2CP8A

Solution structure of the rsgi ruh-046, a uba domain from human next to brca1 gene 1 protein (kiaa0049 protein) r923h variant
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
GSSGSSGQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Next to BRCA1 gene 1 protein
publication title Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant
rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 9
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2cp8A00
2DZLA 1XXHE 1SG9A 2LVPC 2MJ5B 3GLHE 2JZ1A 1UFZA 2JY5A 1G3IA 3MMPA 2RRUA 2DI0A 2CP8A 3BBZA 5JI2E 2ZTDA 1AIPC 1A5TA 3FE3A 4UN2B 1NV9A 2ZTCA 2LBCA 2EJSA 4F1IA 2JY8A 1F4IA 2DAIA 1CUKA 3K9OA 1XB2B 2WZJA 4R71A 2JNHA 3K9PA 2DAKA 4WP2A 1P3QQ 1NV8A 1VDLA 1YLAA 1BVSA 2JZ0A 2G3QA 1OAIA 2BWEA 2MGWA 3H4JA 1VQ1A 1T6OA 1HJPA 2KNVA 2L2DA 3F92A 1VEGA 1HT2E 2KNAA 1JR3E 1T43A 2EKFA 1C7YA 2MROB 2MR9A 1DV0A 1VG5A 1EFUB 2JUJA 1E94E 1OKSA 1WGNA 1ZMWA 1ZMVA 3T6PA 1WR1B 1Q02A 1OQYA 2K9DA 2O25A 2OO9A 3E21A 3FRIA 1ZV1A 2DAMA 1IXSA 2DENA 3B89A 1HT1E 2R0IA 1WIVA 2DHYA 2JP7A 2DNAA 1TR8A 4HEOA 2HAKA 1OTRA 4DBGB 4GEWA 2L4FA 1R4GA 1ZMUA 3GLFE 3IHPA 2LVNC 2OOAA 3FRHA 1V92A 1G41A 2QNJA 2KHHA 1Y8GA 2BWBA 2B3TA 2JY6B 2LVQD 4G3OA 1HQYE 3E46A 2DAGA 2OOBA 2K0BX 2QHOB 1WGLA 2H5XA 1G4AE 2EKKA 5DFLA 3LCUA 1DO2A 2HWJA 2DKLA 2QSFX 1VEJA 1TTEA 2DAEA 3GLGE 3GLIE 3IECA 2LVAA 3LCVB 2L4EA 1KYIA 1WJ7A 2CWBA 2LTUA 1MN3A 1QZEA 2LVOC 1IFYA 1VEKA 1GO5A 1WHCA 1IM2A 1DO0A 1PGYA 2JY7A 4F2LA 2KNZA 4Q7JA
chains in the Genus database with same CATH superfamily
2DZLA 2KZUA 3I4YA 3CF2A 4PDGA 3UGJA 4DV5M 4LFBM 2MJ5B 1YE9A 2JZ1A 2R4EA 5E6JA 5KQDA 4LF8M 3PNYA 4LZJA 5IZ7D 4QOZC 2QPAA 2HKJA 3GPUA 1L2BA 1L2DA 3MMPA 2CP8A 2DXIA 3KXEC 1OFHA 4NRVA 1SXJB 5EP4A 1AIPC 5ITRA 4UN2B 2ZTCA 5EXSA 5FTKA 1XMOM 2DAIA 4DR2M 3HWSA 3K9OA 2APLA 4AG5A 3PXGA 3SAWA 1OIZA 3U6QA 4WP2A 3SARA 3U6PA 1P3QQ 4B3TM 2CHVA 4QNRA 1WXQA 2K47A 2D7EA 1VDLA 2K6BA 1YLAA 1BVSA 1QYRA 2GNOA 1PJTA 2KRUA 4BLCA 3TWMA 4JI6M 3H4JA 5H37D 4WURA 4GKKM 1J09A 1PJSA 5EXTA 2MH8A 2FE8A 3J81S 3SAUA 1GLNA 3TWKA 2A5YB 5EXXA 3AV0A 3R9XB 4ZPXA 2DHRA 4L8RC 1T43A 1C7YA 4DR6M 1NJGA 1JR3D 1DV0A 1RU3A 1ORYB 4Y28F 3HJ8A 2P5TA 3BOSA 2I7NA 4MGYE 3U61B 1E94E 2QCUA 4JI1M 2C99A 3FTDA 1ZMVA 3T6PA 1NSFA 4EIWA 4M9ZA 3WHKA 2DWNA 1OQYA 2LHCA 4OW0A 3GPXA 3TQSA 2VF8A 2DAMA 2DZNB 