2CP8A

Solution structure of the rsgi ruh-046, a uba domain from human next to brca1 gene 1 protein (kiaa0049 protein) r923h variant
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
b'GSSGSSGQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Next to BRCA1 gene 1 protein
publication title Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2cp8A00
2L4EA 2OO9A 1SG9A 1Y8GA 2H5XA 2BWBA 1BVSA 1GO5A 3K9OA 1E94E 1OQYA 1VEGA 2OOAA 2QHOB 3MMPA 1G41A 2HAKA 2JY7A 3B89A 3GLHE 1A5TA 2DAGA 3T6PA 1DO0A 3GLFE 2JUJA 1MN3A 1TR8A 2KHHA 2OOBA 2JNHA 2MR9A 1ZMUA 2JY5A 2KNVA 1IM2A 2QSFX 4Q7JA 2JZ1A 1Q02A 1TTEA 1WR1B 2LVNC 2WZJA 4GEWA 2DENA 2MGWA 1ZMWA 2DHYA 2R0IA 1T6OA 1XB2B 2L4FA 2LTUA 1VEKA 2JY6B 1AIPC 2DNAA 2DAIA 3BBZA 1OKSA 1ZMVA 2DAKA 1IFYA 2KNAA 4R71A 1V92A 4DBGB 1JR3E 1EFUB 1NV9A 2K0BX 3F92A 4F2LA 1HT1E 1F4IA 1HQYE 2DAMA 3LCVB 3H4JA 1WHCA 1HT2E 2CP8A 2DKLA 1WJ7A 3FRIA 1OTRA 2B3TA 1VDLA 2DI0A 1G4AE 2ZTCA 2G3QA 1WIVA 3IECA 2MROB 1OAIA 1VQ1A 3IHPA 1YLAA 1IXSA 2LVAA 5DFLA 3K9PA 4HEOA 1R4GA 2LVPC 1PGYA 3FE3A 2EKKA 2EKFA 4G3OA 2ZTDA 2DAEA 2LVOC 1WGLA 1UFZA 2QNJA 1HJPA 1DO2A 2K9DA 3E46A 3FRHA 1C7YA 1QZEA 1ZV1A 2JP7A 3GLIE 3E21A 4WP2A 2MJ5B 1G3IA 5JI2E 4UN2B 1VG5A 1T43A 2L2DA 2O25A 1DV0A 1CUKA 2DZLA 1NV8A 4F1IA 2JY8A 2EJSA 3GLGE 2HWJA 2KNZA 1VEJA 2JZ0A 1WGNA 1KYIA 2LVQD 2RRUA 1XXHE 3LCUA 2BWEA 2CWBA 2LBCA 1P3QQ
chains in the Genus database with same CATH superfamily
1Z5BA 2L4EA 1SG9A 4AQYM 5IREB 2H5XA 2BWBA 5FTJA 3FUWA 3VKHA 1BVSA 1E94E 1VEGA 1ZQ9A 2CHQA 3U61A 2J7NA 2JWSA 7CATA 1G41A 3B89A 1QDTA 4M9ZA 3GLHE 1E9RA 2DAGA 3B7NA 1DO0A 2XLJA 1QUTA 1MN3A 4OW0A 3VDPA 5DYGA 1OIZA 2FS1A 4TUWA 4W5WA 1OIPA 2JZ1A 2D7GA 1TTEA 1N32M 2WZJA 4ZPXA 4GEWA 4JV5M 1NNUC 2DENA 4M9SA 3GQ3A 3SYLA 2DHYA 3J2PB 2ZM6M 4FW9A 1IN5A 4IBKA 2LTUA 4LJ9A 4G4QA 2CV1A 2HHHM 4JI8M 4LFCM 1AIPC 2HL7A 5C18A 4NRVA 3DA1A 4DV5M 5EXTA 1QAQA 1E32A 2RGOA 3R9XB 3SMSA 3KVWA 3ZCBB 5FSWA 1XMQM 5KPZA 3SAVA 2HKJA 2DZNB 2KNAA 3A42A 4GITA 5EXSA 4R71A 3PVSA 4YY3M 1W5SA 1XWIA 2J7OA 3I51A 5JI3E 1KSFX 1JR3E 2C96A 5A2QS 1EFUB 1L1TA 3FTFA 3FYDA 1HQYE 4MGYE 3C58A 3RE8A 1IXSB 5FTNA 4DV6M 3SMPA 4HLQA 4ANRA 4NXNM 1HQCA 1NY6A 4FD2A 3QAUA 3PNVA 3LQQA 3ILKA 4LJ7A 3TWKA 4DR5M 2D7HA 4KODA 2B3TA 4DR4M 2RKOA 3KS4A 1DGFA 5BR8M 2O01F 4B7HA 3SBJA 1J09A 1IXRC 1GKIA 5EP4A 3VLFB 4CIZA 5ITRA 2DZOB 2VQEM 3K92A 4FVMA 1NO1A 3WHLA 3SASA 3A45A 3IHPA 4LZJA 4D82A 5KPTA 3EIEA 2CEAA 2D7EA 4L78A 1IXSA 2LVAA 4NSRA 3E4RA 2YQZA 3AOGA 2EKFA 4G3OA 4PDGA 1Q3BA 4MGHA 1WGLA 4B7FA 2F5SA 2Q2EB 1HJPA 2Z7JA 4D81A 1HR0M 1TF0B 5ITTA 1N78A 3E46A 1N36M 1W5TA 1Q3CA 2C5RA 2GQFA 1YSYA 2R18A 1QDRA 1SXJC 4G4OA 4AKIA 3KP0E 3GLIE 