2CP8A

Solution structure of the rsgi ruh-046, a uba domain from human next to brca1 gene 1 protein (kiaa0049 protein) r923h variant
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
GSSGSSGQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Next to BRCA1 gene 1 protein
total genus 9
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2cp8A00
2K9DA 1PGYA 1T6OA 1WHCA 2JP7A 3LCUA 2DI0A 2HWJA 1E94E 1HQYE 1NV8A 1V92A 2CP8A 1VEJA 2B3TA 1VG5A 4UN2B 2HAKA 3T6PA 5JI2E 2JZ1A 2EKFA 1G4AE 3LCVB 1VEGA 2ZTDA 2EJSA 3FE3A 1EFUB 2WZJA 1TTEA 4DBGB 1OAIA 2LVOC 2O25A 2QSFX 2L4EA 3K9PA 3IECA 2EKKA 1DO2A 1Y8GA 1HT2E 4G3OA 2OO9A 2JY6B 1OQYA 1OTRA 2BWEA 2JY7A 2KHHA 4HEOA 1F4IA 4GEWA 2MR9A 2DZLA 2ZTCA 2OOBA 1YLAA 3GLHE 3GLIE 3E46A 2R0IA 2L4FA 2KNZA 1IXSA 1VDLA 1UFZA 2BWBA 4F2LA 1A5TA 1HT1E 3IHPA 1AIPC 2DAEA 2QHOB 1ZMUA 2JY5A 2KNAA 4F1IA 1WIVA 3FRIA 3K9OA 1IFYA 3FRHA 2MJ5B 2MROB 1WGLA 2LVNC 1BVSA 1HJPA 3E21A 1KYIA 3GLFE 2OOAA 2DENA 1NV9A 4Q7JA 1JR3E 3F92A 5DFLA 1XB2B 2DKLA 1OKSA 1WGNA 2H5XA 1CUKA 1QZEA 3BBZA 1DV0A 1IM2A 2JNHA 2JZ0A 2LTUA 1ZMWA 2MGWA 2LVQD 2JUJA 1WJ7A 3H4JA 1VEKA 2DAIA 1Q02A 2K0BX 1XXHE 1C7YA 1DO0A 1SG9A 3B89A 2KNVA 2CWBA 1VQ1A 2DNAA 2L2DA 1WR1B 3MMPA 4WP2A 1G3IA 4R71A 2DAMA 1R4GA 2DAGA 2QNJA 1TR8A 2LVPC 2DHYA 2JY8A 1P3QQ 2RRUA 1GO5A 1ZV1A 1MN3A 2DAKA 1ZMVA 1T43A 2LVAA 3GLGE 1G41A 2G3QA 2LBCA
chains in the Genus database with same CATH superfamily
1Q3BA 1NVMA 1PGYA 4FCTA 1WHCA 3WHLA 2DI0A 3QWLA 3U61A 1NV8A 1SXJA 1GVNA 1VEJA 2B3TA 1IY0A 2DHRA 4JXJA 3T1YM 1VG5A 3W68A 4JI1M 4UN2B 1JR3A 2F4VM 4L6V6 1TDHA 2HAKA 2X49A 4LRTA 4GC5A 2JZ1A 4IBDA 3QYEA 4NL4H 3T6PA 3TWKA 5JI2E 3HWSA 3J81S 4MGHA 4YHHM 3RFWA 1G4AE 4LZJA 1MX0A 5C1BA 3Q8GA 1K3XA 2K6BA 2O01F 4LJAA 3TQSA 1QDRA 1TH2A 3FTEA 4DBGB 4DR3M 2F5QA 2QSFX 5E26A 2FS1A 2L4EA 3FUTA 4PDGA 3UGJA 2UUBM 3U6QA 3BXWA 5KQ8A 1N33M 2N35A 2QPAA 1EE8A 1QYRA 3PNYA 2C9CA 4B3TM 7CATA 2DWMA 4DV6M 3SFZA 5FSWA 3SBJA 1OQYA 2C98A 1SXJE 1L1TA 4HL4A 2E5LM 3GLFA 1G8PA 2OQ4A 2KHHA 1PJJA 2CE7A 1QZMA 3IG5A 4G4RA 1C1KA 2MR9A 1NSFA 4QNMA 2KZSA 4NRWA 1JR3D 4FVMA 2UUAM 4GH9A 4EIWA 1Z5CA 3WHKA 3GLGA 3U60B 2I7NA 3GLIE 1D0KA 1OIPA 1KSFX 2L4FA 1HT1E 1H6UA 3HHWA 4L4UA 1YE9A 1ZMUA 1Q39A 2FE8A 4M0WA 3GQ3A 2KNAA 4F1IA 3TWMA 2KEBA 3K9OA 4WURA 2QCUA 2GQFA 5FTJA 3SAUA 2C96A 2KRUA 2MJ5B 4LF6M 1IXZA 1D0MA 1QAMA 1QQWA 2A5YB 5LMUM 4DV7M 4G4QA 3KXEC 4MGIE 2LVNC 5EXTA 3I4VA 5A2QS 1R6BX 2CFOA 2ZBKB 3FUVA 4DR2M 1KYIA 1Z59A 3HJ8A 2CHQA 3VK7A 2G8LA 5BR8M 3J2PB 2J5YA 1HR0M 1VDDA 4PD2A 2FH0A 4IIWA 3F92A 1LTMA 2VF8A 2DKLA 3C3EA 3L29A 1UM8A 5EQTA 3PFIA 2JXNA 2JZ0A 2KA6B 3B7NA 3SARA 4NXNM 4DR1M 1IBKM 1VEKA 1W5TA 3Q8XA 