1J7KA 2WSFF 5L8RF 3SASA 2UXBM 1IXZA 2EA0A 1IXRC 1WIVA 4IJFA 4IBKA 1N34M 2UUBM 2Z3XA 2G5GX 3D8LA 4NL4H 1XMQM 3HKPA 3KOZE 3L27A 4M0DA 3W0FA 4CGYB 4DUYM 3JR5A 5DNYA 1GJSA 1G71A 1QUSA 3BXWA 4G4QA 3PVSA 3RFWA 5ITYA 2AHMA 4CIZA 4IBJA 1K3WA 1V92A 1NO1A 2Y0TA 1IBKM 4DR1M 2BWBA 3QYEA 4G3OA 3VFDA 1LV7A 2C96A 2QP9X 4AW4A 7CATA 1SXJE 1WGLA 3GLFA 3U6SA 3UMMA 4JI7M 4LF7M 1G4AE 1R2ZA 5DFLA 1GL6A 3LCUA 4IBIA 2ZAOA 3ZH9B 3KP1E 1XHBA 4AQYM 2Z4SA 1AUAA 3GLGE 2DAEA 4PCZA 3JR4A 2X8AA 1L2CA 3C3DA 3J7AS 3HJQA 5ITXE 4M9XA 3OTOM 2I7PA 1GJTA 1KYIA 4DV1M 3GRVA 3FTFA 4IBGA 2CWBA 2LTUA 4LJ8A 2YFQA 1QZEA 1PM5A 1L1TA 2LVOC 2RGOA 3A46A 3LVWA 4G4OA 4JI2M 3KS8A 1IFYA 2EO2A 1E9SA 1GL7A 2KW0A 3AJIB 1PGYA 1L1ZA 4NRWA 1Z5BA 2V1CA 2XEPA 4P16A 1HQCA 2J5YA 3GLIB 3DA1A 3B7QA 4II7A 2XF3A 1DGFA 4FVMA 3T1YM 4RKUF 2F5QA 4GH9A 3MJ5A 1SG9A 3RGSA 2CFOA 4LJAA 4LGMA 1L8QA 3HHXA 1GKIA 3KOWE 2DWMA 5F3WA 4ITQA 2DWZB 1H6UA 2JY5A 2RKOA 3J27B 4NSOB 4IBFA 1MJGM 1QZMA 1IY2A 1D0KA 3NWLA 3HHYA 4AKIA 2ZTDA 2UU9M 1NJFA 1QQWA 1QAQA 3GLHA 3C3EA 1XXHB 1NV9A 2FS1A 3U6DA 1F4IA 4IBEA 2JY8A 5FTNA 3HU2A 2L6OA 3HU1A 4LRSA 2KZSA 2R62A 3L29A 1QDTA 5JI3E 4LJ6A 1TGUA 5DYIA 2HCBA 4BBAA 4DV7M 5BR8M 2XFSA 2JXNA 1UM8A 1NV8A 3T1HM 1K82A 4MGZE 3B74A 4L6V6 2G3QA 2BWEA 2MGWA 2Z8YM 1Q3BA 2KNVA 4DR5M 3U5ZA 3QWLA 2L2DA 3J7BA 4IBDA 4OVZA 3F92A 3KSJA 3WHLA 2F4VM 2KNAA 1HT2E 5GKNA 3NBXX 1QDRA 2ZBKB 3LVVA 1NHWC 3AFHA 1NNJA 3HHZA 4I4LA 4D82A 3GRUA 1N77A 1IN7A 1ZMWA 1WGNA 2L7IA 3U6CA 1HR0M 3AL0C 2RGHA 5EP2A 2K9DA 1MU5A 3FRIA 4GHLA 1ZV1A 4R3DA 1QAMA 4M9SA 4DR7M 2HHHM 3J2PB 4RNAA 2UXCM 3B89A 4X66M 1FJGM 2DHYA 4B7HA 1LTMA 2JP7A 2BJVA 2DNAA 5KPTA 1OTRA 4GIPA 4JI3M 4GEWA 4LRTA 1R4GA 3AOEC 2CUZA 2WSEF 2OQ4A 4OU7A 3LMMA 3GQ3A 3GLGA 1Q3CA 1YUBA 1Y8GA 5FTJA 4BB9A 5ITXA 4QOSA 2ERCA 3C58A 1HQYE 2CHQA 3B7ZA 5EJCA 8CATA 4YY3M 2KDLA 1G59A 2C9OA 1D0MA 1IQPA 3C9PA 4LJ7A 2E5LM 4GC5A 4XGIA 2QQ8A 3M6AA 2DWLA 2CV2A 4G4RA 2KRKA 1D0LA 2X4AA 5DYGA 4Z6YA 1Z6TA 2BJWA 1FNNA 1TDZA 2Y0QA 3KFUG 2HWJA 2M60A 1DGHA 2DKLA 2YR0A 4IIWA 3UZUA 3ZC7B 3SBJA 2QBYA 1TTEA 1N33M 3E4RA 1NVMA 2Z7JA 5FLXS 1EIJA 3GQ5A 1PJJA 3VLFB 1WJ7A 4IBCA 4JXJA 4LF9M 2LH0A 1KFVA 1G8PA 3RGPA 1GO5A 3TPZA 1XC8A 1DO0A 2CV1A 5KPZA 4F2LA 2KNZA 3J80S 1NY5A 2O01F 3ILKA 3MK6A 3FD9A 4LZZA 3CF0A 2R6FA 1SXJC 3V76A 3UJNA 2XZUA 4AKHA 2LVPC 3SMSA 4JYAM 4P17A 