2LNHC 2MJ5B 3NWLA 2BJWA 1I4WA 4LRTA 8CATA 3JR5A 1MX0A 2ZANA 4RKUF 2V6ZM 2M60A 2VIIA 1VG5A 1SXJE 1T43A 5KPRA 1DV0A 4X64M 3LW5F 4A3VB 2Z8YM 4Z8XA 3W0FA 1IBKM 4F1IA 4PDIA 1XNQM 3GQ4A 2HWJA 3HKPA 1NJFA 1QAOA 5GKNA 1VEJA 3GLIB 3R8FA 4L6V6 1T3TA 3M6AA 3LVWA 3OTOM 2LVQD 2RRUA 1J5EM 4Y28F 3FUUA 1JQJC 1XXHE 1DGGA 3B7ZA 3QYBA 3L29A 1IBLM 1P3QQ 2C98A 2OO9A 3PXGA 1PJQA 4MGIE 3UZUA 4X65M 3VK7A 3KOZE 1GO5A 3I4YA 4RF0A 1OQYA 2YNMD 1J7KA 4RF1A 3VKGA 3IG8A 4NL4H 3GO8A 2XSZA 3MMPA 4DV1M 3HY5A 5FTMA 3J7AS 2V1UA 4KHPM 4L15A 1A5TA 1XXHB 4AKHA 5F3WA 1V34A 2JUJA 4BLCA 5BPVA 1TR8A 5E6JA 4S12A 3GLIA 3U6DA 2OOBA 2JNHA 4Z6YA 2A5YB 4G6ZA 4B08A 3U6QA 1ZMUA 3GRVA 1PM5A 1N77A 2LWXA 3RGSA 3SATA 1XNRM 1GJSA 2Y0TA 4LJ4A 2DHRA 3GP1A 2QSFX 4XGIA 2X8AA 2K6BA 1PJSA 1KFVA 2LXEA 2N35A 3QYEA 1D2NA 2R4EA 2MGWA 1JB0F 1GL7A 4L16A 1FNNA 3M0EA 4GHAA 2EO2A 2R0IA 1T6OA 3KXEC 4P16A 2KW0A 2L4FA 2JY6B 1QQWA 2DWLA 5H37D 1XXHA 2FNAA 2G8LA 3HHWA 1S3SA 2QQ8A 3KOWE 1H6UA 2C99A 3UK6A 4MGKE 1Q39A 3GPPA 3KS8A 1GL6A 2DAIA 5EP1A 3BBZA 1OKSA 2WSFF 3QWLA 2VQFM 4LJ5A 3NBIA 4I81A 3MJ5A 4EIWA 1V92A 4NOOB 4QNMA 2VDBB 4DR7M 2C9OA 1Z5AA 3AJIB 4IBIA 4ITQA 1IQPA 4I8OA 2DAMA 3SFZA 3H4JA 1IBMM 1HT2E 2EUCA 1FJGM 4M0WA 3U60B 2V1CA 3TWMA 1PRBA 1WJ7A 3KOYE 4QHSA 3FRIA 4XK8F 3T15A 5FTLA 3GPYA 4QOZC 2HCBA 3CF0A 1V33A 3PNYA 1N33M 1NY5A 5ITQA 1XC8A 1XMOM 1VDLA 4DV4M 3W67A 2DI0A 2ZTCA 3SHGB 1ORYB 2LHGA 4CHTB 3B74A 3IECA 4IBGA 2LH0A 4DR6M 1VQ1A 4GH9A 3U6LA 4CISA 4JXJA 1N75A 2UUBM 4JI6M 2M5ZA 3GPXA 1AUAA 4HEOA 4LJ6A 2NQ8C 1R4GA 2LVPC 3U60A 2F5QA 2EKKA 3TQSA 4DR3M 2XFSA 5EP3A 1UFZA 5E26A 4LF7M 1IY1A 1D0KA 2R65A 4M9XA 4I4LA 2AHMA 3EIHA 3THGA 3TE6A 4B7GA 3FKEA 5FLXS 4LGMA 4LJAA 2Y21A 1C7YA 1G8PA 4NSOB 1ZV1A 4OVZB 3I4VA 3SYKA 3AKZA 2XH9A 3E21A 4WP2A 2XZFA 1K82A 3GRRA 1JR3D 3KW6A 2UXDM 2X49A 3KDSE 2X4AA 4GRIA 1Z59A 1HNXM 1L2DA 3KSJA 2CV0A 1CUKA 4PT5A 4JI1M 2VF7A 2JY8A 2F5OA 1LV7A 2KNZA 1VDDA 4DV3M 2MH8A 4IBEA 3KOXE 2ZAOA 3UGJA 3LCUA 4AW4A 2BWEA 2L09A 4OVZA 2LBCA 2ZAMA 2KA6B 2UU9M 4QNRA 4LFAM 3B7QA 3W68A 4PCZA 2DVWB 4G4NA 1TH2A 3SC3A 3AOEC 2F5PA 4BB9A 2QHOB 1NHGC 2C9CA 3CTWB 2BJVA 2HAKA 2JY7A 3CF2A 3HJQA 5ITUA 2FE8A 3GLFE 2E5LM 1NJGA 3I04M 2R46A 4B3SM 2ZBKB 4LFBM 1YUBA 3SAWA 3TL4X 4GKKM 2KHHA 1Z6TA 2MR9A 4DV7M 4LG2A 1Z5CA 1QANA 4DR2M 3DFZA 2QENA 1IM2A 4QHTA 3PFIA 5L8RF 2UXBM 4LY6A 4P17A 3GLFB 3BXWA 3V76A 1NVMA 1ZMWA 3RGPA 3FUVA 2UUAM 1OAOC 2R44A 1K3WA 1VEKA 2L7IA 1SXJD 2DNAA 5EXXA 1IN7A 5ITXA 4LCBA 3AV0A 1ZMVA 4DV0M 3VFDA 4LF6M 5ITYA 1IY2A 1HNZM 2KEBA 1TGUA 2UXCM 2DXIA 4DR1M 3GLFA 3LVVA 1NV9A 4IBFA 3J80S 3FTEA 4AI6A 3AOEA 2R45A 4F2LA 1E9SA 3ZC7B 4B3TM 4GC9A 4KT0F 1X37A 2DKLA 4FWGA 4K0KM 