2CP8A

Solution structure of the rsgi ruh-046, a uba domain from human next to brca1 gene 1 protein (kiaa0049 protein) r923h variant
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
GSSGSSGQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Next to BRCA1 gene 1 protein
publication title Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2cp8A00
2LVNC 4Q7JA 2RRUA 3GLFE 3IECA 2QNJA 2MROB 2LVAA 2K9DA 1HT1E 2QHOB 4F2LA 1IM2A 3K9PA 3F92A 1BVSA 1OQYA 2LVOC 1QZEA 1NV9A 3GLIE 2DHYA 3LCVB 1Y8GA 1V92A 4HEOA 1UFZA 2JNHA 1DO2A 2LVQD 1ZMWA 1VEJA 1F4IA 2JY6B 2EJSA 2KNVA 1WHCA 3GLHE 1WGLA 2JP7A 2JY8A 1HT2E 1ZMVA 5JI2E 2DAKA 1GO5A 1VG5A 2KHHA 2JY7A 1T43A 2LBCA 1CUKA 4DBGB 3FE3A 2DAIA 2L2DA 1WR1B 3E46A 1C7YA 1TTEA 2H5XA 2DNAA 2DZLA 3H4JA 1G41A 1WJ7A 1A5TA 2BWEA 2DAMA 2QSFX 2EKKA 3LCUA 5DFLA 1IFYA 3IHPA 1VQ1A 2G3QA 3BBZA 3T6PA 1E94E 1OTRA 2BWBA 4GEWA 1OAIA 2EKFA 2JZ0A 1ZMUA 2K0BX 2JY5A 2KNZA 2ZTDA 1HJPA 2O25A 3B89A 1DO0A 2CP8A 1PGYA 1YLAA 2DAEA 4UN2B 2DENA 2MR9A 4WP2A 2L4FA 1ZV1A 1G4AE 3FRIA 4F1IA 2MGWA 1T6OA 2HWJA 2HAKA 3GLGE 1AIPC 1R4GA 1WGNA 2LVPC 2MJ5B 2WZJA 2DI0A 1VEGA 2DAGA 4G3OA 3MMPA 3E21A 2ZTCA 2CWBA 1TR8A 1XB2B 2B3TA 2L4EA 1KYIA 1MN3A 1P3QQ 1SG9A 2JUJA 2OOAA 1OKSA 2LTUA 2KNAA 2OOBA 4R71A 1HQYE 1NV8A 1VDLA 1G3IA 1XXHE 2DKLA 1DV0A 2OO9A 1IXSA 1Q02A 1VEKA 1WIVA 3K9OA 1JR3E 1EFUB 2R0IA 2JZ1A 3FRHA
chains in the Genus database with same CATH superfamily
1L2BA 4Q7JA 3WHLA 2RRUA 4L15A 2JA2A 3VK8A 3LVWA 3GLFE 4IBGA 2QNJA 2L6OA 3FYDA 1IN8A 4IBIA 2F5SA 1LTMA 4FVMA 4HL4A 3GLFB 1IM2A 3F92A 2KRUA 4IBEA 3CF0A 3AKZA 4K0KM 2EA0A 2L7IA 3AOEC 3QWLA 2LVOC 3FUWA 3HHWA 4MGIE 4Y28F 3U5ZA 2D7GA 4LF7M 2UXBM 3U60B 3M6AA 3SARA 3B7QA 4LJAA 2VDBB 1OJLA 1PJSA 3L26A 3LCVB 3VLFB 5LMUM 2UXCM 1Y8GA 3J7BA 5LMNM 1Q3CA 2VF8A 3AOGA 1Z6TA 4II7A 3SAUA 2HCBA 4DR4M 4EIWA 1NJGA 4M9SA 2I7PA 2ZAOA 3W0LB 1E32A 2C96A 1C1KA 1XMOM 4CIZA 4I8OA 3PXGA 4M0DA 3FUXA 3NWLA 1WHCA 4LZJA 4JI5M 4FCVA 1ZQ9A 5JI2E 1GABA 2CHVA 4I5SA 5ITXA 1FJGM 4JXJA 3GRVA 5EXPA 2OPFA 1CUKA 3ZCBB 3HJSA 3QAUA 2KDLA 2L2DA 1IXSB 1Z5AA 4FCTA 4JI6M 3FYCA 1Z5CA 2WSFF 2KA6B 3E46A 2WSEF 1C7YA 4JI0M 3HX3A 2DWNA 4NRWA 4RF0A 3H4MA 2DNAA 2DZLA 1PRBA 4DR2M 3U6EA 2LHCA 1GVNA 2P5TA 4S12A 1HNXM 2E5LM 4AKHA 3EIHA 2QSFX 1IFYA 3L27A 1IQPA 2CHQA 2K47A 1S3SA 3K8ZA 1ORYB 3T6PA 2VQEM 2BNKA 3U5ZB 4R7GA 3VFDA 4CHTB 4GEWA 3LQRA 3MJ5A 1TDHA 2JZ0A 2K0BX 3B89A 3HGIA 3KOWE 4IBBA 1HJPA 2O25A 1H6UA 4LCBA 4MH0E 4X62M 4DR5M 4MB7A 1R2YA 2GQFA 2R4JA 1FNNA 3GRRA 4MGYE 3DOAA 4DR7M 4NSRA 1QYRA 2L4FA 4G6ZA 4LJ7A 1NHWC 3KOXE 4D81A 4PD2A 1N77A 3VKGA 1ZV1A 4F1IA 4OVZA 1WXQA 2DZOB 2HWJA 3AV0A 3HY5A 4L16A 2J7OA 1XNRM 4RNAA 