOMA 1UB4A 5AYFA 4RTUA 3UA6A 4HT8A 1M3BA 2DIQA 2GFAA 1KSWA 3LGFA 5CKBA 1ZBXA 4PJOB 3QKJA 2E12A 1OV3A 1SHFA 3TCJA 1S72T 2EQMA 2OTLT 4OB1B 2SEMA 2H8HA 2BE9B 2EVRA 3GNGA 3CCET 4X1VA 3BFMA 1PSFA 1J3TA 1YJWT 2KXCA 1YI2Q 1X01A 1T3SA 1TXQA 1N27A 4OMOA 2MMPA 3FDRA 3QHSA 5LJ5f 2LX7A 1G8XA 4KRTA 3QUIA 3G4SQ 2NWMA 3OYIA 2C0OA 1FXXA 4C8QD 4FYWB 3JCMg 1KIKA 5GAMg 1TH7A 3JSCA 4KULA 4M7AC 4M75F 4M78D 4JRQA 1JXOA 5HK3A 3JCMQ 1E6GA 3OB9A 3OYKA 1FWZA 1W70A 2E41A 2NLUA 4AG2C 3CCMQ 3EG9B 3A8LB 2HEQA 4J7FA 1G3SA 2VV5A 3PFSA 3S3MA 4C0GA 1W1FA 3RDVA 2FZKB 1IREB 2X3XD 2KK4A 4CI0C 2FVUA 2KRNA 5KYUB 3GBQA 1K73U 1YHQA 2XDBA 4DBRA 2PTKA 2FPDA 2P84A 5GAMj 2RO0A 2HNIA 3META 4QW2A 3ULRB 3MEVA 4N4GA 4IUVA 4FW2A 1KHIA 4ELYC 2EGEA 4J9HA 4OMLA 5IHIA 4N4IA 1BIAA 2DLPA 1PHTA 2DTIA 2MPXC 5GAOn 4LDVA 1QP3A 4JLIA 4EMKB 2ROTA 3A1PA 4ZN3A 2FO0A 4MMKA 3EFOA 2KEAA 4M7DB 1UGVA 2FHDA 2QASA 2EYZA 2L3SA 2OJ2A 5A0GA 2F69A 4HVWA 1HYOA 2DD5A 2QA4A 2FEIA 5A0LA 1N8RR 3KXTA 3FJ5A 2EIFA 1MMDA 2KMTA 3SWNA 3VS3A 2E6ZA 3M9QA 3QPHA 5GAMf 3L2QA 2DTHA 1CKAA 2A0FB 4M7AB 3M59A 3L42A 2PVDB 4FIBA 3HL8A 4OVAA 2YHTA 4NS5A 4PJOF 3C0CA 1X6BA 3G71Q 1YITQ 4LN2A 2XIDA 4ZGDB 1H3ZA 2QDLA 3JRZA 3CQTA 1SRMA 4F16A 1QVPA 3FJPA 1OULA 4NL2A 3CXCP 2DETA 2E3HA 1VQLT 4J5YA 1M2VA 3FB9A 1M90C 3ZEHA 1IHVA 2D8HA 3T9NA 5IAYA 2M51A 2GQIA 3HSBA 3CCVQ 2I2LA 1OPKA 4E7KA 3M4YA 9ATCB 2O9SA 5M9OA 2CSIA 4XTZA 1BK2A 3RIRA 4DEYA 1ZBJA 2R57A 2QK0A 3KFVA 4PFPA 1PRLC 1ZQ1A 4BY6C 1LVKA 3CC7A 3TSZA 2VUBA 1G2BA 8ATCB 1C1AA 2QEXQ 3QO3A 4CC3A 3EHQA 3HRUA 2DZ9A 5GJVB 1Q7YC 1NG2A 3E9FA 5KYXB 2B86A 2PUKB 1M5Q1 3L2RA 5FROA 3NFCA 3VJPA 2EKHA 5I2MA 2O2OA 1UGSB 1VYTA 2LVMA 1VQ6A 1WZOA 3ER0A 2RF0A 3BW1A 3JCMe 1RABB 1R8OB 2EKOA 5GAMe 3QJ6A 1TSFA 3JCMX 3HP9A 5CKDA 4PJOA 4HCBA 3O8VA 4GLMA 3CCUQ 2DE0X 2GCXA 3CCSA 2C06A 2DRKA 4N0AC 5A0DA 1ZUUA 1UE9A 2PU9B 5D6XA 1LCKA 3OBYA 5FU6C 3RERA 2DA9A 1VQ8T 3G6EQ 1KK7A 1RAEB 4HKEA 4Y28E 1U3OA 3ZBDA 1K0SA 2EQIA 3HRTA 2HCKA 4AFZC 4X9DA 1RAHB 2LQNA 2CUBA 3VS4A 5LJ5d 2VKNA 4M7DF 4M77C 1M1KC 2XICA 2QI2A 1MUZA 3LH5A 5GAN6 2KT8A 1G3YA 2RHXA 1VQ7Q 1X6GA 4KUDK 2W0ZA 5KYNA 3CXCA 3P8BB 1VQ4A 1AZEA 4J9BA 2M0OA 1ZUYA 2D0NA 4AFQC 5LJ5h 2DFUA 3JCMc 3LWHA 2VVKA 4ESRA 4KBMB 2YSQA 3HRSA 1VQMQ 4FSXA 1VQKQ 3OSSC 1H641 3BY7A 4OGEA 1SRLA 2JVVA 3EH2A 5GMKj 4M7AF 2DBKA 2LCCA 3OW2S 4FW1A 4J9DA 3V7SA 4ZTFA 4NOYA 5CO7A 2A28A 2JS0A 1SSHA 3CCRT 1X2KA 3V7CA 2LX9A 1VYVA 3SB2A 2HL5C 3PE0A 3RBBB 3CMEA 5KYUA 1ZLMA 2DL5A 4F17A 3V8KA 2CP6A 3A8MB 4LDWA 3HPWA 4HVUA 4PJJA 1F1BB 2IVWA 2K2MA 3I55A 1QQJA 2QQ9A 1WXTA 1M27C 4AG1C 1YCSB 1PM3A 2HMAA 5J26A 4ZNXA 1WQWA 1Q7YU 4EMGA 1NJIR 4F14A 1X75C 5IXBA 3PMTA 1Q81R 2ECZA 3SWNC 3RESA 1UHFA 2KR3A 4BB7A 2RI5A 3EHRA 1HD3A 1ZHIA 4EMKA 1MV0B 1NYFA 1VIEA 1I1JA 4M7DA 3NPFA 1Y96A 1JJ2S 1ZX6A 2ZPGB 2K9GA 3GIBA 3OBWA 3QWXX 4KH1B 4M77B 2NYSA 1X2QA 1WHKA 2RK2A 2DVEA 3I5RA 1KQSP 2JJ9A 5GJWB 4OP0A 1WJQA 5IN1A 1QVGS 2LT1A 2C0TA 2MIOA 4BI4A 4EMHA 4IURA 3AHUA 2F5TX 1TWBA 3CPWA 2YUNA 1W6XA 2JZ2A 2D9TA 3H41A 4M7AA 2KSSA 2PNIA 1EX4A 2HL3A 1M1KU 1BI3A 2YWWA 1ZSGA 4A4GA 3HFOA 1GXIE 2LCLA 2F2WA 4JDSA 1GCPA 1BYMA 4JRPA 2LDMA 3X20B 2J05A 1NJIU 1C0MA 4JUVA 1V1CA 2E70A 1D3BB 3P8DA 4L59A 3OYLA 2ZPIB 1YI2A 3EFSA 3P8HA 2HKQB 1WHGA 2RK1A 2YUPA 1FYNA 1JQQA 4M7DG 2V1QA 2BTTA 3VU3C 2W10A 2J06A 1BI0A 1WGSA 1QVFA 2RJEA 3G4SA 2CSQA 3M58A 3FRNA 4FT4A 2EGCA 4C92E 2V8KA 1I81A 1H8KA 4KUIA 2M9UA 5KYWB 4PJLA 2HSEB 