3C3DA 2K0BX 1NNJA 1N36M 1L8QA 1DO0A 4II7A 3I4YA 2X8AA 4CHTB 2CWBA 1VQ1A 3GRVA 1FNNA 3R8FA 2EO2A 1QVRA 1PJQA 1OIZA 2LHCA 3M6AA 5ITQA 3GQ4A 1YSYA 2R45A 1G3IA 1Z5AA 4DR6M 4IBEA 4I81A 3U6MA 1R4GA 2DAGA 2QNJA 3GLFB 2VQEM 2LVPC 1TF0B 1T3TA 4DR4M 1D0LA 2BNKA 3AOEC 3U5ZB 3RGPA 1Q3CA 1V33A 2WSEF 1ZV1A 3EIEA 1XWIA 1IN7A 1ZMVA 2DAKA 3IG8A 3MHVC 3HHXA 3PNVA 3SYLA 4BBAA 3K8ZA 1JB0F 1PJIA 3TE6A 1N75A 1DGHB 4IBJA 4PDIA 3KFUG 2M60A 1HNWM 2UXDM 4I8OA 4QHTA 2F5NA 1T6OA 3U6EA 3KS4A 4LFCM 2JP7A 5FTKA 3VK8A 2QP9X 1NJFA 1PJTA 3A46A 1SXJC 3LVVA 2M5ZA 3A45A 2Y20A 1NHWC 3L2AA 2Q2EB 3KOYE 2G5GX 3AV0A 1TGUA 4GC9A 4OW0A 2JWSA 5ITRA 4KHPM 2EKFA 1V34A 2BJVA 2CHVA 3VLFB 1NNUC 1VEGA 3B7ZA 5EP2A 3FE3A 2XZFA 4AI6A 2YR0A 2LVOC 2DWZB 2HCBA 2V1CA 4CIZA 5ITXA 3UZUA 4PT5A 2QQ8A 4FCWA 3HU3A 1PRBA 3AKZA 4AG6A 3IECA 3UJNA 1ORYB 2EKKA 1DO2A 3KOWE 4XGIA 2XEPA 4GITA 2CV1A 2JY6B 3LVWA 4B7HA 3U6CA 3SATA 1GABA 1HNXM 4GHAA 2VQFM 1F4IA 3W67A 2Z7JA 1NHGC 3GLHB 4LF8M 4GEWA 1J09A 3SC3A 2CV0A 4NC6A 2DZLA 4FW9A 4JI2M 3GLHE 1TH4A 3AOGA 3LQRA 2R0IA 2QBYB 2KDLA 3RGSA 2KNZA 1UFZA 3IHPA 3R9XB 1Z6TA 2L09A 4FCVA 4WW0A 2DAEA 2R6FA 3GRYA 4D81A 3JR4A 5KPTA 5EXXA 2CV2A 3SASA 3L28A 3U6PA 3FRIA 1IFYA 3K2LA 2CHGA 5ITXE 2ZAOA 1WGLA 2XFTA 2UU9M 3GLGB 2O5RA 1HJPA 1WXQA 3CGWA 1K82A 3KOZE 3THGA 3U5ZA 1R2YA 5JI3E 3GLFE 4NRVA 5ITTA 4QOSA 4W5WA 3C9PA 3HJSA 1IN4A 1NV9A 4Q7JA 5KPZA 5DFLA 2F5SA 4LF9M 4LJ8A 2H5XA 1QZEA 3HKPA 1IY2A 2CRUA 1DV0A 1IM2A 2JNHA 3CF6E 4KO8A 2QENA 3JAMS 3T1HM 4G4NA 2MGWA 2J7OA 4GKJM 3T15A 3H4JA 2L6OA 4XK8F 2DAIA 2XGNA 4DUYM 2CEAA 1ZAEA 1Q02A 1XHBA 4D82A 3SMSA 2ZM6M 3GPYA 4JI6M 1N34M 1NY5A 2P5TA 3PVSA 4CISA 2EUCA 2L7IA 4AG5A 3SMPA 4AQYM 1KFVA 1L1ZA 4P16A 4IBIA 2XSZA 3VKHA 4GKKM 4WP2A 3LW5F 4RNAA 4R71A 2APLA 2WSFF 5EXSA 4L8RC 3K92A 4X64M 4JYAM 3ZCBB 1SXJD 3HJQA 2DHYA 5EP4A 1N78A 5DYGA 2R46A 4R7GA 2LWXA 1MN3A 5FLXS 1T43A 3U61B 2XLJA 1G41A 4RF0A 3KW6A 1GLNA 4IBKA 1IBLM 5H37D 2G3QA 2K9DA 3UK6A 1J7KA 2KRKA 3LCUA 3DA1A 1L2BA 2HWJA 3L25A 1HQYE 1V92A 1W5SA 3HU1A 3U6OA 3SAVA 4GHLA 3GLGE 3TPZA 1R5LA 3VDUA 4LJ5A 3K1JA 5DYIA 2MH8A 3MK6A 2HHHM 4L16A 5C18A 3LCVB 1XXHA 5GKNA 3AL0C 4RKUF 2EJSA 2LNHC 3GRUA 4L78A 4X62M 4CGYB 2XZUA 4JV5M 2R44A 3KP0E 4LY6A 3OTOM 1TH3A 1R2ZA 2HKJA 4ANRA 4DUZM 5KPRA 3KSXA 3FYCA 4B3RM 2K47A 3K9PA 4DV5M 4BB9A 3VFDA 3GO8A 2R62A 2LXEA 1L2DA 5EP3A 5IT9S 3GP1A 5F3WA 4D80A 1K3WA 3AFHA 3A42A 4CJ6A 2R65A 3PXGA 3GLHA 4Z8XA 2R4EA 4S12A 3SHGB 4LFAM 2YQZA 3LMMA 4HEOA 3C58A 1R7RA 4KT0F 4DR7M 3TWLA 1IN6A 3CF0A 4A3VB 4B7FA 4IBCA 3QYBA 4NSOB 5ITUA 2OOBA 1YLAA 2DWNA 3E46A 3EIHA 4AKIA 5FTLA 1XMQM 1VDLA 3HHYA 4MGZE 1SXJB 3GPPA 2Y0TA 2QHOB 3AJIB 3KOXE 2JY5A 3M7GA 1J5EM 