3RGSA 2RGHA 2XLJA 1VEGA 3FTFA 3W68A 1XXHA 5ITQA 2XZFA 4HLQA 3W0FA 3MMPA 2ZTCA 2KEBA 3U6QA 3L25A 1OIPA 1OAOC 2CWBA 3B7NA 3SYKA 3HJ8A 2L4EA 1W5SA 3GP1A 1MN3A 1P3QQ 1SG9A 1KSFX 2VF7A 3KS8A 3TWMA 3HU2A 5C1BA 4R71A 1HQCA 3VDUA 3K2LA 2VIIA 1NO1A 4NSOB 3U60A 2C5RA 3U6OA 4AQYM 4B7HA 1Q02A 1VEKA 3BXWA 1L2CA 1R5LA 4NRVA 2O5RA 2R0IA 1LV7A 2KZUA 3FTEA 1GJSA 2LVNC 1XWIA 1E9SA 4PCZA 3IECA 3SASA 2MROB 2LVAA 2C98A 2X4AA 3VK7A 3R9XB 3ILKA 4JI3M 2QHOB 5L8RF 1K3XA 4R3DA 1JQJC 3JR5A 2JWSA 1L1TA 3HU3A 2ZM6M 1QZEA 4LFAM 2GNOA 3UJNA 3T1YM 4LJ6A 1NV9A 4D82A 1J7KA 2DHRA 1QAMA 4MGKE 1IBLM 1N78A 4OVZB 4P16A 2UUAM 2VQFM 1N75A 1MJGM 3Q8XA 4HEOA 5ITRA 5DNYA 3SAVA 3W67A 1HNWM 3RGPA 3PNYA 2UU9M 1YUBA 2JNHA 2XSZA 1PJIA 4LRTA 4IBDA 4B3TM 1XXHB 3IG8A 5KPTA 4FWHA 2JY6B 3LVVA 3R8FA 4L8RC 1EIJA 3FKEA 1IY2A 1R6BX 3GRUA 5FSWA 4QOZC 2ZANA 4IJFA 3B74A 3TQSA 2OQ4A 2V1CA 1SXJE 2D7EA 4DV3M 3J80S 1QVRA 5BR8M 5GKNA 2R6FA 1NY5A 3SMSA 2DZNB 2L7HA 3L28A 1V34A 5JI3E 2DAIA 1IXZA 3HJQA 3TWKA 2J5YA 2QCUA 3LW5F 4GKJM 3KS4A 1IN7A 1JB0F 1G41A 2BWEA 2DAMA 2CEAA 4DV2M 3U6SA 3KP1E 2M60A 4B3SM 4DR1M 3CGWA 3SC3A 4DUYM 1T3TA 3LCUA 4B08A 4LFBM 3BBZA 1E94E 4B7GA 2I7NA 3UZUA 3B9PA 5EP4A 5IZ7D 4YY3M 2DWMA 1OAIA 2L09A 5IT9S 4NC6A 2ZTDA 2JY5A 5DYIA 1PM5A 1E9RA 2QZ4A 2CP8A 3HHXA 1MU5A 3LQQA 4JI7M 3DA1A 4P17A 4UN2B 5ITYA 1J5EM 3JR4A 5A2QS 4AKGA 1RU3A 2C99A 3GQ4A 4QHSA 5KQDA 3C3EA 3FRIA 1TGUA 1AIPC 1Q3BA 1R4GA 1UM8A 1WGNA 2LVPC 3TE6A 1QUTA 1L2DA 2JXNA 3GO8A 1PJQA 5EJCA 2DI0A 2F5QA 4JI2M 1NJFA 1HR0M 1Q39A 3ZH9B 4G3OA 4REZA 5KO3A 2LXEA 1XB2B 3BOSA 4DV5M 1KYIA 1QDTA 3RE8A 1TDZA 3THGA 2CRUA 1V33A 2KNAA 2OOBA 5E26A 2R65A 3GQ5A 1HQYE 5ITUA 4DV4M 1K3WA 2CV0A 3KSXA 4NL4H 1NV8A 2CFOA 1G3IA 4LRSA 4L4UA 2Y21A 4TUWA 2Y0QA 2FS1A 1JR3E 3J7AS 2JZ1A 5EXTA 2Z3XA 4ITQA 1GL7A 3QYEA 4Z6YA 1KFVA 4KLNA 1OIZA 2LNHC 2BJWA 1HT1E 5FTMA 3HKPA 5FTKA 1I4WA 1BVSA 4GIPA 4WURA 4GKKM 3KSJA 4KODA 4G4RA 1IN5A 4IJEA 3PVSA 4AI6A 4BBAA 4GHLA 3FUTA 5EXSA 2R45A 2APLA 1DGFA 3SFZA 2J7NA 4BLCA 4CJ6A 4G4NA 4DR6M 5IWAM 1SXJA 4ZPXA 3K92A 3SHFA 1UFZA 2QPAA 3HWSA 2Z7JA 4FD2A 1ZAEA 2R62A 3KVWA 4L6V6 3T1HM 1K82A 1L1ZA 1OFIA 1GJTA 4LY6A 4LJ8A 3MHVC 8CATA 1VEJA 1F4IA 3NBXX 2EJSA 1NSFA 2KNVA 3GLHE 2JP7A 3C9PA 3KW6A 5EP1A 4CGYB 3PNVA 3GLGA 1TH4A 3U6MA 3U61A 3M0EA 1N34M 4GHAA 1NNUC 1QANA 3KP0E 4GMQA 2DAKA 1GO5A 2KHHA 5FTJA 1R2ZA 1T43A 3J2PB 4ANRA 1QDRA 3FE3A 3JAMS 1WR1B 2UXDM 2Y20A 4XGIA 4WW0A 1IY0A 2N35A 1TTEA 2A5YB 3SMPA 1XNQM 2O01F 2HKJA 1WJ7A 5E6JA 4LJ4A 3E4RA 1R7RA 5KPZA 4DR3M 3KDSE 2XSZD 2QP9X 3KOYE 2LHGA 5KPRA 3FTCA 1G71A 5IREB 1IBKM 2RGOA 1VQ1A 2G3QA 2F5OA 2FNAA 4M9ZA 2Y0TA 3GPUA 3GPYA 4OX9M 5H37D 2EKFA 3UK6A 3GRYA 