3J27B 4FCVA 1IN4A 3VK8A 3A46A 2DWMA 1R2ZA 3TPZA 1TH4A 3HU3A 4GKJM 3LQRA 1QVRA 1K3XA 2YFQA 4CGYB 2H1RA 1OAIA 3T1YM 1PJIA 3HX3A 2QBYB 1YLAA 4I5SA 5IZ7D 2XZUA 2R4JA 2XFTA 5DFLA 3AFHA 3K9PA 1MU5A 1OJLA 3FE3A 4X66M 4X62M 1PJJA 3SAUA 2XEPA 1DGHB 4BBAA 4GC5A 3KSXA 2CE7A 4FCTA 5C1BA 4REZA 1DO2A 4MM3B 3CGWA 3DOAA 3FYCA 3HHXA 2K9DA 4M0DA 4DUZM 3GLGB 4JI0M 4NXMM 3H4MA 3W0LB 1IXZA 2J5YA 3K2LA 1GLNA 3FRHA 4DUYM 1QZEA 2JP7A 4WW0A 3U6SA 3VDUA 2QBYA 1MJGM 1XHBA 4LF5M 2EA0A 3U5ZB 3J7BA 4OU7A 2L6OA 5JI2E 3HHZA 4LF4M 2L2DA 3FD9A 1G71A 2CUZA 5EXPA 5DYIA 2DZLA 1QUSA 1NV8A 3LMMA 1PJTA 1DGHA 2Z4RA 2QPAA 3CF6E 2JZ0A 1WGNA 1NHWC 2Y0QA 4DV2M 4HL4A 1R5LA 3GLHB 4II7A 3GLGA 1TDZA 5KO3A 3A98B 2CWBA 4OX9M 4MGZE 1GVNA 1Y8GA 2Z3XA 5IT9S 3K1JA 2FFJA 2K47A 3U5ZA 2APLA 3K9OA 2OOAA 1N34M 4YHHM 3C3EA 1EIJA 1GABA 3HU1A 4AG5A 1R2YA 3FTCA 1WXQA 3C3DA 4AG6A 4GHLA 2I7NA 3T6PA 2ERCA 3GQ5A 2I7PA 1QYRA 4IBDA 4CJ6A 2QZ4A 3C9PA 3M7GA 4PD2A 2GNOA 2R62A 2JY5A 1QZMA 3GLHA 4RNAA 4L8RC 2KNVA 1R7RA 2FOIC 4LZZA 5EJCA 2XGNA 2XF3A 4Q7JA 4IBJA 5IWAM 1Q02A 3L26A 2DWNA 1HNWM 1WR1B 2LVNC 3HHYA 2KZUA 3MK6A 4LRSA 1C1KA 1G59A 4NRWA 3I01M 2UUCM 1L1ZA 2KDLA 1XB2B 5ITXE 1QAMA 2KRUA 3NBXX 2F4VM 3L28A 4AZFA 2QCUA 5LMUM 4FWDA 1I94M 3JR4A 4GIPA 2WSEF 3TWLA 3U6PA 3SARA 1LTMA 4FCWA 1IY0A 2KZSA 3L27A 3HGIA 4JI3M 4LF9M 2DAKA 2Y20A 1IFYA 4JN6A 3AL0C 3U6OA 3UJNA 4NC6A 3SHFA 4FWHA 1ZAEA 2JA2A 1GJTA 3J81S 4DBGB 4QOSA 2BNKA 2K0BX 3UMMA 3F92A 3K8ZA 4IJEA 3U6CA 1HT1E 1F4IA 3KFUG 2WSCF 1D0MA 2P5TA 2XSZD 1JR3A 3LCVB 3U6EA 4GMQA 5EP2A 2R6FA 1WHCA 3Q8GA 2CP8A 1D0LA 4L4UA 5FTKA 4R7GA 3HU2A 4LF8M 3GRYA 3HJ8A 4IBBA 4JI7M 1OTRA 1EE8A 5KQ8A 4B3RM 2VF8A 5KQDA 2LHCA 3FUXA 1TH3A 2O5RA 1G4AE 1OFHA 1WIVA 2G3QA 4G4RA 4MB7A 3IG5A 2MROB 4JI5M 3HZJA 2CRUA 2KXEA 4KO8A 2OPFA 1L2BA 3JAMS 4D80A 2CHVA 3D8LA 4XBOA 2CHGA 1L8QA 3ZQJA 1PGYA 4B3MM 3B9PA 5DNYA 2ZTDA 2DAEA 3RFWA 2L7HA 2LVOC 3BOSA 2CV2A 3HJSA 1SXJB 4LGYA 2QNJA 3U6MA 4KLNA 3L25A 1L2CA 3T38A 2QP9X 1NSFA 3DZDA 2OQ4A 4JYAM 3KP1E 3FUTA 4JI2M 4MH0E 4LJ8A 5EQTA 2JXNA 4IBCA 2W82A 1RU3A 3T1HM 2KRKA 1R6BX 1G3IA 1IN8A 1UM8A 4WURA 3Q8XA 2FH0A 4UN2B 4AKGA 4IIWA 3ZH9B 2O25A 3U61B 1TDHA 1OFIA 3FTDA 1DGBA 3D8BA 2EJSA 4JI4M 3GLGE 4R3DA 1SXJA 3E9SA 1KYIA 2YR0A 2G5GX 3L2AA 2Z4SA 3MHVC 1YE9A 3WHKA 1NNJA 3GPUA 2CFOA 3HWSA 5LMNM 2F5NA 2RGHA 3GRUA 4IJFA 1IN6A 2DWZB
chains in the Genus database with same CATH topology