3GLFB 2LNHC 2LWXA 4IJEA 4REZA 3CGWA 1V34A 2QENA 2Z4RA 2V6ZM 4L78A 2J7OA 2XZFA 1G3IA 3FTCA 2UXDM 2RRUA 2DI0A 3QAUA 5ITTA 4JI5M 1QANA 3U60A 2XH9A 3FE3A 3VK7A 2LBCA 1K3XA 2EJSA 4F1IA 3I4VA 3A98B 2R18A 1CUKA 4MGIE 5EQTA 4D80A 4AKGA 2Q2EB 4DV4M 2WZJA 1JQJC 1PRBA 4R71A 2R44A 3M0EA 4YHHM 4FCWA 4CISA 3L2AA 1R2YA 3HHWA 2QZ4A 4MGKE 2YNMD 1HNZM 4ANRA 4X62M 4GKJM 1KSFX 3KOYE 3FKEA 3FYCA 3SAVA 4DV3M 2D7HA 5FSWA 3FTEA 2XGNA 2JZ0A 2KEBA 1NY6A 1OAIA 1R6BX 3IG8A 3U6LA 1DGGA 1ZAEA 1VQ1A 3SMPA 1GABA 2FH0A 3FUUA 2F5OA 4HL4A 3I04M 2M5ZA 3H4MA 2JWSA 1VEGA 2OPFA 1N32M 3EIHA 2DZOB 3A42A 3D8BA 1JR3E 2EKFA 2XSZD 4FWDA 4LFAM 4X65M 2YQZA 4LJ9A 3FUXA 2R65A 4JI0M 5IREB 3I01M 3GLHB 1EFUB 2JUJA 2H1RA 1OKSA 1N36M 1HNWM 4MB7A 3HX3A 1WR1B 1Q02A 3AOEA 5FTLA 2XSZA 5C1BA 4LGYA 2OO9A 3E21A 3LQQA 1ZQ9A 3Q8XA 4FW9A 4G6ZA 3SHGB 4KHPM 1IXSA 1IY1A 4LY6A 4B7FA 3TWLA 2UUAM 5A2QS 1IBLM 2C5RA 3SYKA 3HZJA 2ZM6M 1TR8A 2FFJA 4HEOA 4MH0E 4I8OA 4DR3M 2KXEA 3U5ZB 5IT9S 2VQFM 3GQ4A 4OVZB 3VKGA 3KW6A 4MM3B 3W68A 3B9PA 2F5SA 3GLFE 4DR4M 2LVNC 2OOAA 3VDUA 4KLNA 4LCBA 3PFIA 3FRHA 1OJLA 1QVRA 4KT0F 4QHSA 1G41A 2QNJA 2KHHA 4LJ4A 1PJQA 4A3VB 4X64M 2JY6B 4LF6M 3RE8A 1JB0F 4JI8M 1E32A 1DGBA 3E46A 1TH2A 2K0BX 2LHGA 4B08A 4TUWA 1SXJD 3DZDA 4GC9A 4RF0A 3PNVA 3THGA 4DV6M 3SC3A 4AI6A 4S12A 3GP1A 5LMNM 1IBMM 1DO2A 5BPVA 3VDPA 2VF7A 1V33A 3FUVA 1SXJA 1E9RA 3AKZA 3GLIE 1QAOA 3LCVB 3UK6A 2FNAA 1XNRM 4GHAA 1R7RA 1MN3A 3ZQJA 1OAOC 4AZFA 3T15A 3ZCBB 1WHCA 1W5TA 1TDHA 2CHGA 2JY7A 3GLGB 3HJSA 3K92A 3KVWA 3LQRA 1TH4A 1XXHE 3M7GA 1YSYA 3FUWA 3KOXE 4I81A 3GLHE 3L25A 2R4JA 1R5LA 3U6OA 1D2NA 1UFZA 2G8LA 3K1JA 3DFZA 4WW0A 4QNMA 3KDSE 2J7NA 4GMQA 3SATA 5JI2E 5IWAM 3BBZA 1XNQM 4NSRA 2O5RA 1DGHB 3L28A 2LXEA 4NC6A 2QBYB 3JAMS 3R8FA 1A5TA 5KQ8A 2HL7A 3Q8GA 3E9SA 4PDIA 3U61A 3KSXA 3QYBA 4DUZM 3GPPA 1MX0A 1W5SA 2W82A 2XLJA 4JI4M 4B3RM 3GRYA 1XB2B 3KP0E 4FCTA 4XBOA 2L7HA 1VDDA 3NBIA 4XK8F 3IG5A 2JNHA 1JR3A 1IN4A 3K9PA 1X37A 2DAKA 4LF5M 1Z5AA 1OIPA 2DVWB 4LFCM 2F5PA 3FYDA 3HU3A 4KO8A 4DV2M 4L4UA 1IY0A 4HLQA 2CRUA 1T6OA 1HJPA 4B7GA 4LG2A 3GO8A 3KS4A 3VKHA 2X49A 2C9CA 2ZANA 4FD2A 3L26A 3W67A 2CV0A 2C98A 1QUTA 4CHTB 2ZAMA 1N75A 2D7GA 1J5EM 1Q39A 2MROB 2MR9A 1OFIA 1VG5A 4D81A 3U60B 5EP1A 1PJIA 5KPRA 3EIEA 1TH3A 3GRRA 2UUCM 2O25A 4K0KM 1IN5A 4L16A 1GVNA 3A45A 4OX9M 3HY5A 2DENA 1NHGC 5C18A 