4FW9A 1ZMUA 4LJ5A 3L29A 4QHTA 4GC9A 3CTWB 4LGYA 5FTNA 4RF1A 1SXJB 1DO0A 4MGZE 3SHGB 2K6BA 1YLAA 3TWLA 4CISA 5KQ8A 3CF6E 1D2NA 2MR9A 4MGHA 1QQWA 2CUZA 3IG5A 4FWGA 4FWDA 4JI1M 1DGGA 3FUVA 3U6DA 2XZUA 1T6OA 1IN6A 2M5ZA 2HAKA 3HZJA 3GLGE 3GLIA 1DGHA 1X37A 2MJ5B 3GLGB 5EP2A 4AG6A 3U61B 4JYAM 3A46A 2Z4SA 2NQ8C 4IBCA 5EQTA 3WHKA 1N32M 4QNRA 3T15A 3E21A 1JR3A 3DFZA 2F4VM 1JR3D 2XFSA 1QAQA 2KW0A 1TR8A 4YHHM 1HNZM 4LF9M 4W5WA 1SXJC 2JUJA 3A42A 1IY1A 1OKSA 2R46A 2CHGA 2G8LA 2KZSA 3TPZA 1TF0B 2ZAMA 1VDLA 3GLIB 3AL0C 2DWZB 3I04M 2XGNA 1WIVA 1D0LA 2EO2A 5F3WA 4XK8F 1EFUB 3SATA 3B7ZA 3CF2A 1MX0A 4X66M 3Q8GA 3ZC7B 1Z5BA 2FH0A 4KHPM 1YE9A 3J27B 4AW4A 2K9DA 1D0KA 4F2LA 3K9PA 1Z59A 2F5PA 4AZFA 3J81S 1OQYA 3D8LA 3LMMA 4OU7A 4IBKA 3I4YA 3GPPA 1NVMA 1W5TA 3GLIE 4NXMM 4LFCM 2DHYA 3K1JA 3GLHA 3T38A 3VDPA 3VKHA 2F5NA 1V92A 2Q2EB 2BJVA 1J09A 2H1RA 1DGHB 3DZDA 3I01M 4LZZA 5EXXA 2MH8A 7CATA 4A3VB 2V1UA 2DVWB 3SBJA 4B3MM 4JI4M 1GKIA 3HHZA 1DO2A 2LVQD 4I4LA 1I94M 1IBMM 2XEPA 1EE8A 1ZMWA 4M9XA 4QOSA 5ITTA 3KXEC 4GC5A 2XF3A 2YNMD 2CE7A 4KO8A 3C58A 1WGLA 2JY8A 4L78A 1HT2E 2QBYA 2AHMA 3KFUG 2X49A 1ZMVA 3OTOM 5C18A 1VDDA 3D8BA 1VG5A 2JY7A 3C3DA 2CV2A 4LF6M 4AG5A 2LBCA 2X8AA 1L8QA 3MK6A 4DBGB 3AFHA 3FD9A 1NY6A 3I51A 4DV0M 4G4OA 1G59A 3AOEA 5FLXS 3FTDA 4I81A 4M0WA 4DV1M 2LWXA 3TL4X 2D7HA 1N33M 3GQ3A 4IIWA 4DUZM 1OFHA 1SXJD 2H5XA 1QUSA 2LH0A 3H4JA 3V76A 2HL7A 1A5TA 4MM3B 1QZMA 5FTLA 5ITXE 2EKKA 5BPVA 4LGMA 5DFLA 3GPXA 1IXRC 3IHPA 2EUCA 3KOZE 2V6ZM 2Z4RA 4XBOA 1XHBA 4G4QA 3SAWA 4LF8M 1OTRA 1N36M 2BWBA 4LF4M 2R18A 4PDGA 4X64M 2KXEA 4JN6A 2UUBM 4NOOB 2KNZA 2R4EA 2FFJA 1AUAA 1YSYA 3GLHB 4GITA 4Z8XA 4B7FA 3GLFA 1IN4A 2FOIC 3AJIB 4AKIA 1PGYA 2DAEA 2W82A 3QYBA 2DENA 2RKOA 3ZQJA 1GL6A 1XC8A 2FE8A 4WP2A 4PDIA 3U6PA 2G5GX 1XMQM 2DWLA 3M7GA 2ERCA 1G4AE 2ZBKB 4RKUF 2HHHM 2MGWA 4PT5A 3HU1A 3RFWA 4LF5M 4OW0A 2QBYB 2R44A 3E9SA 4QNMA 2C9CA 2WZJA 4DV7M 1G8PA 2CV1A 4LJ9A 2DAGA 3UGJA 1PJTA 1NNJA 2Z8YM 4IBFA 3NBIA 1TH2A 3L2AA 2C9OA 2UUCM 2DXIA 2B3TA 3A45A 4FCWA 4GH9A 2XH9A 2QENA 3UMMA 2YR0A 1GLNA 1NHGC 2WSCF 2XFTA 4X65M 4D80A 4DV6M 4KT0F 1D0MA 2OOAA 2LTUA 4B3RM 4LG2A 4GRIA 4JV5M 3HHYA 1DGBA 2QQ8A 4JI8M 2YQZA 4NXNM 5DYGA 2KRKA 1XXHE 2DKLA 3U6LA 3SYLA 1DV0A 2OO9A 1IXSA 1QAOA 3EIEA 3I4VA 3K9OA 4IBJA 3A98B 3U6CA 1PJJA 3FUUA 1TH3A 5EP3A 4BB9A 2YFQA 3PFIA 3FRHA
chains in the Genus database with same CATH topology