4QVCA 4NL3A 4XTVA 5CK9A 1AWOA 4RCCA 1UDLA 1NBEB 3M4GA 4Z89A 3N5BB 1KD1C 3CCMA 2Y4XA 4IUTA 2LQ8A 2LJ0A 4M7AG 3R6OA 2QGFB 1IB8A 3RKWA 2L0AA 5I21A 3CMAT 4CC2A 2JTEA 5KYXA 1UEBA 1VQ9T 1SG5A 2L3PA 2ENMA 2L89A 1R0BG 3RNJA 4XTUA 2GTOA 2KQWA 2JTFA 4XTWA 1RI9A 3CD6T 2BZYA 1SEMA 1X27A 2A37A 4JLGA 1KQSA 2EQKA 4P5NA 1Q95G 3VS7A 1CKBA 1M3CA 1BCOA 2CH4A 3DLLA 1VQPT 2MI6A 2K2VA 3NGPA 2OAWA 1OX9A 2PVOB 2GQVA 1QKXA 5GMKl 2VGNA 3CCQQ 2JM9A 2RJFA 4OF1A 2BZXA 5IXFA 2ZPBB 5GAOl 3I35A 2LCSA 2KGTA 4QT7A 1PSEA 2ZCFB 4AMCA 3A8OB 1U5SA 1I5OB 1ZUKA 4RTXA 1KC8R 2HD0A 1I0CA 2HBWA 5L8RE 5CVIA 4M77F 4ME7A 2E4HA 1WX6A 1YFNA 5GAOr 1Z9QA 2OX7A 3CC4T 3LH0A 2A7YA 1YIJQ 2E10A 2VC8A 4A4KA 5IH2A 4M75E 3C95A 1YJNQ 4IKFA 1Q82U 3G71A 4OB3B 1YITA 3AT1B 4OMPA 5CIUA 1K9MU 1YP5A 3PTAA 4KGZB 1A0NB 3OQ5A 5KYYB 4BD3A 1EIFA 1ZSZB 2B8AA 3CMAQ 2AK5A 1YJ9Q 1RAGB 5CCAA 5I2SA 1KQ1A 1UUEA 4EMKC 4RCBA 1W2BS 3PVQA 4ATOA 4M7DC 2QTVA 3CD6Q 4C92D 2E1HA 2G6FX 1K73R 2H3JA 2K4YA 4F7UA 3SDZA 1RADB 3MJXA 3M0PA 1KD1U 4RG8A 2RQVA 3LX7A 3FC3A 1FX7A 1GCQA 1MNDA 4GBQA 2PUOB 2A36A 2CZ1B 1WQ7A 3CCVA 3CCJT 1KC8U 1PD1A 1PKSA 1HK9A 4FSSA 4C0FA 1E7OA 4N0AA 3LGLA 4J7IA 3C12A 1QMCA 4JJCA 1VQOQ 4QQGA 3INZA 5FU7C 5GMKh 3H0FA 3MCAB 2CZ7B 1Y07A 4LD9K 2V8IA 2DBMA 1PC0A 2QEXA 3EG1A 2CKKA 2F1LA 1HJDA 4OMNA 4M77A 2DL8A 2D8JA 1AD5A 2YUOA 2XD0A 3GNFB 3I56Q 4RTTA 2YRDA 1V29B 1D0ZA 3J81E 2H3EB 1AHJB 4J8OA 4PKCC 1DJ7B 1RACB 2K57A 3LW5E 2EQJA 2RN8A 3JCMJ 4F7UG 4CC4B 3CCUA 1XJWB 3GPLA 2DEUA 3A8HB 2QDYB 1GBQA 2P0PA 4CC7A 4BDZA 4HCZA 2G3RA 1KHCA 1GFDA 4B9WA 5LJ3g 3G6EA 4PJOE 2QQRA 3QBYA 2WSFE 1S72Q 2OTLQ 3MEUA 2RQRA 1D3BA 3OYCA 2PQWA 1P92A 2MAMA 4HA8A 4B9XA 3CCEQ 1ACMB 1Y7XA 4E7IA 3A98A 5C0MA 2P4RA 2XU8A 4PK4A 3CCLT 1YJWQ 5D6WA 2FZCB 3ZL7C 3VS6A 1VQ7A 4Y92A 3QSUA 1Y96B 1MV3A 2QG9B 3FIFA 2HQXA 1WDXA 3OS1A 3VKIA 4M75D 3EGDB 5KYWA 4M77G 1E6HA 3V8JA 5GANd 2QQSA 3PIOA 4JZ3A 2DL3A 3R6NA 4RTYA 5FLXE 2RD1A 1VQMA 1VQKA 1NPPA 1UGQB 4LUEA 4A4EA 8AT1B 4ZGEB 1ZA1B 1RLQC 1QP2A 3JCMf 3ZFJA 1N9RA 5LJ3j 4O5VA 2OTJT 3OYBA 5GANh 2E3IA 4MDXA 4JS4A 1IZ6A 2RPNA 3O5ZA 1SF9A 4GLKA 5FU7B 3JB9F 4XU3A 2MF2A 2XK0A 1TS9A 2DVJA 2DEQA 1NLPC 1YN8A 2JUFA 1HSQA 2BZ8A 4IUQA 2JS2A 3QIIA 1XNIA 1EZZB 2M0YA 3QYGB 3GLXA 3QXEB 5FRNA 2JN0A 1JO8A 6AT1B 3J80E 3GP8A 2ABLA 1OX8A 1M2OA 2RHIA 5D6YA 1Q86C 3E1SA 1U06A 1VQ8A 2DXBA 3M55A 2AT1B 3VS2A 1B07A 2HAXA 1OPLA 2XHCA 5LJ3f 1MHNA 3HKSA 3OS2A 2QQAA 3OYYA 2VB6A 3JB9I 4A53A 4XK8E 2JOYA 4M7DE 2ED1A 3NTKA 1H92A 2QA4T 3HFNA 1WPYA 4MZMA 3HTRA 3EGXB 2DIGA 2AZVA 4VUBA 1TUCA 4J6XA 4PJOD 5I22A 2DF6A 1M3AA 3F70A 2HKNA 1GCQC 1M90R 3JCMW 2OTJQ 2R5MA 2QXFA 2DXCA 2K3BA 5KYYA 3UDCA 1ZSZA 4Z02A 4M7AE 3M0UA 2FPEA 3UT1A 2GBQA 5GAOp 2YDLA 2J6FA 3L1AA 5CKEA 2DYBA 2DL7A 3OYDA 3H0IA 2RA2A 3X28B 1C6VX 4L5GA 4KT0E 1WNLA 5DM7R 3H6ZA 1VQLQ 1QCNA 2LZ6B 3JV3A 1WLPB 1VIFA 4GY5A 2MCNA 4DBHA 3OYFA 5A2QE 3OW2P 1Q7YR 1LNXA 5J39A 4BUGA 4BACA 1UECA 4M78C 2SRCA 2E65A 1K8AC 7AT1B 5LJ3e 3VUZA 2RI2A 2RI3A 3CC7T 2E64A 4EPCA 1YCYA 2F2XA 3VRYA 1M90U 3NTHA 1PNJA 2JTMA 2L8DA 4OMFB 3M0QA 4PL6A 3JB9G 5GAN7 1RLPC 1X69A 1Q81C 4XU2A 2CZ6B 3VS1A 4ORZA 2KY9A 1M1GA 2ED0A 2KRSA 1JXMA 2RQTA 2C0IA 1VQ6T 2DXUA 2CP0A 1BCMA 4J83A 3NMZC 1XOVA 4ELZC 1G83A 2MOXA 4QVDA 3OS0A 1OOTA 3CPWS 2K3XA 1SPKA 1T3LA 4F7UB 1M1KR 4K11A 1AEYA 4E6RA 2ESWA 3CCST 1TUDA 4A4HA 2DJQA 5KCHA 1JJ2P 3M53A 1UTIA 4PFZA 2QQBA 2FYKA 1AT1B 1TTHB 5CR2A 3UATA 3QWYA 1D0XA 3CCQA 4M7DD 