4KLNA 1X37A 1QUSA 1WIVA 3TL4X 3FRHA 2Y0QA 2MROB 1DGBA 1QAQA 3FUUA 1DGHA 4GMQA 1BVSA 4B7GA 4MH0E 3E21A 4ZPXA 4B3SM 2OOAA 2WSCF 2VDBB 3HY5A 1XMOM 4TUWA 1GL7A 3KSJA 2H1RA 4FWDA 4BLCA 4YY3M 5LMNM 2YFQA 1MJGM 3BOSA 3W0LB 1XB2B 1E9RA 2R4JA 3A98B 3FYDA 1OKSA 1WGNA 3M0EA 4LJ6A 4LF7M 1E9SA 3BBZA 4LF4M 3FUXA 1XXHB 3D8LA 4DR5M 2LTUA 5FTMA 3FTCA 2FFJA 3J7AS 3J7BA 1WJ7A 4JI3M 4G4OA 2CUZA 1QUTA 4X66M 3J80S 3I51A 3VKGA 4JI7M 2LHGA 4I4LA 3KP1E 1C7YA 3HX3A 3B89A 3DFZA 4LGMA 4DV0M 2D7EA 2KXEA 4LJ4A 3I04M 2EA0A 3CTWB 3MMPA 3ZC7B 4JI5M 1IXRC 4OU7A 4AZFA 2DAMA 2R18A 1OFIA 3LQQA 5L8RF 4LJ7A 2F5PA 2JY8A 2Y21A 2XF3A 4LF5M 4K0KM 3DOAA 3GLIA 1P3QQ 2ZANA 5KQDA 2XFSA 1N32M 1JQJC 3KDSE 4MGYE 2Z4SA 4LGYA 2LBCA 2L7HA 3GRRA 3L27A 4FD2A 1HQCA 1OAOC 2ZAMA 2W82A 5KO3A 2QBYA 2KW0A 4GRIA 2ERCA 2XH9A 2YNMD 1E94E 1IN8A 2CP8A 4M0DA 4MB7A 1LV7A 3HGIA 3FD9A 2FNAA 4RF1A 1GJTA 4IBBA 4X65M 4DV2M 1XNQM 1GL6A 4IJFA 1G71A 5EP1A 4B08A 4LJ9A 1MU5A 1GKIA 3FKEA 1OFHA 3GPXA 3U6DA 1NJGA 4IBGA 2DVWB 4R3DA 4KODA 3VDPA 2VF7A 4M9XA 4Y28F 2ZTDA 1XNRM 1EFUB 2WZJA 1TTEA 1YUBA 4FWHA 1OAIA 2O25A 4LRSA 4AKGA 5EXPA 3L26A 4NSRA 5IWAM 3DZDA 4OVZB 3B7QA 4IBFA 3U60A 1Y8GA 1HT2E 3HHZA 4B3MM 4NXMM 1NY6A 3NBXX 4G3OA 2JA2A 2OO9A 4G6ZA 3CF2A 1L2CA 1I94M 3SAWA 3B74A 1OTRA 3HU2A 3ZH9B 4Z6YA 2Z8YM 4MGKE 2BWEA 1S3SA 2JY7A 1HNZM 1QDTA 3KVWA 1N77A 2X4AA 4JN6A 3H4MA 1IQPA 5EJCA 4LCBA 2UXCM 2V1UA 1FJGM 4M9ZA 4ITQA 3GPUA 2OPFA 2ZTCA 5DNYA 1XC8A 3JR5A 3NWLA 3HZJA 4M9SA 4PCZA 4JI8M 1IXSA 4F2LA 2BWBA 2C9OA 3U6LA 1A5TA 1AIPC 2V6ZM 2DWLA 4FWGA 1IBMM 3UMMA 2RGHA 3SHFA 2UXBM 4OVZA 1IY1A 1OJLA 4GIPA 2RGOA 1RU3A 1PM5A 1D2NA 2LH0A 5IREB 4DV4M 3FTFA 4MM3B 1G59A 2FOIC 4QNRA 3GLIB 2C5RA 5BPVA 4LZZA 3ZQJA 3W0FA 4XBOA 1GJSA 2J7NA 1TDZA 2C99A 2DENA 3E4RA 4AW4A 2BJWA 3SYKA 2D7HA 4I5SA 2DXIA 3B9PA 3T38A 1DGGA 1JR3E 2NQ8C 2QZ4A 2VIIA 3E9SA 3FUWA 2UUCM 3V76A 5ITYA 5IZ7D 3U6SA 1E32A 2F5OA 4REZA 1CUKA 2D7GA 1IXSB 4HLQA 2XSZD 1NO1A 1ZMWA 2GNOA 3J27B 2LVQD 2JUJA 4L15A 3MJ5A 2KZUA 2Z4RA 1QAOA 1ZQ9A 4IJEA 3NBIA 5FTNA 1XXHE 4QOZC 4LG2A 1SG9A 2RKOA 1PJSA 4LFBM 4NOOB 2KNVA 1Z5BA 1AUAA 5E6JA 3RE8A 3QAUA 2DNAA 2L2DA 1WR1B 8CATA 4OX9M 1EIJA 3FTDA 2DZOB 1IN5A 4QHSA 1TR8A 2I7PA 3AOEA 4DV1M 1QANA 2DZNB 3GQ5A 4P17A 4DV3M 2RRUA 3KS8A 3I01M 3D8BA 3ILKA 2HL7A 2LVAA 1GO5A 1I4WA 4JI0M 4AKHA 4JI4M 2AHMA 1DGFA 2Z3XA
chains in the Genus database with same CATH topology