2LVNC 4Q7JA 2RRUA 3GLFE 3IECA 2QNJA 2MROB 2LVAA 2K9DA 1HT1E 2QHOB 4F2LA 1IM2A 3K9PA 3F92A 1BVSA 1OQYA 2LVOC 1QZEA 1NV9A 3GLIE 2DHYA 3LCVB 1Y8GA 1V92A 4HEOA 1UFZA 2JNHA 1DO2A 2LVQD 1ZMWA 1VEJA 1F4IA 2JY6B 2EJSA 2KNVA 1WHCA 3GLHE 1WGLA 2JP7A 2JY8A 1HT2E 1ZMVA 5JI2E 2DAKA 1GO5A 1VG5A 2KHHA 2JY7A 1T43A 2LBCA 1CUKA 4DBGB 3FE3A 2DAIA 2L2DA 1WR1B 3E46A 1C7YA 1TTEA 2H5XA 2DNAA 2DZLA 3H4JA 1G41A 1WJ7A 1A5TA 2BWEA 2DAMA 2QSFX 2EKKA 3LCUA 5DFLA 1IFYA 3IHPA 1VQ1A 2G3QA 3BBZA 3T6PA 1E94E 1OTRA 2BWBA 4GEWA 1OAIA 2EKFA 2JZ0A 1ZMUA 2K0BX 2JY5A 2KNZA 2ZTDA 1HJPA 2O25A 3B89A 1DO0A 2CP8A 1PGYA 1YLAA 2DAEA 4UN2B 2DENA 2MR9A 4WP2A 2L4FA 1ZV1A 1G4AE 3FRIA 4F1IA 2MGWA 1T6OA 2HWJA 2HAKA 3GLGE 1AIPC 1R4GA 1WGNA 2LVPC 2MJ5B 2WZJA 2DI0A 1VEGA 2DAGA 4G3OA 3MMPA 3E21A 2ZTCA 2CWBA 1TR8A 1XB2B 2B3TA 2L4EA 1KYIA 1MN3A 1P3QQ 1SG9A 2JUJA 2OOAA 1OKSA 2LTUA 2KNAA 2OOBA 4R71A 1HQYE 1NV8A 1VDLA 1G3IA 1XXHE 2DKLA 1DV0A 2OO9A 1IXSA 1Q02A 1VEKA 1WIVA 3K9OA 1JR3E 1EFUB 2R0IA 2JZ1A 3FRHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LVN C;  4Q7J A;  2RRU A;  3GLF E;  3IEC A;  2QNJ A;  2MRO B;  2LVA A;  2K9D A;  1HT1 E;  2QHO B;  4F2L A;  1IM2 A;  3K9P A;  3F92 A;  1BVS A;  1OQY A;  2LVO C;  1QZE A;  1NV9 A;  3GLI E;  2DHY A;  3LCV B;  1Y8G A;  1V92 A;  4HEO A;  1UFZ A;  2JNH A;  1DO2 A;  2LVQ D;  1ZMW A;  1VEJ A;  1F4I A;  2JY6 B;  2EJS A;  2KNV A;  1WHC A;  3GLH E;  1WGL A;  2JP7 A;  2JY8 A;  1HT2 E;  1ZMV A;  5JI2 E;  2DAK A;  1GO5 A;  1VG5 A;  2KHH A;  2JY7 A;  1T43 A;  2LBC A;  1CUK A;  4DBG B;  3FE3 A;  2DAI A;  2L2D A;  1WR1 B;  3E46 A;  1C7Y A;  1TTE A;  2H5X A;  2DNA A;  2DZL A;  3H4J A;  1G41 A;  1WJ7 A;  1A5T A;  2BWE A;  2DAM A;  2QSF X;  2EKK A;  3LCU A;  5DFL A;  1IFY A;  3IHP A;  1VQ1 A;  2G3Q A;  3BBZ A;  3T6P A;  1E94 E;  1OTR A;  2BWB A;  4GEW A;  1OAI A;  2EKF A;  2JZ0 A;  1ZMU A;  2K0B X;  2JY5 A;  2KNZ A;  2ZTD A;  1HJP A;  2O25 A;  3B89 A;  1DO0 A;  2CP8 A;  1PGY A;  1YLA A;  2DAE A;  4UN2 B;  2DEN A;  2MR9 A;  4WP2 A;  2L4F A;  1ZV1 A;  1G4A E;  3FRI A;  4F1I A;  2MGW A;  1T6O A;  2HWJ A;  2HAK A;  3GLG E;  1AIP C;  1R4G A;  1WGN A;  2LVP C;  2MJ5 B;  2WZJ A;  2DI0 A;  1VEG A;  2DAG A;  4G3O A;  3MMP A;  3E21 A;  2ZTC A;  2CWB A;  1TR8 A;  1XB2 B;  2B3T A;  2L4E A;  1KYI A;  1MN3 A;  1P3Q Q;  1SG9 A;  2JUJ A;  2OOA A;  1OKS A;  2LTU A;  2KNA A;  2OOB A;  4R71 A;  1HQY E;  1NV8 A;  1VDL A;  1G3I A;  1XXH E;  2DKL A;  1DV0 A;  2OO9 A;  1IXS A;  1Q02 A;  1VEK A;  1WIV A;  3K9O A;  1JR3 E;  1EFU B;  2R0I A;  2JZ1 A;  3FRH A; 
#chains in the Genus database with same CATH topology