1VQ8Q 4FCYA 2P0QA 1RL2A 4XAXB 4D6WA 2M16A 4OB2B 2FRYA 1M30A 4LE9A 1KQ2A 4C92B 2DAQA 1N5ZA 3URGA 4XQ3A 2JT4A 4JPBW 1OU9A 2HZYA 1S1NA 3VYGA 1OU8A 3MHXA 1PWTA 2VYTA 2QAZA 3EGDA 1VQ4T 1QVFS 1ABOA 2EYQA 2J7IA 4Y91A 4LUDA 3JCMd 5GAMd 1YIJA 4M7AD 2RMOA 4C0DC 4C8QB 4AFUC 1YJNA 3OW2A 1UFFA 5J3BA 4A54A 3S3OA 4M78B 3OMCA 1RAFB 2GGRA 5KH6A 3TU4K 3JCMh 5GAMh 1NZ9A 1Y57A 3CMAA 1YJ9A 1O75A 1BI2A 1BIBA 1M8MA 5GAN3 1VQ9A 4OMQA 2COWA 3M5AA 3CCRQ 5EG2A 3CD6A 2EYWA 3CMET 2DK3A 1K4US 1WHJA 1LJOA 4BI8B 2FB7A 2KDSA 4QQDA 3I55T 2EQUA 4XU0A 3CC2T 1VYUA 4FL6A 2X4JA 1VQNT 1KQSS 3REBB 1QWEA 3LWIA 2K79A 2DKGA 4PJNA 3JB9J 4ZTJA 2L5QA 1XQHA 1AOJA 2CT3A 1Y71A 1Z9ZA 1B7TA 2KT1A 2LTOA 1VQOA 1PD0A 5HCKA 3TEEA 2WSCE 3OS5A 4E7LA 3OYHA 1JJ2A 1V76A 1ABQA 1IO6A 5GAN2 1BKBA 1QWFA 2LJ3A 3RMQA 5GMKm 1ZSZC 1MMGA 5GAOm 4IIMA 1QKWA 2WSEE 3I56A 4J6YA 3IQLA 2CREA 4MZTA 1ZA2B 3EGXA 1SSFA 3VRZA 1R0CB
chains in the Genus database with same CATH topology
2Z0WA 3RDVA 2HL3A 2HKQB 1WHHA 1TXQA 2E4HA 2COZA 1WHGA 2COYA 2HKNA 2MPXC 1TOVA 2HL5C 3E2UA 1WHKA 2CP3A 3TQ7P 2CP0A 4B6MA 2CP2A 1IXDA 2COWA 2CP6A 2CP5A 2M02A 2E3HA 2E3IA 1WHMA 1LPLA 1WHLA 1WHJA 2HQHA 2QK0A 2CP7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2Z0W A;  3RDV A;  2HL3 A;  2HKQ B;  1WHH A;  1TXQ A;  2E4H A;  2COZ A;  1WHG A;  2COY A;  2HKN A;  2MPX C;  1TOV A;  2HL5 C;  3E2U A;  1WHK A;  2CP3 A;  3TQ7 P;  2CP0 A;  4B6M A;  2CP2 A;  1IXD A;  2COW A;  2CP6 A;  2CP5 A;  2M02 A;  2E3H A;  2E3I A;  1WHM A;  1LPL A;  1WHL A;  1WHJ A;  2HQH A;  2QK0 A;  2CP7 A; 
#chains in the Genus database with same CATH topology
 4AT1 B;  4OMM A;  4M77 E;  2MYS A;  1RUW A;  4L6V 5;  2NUZ A;  2FG0 A;  1D1A A;  5CKH A;  4MZP A;  2DPP B;  4F7U F;  1LOJ A;  1Q82 R;  1G3W A;  2ZPH B;  4C0D B;  2EYX A;  4E7S A;  2I0N A;  3UF4 A;  1K9M R;  1LPL A;  4N4H A;  1AVZ C;  2DYI A;  4KGX B;  1KG1 A;  4E2F B;  1S72 A;  2OTL A;  4WTO B;  4HCC A;  1ARK A;  2KBT A;  1WHH A;  2CZ0 B;  3CCE A;  2X4X A;  1IRX A;  3KUF A;  1YI2 T;  4FT2 A;  2CS7 A;  1NYG A;  5LJ5 g;  1IXD A;  2O4X B;  1MMN A;  1YJW A;  4Z8A A;  1AWW A;  2DL4 A;  1BI1 A;  1KD1 R;  1UG1 A;  2K5I A;  3D7S B;  3PMI A;  1WYX A;  5IT9 E;  2EJ9 A;  5KCO A;  1GRI A;  2V1R A;  2LNH B;  1K1Z A;  3M56 A;  5CQX A;  1FMK A;  2XDD A;  1W2B P;  2M02 A;  2NUT B;  4C8Q F;  3RKX A;  1UJ0 A;  3PVL A;  1TG0 A;  4PNO A;  4BI3 A;  4D8K A;  2HSP A;  5FWC A;  4J9F A;  4M78 F;  1VQ5 T;  2O31 A;  1QCO A;  2IPO B;  2RM4 A;  2DRM A;  2ATC B;  1WIE A;  2EPD A;  3SFM A;  2PVG B;  3EG3 A;  4QVZ A;  3OY9 A;  2EBP A;  1B34 B;  1EFN A;  2X4Y A;  5GMK i;  1Y0M A;  3MPU B;  1VQ9 Q;  2CP5 A;  5GAN e;  2AZS A;  1YNZ A;  1YWO A;  3V8L A;  3H8Z A;  4F04 B;  2Z0W A;  1WFW A;  2VXE A;  1GBR A;  4XU1 A;  4FYY B;  4V2S A;  2OI3 A;  2LNV A;  1QLY A;  3THK A;  1RAA B;  3OYG A;  3GOX A;  2MWP A;  1VQP Q;  2MK5 A;  2AKL A;  3WXM B;  2BUD A;  3EG2 A;  3TRE A;  2KNB B;  5FWB A;  2CDT A;  4C92 A;  3CCL A;  2Y4Y A;  2FZG B;  2EWN A;  4M77 D;  4RTW A;  3CBP A;  4LD6 A;  1JEG A;  2ZZD A;  4TVR A;  1M9S A;  2BKD N;  4IUP A;  2DNU A;  2YT6 A;  1IGQ A;  2EJG A;  1PCX A;  3SHW A;  4WF2 A;  4RKU E;  5HY6 A;  3TVT A;  4LDU A;  4C8Q A;  1AZG B;  1N9S A;  3CC4 Q;  3PT9 A;  4Z88 A;  2XI9 A;  3OYN A;  4M78 A;  2OTJ A;  1U8R A;  1BBZ A;  4PJM A;  3G71 T;  1YIT T;  1VQ5 Q;  1GL5 A;  2M1H A;  4AFS C;  5GAN 4;  2RQW A;  5GAN 