2L4EA 2OO9A 1SG9A 1Y8GA 2H5XA 2BWBA 1BVSA 1GO5A 3K9OA 1E94E 1OQYA 1VEGA 2OOAA 2QHOB 3MMPA 1G41A 2HAKA 2JY7A 3B89A 3GLHE 1A5TA 2DAGA 3T6PA 1DO0A 3GLFE 2JUJA 1MN3A 1TR8A 2KHHA 2OOBA 2JNHA 2MR9A 1ZMUA 2JY5A 2KNVA 1IM2A 2QSFX 4Q7JA 2JZ1A 1Q02A 1TTEA 1WR1B 2LVNC 2WZJA 4GEWA 2DENA 2MGWA 1ZMWA 2DHYA 2R0IA 1T6OA 1XB2B 2L4FA 2LTUA 1VEKA 2JY6B 1AIPC 2DNAA 2DAIA 3BBZA 1OKSA 1ZMVA 2DAKA 1IFYA 2KNAA 4R71A 1V92A 4DBGB 1JR3E 1EFUB 1NV9A 2K0BX 3F92A 4F2LA 1HT1E 1F4IA 1HQYE 2DAMA 3LCVB 3H4JA 1WHCA 1HT2E 2CP8A 2DKLA 1WJ7A 3FRIA 1OTRA 2B3TA 1VDLA 2DI0A 1G4AE 2ZTCA 2G3QA 1WIVA 3IECA 2MROB 1OAIA 1VQ1A 3IHPA 1YLAA 1IXSA 2LVAA 5DFLA 3K9PA 4HEOA 1R4GA 2LVPC 1PGYA 3FE3A 2EKKA 2EKFA 4G3OA 2ZTDA 2DAEA 2LVOC 1WGLA 1UFZA 2QNJA 1HJPA 1DO2A 2K9DA 3E46A 3FRHA 1C7YA 1QZEA 1ZV1A 2JP7A 3GLIE 3E21A 4WP2A 2MJ5B 1G3IA 5JI2E 4UN2B 1VG5A 1T43A 2L2DA 2O25A 1DV0A 1CUKA 2DZLA 1NV8A 4F1IA 2JY8A 2EJSA 3GLGE 2HWJA 2KNZA 1VEJA 2JZ0A 1WGNA 1KYIA 2LVQD 2RRUA 1XXHE 3LCUA 2BWEA 2CWBA 2LBCA 1P3QQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4E A;  2OO9 A;  1SG9 A;  1Y8G A;  2H5X A;  2BWB A;  1BVS A;  1GO5 A;  3K9O A;  1E94 E;  1OQY A;  1VEG A;  2OOA A;  2QHO B;  3MMP A;  1G41 A;  2HAK A;  2JY7 A;  3B89 A;  3GLH E;  1A5T A;  2DAG A;  3T6P A;  1DO0 A;  3GLF E;  2JUJ A;  1MN3 A;  1TR8 A;  2KHH A;  2OOB A;  2JNH A;  2MR9 A;  1ZMU A;  2JY5 A;  2KNV A;  1IM2 A;  2QSF X;  4Q7J A;  2JZ1 A;  1Q02 A;  1TTE A;  1WR1 B;  2LVN C;  2WZJ A;  4GEW A;  2DEN A;  2MGW A;  1ZMW A;  2DHY A;  2R0I A;  1T6O A;  1XB2 B;  2L4F A;  2LTU A;  1VEK A;  2JY6 B;  1AIP C;  2DNA A;  2DAI A;  3BBZ A;  1OKS A;  1ZMV A;  2DAK A;  1IFY A;  2KNA A;  4R71 A;  1V92 A;  4DBG B;  1JR3 E;  1EFU B;  1NV9 A;  2K0B X;  3F92 A;  4F2L A;  1HT1 E;  1F4I A;  1HQY E;  2DAM A;  3LCV B;  3H4J A;  1WHC A;  1HT2 E;  2CP8 A;  2DKL A;  1WJ7 A;  3FRI A;  1OTR A;  2B3T A;  1VDL A;  2DI0 A;  1G4A E;  2ZTC A;  2G3Q A;  1WIV A;  3IEC A;  2MRO B;  1OAI A;  1VQ1 A;  3IHP A;  1YLA A;  1IXS A;  2LVA A;  5DFL A;  3K9P A;  4HEO A;  1R4G A;  2LVP C;  1PGY A;  3FE3 A;  2EKK A;  2EKF A;  4G3O A;  2ZTD A;  2DAE A;  2LVO C;  1WGL A;  1UFZ A;  2QNJ A;  1HJP A;  1DO2 A;  2K9D A;  3E46 A;  3FRH A;  1C7Y A;  1QZE A;  1ZV1 A;  2JP7 A;  3GLI E;  3E21 A;  4WP2 A;  2MJ5 B;  1G3I A;  5JI2 E;  4UN2 B;  1VG5 A;  1T43 A;  2L2D A;  2O25 A;  1DV0 A;  1CUK A;  2DZL A;  1NV8 A;  4F1I A;  2JY8 A;  2EJS A;  3GLG E;  2HWJ A;  2KNZ A;  1VEJ A;  2JZ0 A;  1WGN A;  1KYI A;  2LVQ D;  2RRU A;  1XXH E;  3LCU A;  2BWE A;  2CWB A;  2LBC A;  1P3Q Q; 
#chains in the Genus database with same CATH topology