 1L2B A;  4Q7J A;  3WHL A;  2RRU A;  4L15 A;  2JA2 A;  3VK8 A;  3LVW A;  3GLF E;  4IBG A;  2QNJ A;  2L6O A;  3FYD A;  1IN8 A;  4IBI A;  2F5S A;  1LTM A;  4FVM A;  4HL4 A;  3GLF B;  1IM2 A;  3F92 A;  2KRU A;  4IBE A;  3CF0 A;  3AKZ A;  4K0K M;  2EA0 A;  2L7I A;  3AOE C;  3QWL A;  2LVO C;  3FUW A;  3HHW A;  4MGI E;  4Y28 F;  3U5Z A;  2D7G A;  4LF7 M;  2UXB M;  3U60 B;  3M6A A;  3SAR A;  3B7Q A;  4LJA A;  2VDB B;  1OJL A;  1PJS A;  3L26 A;  3LCV B;  3VLF B;  5LMU M;  2UXC M;  1Y8G A;  3J7B A;  5LMN M;  1Q3C A;  2VF8 A;  3AOG A;  1Z6T A;  4II7 A;  3SAU A;  2HCB A;  4DR4 M;  4EIW A;  1NJG A;  4M9S A;  2I7P A;  2ZAO A;  3W0L B;  1E32 A;  2C96 A;  1C1K A;  1XMO M;  4CIZ A;  4I8O A;  3PXG A;  4M0D A;  3FUX A;  3NWL A;  1WHC A;  4LZJ A;  4JI5 M;  4FCV A;  1ZQ9 A;  5JI2 E;  1GAB A;  2CHV A;  4I5S A;  5ITX A;  1FJG M;  4JXJ A;  3GRV A;  5EXP A;  2OPF A;  1CUK A;  3ZCB B;  3HJS A;  3QAU A;  2KDL A;  2L2D A;  1IXS B;  1Z5A A;  4FCT A;  4JI6 M;  3FYC A;  1Z5C A;  2WSF F;  2KA6 B;  3E46 A;  2WSE F;  1C7Y A;  4JI0 M;  3HX3 A;  2DWN A;  4NRW A;  4RF0 A;  3H4M A;  2DNA A;  2DZL A;  1PRB A;  4DR2 M;  3U6E A;  2LHC A;  1GVN A;  2P5T A;  4S12 A;  1HNX M;  2E5L M;  4AKH A;  3EIH A;  2QSF X;  1IFY A;  3L27 A;  1IQP A;  2CHQ A;  2K47 A;  1S3S A;  3K8Z A;  1ORY B;  3T6P A;  2VQE M;  2BNK A;  3U5Z B;  4R7G A;  3VFD A;  4CHT B;  4GEW A;  3LQR A;  3MJ5 A;  1TDH A;  2JZ0 A;  2K0B X;  3B89 A;  3HGI A;  3KOW E;  4IBB A;  1HJP A;  2O25 A;  1H6U A;  4LCB A;  4MH0 E;  4X62 M;  4DR5 M;  4MB7 A;  1R2Y A;  2GQF A;  2R4J A;  1FNN A;  3GRR A;  4MGY E;  3DOA A;  4DR7 M;  4NSR A;  1QYR A;  2L4F A;  4G6Z A;  4LJ7 A;  1NHW C;  3KOX E;  4D81 A;  4PD2 A;  1N77 A;  3VKG A;  1ZV1 A;  4F1I A;  4OVZ A;  1WXQ A;  2DZO B;  2HWJ A;  3AV0 A;  3HY5 A;  4L16 A;  2J7O A;  1XNR M;  4RNA A;  3RGS A;  2RGH A;  2XLJ A;  1VEG A;  3FTF A;  3W68 A;  1XXH A;  5ITQ A;  2XZF A;  4HLQ A;  3W0F A;  3MMP A;  2ZTC A;  2KEB A;  3U6Q A;  3L25 A;  1OIP A;  1OAO C;  2CWB A;  3B7N A;  3SYK A;  3HJ8 A;  2L4E A;  1W5S A;  3GP1 A;  1MN3 A;  1P3Q Q;  1SG9 A;  1KSF X;  2VF7 A;  3KS8 A;  3TWM A;  3HU2 A;  5C1B A;  4R71 A;  1HQC A;  3VDU A;  3K2L A;  2VII A;  1NO1 A;  4NSO B;  3U60 A;  2C5R A;  3U6O A;  4AQY M;  4B7H A;  1Q02 A;  1VEK A;  3BXW A;  1L2C A;  1R5L A;  4NRV A;  2O5R A;  2R0I A;  1LV7 A;  2KZU A;  3FTE A;  1GJS A;  2LVN C;  1XWI A;  1E9S A;  4PCZ A;  3IEC A;  3SAS A;  2MRO B;  2LVA A;  2C98 A;  2X4A A;  3VK7 A;  3R9X B;  3ILK A;  4JI3 M;  2QHO B;  5L8R F;  1K3X A;  4R3D A;  1JQJ C;  3JR5 A;  2JWS A;  1L1T A;  3HU3 A;  2ZM6 M;  1QZE A;  4LFA M;  2GNO A;  3UJN A;  3T1Y M;  4LJ6 A;  1NV9 A;  4D82 A;  1J7K A;  2DHR A;  1QAM A;  4MGK E;  1IBL M;  1N78 A;  4OVZ B;  4P16 A;  2UUA M;  2VQF M;  1N75 A;  1MJG M;  3Q8X A;  4HEO A;  5ITR A;  5DNY A;  3SAV A;  3W67 A;  1HNW M;  3RGP A;  3PNY A;  2UU9 M;  1YUB A;  2JNH A;  2XSZ A;  1PJI A;  4LRT A;  4IBD A;  4B3T M;  1XXH B;  