8;  3HHT B;  4FM4 B;  2L3Q A;  2FPF A;  2RHY A;  2IIM A;  2IG0 A;  1W2B A;  4JJB A;  4A63 B;  2VAS A;  4YTL A;  1QW1 A;  1VUB A;  4PFO A;  2DM1 A;  2LMJ A;  1N8R C;  1WA7 A;  2L3R A;  1K9A A;  3M0T A;  3A5Z B;  1PG5 B;  2X9H A;  2O88 A;  4E7J A;  1JBM A;  3EGU A;  1K0X A;  3CBM A;  1TOV A;  1VQL A;  4LNP A;  1QCF A;  4C92 G;  1X43 A;  2QYZ A;  3OYJ A;  2HBP A;  3G7Z A;  2AKK A;  3UA7 A;  5GAO q;  4R0K A;  2O01 E;  2E5Q A;  3CCV T;  3E19 A;  2D6F A;  4CRI A;  4RTV A;  5HK0 A;  3CCJ Q;  2RQU A;  2E6N A;  2VGM A;  2HQE A;  4QQ6 A;  1WJS A;  5EC7 A;  4J6W A;  1NLO C;  1YBY A;  1FMW A;  2YRC A;  4BDY A;  3DKM A;  3M57 A;  4LDY A;  3JCM V;  1PRM C;  4C8Q G;  1IHW A;  4JRK A;  4C5G A;  4M78 G;  2QEX T;  3J7A F;  1D1C A;  4IIO A;  4HXJ A;  5LJ5 e;  2X4W A;  2RJC A;  1W4S A;  2ZAE A;  4RUG A;  2K7A A;  3MO8 A;  4M75 A;  3M54 A;  2EAY A;  3DB3 A;  3TQ7 P;  1WJR A;  1MMA A;  2DIL A;  2DX1 A;  1U1S A;  1BB9 A;  3S6W A;  4LXC A;  1YHQ T;  4EDU A;  2LP5 A;  2LJ1 A;  4HVV A;  3MKD A;  5CKF A;  2K5F A;  2L2P A;  3CCU T;  4MML A;  1BU1 A;  5ECA A;  2P0K A;  2EGA A;  2P4T A;  2KI7 A;  3BDU A;  3CPF A;  1G5V A;  3S3N A;  4DOV A;  3G6E T;  2ZPF B;  2JMC A;  1MGQ A;  1M4Z A;  2ROL A;  4R56 A;  4II1 A;  2O4X A;  1T0J A;  1JB0 E;  5HKC A;  2RHZ A;  5DLO A;  1FMV A;  3ASK A;  3GF5 A;  4FYX B;  3CCL Q;  1VQ7 T;  2FL7 A;  1NE8 A;  2R5A A;  1M1F A;  1O9S A;  3WVE B;  1N8R U;  2YRV A;  2LC4 A;  3MEW A;  2O9V A;  1NPR A;  3CXC S;  5KE3 A;  1VQM T;  1UGR B;  2DXT A;  1VQK T;  2LQW A;  1U1T A;  1JRI A;  4M75 G;  2EYY A;  2NUT A;  1VA7 A;  2KXD A;  4M4Z A;  5DY9 A;  2J6K A;  3VS5 A;  3JB9 D;  3QZ5 B;  4Q5W A;  3EG0 A;  3L2W A;  3JB9 H;  1G3T A;  2CP2 A;  1Q86 R;  3VUB A;  1B34 A;  4DQ2 A;  3BDL A;  2D0Q B;  3Q1J A;  3CCR A;  3EFR A;  5DLQ E;  2JXB A;  3RMS A;  4JJN K;  2RNA A;  4C92 C;  1NEG A;  2JM8 A;  1YHQ Q;  2CYZ B;  3C4S A;  1N6A A;  3OMG A;  1R77 A;  2DJZ A;  4DBQ A;  2KE9 A;  3JCM b;  2NUP B;  4DBF A;  4OGC A;  5C6S A;  2MWO A;  1B3Q A;  4C8Q C;  1YWP A;  5AT1 B;  3OYE A;  2CH4 W;  2JW4 A;  3MEA A;  2D1X A;  3G1J A;  4RG2 A;  1OI1 A;  3QYH B;  4JRI A;  1CSK A;  4ANJ A;  2J6O A;  3CPW P;  4HT9 A;  5IHK A;  2YLB A;  2KRO A;  5FW9 A;  1TUG B;  1KFZ A;  2EJF A;  1NJI C;  1NM7 A;  1Q86 U;  3EH1 A;  2QA4 Q;  3QDR B;  1SHG A;  4JJD A;  2EFI A;  2JNG A;  2X3W D;  2GTJ A;  2CGH A;  1T0H A;  4PLI A;  4RTZ A;  2QGG A;  1HXD A;  3EG9 A;  1WXU A;  2OAU A;  4PJO G;  1WHM A;  2F5K A;  3RR6 A;  4BY6 B;  2KYB A;  4FU6 A;  2V8J A;  4R55 A;  1QVF P;  2KRM A;  2PZ1 A;  4HCK A;  4D8D A;  2VXF A;  4KGV B;  1K8A R;  1K76 A;  3VS0 A;  3H9N A;  2DO3 A;  1QVG P;  4J9C A;  2FRW A;  4OB0 B;  3PGG A;  4XTX A;  2DMO A;  2YLC A;  3QZ9 B;  3SEM A;  3TSW A;  3CC2 A;  3MP1 A;  1VQN A;  3JCM P;  3X25 B;  3C94 A;  2XG8 D;  3H0H A;  2K6D A;  4JS5 A;  3CEY A;  4QKU A;  2AIR B;  4M75 C;  4DEX A;  4MDW A;  5GAN g;  5KE2 A;  1D09 B;  3V7R A;  1I8F A;  5D7U A;  2A3L A;  5FU6 B;  3OA6 A;  3M0R A;  1OQK A;  4J9I A;  3FEO A;  3E9G A;  5I11 A;  1UGP B;  2RHU A;  1D0Y A;  3A8G B;  1XTD A;  1RAI B;  5IHN A;  3UWN A;  2CUD A;  2XKO C;  3CC7 Q;  4BE2 A;  3RUX A;  2Y90 A;  1H3H A;  3LYI A;  2CP3 A;  3QJY A;  4DOW A;  1X6O A;  1KJW A;  5LL6 S;  3I9Q A;  1I07 A;  3L2V A;  3VV0 A;  2BE7 D;  4IUU A;  3MP8 A;  3OYA A;  2DZC A;  4J9E A;  1VQ6 Q;  1K8A U;  1UHC A;  5GAN j;  4UC4 