2L09A 3FUTA 1HT1E 2VIIA 2R0IA 4LF4M 1IN6A 5KO3A 4KODA 2V1UA 4NOOB 3SYLA 4GRIA 2HAKA 4MGHA 5EXPA 3W0LB 3GPYA 4DBGB 3LW5F 1T3TA 2FOIC 4PT5A 1IN8A 2L4FA 2GQFA 4QHTA 4PD2A 4M0WA 1NNUC 5EP3A 3I51A 2WSCF 2XFTA 1ZMUA 1Z59A 3TL4X 3B7NA 2KA6B 3IHPA 5LMUM 4G4NA 4NXMM 4GITA 1S3SA 2EUCA 4LJ5A 3CF6E 3SFZA 3GLIA 2CEAA 1XWIA 3TE6A 2F5NA 2B3TA 2LVQD 4NXNM 3T38A 3VK8A 4B3MM 1I94M 2DAGA 2OOBA 2QHOB 3SHFA 2Y21A 3U6MA 2H5XA 4L15A 3DOAA 5E26A 2Y20A 5FTMA 2EKKA 3CTWB 4FCVA 2R46A 3K2LA 1I4WA 1IXSB 2CE7A 4Z8XA 4FWHA 2BNKA 2QSFX 3MHVC 1VEJA 3U6EA 1Z5CA 1XXHA 4CJ6A 3IECA 2LVAA 1TF0B 2L4EA 2NQ8C 3AOGA 2VQEM 1N78A 5ITQA 3HGIA 4RF1A 4IBBA 2JA2A 2R45A 2VDBB 5ITUA 2N35A 4W5WA 4AG6A 1VEKA 3K8ZA 1IM2A 4DV0M 1EE8A 4FWGA 4R7GA 1HNXM 4B3SM 4JN6A 4JV5M 4Q7JA 4I5SA 1C1KA
chains in the Genus database with same CATH topology
2DZLA 1XXHE 1SG9A 2LVPC 2MJ5B 3GLHE 2JZ1A 1UFZA 2JY5A 1G3IA 3MMPA 2RRUA 2DI0A 2CP8A 3BBZA 5JI2E 2ZTDA 1AIPC 1A5TA 3FE3A 4UN2B 1NV9A 2ZTCA 2LBCA 2EJSA 4F1IA 2JY8A 1F4IA 2DAIA 1CUKA 3K9OA 1XB2B 2WZJA 4R71A 2JNHA 3K9PA 2DAKA 4WP2A 1P3QQ 1NV8A 1VDLA 1YLAA 1BVSA 2JZ0A 2G3QA 1OAIA 2BWEA 2MGWA 3H4JA 1VQ1A 1T6OA 1HJPA 2KNVA 2L2DA 3F92A 1VEGA 1HT2E 2KNAA 1JR3E 1T43A 2EKFA 1C7YA 2MROB 2MR9A 1DV0A 1VG5A 1EFUB 2JUJA 1E94E 1OKSA 1WGNA 1ZMWA 1ZMVA 3T6PA 1WR1B 1Q02A 1OQYA 2K9DA 2O25A 2OO9A 3E21A 3FRIA 1ZV1A 2DAMA 1IXSA 2DENA 3B89A 1HT1E 2R0IA 1WIVA 2DHYA 2JP7A 2DNAA 1TR8A 4HEOA 2HAKA 1OTRA 4DBGB 4GEWA 2L4FA 1R4GA 1ZMUA 3GLFE 3IHPA 2LVNC 2OOAA 3FRHA 1V92A 1G41A 2QNJA 2KHHA 1Y8GA 2BWBA 2B3TA 2JY6B 2LVQD 4G3OA 1HQYE 3E46A 2DAGA 2OOBA 2K0BX 2QHOB 1WGLA 2H5XA 1G4AE 2EKKA 5DFLA 3LCUA 1DO2A 2HWJA 2DKLA 2QSFX 1VEJA 1TTEA 2DAEA 3GLGE 3GLIE 3IECA 2LVAA 3LCVB 2L4EA 1KYIA 1WJ7A 2CWBA 2LTUA 1MN3A 1QZEA 2LVOC 1IFYA 1VEKA 1GO5A 1WHCA 1IM2A 1DO0A 1PGYA 2JY7A 4F2LA 2KNZA 4Q7JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DZL A;  1XXH E;  1SG9 A;  2LVP C;  2MJ5 B;  3GLH E;  2JZ1 A;  1UFZ A;  2JY5 A;  1G3I A;  3MMP A;  2RRU A;  2DI0 A;  2CP8 A;  3BBZ A;  5JI2 E;  2ZTD A;  1AIP C;  1A5T A;  3FE3 A;  4UN2 B;  1NV9 A;  2ZTC A;  2LBC A;  2EJS A;  4F1I A;  2JY8 A;  1F4I A;  2DAI A;  1CUK A;  3K9O A;  1XB2 B;  2WZJ A;  4R71 A;  2JNH A;  3K9P A;  2DAK A;  4WP2 A;  1P3Q Q;  1NV8 A;  1VDL A;  1YLA A;  1BVS A;  2JZ0 A;  2G3Q A;  1OAI A;  2BWE A;  