3IG8 A;  5KPT A;  4FWH A;  2JY6 B;  3LVV A;  3R8F A;  4L8R C;  1EIJ A;  3FKE A;  1IY2 A;  1R6B X;  3GRU A;  5FSW A;  4QOZ C;  2ZAN A;  4IJF A;  3B74 A;  3TQS A;  2OQ4 A;  2V1C A;  1SXJ E;  2D7E A;  4DV3 M;  3J80 S;  1QVR A;  5BR8 M;  5GKN A;  2R6F A;  1NY5 A;  3SMS A;  2DZN B;  2L7H A;  3L28 A;  1V34 A;  5JI3 E;  2DAI A;  1IXZ A;  3HJQ A;  3TWK A;  2J5Y A;  2QCU A;  3LW5 F;  4GKJ M;  3KS4 A;  1IN7 A;  1JB0 F;  1G41 A;  2BWE A;  2DAM A;  2CEA A;  4DV2 M;  3U6S A;  3KP1 E;  2M60 A;  4B3S M;  4DR1 M;  3CGW A;  3SC3 A;  4DUY M;  1T3T A;  3LCU A;  4B08 A;  4LFB M;  3BBZ A;  1E94 E;  4B7G A;  2I7N A;  3UZU A;  3B9P A;  5EP4 A;  5IZ7 D;  4YY3 M;  2DWM A;  1OAI A;  2L09 A;  5IT9 S;  4NC6 A;  2ZTD A;  2JY5 A;  5DYI A;  1PM5 A;  1E9R A;  2QZ4 A;  2CP8 A;  3HHX A;  1MU5 A;  3LQQ A;  4JI7 M;  3DA1 A;  4P17 A;  4UN2 B;  5ITY A;  1J5E M;  3JR4 A;  5A2Q S;  4AKG A;  1RU3 A;  2C99 A;  3GQ4 A;  4QHS A;  5KQD A;  3C3E A;  3FRI A;  1TGU A;  1AIP C;  1Q3B A;  1R4G A;  1UM8 A;  1WGN A;  2LVP C;  3TE6 A;  1QUT A;  1L2D A;  2JXN A;  3GO8 A;  1PJQ A;  5EJC A;  2DI0 A;  2F5Q A;  4JI2 M;  1NJF A;  1HR0 M;  1Q39 A;  3ZH9 B;  4G3O A;  4REZ A;  5KO3 A;  2LXE A;  1XB2 B;  3BOS A;  4DV5 M;  1KYI A;  1QDT A;  3RE8 A;  1TDZ A;  3THG A;  2CRU A;  1V33 A;  2KNA A;  2OOB A;  5E26 A;  2R65 A;  3GQ5 A;  1HQY E;  5ITU A;  4DV4 M;  1K3W A;  2CV0 A;  3KSX A;  4NL4 H;  1NV8 A;  2CFO A;  1G3I A;  4LRS A;  4L4U A;  2Y21 A;  4TUW A;  2Y0Q A;  2FS1 A;  1JR3 E;  3J7A S;  2JZ1 A;  5EXT A;  2Z3X A;  4ITQ A;  1GL7 A;  3QYE A;  4Z6Y A;  1KFV A;  4KLN A;  1OIZ A;  2LNH C;  2BJW A;  1HT1 E;  5FTM A;  3HKP A;  5FTK A;  1I4W A;  1BVS A;  4GIP A;  4WUR A;  4GKK M;  3KSJ A;  4KOD A;  4G4R A;  1IN5 A;  4IJE A;  3PVS A;  4AI6 A;  4BBA A;  4GHL A;  3FUT A;  5EXS A;  2R45 A;  2APL A;  1DGF A;  3SFZ A;  2J7N A;  4BLC A;  4CJ6 A;  4G4N A;  4DR6 M;  5IWA M;  1SXJ A;  4ZPX A;  3K92 A;  3SHF A;  1UFZ A;  2QPA A;  3HWS A;  2Z7J A;  4FD2 A;  1ZAE A;  2R62 A;  3KVW A;  4L6V 6;  3T1H M;  1K82 A;  1L1Z A;  1OFI A;  1GJT A;  4LY6 A;  4LJ8 A;  3MHV C;  8CAT A;  1VEJ A;  1F4I A;  3NBX X;  2EJS A;  1NSF A;  2KNV A;  3GLH E;  2JP7 A;  3C9P A;  3KW6 A;  5EP1 A;  4CGY B;  3PNV A;  3GLG A;  1TH4 A;  3U6M A;  3U61 A;  3M0E A;  1N34 M;  4GHA A;  1NNU C;  1QAN A;  3KP0 E;  4GMQ A;  2DAK A;  1GO5 A;  2KHH A;  5FTJ A;  1R2Z A;  1T43 A;  3J2P B;  4ANR A;  1QDR A;  3FE3 A;  3JAM S;  1WR1 B;  2UXD M;  2Y20 A;  4XGI A;  4WW0 A;  1IY0 A;  2N35 A;  1TTE A;  2A5Y B;  3SMP A;  1XNQ M;  2O01 F;  2HKJ A;  1WJ7 A;  5E6J A;  4LJ4 A;  3E4R A;  1R7R A;  5KPZ A;  4DR3 M;  3KDS E;  2XSZ D;  2QP9 X;  