A;  4WCI A;  2V26 A;  2X51 A;  1PKT A;  2XDP A;  4F7U E;  3OYM A;  4JZ4 A;  3CCS Q;  1VQP A;  3VYH B;  3FLG A;  5LJ3 d;  5GAN 5;  2DD4 A;  3CCQ T;  1NEB A;  1Q81 U;  1UJY A;  1M8V A;  4X9C A;  3JAM E;  1TU0 B;  2YUQ A;  2K3Y A;  3MP6 A;  3OSV A;  3ME9 A;  2KYM A;  3EFO B;  1Q82 C;  4BE1 A;  1OZ2 A;  3E2U A;  4DA4 A;  2GNC A;  4XTY A;  5LJ3 h;  1I5L A;  1JU5 C;  2LT4 A;  1K9M C;  2E5K A;  1AWX A;  1QVG A;  1RI0 A;  2CT4 A;  1VQ4 Q;  4PLL A;  4RMO A;  3BE3 A;  1YIJ T;  2BIV A;  4M75 B;  4C5H A;  3CC4 A;  5GAN f;  2JMA A;  5GMK e;  1SKU B;  3QDF A;  1OEB A;  3U23 A;  4PJO C;  3SWN B;  4E7H A;  1YJN T;  1MNE A;  1VQ5 A;  3WVD B;  4C5E A;  2LRQ A;  3DLM A;  3CBO A;  4C8Q E;  2WAC A;  4J9G A;  2K5L A;  5CQY A;  2DTO A;  4E7Z A;  3UPU A;  1OYX A;  4BE0 A;  1KC8 C;  4ZGJ B;  1YJ9 T;  4M78 E;  2GFU A;  2HQH A;  1WI7 A;  2CP7 A;  3EAE A;  3L2U A;  1WXB A;  2VWF A;  2COZ A;  2COY A;  3X24 B;  1OZ3 A;  2XMF A;  3CME Q;  4X34 A;  4EIK A;  1GFC A;  1M2V B;  2RH2 A;  3KBG A;  4C92 F;  3I55 Q;  2X35 A;  2ZGW A;  1WHL A;  3CC2 Q;  2QTX A;  2A08 A;  1VQN Q;  2NUP A;  3G4S T;  5CAI A;  4ZN1 A;  3CCJ A;  2EW3 A;  5FRM A;  2AHJ B;  1IGU A;  4C0Z A;  3M0S A;  2RB6 A;  4C5I A;  1VQO T;  3L2Z A;  2KAF A;  2HDA A;  3RKY A;  2DER A;  3DB4 A;  1K73 C;  2RJD A;  2YXY A;  3NHN A;  2GF7 A;  2LQK A;  3I5S A;  4FYV B;  3LLR A;  3QG1 A;  3X26 B;  5L23 A;  4O6J A;  3CCM T;  2ZPE B;  4KH0 B;  2R58 A;  2KVQ G;  2F2V A;  4E47 A;  1I4K 1;  4A4F A;  3PIP A;  3I56 T;  1AWJ A;  3NTI A;  4LDX A;  3PNW C;  5LJ5 j;  4B6M A;  3SD4 A;  1D1B A;  3REA B;  1VOM A;  1UB4 A;  5AYF A;  4RTU A;  3UA6 A;  4HT8 A;  1M3B A;  2DIQ A;  2GFA A;  1KSW A;  3LGF A;  5CKB A;  1ZBX A;  4PJO B;  3QKJ A;  2E12 A;  1OV3 A;  1SHF A;  3TCJ A;  1S72 T;  2EQM A;  2OTL T;  4OB1 B;  2SEM A;  2H8H A;  2BE9 B;  2EVR A;  3GNG A;  3CCE T;  4X1V A;  3BFM A;  1PSF A;  1J3T A;  1YJW T;  2KXC A;  1YI2 Q;  1X01 A;  1T3S A;  1TXQ A;  1N27 A;  4OMO A;  2MMP A;  3FDR A;  3QHS A;  5LJ5 f;  2LX7 A;  1G8X A;  4KRT A;  3QUI A;  3G4S Q;  2NWM A;  3OYI A;  2C0O A;  1FXX A;  4C8Q D;  4FYW B;  3JCM g;  1KIK A;  5GAM g;  1TH7 A;  3JSC A;  4KUL A;  4M7A C;  4M75 F;  4M78 D;  4JRQ A;  1JXO A;  5HK3 A;  3JCM Q;  1E6G A;  3OB9 A;  3OYK A;  1FWZ A;  1W70 A;  2E41 A;  2NLU A;  4AG2 C;  3CCM Q;  3EG9 B;  3A8L B;  2HEQ A;  4J7F A;  1G3S A;  2VV5 A;  3PFS A;  3S3M A;  4C0G A;  1W1F A;  3RDV A;  2FZK B;  1IRE B;  2X3X D;  2KK4 A;  4CI0 C;  2FVU A;  2KRN A;  5KYU B;  3GBQ A;  1K73 U;  1YHQ A;  2XDB A;  4DBR A;  2PTK A;  2FPD A;  2P84 A;  5GAM j;  2RO0 A;  2HNI A;  3MET A;  4QW2 A;  3ULR B;  3MEV A;  4N4G A;  4IUV A;  4FW2 A;  1KHI A;  4ELY C;  2EGE A;  4J9H A;  4OML A;  5IHI A;  4N4I A;  1BIA A;  2DLP A;  1PHT A;  2DTI A;  2MPX C;  5GAO n;  4LDV A;  1QP3 A;  4JLI A;  4EMK B;  2ROT A;  3A1P A;  4ZN3 A;  2FO0 A;  4MMK A;  3EFO A;  2KEA A;  4M7D B;  1UGV A;  2FHD A;  2QAS A;  2EYZ A;  2L3S A;  2OJ2 A;  5A0G A;  2F69 A;  4HVW A;  1HYO A;  2DD5 A;  2QA4 A;  2FEI A;  5A0L A;  1N8R R;  3KXT A;  3FJ5 A;  2EIF A;  1MMD A;  2KMT A;  3SWN A;  3VS3 A;  2E6Z A;  3M9Q A;  3QPH A;  5GAM f;  3L2Q A;  2DTH A;  1CKA A;  2A0F B;  4M7A B;  3M59 A;  3L42 A;  2PVD B;  4FIB A;  3HL8 A;  4OVA A;  2YHT A;  4NS5 A;  4PJO F;  3C0C A;  1X6B A;  3G71 Q;  1YIT Q;  4LN2 A;  2XID A;  4ZGD B;  1H3Z A;  2QDL A;  3JRZ A;  3CQT A;  1SRM