 1Z5B A;  2L4E A;  1SG9 A;  4AQY M;  5IRE B;  2H5X A;  2BWB A;  5FTJ A;  3FUW A;  3VKH A;  1BVS A;  1E94 E;  1VEG A;  1ZQ9 A;  2CHQ A;  3U61 A;  2J7N A;  2JWS A;  7CAT A;  1G41 A;  3B89 A;  1QDT A;  4M9Z A;  3GLH E;  1E9R A;  2DAG A;  3B7N A;  1DO0 A;  2XLJ A;  1QUT A;  1MN3 A;  4OW0 A;  3VDP A;  5DYG A;  1OIZ A;  2FS1 A;  4TUW A;  4W5W A;  1OIP A;  2JZ1 A;  2D7G A;  1TTE A;  1N32 M;  2WZJ A;  4ZPX A;  4GEW A;  4JV5 M;  1NNU C;  2DEN A;  4M9S A;  3GQ3 A;  3SYL A;  2DHY A;  3J2P B;  2ZM6 M;  4FW9 A;  1IN5 A;  4IBK A;  2LTU A;  4LJ9 A;  4G4Q A;  2CV1 A;  2HHH M;  4JI8 M;  4LFC M;  1AIP C;  2HL7 A;  5C18 A;  4NRV A;  3DA1 A;  4DV5 M;  5EXT A;  1QAQ A;  1E32 A;  2RGO A;  3R9X B;  3SMS A;  3KVW A;  3ZCB B;  5FSW A;  1XMQ M;  5KPZ A;  3SAV A;  2HKJ A;  2DZN B;  2KNA A;  3A42 A;  4GIT A;  5EXS A;  4R71 A;  3PVS A;  4YY3 M;  1W5S A;  1XWI A;  2J7O A;  3I51 A;  5JI3 E;  1KSF X;  1JR3 E;  2C96 A;  5A2Q S;  1EFU B;  1L1T A;  3FTF A;  3FYD A;  1HQY E;  4MGY E;  3C58 A;  3RE8 A;  1IXS B;  5FTN A;  4DV6 M;  3SMP A;  4HLQ A;  4ANR A;  4NXN M;  1HQC A;  1NY6 A;  4FD2 A;  3QAU A;  3PNV A;  3LQQ A;  3ILK A;  4LJ7 A;  3TWK A;  4DR5 M;  2D7H A;  4KOD A;  2B3T A;  4DR4 M;  2RKO A;  3KS4 A;  1DGF A;  5BR8 M;  2O01 F;  4B7H A;  3SBJ A;  1J09 A;  1IXR C;  1GKI A;  5EP4 A;  3VLF B;  4CIZ A;  5ITR A;  2DZO B;  2VQE M;  3K92 A;  4FVM A;  1NO1 A;  3WHL A;  3SAS A;  3A45 A;  3IHP A;  4LZJ A;  4D82 A;  5KPT A;  3EIE A;  2CEA A;  2D7E A;  4L78 A;  1IXS A;  2LVA A;  4NSR A;  3E4R A;  2YQZ A;  3AOG A;  2EKF A;  4G3O A;  4PDG A;  1Q3B A;  4MGH A;  1WGL A;  4B7F A;  2F5S A;  2Q2E B;  1HJP A;  2Z7J A;  4D81 A;  1HR0 M;  1TF0 B;  5ITT A;  1N78 A;  3E46 A;  1N36 M;  1W5T A;  1Q3C A;  2C5R A;  2GQF A;  1YSY A;  2R18 A;  1QDR A;  1SXJ C;  4G4O A;  4AKI A;  3KP0 E;  3GLI E;  2LNH C;  2MJ5 B;  3NWL A;  2BJW A;  1I4W A;  4LRT A;  8CAT A;  3JR5 A;  1MX0 A;  2ZAN A;  4RKU F;  2V6Z M;  2M60 A;  2VII A;  1VG5 A;  1SXJ E;  1T43 A;  5KPR A;  1DV0 A;  4X64 M;  3LW5 F;  4A3V B;  2Z8Y M;  4Z8X A;  3W0F A;  1IBK M;  4F1I A;  4PDI A;  1XNQ M;  3GQ4 A;  2HWJ A;  3HKP A;  1NJF A;  1QAO A;  5GKN A;  1VEJ A;  3GLI B;  3R8F A;  4L6V 6;  1T3T A;  3M6A A;  3LVW A;  3OTO M;  2LVQ D;  2RRU A;  1J5E M;  4Y28 F;  3FUU A;  1JQJ C;  1XXH E;  1DGG A;  3B7Z A;  3QYB A;  3L29 A;  1IBL M;  1P3Q Q;  2C98 A;  2OO9 A;  3PXG A;  1PJQ A;  4MGI E;  3UZU A;  4X65 M;  3VK7 A;  3KOZ E;  1GO5 A;  3I4Y A;  4RF0 A;  1OQY A;  2YNM D;  1J7K A;  4RF1 A;  3VKG A;  3IG8 A;  4NL4 H;  3GO8 A;  2XSZ A;  3MMP A;  4DV1 M;  3HY5 A;  5FTM A;  3J7A S;  2V1U A;  4KHP M;  4L15 A;  1A5T A;  1XXH B;  4AKH A;  5F3W A;  1V34 A;  2JUJ A;  4BLC A;  5BPV A;  1TR8 A;  5E6J A;  4S12 A;  3GLI A;  3U6D A;  2OOB A;  2JNH A;  4Z6Y A;  2A5Y B;  4G6Z A;  4B08 A;  3U6Q A;  1ZMU A;  3GRV A;  1PM5 A;  1N77 A;  2LWX A;  3RGS A;  3SAT A;  1XNR M;  1GJS A;  2Y0T A;  4LJ4 A;  2DHR A;  3GP1 A;  2QSF X;  4XGI A;  