2K9DA 1PGYA 1T6OA 1WHCA 2JP7A 3LCUA 2DI0A 2HWJA 1E94E 1HQYE 1NV8A 1V92A 2CP8A 1VEJA 2B3TA 1VG5A 4UN2B 2HAKA 3T6PA 5JI2E 2JZ1A 2EKFA 1G4AE 3LCVB 1VEGA 2ZTDA 2EJSA 3FE3A 1EFUB 2WZJA 1TTEA 4DBGB 1OAIA 2LVOC 2O25A 2QSFX 2L4EA 3K9PA 3IECA 2EKKA 1DO2A 1Y8GA 1HT2E 4G3OA 2OO9A 2JY6B 1OQYA 1OTRA 2BWEA 2JY7A 2KHHA 4HEOA 1F4IA 4GEWA 2MR9A 2DZLA 2ZTCA 2OOBA 1YLAA 3GLHE 3GLIE 3E46A 2R0IA 2L4FA 2KNZA 1IXSA 1VDLA 1UFZA 2BWBA 4F2LA 1A5TA 1HT1E 3IHPA 1AIPC 2DAEA 2QHOB 1ZMUA 2JY5A 2KNAA 4F1IA 1WIVA 3FRIA 3K9OA 1IFYA 3FRHA 2MJ5B 2MROB 1WGLA 2LVNC 1BVSA 1HJPA 3E21A 1KYIA 3GLFE 2OOAA 2DENA 1NV9A 4Q7JA 1JR3E 3F92A 5DFLA 1XB2B 2DKLA 1OKSA 1WGNA 2H5XA 1CUKA 1QZEA 3BBZA 1DV0A 1IM2A 2JNHA 2JZ0A 2LTUA 1ZMWA 2MGWA 2LVQD 2JUJA 1WJ7A 3H4JA 1VEKA 2DAIA 1Q02A 2K0BX 1XXHE 1C7YA 1DO0A 1SG9A 3B89A 2KNVA 2CWBA 1VQ1A 2DNAA 2L2DA 1WR1B 3MMPA 4WP2A 1G3IA 4R71A 2DAMA 1R4GA 2DAGA 2QNJA 1TR8A 2LVPC 2DHYA 2JY8A 1P3QQ 2RRUA 1GO5A 1ZV1A 1MN3A 2DAKA 1ZMVA 1T43A 2LVAA 3GLGE 1G41A 2G3QA 2LBCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K9D A;  1PGY A;  1T6O A;  1WHC A;  2JP7 A;  3LCU A;  2DI0 A;  2HWJ A;  1E94 E;  1HQY E;  1NV8 A;  1V92 A;  2CP8 A;  1VEJ A;  2B3T A;  1VG5 A;  4UN2 B;  2HAK A;  3T6P A;  5JI2 E;  2JZ1 A;  2EKF A;  1G4A E;  3LCV B;  1VEG A;  2ZTD A;  2EJS A;  3FE3 A;  1EFU B;  2WZJ A;  1TTE A;  4DBG B;  1OAI A;  2LVO C;  2O25 A;  2QSF X;  2L4E A;  3K9P A;  3IEC A;  2EKK A;  1DO2 A;  1Y8G A;  1HT2 E;  4G3O A;  2OO9 A;  2JY6 B;  1OQY A;  1OTR A;  2BWE A;  2JY7 A;  2KHH A;  4HEO A;  1F4I A;  4GEW A;  2MR9 A;  2DZL A;  2ZTC A;  2OOB A;  1YLA A;  3GLH E;  3GLI E;  3E46 A;  2R0I A;  2L4F A;  2KNZ A;  1IXS A;  1VDL A;  1UFZ A;  2BWB A;  4F2L A;  1A5T A;  1HT1 E;  3IHP A;  1AIP C;  2DAE A;  2QHO B;  1ZMU A;  2JY5 A;  2KNA A;  4F1I A;  1WIV A;  3FRI A;  3K9O A;  1IFY A;  3FRH A;  2MJ5 B;  2MRO B;  1WGL A;  2LVN C;  1BVS A;  1HJP A;  3E21 A;  1KYI A;  3GLF E;  2OOA A;  2DEN A;  1NV9 A;  4Q7J A;  1JR3 E;  3F92 A;  5DFL A;  1XB2 B;  2DKL A;  1OKS A;  1WGN A;  2H5X A;  1CUK A;  1QZE A;  3BBZ A;  1DV0 A;  1IM2 A;  2JNH A;  2JZ0 A;  2LTU A;  1ZMW A;  2MGW A;  2LVQ D;  2JUJ A;  1WJ7 A;  3H4J A;  1VEK A;  2DAI A;  1Q02 A;  2K0B X;  1XXH E;  1C7Y A;  1DO0 A;  1SG9 A;  3B89 A;  2KNV A;  2CWB A;  1VQ1 A;  2DNA A;  2L2D A;  1WR1 B;  3MMP A;  4WP2 A;  1G3I A;  4R71 A;  2DAM A;  1R4G A;  2DAG A;  2QNJ A;  1TR8 A;  2LVP C;  2DHY A;  2JY8 A;  1P3Q Q;  2RRU A;  1GO5 A;  1ZV1 A;  1MN3 A;  2DAK A;  1ZMV A;  1T43 A;  2LVA A;  3GLG E;  1G41 A;  2G3Q A;  2LBC A; 
#chains in the Genus database with same CATH topology