A;  4F16 A;  1QVP A;  3FJP A;  1OUL A;  4NL2 A;  3CXC P;  2DET A;  2E3H A;  1VQL T;  4J5Y A;  1M2V A;  3FB9 A;  1M90 C;  3ZEH A;  1IHV A;  2D8H A;  3T9N A;  5IAY A;  2M51 A;  2GQI A;  3HSB A;  3CCV Q;  2I2L A;  1OPK A;  4E7K A;  3M4Y A;  9ATC B;  2O9S A;  5M9O A;  2CSI A;  4XTZ A;  1BK2 A;  3RIR A;  4DEY A;  1ZBJ A;  2R57 A;  2QK0 A;  3KFV A;  4PFP A;  1PRL C;  1ZQ1 A;  4BY6 C;  1LVK A;  3CC7 A;  3TSZ A;  2VUB A;  1G2B A;  8ATC B;  1C1A A;  2QEX Q;  3QO3 A;  4CC3 A;  3EHQ A;  3HRU A;  2DZ9 A;  5GJV B;  1Q7Y C;  1NG2 A;  3E9F A;  5KYX B;  2B86 A;  2PUK B;  1M5Q 1;  3L2R A;  5FRO A;  3NFC A;  3VJP A;  2EKH A;  5I2M A;  2O2O A;  1UGS B;  1VYT A;  2LVM A;  1VQ6 A;  1WZO A;  3ER0 A;  2RF0 A;  3BW1 A;  3JCM e;  1RAB B;  1R8O B;  2EKO A;  5GAM e;  3QJ6 A;  1TSF A;  3JCM X;  3HP9 A;  5CKD A;  4PJO A;  4HCB A;  3O8V A;  4GLM A;  3CCU Q;  2DE0 X;  2GCX A;  3CCS A;  2C06 A;  2DRK A;  4N0A C;  5A0D A;  1ZUU A;  1UE9 A;  2PU9 B;  5D6X A;  1LCK A;  3OBY A;  5FU6 C;  3RER A;  2DA9 A;  1VQ8 T;  3G6E Q;  1KK7 A;  1RAE B;  4HKE A;  4Y28 E;  1U3O A;  3ZBD A;  1K0S A;  2EQI A;  3HRT A;  2HCK A;  4AFZ C;  4X9D A;  1RAH B;  2LQN A;  2CUB A;  3VS4 A;  5LJ5 d;  2VKN A;  4M7D F;  4M77 C;  1M1K C;  2XIC A;  2QI2 A;  1MUZ A;  3LH5 A;  5GAN 6;  2KT8 A;  1G3Y A;  2RHX A;  1VQ7 Q;  1X6G A;  4KUD K;  2W0Z A;  5KYN A;  3CXC A;  3P8B B;  1VQ4 A;  1AZE A;  4J9B A;  2M0O A;  1ZUY A;  2D0N A;  4AFQ C;  5LJ5 h;  2DFU A;  3JCM c;  3LWH A;  2VVK A;  4ESR A;  4KBM B;  2YSQ A;  3HRS A;  1VQM Q;  4FSX A;  1VQK Q;  3OSS C;  1H64 1;  3BY7 A;  4OGE A;  1SRL A;  2JVV A;  3EH2 A;  5GMK j;  4M7A F;  2DBK A;  2LCC A;  3OW2 S;  4FW1 A;  4J9D A;  3V7S A;  4ZTF A;  4NOY A;  5CO7 A;  2A28 A;  2JS0 A;  1SSH A;  3CCR T;  1X2K A;  3V7C A;  2LX9 A;  1VYV A;  3SB2 A;  2HL5 C;  3PE0 A;  3RBB B;  3CME A;  5KYU A;  1ZLM A;  2DL5 A;  4F17 A;  3V8K A;  2CP6 A;  3A8M B;  4LDW A;  3HPW A;  4HVU A;  4PJJ A;  1F1B B;  2IVW A;  2K2M A;  3I55 A;  1QQJ A;  2QQ9 A;  1WXT A;  1M27 C;  4AG1 C;  1YCS B;  1PM3 A;  2HMA A;  5J26 A;  4ZNX A;  1WQW A;  1Q7Y U;  4EMG A;  1NJI R;  4F14 A;  1X75 C;  5IXB A;  3PMT A;  1Q81 R;  2ECZ A;  3SWN C;  3RES A;  1UHF A;  2KR3 A;  4BB7 A;  2RI5 A;  3EHR A;  1HD3 A;  1ZHI A;  4EMK A;  1MV0 B;  1NYF A;  1VIE A;  1I1J A;  4M7D A;  3NPF A;  1Y96 A;  1JJ2 S;  1ZX6 A;  2ZPG B;  2K9G A;  3GIB A;  3OBW A;  3QWX X;  4KH1 B;  4M77 B;  2NYS A;  1X2Q A;  1WHK A;  2RK2 A;  2DVE A;  3I5R A;  1KQS P;  2JJ9 A;  5GJW B;  4OP0 A;  1WJQ A;  5IN1 A;  1QVG S;  2LT1 A;  2C0T A;  2MIO A;  4BI4 A;  4EMH A;  4IUR A;  3AHU A;  2F5T X;  1TWB A;  3CPW A;  2YUN A;  1W6X A;  2JZ2 A;  2D9T A;  3H41 A;  4M7A A;  2KSS A;  2PNI A;  1EX4 A;  2HL3 A;  1M1K U;  1BI3 A;  2YWW A;  1ZSG A;  4A4G A;  3HFO A;  1GXI E;  2LCL A;  2F2W A;  4JDS A;  1GCP A;  1BYM A;  4JRP A;  2LDM A;  3X20 B;  2J05 A;  1NJI U;  1C0M A;  4JUV A;  1V1C A;  2E70 A;  1D3B B;  3P8D A;  4L59 A;  3OYL A;  2ZPI B;  1YI2 A;  3EFS A;  3P8H A;  2HKQ B;  1WHG A;  2RK1 A;  2YUP A;  1FYN A;  1JQQ A;  4M7D G;  2V1Q A;  2BTT A;  3VU3 C;  2W10 A;  2J06 A;  1BI0 A;  1WGS A;  1QVF A;  2RJE A;  3G4S A;  2CSQ A;  3M58 A;  3FRN A;  4FT4 A;  2EGC A;  4C92 E;  2V8K A;  1I81 A;  1H8K A;  4KUI A;  2M9U A;  5KYW B;  4PJL A;  2HSE B;  4QVC A;  4NL3 A;  4XTV A;  5CK9 A;  1AWO A;  4RCC A;  1UDL A;  1NBE B;  3M4G A;  4Z89 A;  