2MGW A;  3H4J A;  1VQ1 A;  1T6O A;  1HJP A;  2KNV A;  2L2D A;  3F92 A;  1VEG A;  1HT2 E;  2KNA A;  1JR3 E;  1T43 A;  2EKF A;  1C7Y A;  2MRO B;  2MR9 A;  1DV0 A;  1VG5 A;  1EFU B;  2JUJ A;  1E94 E;  1OKS A;  1WGN A;  1ZMW A;  1ZMV A;  3T6P A;  1WR1 B;  1Q02 A;  1OQY A;  2K9D A;  2O25 A;  2OO9 A;  3E21 A;  3FRI A;  1ZV1 A;  2DAM A;  1IXS A;  2DEN A;  3B89 A;  1HT1 E;  2R0I A;  1WIV A;  2DHY A;  2JP7 A;  2DNA A;  1TR8 A;  4HEO A;  2HAK A;  1OTR A;  4DBG B;  4GEW A;  2L4F A;  1R4G A;  1ZMU A;  3GLF E;  3IHP A;  2LVN C;  2OOA A;  3FRH A;  1V92 A;  1G41 A;  2QNJ A;  2KHH A;  1Y8G A;  2BWB A;  2B3T A;  2JY6 B;  2LVQ D;  4G3O A;  1HQY E;  3E46 A;  2DAG A;  2OOB A;  2K0B X;  2QHO B;  1WGL A;  2H5X A;  1G4A E;  2EKK A;  5DFL A;  3LCU A;  1DO2 A;  2HWJ A;  2DKL A;  2QSF X;  1VEJ A;  1TTE A;  2DAE A;  3GLG E;  3GLI E;  3IEC A;  2LVA A;  3LCV B;  2L4E A;  1KYI A;  1WJ7 A;  2CWB A;  2LTU A;  1MN3 A;  1QZE A;  2LVO C;  1IFY A;  1VEK A;  1GO5 A;  1WHC A;  1IM2 A;  1DO0 A;  1PGY A;  2JY7 A;  4F2L A;  2KNZ A;  4Q7J A; 
#chains in the Genus database with same CATH topology
 2DZL A;  2KZU A;  3I4Y A;  3CF2 A;  4PDG A;  3UGJ A;  4DV5 M;  4LFB M;  2MJ5 B;  1YE9 A;  2JZ1 A;  2R4E A;  5E6J A;  5KQD A;  4LF8 M;  3PNY A;  4LZJ A;  5IZ7 D;  4QOZ C;  2QPA A;  2HKJ A;  3GPU A;  1L2B A;  1L2D A;  3MMP A;  2CP8 A;  2DXI A;  3KXE C;  1OFH A;  4NRV A;  1SXJ B;  5EP4 A;  1AIP C;  5ITR A;  4UN2 B;  2ZTC A;  5EXS A;  5FTK A;  1XMO M;  2DAI A;  4DR2 M;  3HWS A;  3K9O A;  2APL A;  4AG5 A;  3PXG A;  3SAW A;  1OIZ A;  3U6Q A;  4WP2 A;  3SAR A;  3U6P A;  1P3Q Q;  4B3T M;  2CHV A;  4QNR A;  1WXQ A;  2K47 A;  2D7E A;  1VDL A;  2K6B A;  1YLA A;  1BVS A;  1QYR A;  2GNO A;  1PJT A;  2KRU A;  4BLC A;  3TWM A;  4JI6 M;  3H4J A;  5H37 D;  4WUR A;  4GKK M;  1J09 A;  1PJS A;  5EXT A;  2MH8 A;  2FE8 A;  3J81 S;  3SAU A;  1GLN A;  3TWK A;  2A5Y B;  5EXX A;  3AV0 A;  3R9X B;  4ZPX A;  2DHR A;  4L8R C;  1T43 A;  1C7Y A;  4DR6 M;  1NJG A;  1JR3 D;  1DV0 A;  1RU3 A;  1ORY B;  4Y28 F;  3HJ8 A;  2P5T A;  3BOS A;  2I7N A;  4MGY E;  3U61 B;  1E94 E;  2QCU A;  4JI1 M;  2C99 A;  3FTD A;  1ZMV A;  3T6P A;  1NSF A;  4EIW A;  4M9Z A;  3WHK A;  2DWN A;  1OQY A;  2LHC A;  4OW0 A;  3GPX A;  3TQS A;  2VF8 A;  2DAM A;  2DZN B;  1J7K A;  2WSF F;  5L8R F;  3SAS A;  