2X8A A;  2K6B A;  1PJS A;  1KFV A;  2LXE A;  2N35 A;  3QYE A;  1D2N A;  2R4E A;  2MGW A;  1JB0 F;  1GL7 A;  4L16 A;  1FNN A;  3M0E A;  4GHA A;  2EO2 A;  2R0I A;  1T6O A;  3KXE C;  4P16 A;  2KW0 A;  2L4F A;  2JY6 B;  1QQW A;  2DWL A;  5H37 D;  1XXH A;  2FNA A;  2G8L A;  3HHW A;  1S3S A;  2QQ8 A;  3KOW E;  1H6U A;  2C99 A;  3UK6 A;  4MGK E;  1Q39 A;  3GPP A;  3KS8 A;  1GL6 A;  2DAI A;  5EP1 A;  3BBZ A;  1OKS A;  2WSF F;  3QWL A;  2VQF M;  4LJ5 A;  3NBI A;  4I81 A;  3MJ5 A;  4EIW A;  1V92 A;  4NOO B;  4QNM A;  2VDB B;  4DR7 M;  2C9O A;  1Z5A A;  3AJI B;  4IBI A;  4ITQ A;  1IQP A;  4I8O A;  2DAM A;  3SFZ A;  3H4J A;  1IBM M;  1HT2 E;  2EUC A;  1FJG M;  4M0W A;  3U60 B;  2V1C A;  3TWM A;  1PRB A;  1WJ7 A;  3KOY E;  4QHS A;  3FRI A;  4XK8 F;  3T15 A;  5FTL A;  3GPY A;  4QOZ C;  2HCB A;  3CF0 A;  1V33 A;  3PNY A;  1N33 M;  1NY5 A;  5ITQ A;  1XC8 A;  1XMO M;  1VDL A;  4DV4 M;  3W67 A;  2DI0 A;  2ZTC A;  3SHG B;  1ORY B;  2LHG A;  4CHT B;  3B74 A;  3IEC A;  4IBG A;  2LH0 A;  4DR6 M;  1VQ1 A;  4GH9 A;  3U6L A;  4CIS A;  4JXJ A;  1N75 A;  2UUB M;  4JI6 M;  2M5Z A;  3GPX A;  1AUA A;  4HEO A;  4LJ6 A;  2NQ8 C;  1R4G A;  2LVP C;  3U60 A;  2F5Q A;  2EKK A;  3TQS A;  4DR3 M;  2XFS A;  5EP3 A;  1UFZ A;  5E26 A;  4LF7 M;  1IY1 A;  1D0K A;  2R65 A;  4M9X A;  4I4L A;  2AHM A;  3EIH A;  3THG A;  3TE6 A;  4B7G A;  3FKE A;  5FLX S;  4LGM A;  4LJA A;  2Y21 A;  1C7Y A;  1G8P A;  4NSO B;  1ZV1 A;  4OVZ B;  3I4V A;  3SYK A;  3AKZ A;  2XH9 A;  3E21 A;  4WP2 A;  2XZF A;  1K82 A;  3GRR A;  1JR3 D;  3KW6 A;  2UXD M;  2X49 A;  3KDS E;  2X4A A;  4GRI A;  1Z59 A;  1HNX M;  1L2D A;  3KSJ A;  2CV0 A;  1CUK A;  4PT5 A;  4JI1 M;  2VF7 A;  2JY8 A;  2F5O A;  1LV7 A;  2KNZ A;  1VDD A;  4DV3 M;  2MH8 A;  4IBE A;  3KOX E;  2ZAO A;  3UGJ A;  3LCU A;  4AW4 A;  2BWE A;  2L09 A;  4OVZ A;  2LBC A;  2ZAM A;  2KA6 B;  2UU9 M;  4QNR A;  4LFA M;  3B7Q A;  3W68 A;  4PCZ A;  2DVW B;  4G4N A;  1TH2 A;  3SC3 A;  3AOE C;  2F5P A;  4BB9 A;  2QHO B;  1NHG C;  2C9C A;  3CTW B;  2BJV A;  2HAK A;  2JY7 A;  3CF2 A;  3HJQ A;  5ITU A;  2FE8 A;  3GLF E;  2E5L M;  1NJG A;  3I04 M;  2R46 A;  4B3S M;  2ZBK B;  4LFB M;  1YUB A;  3SAW A;  3TL4 X;  4GKK M;  2KHH A;  1Z6T A;  2MR9 A;  4DV7 M;  4LG2 A;  1Z5C A;  1QAN A;  4DR2 M;  3DFZ A;  2QEN A;  1IM2 A;  4QHT A;  3PFI A;  5L8R F;  2UXB M;  4LY6 A;  4P17 A;  3GLF B;  3BXW A;  3V76 A;  1NVM A;  1ZMW A;  3RGP A;  3FUV A;  2UUA M;  1OAO C;  2R44 A;  1K3W A;  1VEK A;  2L7I A;  1SXJ D;  2DNA A;  5EXX A;  1IN7 A;  5ITX A;  4LCB A;  3AV0 A;  1ZMV A;  4DV0 M;  3VFD A;  4LF6 M;  5ITY A;  1IY2 A;  1HNZ M;  2KEB A;  1TGU A;  2UXC M;  