3N5B B;  1KD1 C;  3CCM A;  2Y4X A;  4IUT A;  2LQ8 A;  2LJ0 A;  4M7A G;  3R6O A;  2QGF B;  1IB8 A;  3RKW A;  2L0A A;  5I21 A;  3CMA T;  4CC2 A;  2JTE A;  5KYX A;  1UEB A;  1VQ9 T;  1SG5 A;  2L3P A;  2ENM A;  2L89 A;  1R0B G;  3RNJ A;  4XTU A;  2GTO A;  2KQW A;  2JTF A;  4XTW A;  1RI9 A;  3CD6 T;  2BZY A;  1SEM A;  1X27 A;  2A37 A;  4JLG A;  1KQS A;  2EQK A;  4P5N A;  1Q95 G;  3VS7 A;  1CKB A;  1M3C A;  1BCO A;  2CH4 A;  3DLL A;  1VQP T;  2MI6 A;  2K2V A;  3NGP A;  2OAW A;  1OX9 A;  2PVO B;  2GQV A;  1QKX A;  5GMK l;  2VGN A;  3CCQ Q;  2JM9 A;  2RJF A;  4OF1 A;  2BZX A;  5IXF A;  2ZPB B;  5GAO l;  3I35 A;  2LCS A;  2KGT A;  4QT7 A;  1PSE A;  2ZCF B;  4AMC A;  3A8O B;  1U5S A;  1I5O B;  1ZUK A;  4RTX A;  1KC8 R;  2HD0 A;  1I0C A;  2HBW A;  5L8R E;  5CVI A;  4M77 F;  4ME7 A;  2E4H A;  1WX6 A;  1YFN A;  5GAO r;  1Z9Q A;  2OX7 A;  3CC4 T;  3LH0 A;  2A7Y A;  1YIJ Q;  2E10 A;  2VC8 A;  4A4K A;  5IH2 A;  4M75 E;  3C95 A;  1YJN Q;  4IKF A;  1Q82 U;  3G71 A;  4OB3 B;  1YIT A;  3AT1 B;  4OMP A;  5CIU A;  1K9M U;  1YP5 A;  3PTA A;  4KGZ B;  1A0N B;  3OQ5 A;  5KYY B;  4BD3 A;  1EIF A;  1ZSZ B;  2B8A A;  3CMA Q;  2AK5 A;  1YJ9 Q;  1RAG B;  5CCA A;  5I2S A;  1KQ1 A;  1UUE A;  4EMK C;  4RCB A;  1W2B S;  3PVQ A;  4ATO A;  4M7D C;  2QTV A;  3CD6 Q;  4C92 D;  2E1H A;  2G6F X;  1K73 R;  2H3J A;  2K4Y A;  4F7U A;  3SDZ A;  1RAD B;  3MJX A;  3M0P A;  1KD1 U;  4RG8 A;  2RQV A;  3LX7 A;  3FC3 A;  1FX7 A;  1GCQ A;  1MND A;  4GBQ A;  2PUO B;  2A36 A;  2CZ1 B;  1WQ7 A;  3CCV A;  3CCJ T;  1KC8 U;  1PD1 A;  1PKS A;  1HK9 A;  4FSS A;  4C0F A;  1E7O A;  4N0A A;  3LGL A;  4J7I A;  3C12 A;  1QMC A;  4JJC A;  1VQO Q;  4QQG A;  3INZ A;  5FU7 C;  5GMK h;  3H0F A;  3MCA B;  2CZ7 B;  1Y07 A;  4LD9 K;  2V8I A;  2DBM A;  1PC0 A;  2QEX A;  3EG1 A;  2CKK A;  2F1L A;  1HJD A;  4OMN A;  4M77 A;  2DL8 A;  2D8J A;  1AD5 A;  2YUO A;  2XD0 A;  3GNF B;  3I56 Q;  4RTT A;  2YRD A;  1V29 B;  1D0Z A;  3J81 E;  2H3E B;  1AHJ B;  4J8O A;  4PKC C;  1DJ7 B;  1RAC B;  2K57 A;  3LW5 E;  2EQJ A;  2RN8 A;  3JCM J;  4F7U G;  4CC4 B;  3CCU A;  1XJW B;  3GPL A;  2DEU A;  3A8H B;  2QDY B;  1GBQ A;  2P0P A;  4CC7 A;  4BDZ A;  4HCZ A;  2G3R A;  1KHC A;  1GFD A;  4B9W A;  5LJ3 g;  3G6E A;  4PJO E;  2QQR A;  3QBY A;  2WSF E;  1S72 Q;  2OTL Q;  3MEU A;  2RQR A;  1D3B A;  3OYC A;  2PQW A;  1P92 A;  2MAM A;  4HA8 A;  4B9X A;  3CCE Q;  1ACM B;  1Y7X A;  4E7I A;  3A98 A;  5C0M A;  2P4R A;  2XU8 A;  4PK4 A;  3CCL T;  1YJW Q;  5D6W A;  2FZC B;  3ZL7 C;  3VS6 A;  1VQ7 A;  4Y92 A;  3QSU A;  1Y96 B;  1MV3 A;  2QG9 B;  3FIF A;  2HQX A;  1WDX A;  3OS1 A;  3VKI A;  4M75 D;  3EGD B;  5KYW A;  4M77 G;  1E6H A;  3V8J A;  5GAN d;  2QQS A;  3PIO A;  4JZ3 A;  2DL3 A;  3R6N A;  4RTY A;  5FLX E;  2RD1 A;  1VQM A;  1VQK A;  1NPP A;  1UGQ B;  4LUE A;  4A4E A;  8AT1 B;  4ZGE B;  1ZA1 B;  1RLQ C;  1QP2 A;  3JCM f;  3ZFJ A;  1N9R A;  5LJ3 j;  4O5V A;  2OTJ T;  3OYB A;  5GAN h;  2E3I A;  4MDX A;  4JS4 A;  1IZ6 A;  2RPN A;  3O5Z A;  1SF9 A;  4GLK A;  5FU7 B;  3JB9 F;  4XU3 A;  2MF2 A;  2XK0 A;  1TS9 A;  2DVJ A;  2DEQ A;  1NLP C;  1YN8 A;  2JUF A;  1HSQ A;  2BZ8 A;  4IUQ A;  2JS2 A;  3QII A;  1XNI A;  1EZZ B;  2M0Y A;  3QYG B;  3GLX A;  3QXE B;  5FRN A;  2JN0 A;  1JO8 A;  6AT1 B;  3J80 E;  3GP8 A;  2ABL A;  1OX8 A;  1M2O A;  2RHI A;  5D6Y A;  1Q86 C;  3E1S A;  1U06 A;  1VQ8 A;  2DXB A;  3M55 A;  