2UXB M;  1IXZ A;  2EA0 A;  1IXR C;  1WIV A;  4IJF A;  4IBK A;  1N34 M;  2UUB M;  2Z3X A;  2G5G X;  3D8L A;  4NL4 H;  1XMQ M;  3HKP A;  3KOZ E;  3L27 A;  4M0D A;  3W0F A;  4CGY B;  4DUY M;  3JR5 A;  5DNY A;  1GJS A;  1G71 A;  1QUS A;  3BXW A;  4G4Q A;  3PVS A;  3RFW A;  5ITY A;  2AHM A;  4CIZ A;  4IBJ A;  1K3W A;  1V92 A;  1NO1 A;  2Y0T A;  1IBK M;  4DR1 M;  2BWB A;  3QYE A;  4G3O A;  3VFD A;  1LV7 A;  2C96 A;  2QP9 X;  4AW4 A;  7CAT A;  1SXJ E;  1WGL A;  3GLF A;  3U6S A;  3UMM A;  4JI7 M;  4LF7 M;  1G4A E;  1R2Z A;  5DFL A;  1GL6 A;  3LCU A;  4IBI A;  2ZAO A;  3ZH9 B;  3KP1 E;  1XHB A;  4AQY M;  2Z4S A;  1AUA A;  3GLG E;  2DAE A;  4PCZ A;  3JR4 A;  2X8A A;  1L2C A;  3C3D A;  3J7A S;  3HJQ A;  5ITX E;  4M9X A;  3OTO M;  2I7P A;  1GJT A;  1KYI A;  4DV1 M;  3GRV A;  3FTF A;  4IBG A;  2CWB A;  2LTU A;  4LJ8 A;  2YFQ A;  1QZE A;  1PM5 A;  1L1T A;  2LVO C;  2RGO A;  3A46 A;  3LVW A;  4G4O A;  4JI2 M;  3KS8 A;  1IFY A;  2EO2 A;  1E9S A;  1GL7 A;  2KW0 A;  3AJI B;  1PGY A;  1L1Z A;  4NRW A;  1Z5B A;  2V1C A;  2XEP A;  4P16 A;  1HQC A;  2J5Y A;  3GLI B;  3DA1 A;  3B7Q A;  4II7 A;  2XF3 A;  1DGF A;  4FVM A;  3T1Y M;  4RKU F;  2F5Q A;  4GH9 A;  3MJ5 A;  1SG9 A;  3RGS A;  2CFO A;  4LJA A;  4LGM A;  1L8Q A;  3HHX A;  1GKI A;  3KOW E;  2DWM A;  5F3W A;  4ITQ A;  2DWZ B;  1H6U A;  2JY5 A;  2RKO A;  3J27 B;  4NSO B;  4IBF A;  1MJG M;  1QZM A;  1IY2 A;  1D0K A;  3NWL A;  3HHY A;  4AKI A;  2ZTD A;  2UU9 M;  1NJF A;  1QQW A;  1QAQ A;  3GLH A;  3C3E A;  1XXH B;  1NV9 A;  2FS1 A;  3U6D A;  1F4I A;  4IBE A;  2JY8 A;  5FTN A;  3HU2 A;  2L6O A;  3HU1 A;  4LRS A;  2KZS A;  2R62 A;  3L29 A;  1QDT A;  5JI3 E;  4LJ6 A;  1TGU A;  5DYI A;  2HCB A;  4BBA A;  4DV7 M;  5BR8 M;  2XFS A;  2JXN A;  1UM8 A;  1NV8 A;  3T1H M;  1K82 A;  4MGZ E;  3B74 A;  4L6V 6;  2G3Q A;  2BWE A;  2MGW A;  2Z8Y M;  1Q3B A;  2KNV A;  4DR5 M;  3U5Z A;  3QWL A;  2L2D A;  3J7B A;  4IBD A;  4OVZ A;  3F92 A;  3KSJ A;  3WHL A;  2F4V M;  2KNA A;  1HT2 E;  5GKN A;  3NBX X;  1QDR A;  2ZBK B;  3LVV A;  1NHW C;  3AFH A;  1NNJ A;  3HHZ A;  4I4L A;  4D82 A;  3GRU A;  1N77 A;  1IN7 A;  1ZMW A;  1WGN A;  2L7I A;  3U6C A;  1HR0 M;  3AL0 C;  2RGH A;  5EP2 A;  2K9D A;  1MU5 A;  3FRI A;  4GHL A;  1ZV1 A;  4R3D A;  1QAM A;  4M9S A;  4DR7 M;  2HHH M;  3J2P B;  4RNA A;  