 1Q3B A;  1NVM A;  1PGY A;  4FCT A;  1WHC A;  3WHL A;  2DI0 A;  3QWL A;  3U61 A;  1NV8 A;  1SXJ A;  1GVN A;  1VEJ A;  2B3T A;  1IY0 A;  2DHR A;  4JXJ A;  3T1Y M;  1VG5 A;  3W68 A;  4JI1 M;  4UN2 B;  1JR3 A;  2F4V M;  4L6V 6;  1TDH A;  2HAK A;  2X49 A;  4LRT A;  4GC5 A;  2JZ1 A;  4IBD A;  3QYE A;  4NL4 H;  3T6P A;  3TWK A;  5JI2 E;  3HWS A;  3J81 S;  4MGH A;  4YHH M;  3RFW A;  1G4A E;  4LZJ A;  1MX0 A;  5C1B A;  3Q8G A;  1K3X A;  2K6B A;  2O01 F;  4LJA A;  3TQS A;  1QDR A;  1TH2 A;  3FTE A;  4DBG B;  4DR3 M;  2F5Q A;  2QSF X;  5E26 A;  2FS1 A;  2L4E A;  3FUT A;  4PDG A;  3UGJ A;  2UUB M;  3U6Q A;  3BXW A;  5KQ8 A;  1N33 M;  2N35 A;  2QPA A;  1EE8 A;  1QYR A;  3PNY A;  2C9C A;  4B3T M;  7CAT A;  2DWM A;  4DV6 M;  3SFZ A;  5FSW A;  3SBJ A;  1OQY A;  2C98 A;  1SXJ E;  1L1T A;  4HL4 A;  2E5L M;  3GLF A;  1G8P A;  2OQ4 A;  2KHH A;  1PJJ A;  2CE7 A;  1QZM A;  3IG5 A;  4G4R A;  1C1K A;  2MR9 A;  1NSF A;  4QNM A;  2KZS A;  4NRW A;  1JR3 D;  4FVM A;  2UUA M;  4GH9 A;  4EIW A;  1Z5C A;  3WHK A;  3GLG A;  3U60 B;  2I7N A;  3GLI E;  1D0K A;  1OIP A;  1KSF X;  2L4F A;  1HT1 E;  1H6U A;  3HHW A;  4L4U A;  1YE9 A;  1ZMU A;  1Q39 A;  2FE8 A;  4M0W A;  3GQ3 A;  2KNA A;  4F1I A;  3TWM A;  2KEB A;  3K9O A;  4WUR A;  2QCU A;  2GQF A;  5FTJ A;  3SAU A;  2C96 A;  2KRU A;  2MJ5 B;  4LF6 M;  1IXZ A;  1D0M A;  1QAM A;  1QQW A;  2A5Y B;  5LMU M;  4DV7 M;  4G4Q A;  3KXE C;  4MGI E;  2LVN C;  5EXT A;  3I4V A;  5A2Q S;  1R6B X;  2CFO A;  2ZBK B;  3FUV A;  4DR2 M;  1KYI A;  1Z59 A;  3HJ8 A;  2CHQ A;  3VK7 A;  2G8L A;  5BR8 M;  3J2P B;  2J5Y A;  1HR0 M;  1VDD A;  4PD2 A;  2FH0 A;  4IIW A;  3F92 A;  1LTM A;  2VF8 A;  2DKL A;  3C3E A;  3L29 A;  1UM8 A;  5EQT A;  3PFI A;  2JXN A;  2JZ0 A;  2KA6 B;  3B7N A;  3SAR A;  4NXN M;  4DR1 M;  1IBK M;  1VEK A;  1W5T A;  3Q8X A;  3C3D A;  2K0B X;  1NNJ A;  1N36 M;  1L8Q A;  1DO0 A;  4II7 A;  3I4Y A;  2X8A A;  4CHT B;  2CWB A;  1VQ1 A;  3GRV A;  1FNN A;  3R8F A;  2EO2 A;  1QVR A;  1PJQ A;  1OIZ A;  2LHC A;  3M6A A;  5ITQ A;  3GQ4 A;  1YSY A;  2R45 A;  1G3I A;  1Z5A A;  4DR6 M;  4IBE A;  4I81 A;  3U6M A;  1R4G A;  2DAG A;  2QNJ A;  3GLF B;  2VQE M;  2LVP C;  1TF0 B;  1T3T A;  4DR4 M;  1D0L A;  2BNK A;  3AOE C;  3U5Z B;  3RGP A;  1Q3C A;  1V33 A;  2WSE F;  1ZV1 A;  3EIE A;  1XWI A;  1IN7 A;  1ZMV A;  2DAK A;  3IG8 A;  3MHV C;  3HHX A;  3PNV A;  3SYL A;  4BBA A;  3K8Z A;  1JB0 F;  1PJI A;  3TE6 A;  1N75 A;  1DGH B;  4IBJ A;  4PDI A;  3KFU G;  2M60 A;  1HNW M;  2UXD M;  4I8O A;  4QHT A;  2F5N A;  1T6O A;  3U6E A;  3KS4 A;  4LFC M;  2JP7 A;  5FTK A;  3VK8 A;  2QP9 X;  1NJF A;  1PJT A;  3A46 A;  1SXJ C;  3LVV A;  2M5Z A;  3A45 A;  2Y20 A;  1NHW C;  3L2A A;  2Q2E B;  3KOY E;  2G5G X;  3AV0 A;  1TGU A;  4GC9 A;  4OW0 A;  2JWS A;  5ITR A;  4KHP M;  2EKF A;  1V34 A;  2BJV A;  2CHV A;  3VLF B;  1NNU C;  1VEG A;  3B7Z A;  5EP2 A;  3FE3 A;  2XZF A;  4AI6 A;  2YR0 A;  2LVO C;  2DWZ B;  2HCB A;  2V1C A;  