2DXI A;  4DR1 M;  3GLF A;  3LVV A;  1NV9 A;  4IBF A;  3J80 S;  3FTE A;  4AI6 A;  3AOE A;  2R45 A;  4F2L A;  1E9S A;  3ZC7 B;  4B3T M;  4GC9 A;  4KT0 F;  1X37 A;  2DKL A;  4FWG A;  4K0K M;  3J27 B;  4FCV A;  1IN4 A;  3VK8 A;  3A46 A;  2DWM A;  1R2Z A;  3TPZ A;  1TH4 A;  3HU3 A;  4GKJ M;  3LQR A;  1QVR A;  1K3X A;  2YFQ A;  4CGY B;  2H1R A;  1OAI A;  3T1Y M;  1PJI A;  3HX3 A;  2QBY B;  1YLA A;  4I5S A;  5IZ7 D;  2XZU A;  2R4J A;  2XFT A;  5DFL A;  3AFH A;  3K9P A;  1MU5 A;  1OJL A;  3FE3 A;  4X66 M;  4X62 M;  1PJJ A;  3SAU A;  2XEP A;  1DGH B;  4BBA A;  4GC5 A;  3KSX A;  2CE7 A;  4FCT A;  5C1B A;  4REZ A;  1DO2 A;  4MM3 B;  3CGW A;  3DOA A;  3FYC A;  3HHX A;  2K9D A;  4M0D A;  4DUZ M;  3GLG B;  4JI0 M;  4NXM M;  3H4M A;  3W0L B;  1IXZ A;  2J5Y A;  3K2L A;  1GLN A;  3FRH A;  4DUY M;  1QZE A;  2JP7 A;  4WW0 A;  3U6S A;  3VDU A;  2QBY A;  1MJG M;  1XHB A;  4LF5 M;  2EA0 A;  3U5Z B;  3J7B A;  4OU7 A;  2L6O A;  5JI2 E;  3HHZ A;  4LF4 M;  2L2D A;  3FD9 A;  1G71 A;  2CUZ A;  5EXP A;  5DYI A;  2DZL A;  1QUS A;  1NV8 A;  3LMM A;  1PJT A;  1DGH A;  2Z4R A;  2QPA A;  3CF6 E;  2JZ0 A;  1WGN A;  1NHW C;  2Y0Q A;  4DV2 M;  4HL4 A;  1R5L A;  3GLH B;  4II7 A;  3GLG A;  1TDZ A;  5KO3 A;  3A98 B;  2CWB A;  4OX9 M;  4MGZ E;  1GVN A;  1Y8G A;  2Z3X A;  5IT9 S;  3K1J A;  2FFJ A;  2K47 A;  3U5Z A;  2APL A;  3K9O A;  2OOA A;  1N34 M;  4YHH M;  3C3E A;  1EIJ A;  1GAB A;  3HU1 A;  4AG5 A;  1R2Y A;  3FTC A;  1WXQ A;  3C3D A;  4AG6 A;  4GHL A;  2I7N A;  3T6P A;  2ERC A;  3GQ5 A;  2I7P A;  1QYR A;  4IBD A;  4CJ6 A;  2QZ4 A;  3C9P A;  3M7G A;  4PD2 A;  2GNO A;  2R62 A;  2JY5 A;  1QZM A;  3GLH A;  4RNA A;  4L8R C;  2KNV A;  1R7R A;  2FOI C;  4LZZ A;  5EJC A;  2XGN A;  2XF3 A;  4Q7J A;  4IBJ A;  5IWA M;  1Q02 A;  3L26 A;  2DWN A;  1HNW M;  1WR1 B;  2LVN C;  3HHY A;  2KZU A;  3MK6 A;  4LRS A;  1C1K A;  1G59 A;  4NRW A;  3I01 M;  2UUC M;  1L1Z A;  2KDL A;  1XB2 B;  5ITX E;  1QAM A;  2KRU A;  3NBX X;  2F4V M;  3L28 A;  4AZF A;  2QCU A;  5LMU M;  4FWD A;  1I94 M;  3JR4 A;  4GIP A;  2WSE F;  3TWL A;  3U6P A;  3SAR A;  1LTM A;  4FCW A;  1IY0 A;  2KZS A;  3L27 A;  3HGI A;  4JI3 M;  4LF9 M;  2DAK A;  2Y20 A;  1IFY A;  4JN6 A;  3AL0 C;  3U6O A;  3UJN A;  4NC6 A;  3SHF A;  4FWH A;  1ZAE A;  2JA2 A;  1GJT A;  3J81 S;  4DBG B;  4QOS A;  2BNK A;  2K0B X;  3UMM A;  3F92 A;  3K8Z A;  4IJE A;  3U6C A;  1HT1 E;  1F4I A;  3KFU G;  2WSC F;  1D0M A;  2P5T A;  2XSZ D;  1JR3 A;  3LCV B;  3U6E A;  4GMQ A;  5EP2 A;  2R6F A;  1WHC A;  3Q8G A;  2CP8 A;  1D0L A;  4L4U A;  5FTK A;  4R7G A;  3HU2 A;  4LF8 M;  3GRY A;  3HJ8 A;  4IBB A;  4JI7 M;  1OTR A;  1EE8 A;  