3KOY E;  2LHG A;  5KPR A;  3FTC A;  1G71 A;  5IRE B;  1IBK M;  2RGO A;  1VQ1 A;  2G3Q A;  2F5O A;  2FNA A;  4M9Z A;  2Y0T A;  3GPU A;  3GPY A;  4OX9 M;  5H37 D;  2EKF A;  3UK6 A;  3GRY A;  4FW9 A;  1ZMU A;  4LJ5 A;  3L29 A;  4QHT A;  4GC9 A;  3CTW B;  4LGY A;  5FTN A;  4RF1 A;  1SXJ B;  1DO0 A;  4MGZ E;  3SHG B;  2K6B A;  1YLA A;  3TWL A;  4CIS A;  5KQ8 A;  3CF6 E;  1D2N A;  2MR9 A;  4MGH A;  1QQW A;  2CUZ A;  3IG5 A;  4FWG A;  4FWD A;  4JI1 M;  1DGG A;  3FUV A;  3U6D A;  2XZU A;  1T6O A;  1IN6 A;  2M5Z A;  2HAK A;  3HZJ A;  3GLG E;  3GLI A;  1DGH A;  1X37 A;  2MJ5 B;  3GLG B;  5EP2 A;  4AG6 A;  3U61 B;  4JYA M;  3A46 A;  2Z4S A;  2NQ8 C;  4IBC A;  5EQT A;  3WHK A;  1N32 M;  4QNR A;  3T15 A;  3E21 A;  1JR3 A;  3DFZ A;  2F4V M;  1JR3 D;  2XFS A;  1QAQ A;  2KW0 A;  1TR8 A;  4YHH M;  1HNZ M;  4LF9 M;  4W5W A;  1SXJ C;  2JUJ A;  3A42 A;  1IY1 A;  1OKS A;  2R46 A;  2CHG A;  2G8L A;  2KZS A;  3TPZ A;  1TF0 B;  2ZAM A;  1VDL A;  3GLI B;  3AL0 C;  2DWZ B;  3I04 M;  2XGN A;  1WIV A;  1D0L A;  2EO2 A;  5F3W A;  4XK8 F;  1EFU B;  3SAT A;  3B7Z A;  3CF2 A;  1MX0 A;  4X66 M;  3Q8G A;  3ZC7 B;  1Z5B A;  2FH0 A;  4KHP M;  1YE9 A;  3J27 B;  4AW4 A;  2K9D A;  1D0K A;  4F2L A;  3K9P A;  1Z59 A;  2F5P A;  4AZF A;  3J81 S;  1OQY A;  3D8L A;  3LMM A;  4OU7 A;  4IBK A;  3I4Y A;  3GPP A;  1NVM A;  1W5T A;  3GLI E;  4NXM M;  4LFC M;  2DHY A;  3K1J A;  3GLH A;  3T38 A;  3VDP A;  3VKH A;  2F5N A;  1V92 A;  2Q2E B;  2BJV A;  1J09 A;  2H1R A;  1DGH B;  3DZD A;  3I01 M;  4LZZ A;  5EXX A;  2MH8 A;  7CAT A;  4A3V B;  2V1U A;  2DVW B;  3SBJ A;  4B3M M;  4JI4 M;  1GKI A;  3HHZ A;  1DO2 A;  2LVQ D;  4I4L A;  1I94 M;  1IBM M;  2XEP A;  1EE8 A;  1ZMW A;  4M9X A;  4QOS A;  5ITT A;  3KXE C;  4GC5 A;  2XF3 A;  2YNM D;  2CE7 A;  4KO8 A;  3C58 A;  1WGL A;  2JY8 A;  4L78 A;  1HT2 E;  2QBY A;  2AHM A;  3KFU G;  2X49 A;  1ZMV A;  3OTO M;  5C18 A;  1VDD A;  3D8B A;  1VG5 A;  2JY7 A;  3C3D A;  2CV2 A;  4LF6 M;  4AG5 A;  2LBC A;  2X8A A;  1L8Q A;  3MK6 A;  4DBG B;  3AFH A;  3FD9 A;  1NY6 A;  3I51 A;  4DV0 M;  4G4O A;  1G59 A;  3AOE A;  5FLX S;  3FTD A;  4I81 A;  4M0W A;  4DV1 M;  2LWX A;  3TL4 X;  2D7H A;  1N33 M;  3GQ3 A;  4IIW A;  4DUZ M;  1OFH A;  1SXJ D;  2H5X A;  1QUS A;  2LH0 A;  3H4J A;  3V76 A;  2HL7 A;  1A5T A;  4MM3 B;  1QZM A;  5FTL A;  5ITX E;  2EKK A;  5BPV A;  4LGM A;  5DFL A;  3GPX A;  1IXR C;  3IHP A;  2EUC A;  3KOZ E;  2V6Z M;  2Z4R A;  4XBO A;  1XHB A;  4G4Q A;  3SAW A;  4LF8 M;  1OTR A;  1N36 M;  2BWB A;  4LF4 M;  2R18 A;  4PDG A;  4X64 M;  2KXE A;  4JN6 A;  2UUB M;  4NOO B;  2KNZ A;  2R4E A;  2FFJ A;  1AUA A;  1YSY A;  3GLH B;  