4CIZ A;  5ITX A;  3UZU A;  4PT5 A;  2QQ8 A;  4FCW A;  3HU3 A;  1PRB A;  3AKZ A;  4AG6 A;  3IEC A;  3UJN A;  1ORY B;  2EKK A;  1DO2 A;  3KOW E;  4XGI A;  2XEP A;  4GIT A;  2CV1 A;  2JY6 B;  3LVW A;  4B7H A;  3U6C A;  3SAT A;  1GAB A;  1HNX M;  4GHA A;  2VQF M;  1F4I A;  3W67 A;  2Z7J A;  1NHG C;  3GLH B;  4LF8 M;  4GEW A;  1J09 A;  3SC3 A;  2CV0 A;  4NC6 A;  2DZL A;  4FW9 A;  4JI2 M;  3GLH E;  1TH4 A;  3AOG A;  3LQR A;  2R0I A;  2QBY B;  2KDL A;  3RGS A;  2KNZ A;  1UFZ A;  3IHP A;  3R9X B;  1Z6T A;  2L09 A;  4FCV A;  4WW0 A;  2DAE A;  2R6F A;  3GRY A;  4D81 A;  3JR4 A;  5KPT A;  5EXX A;  2CV2 A;  3SAS A;  3L28 A;  3U6P A;  3FRI A;  1IFY A;  3K2L A;  2CHG A;  5ITX E;  2ZAO A;  1WGL A;  2XFT A;  2UU9 M;  3GLG B;  2O5R A;  1HJP A;  1WXQ A;  3CGW A;  1K82 A;  3KOZ E;  3THG A;  3U5Z A;  1R2Y A;  5JI3 E;  3GLF E;  4NRV A;  5ITT A;  4QOS A;  4W5W A;  3C9P A;  3HJS A;  1IN4 A;  1NV9 A;  4Q7J A;  5KPZ A;  5DFL A;  2F5S A;  4LF9 M;  4LJ8 A;  2H5X A;  1QZE A;  3HKP A;  1IY2 A;  2CRU A;  1DV0 A;  1IM2 A;  2JNH A;  3CF6 E;  4KO8 A;  2QEN A;  3JAM S;  3T1H M;  4G4N A;  2MGW A;  2J7O A;  4GKJ M;  3T15 A;  3H4J A;  2L6O A;  4XK8 F;  2DAI A;  2XGN A;  4DUY M;  2CEA A;  1ZAE A;  1Q02 A;  1XHB A;  4D82 A;  3SMS A;  2ZM6 M;  3GPY A;  4JI6 M;  1N34 M;  1NY5 A;  2P5T A;  3PVS A;  4CIS A;  2EUC A;  2L7I A;  4AG5 A;  3SMP A;  4AQY M;  1KFV A;  1L1Z A;  4P16 A;  4IBI A;  2XSZ A;  3VKH A;  4GKK M;  4WP2 A;  3LW5 F;  4RNA A;  4R71 A;  2APL A;  2WSF F;  5EXS A;  4L8R C;  3K92 A;  4X64 M;  4JYA M;  3ZCB B;  1SXJ D;  3HJQ A;  2DHY A;  5EP4 A;  1N78 A;  5DYG A;  2R46 A;  4R7G A;  2LWX A;  1MN3 A;  5FLX S;  1T43 A;  3U61 B;  2XLJ A;  1G41 A;  4RF0 A;  3KW6 A;  1GLN A;  4IBK A;  1IBL M;  5H37 D;  2G3Q A;  2K9D A;  3UK6 A;  1J7K A;  2KRK A;  3LCU A;  3DA1 A;  1L2B A;  2HWJ A;  3L25 A;  1HQY E;  1V92 A;  1W5S A;  3HU1 A;  3U6O A;  3SAV A;  4GHL A;  3GLG E;  3TPZ A;  1R5L A;  3VDU A;  4LJ5 A;  3K1J A;  5DYI A;  2MH8 A;  3MK6 A;  2HHH M;  4L16 A;  5C18 A;  3LCV B;  1XXH A;  5GKN A;  3AL0 C;  4RKU F;  2EJS A;  2LNH C;  3GRU A;  4L78 A;  4X62 M;  4CGY B;  2XZU A;  4JV5 M;  2R44 A;  3KP0 E;  4LY6 A;  3OTO M;  1TH3 A;  1R2Z A;  2HKJ A;  4ANR A;  4DUZ M;  5KPR A;  3KSX A;  3FYC A;  4B3R M;  2K47 A;  3K9P A;  4DV5 M;  4BB9 A;  3VFD A;  3GO8 A;  2R62 A;  2LXE A;  1L2D A;  5EP3 A;  5IT9 S;  3GP1 A;  5F3W A;  4D80 A;  1K3W A;  3AFH A;  3A42 A;  4CJ6 A;  2R65 A;  3PXG A;  3GLH A;  4Z8X A;  2R4E A;  4S12 A;  3SHG B;  4LFA M;  2YQZ A;  3LMM A;  4HEO A;  3C58 A;  1R7R A;  4KT0 F;  4DR7 M;  3TWL A;  1IN6 A;  3CF0 A;  4A3V B;  4B7F A;  4IBC A;  3QYB A;  