2UXC M;  3B89 A;  4X66 M;  1FJG M;  2DHY A;  4B7H A;  1LTM A;  2JP7 A;  2BJV A;  2DNA A;  5KPT A;  1OTR A;  4GIP A;  4JI3 M;  4GEW A;  4LRT A;  1R4G A;  3AOE C;  2CUZ A;  2WSE F;  2OQ4 A;  4OU7 A;  3LMM A;  3GQ3 A;  3GLG A;  1Q3C A;  1YUB A;  1Y8G A;  5FTJ A;  4BB9 A;  5ITX A;  4QOS A;  2ERC A;  3C58 A;  1HQY E;  2CHQ A;  3B7Z A;  5EJC A;  8CAT A;  4YY3 M;  2KDL A;  1G59 A;  2C9O A;  1D0M A;  1IQP A;  3C9P A;  4LJ7 A;  2E5L M;  4GC5 A;  4XGI A;  2QQ8 A;  3M6A A;  2DWL A;  2CV2 A;  4G4R A;  2KRK A;  1D0L A;  2X4A A;  5DYG A;  4Z6Y A;  1Z6T A;  2BJW A;  1FNN A;  1TDZ A;  2Y0Q A;  3KFU G;  2HWJ A;  2M60 A;  1DGH A;  2DKL A;  2YR0 A;  4IIW A;  3UZU A;  3ZC7 B;  3SBJ A;  2QBY A;  1TTE A;  1N33 M;  3E4R A;  1NVM A;  2Z7J A;  5FLX S;  1EIJ A;  3GQ5 A;  1PJJ A;  3VLF B;  1WJ7 A;  4IBC A;  4JXJ A;  4LF9 M;  2LH0 A;  1KFV A;  1G8P A;  3RGP A;  1GO5 A;  3TPZ A;  1XC8 A;  1DO0 A;  2CV1 A;  5KPZ A;  4F2L A;  2KNZ A;  3J80 S;  1NY5 A;  2O01 F;  3ILK A;  3MK6 A;  3FD9 A;  4LZZ A;  3CF0 A;  2R6F A;  1SXJ C;  3V76 A;  3UJN A;  2XZU A;  4AKH A;  2LVP C;  3SMS A;  4JYA M;  4P17 A;  3GLF B;  2LNH C;  2LWX A;  4IJE A;  4REZ A;  3CGW A;  1V34 A;  2QEN A;  2Z4R A;  2V6Z M;  4L78 A;  2J7O A;  2XZF A;  1G3I A;  3FTC A;  2UXD M;  2RRU A;  2DI0 A;  3QAU A;  5ITT A;  4JI5 M;  1QAN A;  3U60 A;  2XH9 A;  3FE3 A;  3VK7 A;  2LBC A;  1K3X A;  2EJS A;  4F1I A;  3I4V A;  3A98 B;  2R18 A;  1CUK A;  4MGI E;  5EQT A;  4D80 A;  4AKG A;  2Q2E B;  4DV4 M;  2WZJ A;  1JQJ C;  1PRB A;  4R71 A;  2R44 A;  3M0E A;  4YHH M;  4FCW A;  4CIS A;  3L2A A;  1R2Y A;  3HHW A;  2QZ4 A;  4MGK E;  2YNM D;  1HNZ M;  4ANR A;  4X62 M;  4GKJ M;  1KSF X;  3KOY E;  3FKE A;  3FYC A;  3SAV A;  4DV3 M;  2D7H A;  5FSW A;  3FTE A;  2XGN A;  2JZ0 A;  2KEB A;  1NY6 A;  1OAI A;  1R6B X;  3IG8 A;  3U6L A;  1DGG A;  1ZAE A;  1VQ1 A;  3SMP A;  1GAB A;  2FH0 A;  3FUU A;  2F5O A;  4HL4 A;  3I04 M;  2M5Z A;  3H4M A;  2JWS A;  1VEG A;  2OPF A;  1N32 M;  3EIH A;  2DZO B;  3A42 A;  3D8B A;  1JR3 E;  2EKF A;  2XSZ D;  4FWD A;  4LFA M;  4X65 M;  2YQZ A;  4LJ9 A;  3FUX A;  2R65 A;  4JI0 M;  5IRE B;  3I01 M;  3GLH B;  1EFU B;  2JUJ A;  2H1R A;  1OKS A;  1N36 M;  1HNW M;  4MB7 A;  3HX3 A;  1WR1 B;  1Q02 A;  3AOE A;  5FTL A;  2XSZ A;  5C1B A;  4LGY A;  2OO9 A;  3E21 A;  3LQQ A;  