2AT1 B;  3VS2 A;  1B07 A;  2HAX A;  1OPL A;  2XHC A;  5LJ3 f;  1MHN A;  3HKS A;  3OS2 A;  2QQA A;  3OYY A;  2VB6 A;  3JB9 I;  4A53 A;  4XK8 E;  2JOY A;  4M7D E;  2ED1 A;  3NTK A;  1H92 A;  2QA4 T;  3HFN A;  1WPY A;  4MZM A;  3HTR A;  3EGX B;  2DIG A;  2AZV A;  4VUB A;  1TUC A;  4J6X A;  4PJO D;  5I22 A;  2DF6 A;  1M3A A;  3F70 A;  2HKN A;  1GCQ C;  1M90 R;  3JCM W;  2OTJ Q;  2R5M A;  2QXF A;  2DXC A;  2K3B A;  5KYY A;  3UDC A;  1ZSZ A;  4Z02 A;  4M7A E;  3M0U A;  2FPE A;  3UT1 A;  2GBQ A;  5GAO p;  2YDL A;  2J6F A;  3L1A A;  5CKE A;  2DYB A;  2DL7 A;  3OYD A;  3H0I A;  2RA2 A;  3X28 B;  1C6V X;  4L5G A;  4KT0 E;  1WNL A;  5DM7 R;  3H6Z A;  1VQL Q;  1QCN A;  2LZ6 B;  3JV3 A;  1WLP B;  1VIF A;  4GY5 A;  2MCN A;  4DBH A;  3OYF A;  5A2Q E;  3OW2 P;  1Q7Y R;  1LNX A;  5J39 A;  4BUG A;  4BAC A;  1UEC A;  4M78 C;  2SRC A;  2E65 A;  1K8A C;  7AT1 B;  5LJ3 e;  3VUZ A;  2RI2 A;  2RI3 A;  3CC7 T;  2E64 A;  4EPC A;  1YCY A;  2F2X A;  3VRY A;  1M90 U;  3NTH A;  1PNJ A;  2JTM A;  2L8D A;  4OMF B;  3M0Q A;  4PL6 A;  3JB9 G;  5GAN 7;  1RLP C;  1X69 A;  1Q81 C;  4XU2 A;  2CZ6 B;  3VS1 A;  4ORZ A;  2KY9 A;  1M1G A;  2ED0 A;  2KRS A;  1JXM A;  2RQT A;  2C0I A;  1VQ6 T;  2DXU A;  2CP0 A;  1BCM A;  4J83 A;  3NMZ C;  1XOV A;  4ELZ C;  1G83 A;  2MOX A;  4QVD A;  3OS0 A;  1OOT A;  3CPW S;  2K3X A;  1SPK A;  1T3L A;  4F7U B;  1M1K R;  4K11 A;  1AEY A;  4E6R A;  2ESW A;  3CCS T;  1TUD A;  4A4H A;  2DJQ A;  5KCH A;  1JJ2 P;  3M53 A;  1UTI A;  4PFZ A;  2QQB A;  2FYK A;  1AT1 B;  1TTH B;  5CR2 A;  3UAT A;  3QWY A;  1D0X A;  3CCQ A;  4M7D D;  1VQ8 Q;  4FCY A;  2P0Q A;  1RL2 A;  4XAX B;  4D6W A;  2M16 A;  4OB2 B;  2FRY A;  1M30 A;  4LE9 A;  1KQ2 A;  4C92 B;  2DAQ A;  1N5Z A;  3URG A;  4XQ3 A;  2JT4 A;  4JPB W;  1OU9 A;  2HZY A;  1S1N A;  3VYG A;  1OU8 A;  3MHX A;  1PWT A;  2VYT A;  2QAZ A;  3EGD A;  1VQ4 T;  1QVF S;  1ABO A;  2EYQ A;  2J7I A;  4Y91 A;  4LUD A;  3JCM d;  5GAM d;  1YIJ A;  4M7A D;  2RMO A;  4C0D C;  4C8Q B;  4AFU C;  1YJN A;  3OW2 A;  1UFF A;  5J3B A;  4A54 A;  3S3O A;  4M78 B;  3OMC A;  1RAF B;  2GGR A;  5KH6 A;  3TU4 K;  3JCM h;  5GAM h;  1NZ9 A;  1Y57 A;  3CMA A;  1YJ9 A;  1O75 A;  1BI2 A;  1BIB A;  1M8M A;  5GAN 3;  1VQ9 A;  4OMQ A;  2COW A;  3M5A A;  3CCR Q;  5EG2 A;  3CD6 A;  2EYW A;  3CME T;  2DK3 A;  1K4U S;  1WHJ A;  1LJO A;  4BI8 B;  2FB7 A;  2KDS A;  4QQD A;  3I55 T;  2EQU A;  4XU0 A;  3CC2 T;  1VYU A;  4FL6 A;  2X4J A;  1VQN T;  1KQS S;  3REB B;  1QWE A;  3LWI A;  2K79 A;  2DKG A;  4PJN A;  3JB9 J;  4ZTJ A;  2L5Q A;  1XQH A;  1AOJ A;  2CT3 A;  1Y71 A;  1Z9Z A;  1B7T A;  2KT1 A;  2LTO A;  1VQO A;  1PD0 A;  5HCK A;  3TEE A;  2WSC E;  3OS5 A;  4E7L A;  3OYH A;  1JJ2 A;  1V76 A;  1ABQ A;  1IO6 A;  5GAN 2;  1BKB A;  1QWF A;  2LJ3 A;  3RMQ A;  5GMK m;  1ZSZ C;  1MMG A;  5GAO m;  4IIM A;  1QKW A;  2WSE E;  3I56 A;  4J6Y A;  3IQL A;  2CRE A;  4MZT A;  1ZA2 B;  3EGX A;  1SSF A;  3VRZ A;  1R0C B; 
#chains in the Genus database with same CATH homology
 2Z0W A;  3RDV A;  2HL3 A;  2HKQ B;  1WHH A;  1TXQ A;  2E4H A;  2COZ A;  1WHG A;  2COY A;  2HKN A;  2MPX C;  1TOV A;  2HL5 C;  3E2U A;  1WHK A;  2CP3 A;  3TQ7 P;  2CP0 A;  4B6M A;  2CP2 A;  1IXD A;  2COW A;  2CP6 A;  2CP5 A;  2M02 A;  2E3H A;  2E3I A;  1WHM A;  1LPL A;  1WHL A;  1WHJ A;  2HQH A;  2QK0 A;  2CP7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...