4GIT A;  4Z8X A;  4B7F A;  3GLF A;  1IN4 A;  2FOI C;  3AJI B;  4AKI A;  1PGY A;  2DAE A;  2W82 A;  3QYB A;  2DEN A;  2RKO A;  3ZQJ A;  1GL6 A;  1XC8 A;  2FE8 A;  4WP2 A;  4PDI A;  3U6P A;  2G5G X;  1XMQ M;  2DWL A;  3M7G A;  2ERC A;  1G4A E;  2ZBK B;  4RKU F;  2HHH M;  2MGW A;  4PT5 A;  3HU1 A;  3RFW A;  4LF5 M;  4OW0 A;  2QBY B;  2R44 A;  3E9S A;  4QNM A;  2C9C A;  2WZJ A;  4DV7 M;  1G8P A;  2CV1 A;  4LJ9 A;  2DAG A;  3UGJ A;  1PJT A;  1NNJ A;  2Z8Y M;  4IBF A;  3NBI A;  1TH2 A;  3L2A A;  2C9O A;  2UUC M;  2DXI A;  2B3T A;  3A45 A;  4FCW A;  4GH9 A;  2XH9 A;  2QEN A;  3UMM A;  2YR0 A;  1GLN A;  1NHG C;  2WSC F;  2XFT A;  4X65 M;  4D80 A;  4DV6 M;  4KT0 F;  1D0M A;  2OOA A;  2LTU A;  4B3R M;  4LG2 A;  4GRI A;  4JV5 M;  3HHY A;  1DGB A;  2QQ8 A;  4JI8 M;  2YQZ A;  4NXN M;  5DYG A;  2KRK A;  1XXH E;  2DKL A;  3U6L A;  3SYL A;  1DV0 A;  2OO9 A;  1IXS A;  1QAO A;  3EIE A;  3I4V A;  3K9O A;  4IBJ A;  3A98 B;  3U6C A;  1PJJ A;  3FUU A;  1TH3 A;  5EP3 A;  4BB9 A;  2YFQ A;  3PFI A;  3FRH A; 
#chains in the Genus database with same CATH homology
 2LVN C;  4Q7J A;  2RRU A;  3GLF E;  3IEC A;  2QNJ A;  2MRO B;  2LVA A;  2K9D A;  1HT1 E;  2QHO B;  4F2L A;  1IM2 A;  3K9P A;  3F92 A;  1BVS A;  1OQY A;  2LVO C;  1QZE A;  1NV9 A;  3GLI E;  2DHY A;  3LCV B;  1Y8G A;  1V92 A;  4HEO A;  1UFZ A;  2JNH A;  1DO2 A;  2LVQ D;  1ZMW A;  1VEJ A;  1F4I A;  2JY6 B;  2EJS A;  2KNV A;  1WHC A;  3GLH E;  1WGL A;  2JP7 A;  2JY8 A;  1HT2 E;  1ZMV A;  5JI2 E;  2DAK A;  1GO5 A;  1VG5 A;  2KHH A;  2JY7 A;  1T43 A;  2LBC A;  1CUK A;  4DBG B;  3FE3 A;  2DAI A;  2L2D A;  1WR1 B;  3E46 A;  1C7Y A;  1TTE A;  2H5X A;  2DNA A;  2DZL A;  3H4J A;  1G41 A;  1WJ7 A;  1A5T A;  2BWE A;  2DAM A;  2QSF X;  2EKK A;  3LCU A;  5DFL A;  1IFY A;  3IHP A;  1VQ1 A;  2G3Q A;  3BBZ A;  3T6P A;  1E94 E;  1OTR A;  2BWB A;  4GEW A;  1OAI A;  2EKF A;  2JZ0 A;  1ZMU A;  2K0B X;  2JY5 A;  2KNZ A;  2ZTD A;  1HJP A;  2O25 A;  3B89 A;  1DO0 A;  2CP8 A;  1PGY A;  1YLA A;  2DAE A;  4UN2 B;  2DEN A;  2MR9 A;  4WP2 A;  2L4F A;  1ZV1 A;  1G4A E;  3FRI A;  4F1I A;  2MGW A;  1T6O A;  2HWJ A;  2HAK A;  3GLG E;  1AIP C;  1R4G A;  1WGN A;  2LVP C;  2MJ5 B;  2WZJ A;  2DI0 A;  1VEG A;  2DAG A;  4G3O A;  3MMP A;  3E21 A;  2ZTC A;  2CWB A;  1TR8 A;  1XB2 B;  2B3T A;  2L4E A;  1KYI A;  1MN3 A;  1P3Q Q;  1SG9 A;  2JUJ A;  2OOA A;  1OKS A;  2LTU A;  2KNA A;  2OOB A;  4R71 A;  1HQY E;  1NV8 A;  1VDL A;  1G3I A;  1XXH E;  2DKL A;  1DV0 A;  2OO9 A;  1IXS A;  1Q02 A;  1VEK A;  1WIV A;  3K9O A;  1JR3 E;  1EFU B;  2R0I A;  2JZ1 A;  3FRH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...