4NSO B;  5ITU A;  2OOB A;  1YLA A;  2DWN A;  3E46 A;  3EIH A;  4AKI A;  5FTL A;  1XMQ M;  1VDL A;  3HHY A;  4MGZ E;  1SXJ B;  3GPP A;  2Y0T A;  2QHO B;  3AJI B;  3KOX E;  2JY5 A;  3M7G A;  1J5E M;  4KLN A;  1X37 A;  1QUS A;  1WIV A;  3TL4 X;  3FRH A;  2Y0Q A;  2MRO B;  1DGB A;  1QAQ A;  3FUU A;  1DGH A;  4GMQ A;  1BVS A;  4B7G A;  4MH0 E;  3E21 A;  4ZPX A;  4B3S M;  2OOA A;  2WSC F;  2VDB B;  3HY5 A;  1XMO M;  4TUW A;  1GL7 A;  3KSJ A;  2H1R A;  4FWD A;  4BLC A;  4YY3 M;  5LMN M;  2YFQ A;  1MJG M;  3BOS A;  3W0L B;  1XB2 B;  1E9R A;  2R4J A;  3A98 B;  3FYD A;  1OKS A;  1WGN A;  3M0E A;  4LJ6 A;  4LF7 M;  1E9S A;  3BBZ A;  4LF4 M;  3FUX A;  1XXH B;  3D8L A;  4DR5 M;  2LTU A;  5FTM A;  3FTC A;  2FFJ A;  3J7A S;  3J7B A;  1WJ7 A;  4JI3 M;  4G4O A;  2CUZ A;  1QUT A;  4X66 M;  3J80 S;  3I51 A;  3VKG A;  4JI7 M;  2LHG A;  4I4L A;  3KP1 E;  1C7Y A;  3HX3 A;  3B89 A;  3DFZ A;  4LGM A;  4DV0 M;  2D7E A;  2KXE A;  4LJ4 A;  3I04 M;  2EA0 A;  3CTW B;  3MMP A;  3ZC7 B;  4JI5 M;  1IXR C;  4OU7 A;  4AZF A;  2DAM A;  2R18 A;  1OFI A;  3LQQ A;  5L8R F;  4LJ7 A;  2F5P A;  2JY8 A;  2Y21 A;  2XF3 A;  4LF5 M;  4K0K M;  3DOA A;  3GLI A;  1P3Q Q;  2ZAN A;  5KQD A;  2XFS A;  1N32 M;  1JQJ C;  3KDS E;  4MGY E;  2Z4S A;  4LGY A;  2LBC A;  2L7H A;  3GRR A;  3L27 A;  4FD2 A;  1HQC A;  1OAO C;  2ZAM A;  2W82 A;  5KO3 A;  2QBY A;  2KW0 A;  4GRI A;  2ERC A;  2XH9 A;  2YNM D;  1E94 E;  1IN8 A;  2CP8 A;  4M0D A;  4MB7 A;  1LV7 A;  3HGI A;  3FD9 A;  2FNA A;  4RF1 A;  1GJT A;  4IBB A;  4X65 M;  4DV2 M;  1XNQ M;  1GL6 A;  4IJF A;  1G71 A;  5EP1 A;  4B08 A;  4LJ9 A;  1MU5 A;  1GKI A;  3FKE A;  1OFH A;  3GPX A;  3U6D A;  1NJG A;  4IBG A;  2DVW B;  4R3D A;  4KOD A;  3VDP A;  2VF7 A;  4M9X A;  4Y28 F;  2ZTD A;  1XNR M;  1EFU B;  2WZJ A;  1TTE A;  1YUB A;  4FWH A;  1OAI A;  2O25 A;  4LRS A;  4AKG A;  5EXP A;  3L26 A;  4NSR A;  5IWA M;  3DZD A;  4OVZ B;  3B7Q A;  4IBF A;  3U60 A;  1Y8G A;  1HT2 E;  3HHZ A;  4B3M M;  4NXM M;  1NY6 A;  3NBX X;  4G3O A;  2JA2 A;  2OO9 A;  4G6Z A;  3CF2 A;  1L2C A;  1I94 M;  3SAW A;  3B74 A;  1OTR A;  3HU2 A;  3ZH9 B;  4Z6Y A;  2Z8Y M;  4MGK E;  2BWE A;  1S3S A;  2JY7 A;  1HNZ M;  1QDT A;  3KVW A;  1N77 A;  2X4A A;  4JN6 A;  3H4M A;  1IQP A;  5EJC A;  4LCB A;  2UXC M;  2V1U A;  1FJG M;  4M9Z A;  4ITQ A;  3GPU A;  2OPF A;  2ZTC A;  5DNY A;  1XC8 A;  3JR5 A;  3NWL A;  3HZJ A;  4M9S A;  4PCZ A;  4JI8 M;  1IXS A;  4F2L A;  2BWB A;  2C9O A;  3U6L A;  1A5T A;  1AIP C;  2V6Z M;  2DWL A;  4FWG A;  1IBM M;  3UMM A;  2RGH A;  3SHF A;  2UXB M;  4OVZ A;  1IY1 A;  1OJL A;  4GIP A;  2RGO A;  1RU3 A;  1PM5 A;  1D2N A;  2LH0 A;  