5KQ8 A;  4B3R M;  2VF8 A;  5KQD A;  2LHC A;  3FUX A;  1TH3 A;  2O5R A;  1G4A E;  1OFH A;  1WIV A;  2G3Q A;  4G4R A;  4MB7 A;  3IG5 A;  2MRO B;  4JI5 M;  3HZJ A;  2CRU A;  2KXE A;  4KO8 A;  2OPF A;  1L2B A;  3JAM S;  4D80 A;  2CHV A;  3D8L A;  4XBO A;  2CHG A;  1L8Q A;  3ZQJ A;  1PGY A;  4B3M M;  3B9P A;  5DNY A;  2ZTD A;  2DAE A;  3RFW A;  2L7H A;  2LVO C;  3BOS A;  2CV2 A;  3HJS A;  1SXJ B;  4LGY A;  2QNJ A;  3U6M A;  4KLN A;  3L25 A;  1L2C A;  3T38 A;  2QP9 X;  1NSF A;  3DZD A;  2OQ4 A;  4JYA M;  3KP1 E;  3FUT A;  4JI2 M;  4MH0 E;  4LJ8 A;  5EQT A;  2JXN A;  4IBC A;  2W82 A;  1RU3 A;  3T1H M;  2KRK A;  1R6B X;  1G3I A;  1IN8 A;  1UM8 A;  4WUR A;  3Q8X A;  2FH0 A;  4UN2 B;  4AKG A;  4IIW A;  3ZH9 B;  2O25 A;  3U61 B;  1TDH A;  1OFI A;  3FTD A;  1DGB A;  3D8B A;  2EJS A;  4JI4 M;  3GLG E;  4R3D A;  1SXJ A;  3E9S A;  1KYI A;  2YR0 A;  2G5G X;  3L2A A;  2Z4S A;  3MHV C;  1YE9 A;  3WHK A;  1NNJ A;  3GPU A;  2CFO A;  3HWS A;  5LMN M;  2F5N A;  2RGH A;  3GRU A;  4IJF A;  1IN6 A;  2DWZ B; 
#chains in the Genus database with same CATH homology
 2L4E A;  2OO9 A;  1SG9 A;  1Y8G A;  2H5X A;  2BWB A;  1BVS A;  1GO5 A;  3K9O A;  1E94 E;  1OQY A;  1VEG A;  2OOA A;  2QHO B;  3MMP A;  1G41 A;  2HAK A;  2JY7 A;  3B89 A;  3GLH E;  1A5T A;  2DAG A;  3T6P A;  1DO0 A;  3GLF E;  2JUJ A;  1MN3 A;  1TR8 A;  2KHH A;  2OOB A;  2JNH A;  2MR9 A;  1ZMU A;  2JY5 A;  2KNV A;  1IM2 A;  2QSF X;  4Q7J A;  2JZ1 A;  1Q02 A;  1TTE A;  1WR1 B;  2LVN C;  2WZJ A;  4GEW A;  2DEN A;  2MGW A;  1ZMW A;  2DHY A;  2R0I A;  1T6O A;  1XB2 B;  2L4F A;  2LTU A;  1VEK A;  2JY6 B;  1AIP C;  2DNA A;  2DAI A;  3BBZ A;  1OKS A;  1ZMV A;  2DAK A;  1IFY A;  2KNA A;  4R71 A;  1V92 A;  4DBG B;  1JR3 E;  1EFU B;  1NV9 A;  2K0B X;  3F92 A;  4F2L A;  1HT1 E;  1F4I A;  1HQY E;  2DAM A;  3LCV B;  3H4J A;  1WHC A;  1HT2 E;  2CP8 A;  2DKL A;  1WJ7 A;  3FRI A;  1OTR A;  2B3T A;  1VDL A;  2DI0 A;  1G4A E;  2ZTC A;  2G3Q A;  1WIV A;  3IEC A;  2MRO B;  1OAI A;  1VQ1 A;  3IHP A;  1YLA A;  1IXS A;  2LVA A;  5DFL A;  3K9P A;  4HEO A;  1R4G A;  2LVP C;  1PGY A;  3FE3 A;  2EKK A;  2EKF A;  4G3O A;  2ZTD A;  2DAE A;  2LVO C;  1WGL A;  1UFZ A;  2QNJ A;  1HJP A;  1DO2 A;  2K9D A;  3E46 A;  3FRH A;  1C7Y A;  1QZE A;  1ZV1 A;  2JP7 A;  3GLI E;  3E21 A;  4WP2 A;  2MJ5 B;  1G3I A;  5JI2 E;  4UN2 B;  1VG5 A;  1T43 A;  2L2D A;  2O25 A;  1DV0 A;  1CUK A;  2DZL A;  1NV8 A;  4F1I A;  2JY8 A;  2EJS A;  3GLG E;  2HWJ A;  2KNZ A;  1VEJ A;  2JZ0 A;  1WGN A;  1KYI A;  2LVQ D;  2RRU A;  1XXH E;  3LCU A;  2BWE A;  2CWB A;  2LBC A;  1P3Q Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...