5IRE B;  4DV4 M;  3FTF A;  4MM3 B;  1G59 A;  2FOI C;  4QNR A;  3GLI B;  2C5R A;  5BPV A;  4LZZ A;  3ZQJ A;  3W0F A;  4XBO A;  1GJS A;  2J7N A;  1TDZ A;  2C99 A;  2DEN A;  3E4R A;  4AW4 A;  2BJW A;  3SYK A;  2D7H A;  4I5S A;  2DXI A;  3B9P A;  3T38 A;  1DGG A;  1JR3 E;  2NQ8 C;  2QZ4 A;  2VII A;  3E9S A;  3FUW A;  2UUC M;  3V76 A;  5ITY A;  5IZ7 D;  3U6S A;  1E32 A;  2F5O A;  4REZ A;  1CUK A;  2D7G A;  1IXS B;  4HLQ A;  2XSZ D;  1NO1 A;  1ZMW A;  2GNO A;  3J27 B;  2LVQ D;  2JUJ A;  4L15 A;  3MJ5 A;  2KZU A;  2Z4R A;  1QAO A;  1ZQ9 A;  4IJE A;  3NBI A;  5FTN A;  1XXH E;  4QOZ C;  4LG2 A;  1SG9 A;  2RKO A;  1PJS A;  4LFB M;  4NOO B;  2KNV A;  1Z5B A;  1AUA A;  5E6J A;  3RE8 A;  3QAU A;  2DNA A;  2L2D A;  1WR1 B;  8CAT A;  4OX9 M;  1EIJ A;  3FTD A;  2DZO B;  1IN5 A;  4QHS A;  1TR8 A;  2I7P A;  3AOE A;  4DV1 M;  1QAN A;  2DZN B;  3GQ5 A;  4P17 A;  4DV3 M;  2RRU A;  3KS8 A;  3I01 M;  3D8B A;  3ILK A;  2HL7 A;  2LVA A;  1GO5 A;  1I4W A;  4JI0 M;  4AKH A;  4JI4 M;  2AHM A;  1DGF A;  2Z3X A; 
#chains in the Genus database with same CATH homology
 2K9D A;  1PGY A;  1T6O A;  1WHC A;  2JP7 A;  3LCU A;  2DI0 A;  2HWJ A;  1E94 E;  1HQY E;  1NV8 A;  1V92 A;  2CP8 A;  1VEJ A;  2B3T A;  1VG5 A;  4UN2 B;  2HAK A;  3T6P A;  5JI2 E;  2JZ1 A;  2EKF A;  1G4A E;  3LCV B;  1VEG A;  2ZTD A;  2EJS A;  3FE3 A;  1EFU B;  2WZJ A;  1TTE A;  4DBG B;  1OAI A;  2LVO C;  2O25 A;  2QSF X;  2L4E A;  3K9P A;  3IEC A;  2EKK A;  1DO2 A;  1Y8G A;  1HT2 E;  4G3O A;  2OO9 A;  2JY6 B;  1OQY A;  1OTR A;  2BWE A;  2JY7 A;  2KHH A;  4HEO A;  1F4I A;  4GEW A;  2MR9 A;  2DZL A;  2ZTC A;  2OOB A;  1YLA A;  3GLH E;  3GLI E;  3E46 A;  2R0I A;  2L4F A;  2KNZ A;  1IXS A;  1VDL A;  1UFZ A;  2BWB A;  4F2L A;  1A5T A;  1HT1 E;  3IHP A;  1AIP C;  2DAE A;  2QHO B;  1ZMU A;  2JY5 A;  2KNA A;  4F1I A;  1WIV A;  3FRI A;  3K9O A;  1IFY A;  3FRH A;  2MJ5 B;  2MRO B;  1WGL A;  2LVN C;  1BVS A;  1HJP A;  3E21 A;  1KYI A;  3GLF E;  2OOA A;  2DEN A;  1NV9 A;  4Q7J A;  1JR3 E;  3F92 A;  5DFL A;  1XB2 B;  2DKL A;  1OKS A;  1WGN A;  2H5X A;  1CUK A;  1QZE A;  3BBZ A;  1DV0 A;  1IM2 A;  2JNH A;  2JZ0 A;  2LTU A;  1ZMW A;  2MGW A;  2LVQ D;  2JUJ A;  1WJ7 A;  3H4J A;  1VEK A;  2DAI A;  1Q02 A;  2K0B X;  1XXH E;  1C7Y A;  1DO0 A;  1SG9 A;  3B89 A;  2KNV A;  2CWB A;  1VQ1 A;  2DNA A;  2L2D A;  1WR1 B;  3MMP A;  4WP2 A;  1G3I A;  4R71 A;  2DAM A;  1R4G A;  2DAG A;  2QNJ A;  1TR8 A;  2LVP C;  2DHY A;  2JY8 A;  1P3Q Q;  2RRU A;  1GO5 A;  1ZV1 A;  1MN3 A;  2DAK A;  1ZMV A;  1T43 A;  2LVA A;  3GLG E;  1G41 A;  2G3Q A;  2LBC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...