1ZQ9 A;  3Q8X A;  4FW9 A;  4G6Z A;  3SHG B;  4KHP M;  1IXS A;  1IY1 A;  4LY6 A;  4B7F A;  3TWL A;  2UUA M;  5A2Q S;  1IBL M;  2C5R A;  3SYK A;  3HZJ A;  2ZM6 M;  1TR8 A;  2FFJ A;  4HEO A;  4MH0 E;  4I8O A;  4DR3 M;  2KXE A;  3U5Z B;  5IT9 S;  2VQF M;  3GQ4 A;  4OVZ B;  3VKG A;  3KW6 A;  4MM3 B;  3W68 A;  3B9P A;  2F5S A;  3GLF E;  4DR4 M;  2LVN C;  2OOA A;  3VDU A;  4KLN A;  4LCB A;  3PFI A;  3FRH A;  1OJL A;  1QVR A;  4KT0 F;  4QHS A;  1G41 A;  2QNJ A;  2KHH A;  4LJ4 A;  1PJQ A;  4A3V B;  4X64 M;  2JY6 B;  4LF6 M;  3RE8 A;  1JB0 F;  4JI8 M;  1E32 A;  1DGB A;  3E46 A;  1TH2 A;  2K0B X;  2LHG A;  4B08 A;  4TUW A;  1SXJ D;  3DZD A;  4GC9 A;  4RF0 A;  3PNV A;  3THG A;  4DV6 M;  3SC3 A;  4AI6 A;  4S12 A;  3GP1 A;  5LMN M;  1IBM M;  1DO2 A;  5BPV A;  3VDP A;  2VF7 A;  1V33 A;  3FUV A;  1SXJ A;  1E9R A;  3AKZ A;  3GLI E;  1QAO A;  3LCV B;  3UK6 A;  2FNA A;  1XNR M;  4GHA A;  1R7R A;  1MN3 A;  3ZQJ A;  1OAO C;  4AZF A;  3T15 A;  3ZCB B;  1WHC A;  1W5T A;  1TDH A;  2CHG A;  2JY7 A;  3GLG B;  3HJS A;  3K92 A;  3KVW A;  3LQR A;  1TH4 A;  1XXH E;  3M7G A;  1YSY A;  3FUW A;  3KOX E;  4I81 A;  3GLH E;  3L25 A;  2R4J A;  1R5L A;  3U6O A;  1D2N A;  1UFZ A;  2G8L A;  3K1J A;  3DFZ A;  4WW0 A;  4QNM A;  3KDS E;  2J7N A;  4GMQ A;  3SAT A;  5JI2 E;  5IWA M;  3BBZ A;  1XNQ M;  4NSR A;  2O5R A;  1DGH B;  3L28 A;  2LXE A;  4NC6 A;  2QBY B;  3JAM S;  3R8F A;  1A5T A;  5KQ8 A;  2HL7 A;  3Q8G A;  3E9S A;  4PDI A;  3U61 A;  3KSX A;  3QYB A;  4DUZ M;  3GPP A;  1MX0 A;  1W5S A;  2W82 A;  2XLJ A;  4JI4 M;  4B3R M;  3GRY A;  1XB2 B;  3KP0 E;  4FCT A;  4XBO A;  2L7H A;  1VDD A;  3NBI A;  4XK8 F;  3IG5 A;  2JNH A;  1JR3 A;  1IN4 A;  3K9P A;  1X37 A;  2DAK A;  4LF5 M;  1Z5A A;  1OIP A;  2DVW B;  4LFC M;  2F5P A;  3FYD A;  3HU3 A;  4KO8 A;  4DV2 M;  4L4U A;  1IY0 A;  4HLQ A;  2CRU A;  1T6O A;  1HJP A;  4B7G A;  4LG2 A;  3GO8 A;  3KS4 A;  3VKH A;  2X49 A;  2C9C A;  2ZAN A;  4FD2 A;  3L26 A;  3W67 A;  2CV0 A;  2C98 A;  1QUT A;  4CHT B;  2ZAM A;  1N75 A;  2D7G A;  1J5E M;  1Q39 A;  2MRO B;  2MR9 A;  1OFI A;  1VG5 A;  4D81 A;  3U60 B;  5EP1 A;  1PJI A;  5KPR A;  3EIE A;  1TH3 A;  3GRR A;  2UUC M;  2O25 A;  4K0K M;  1IN5 A;  4L16 A;  1GVN A;  3A45 A;  4OX9 M;  3HY5 A;  2DEN A;  1NHG C;  5C18 A;  2L09 A;  3FUT A;  1HT1 E;  2VII A;  2R0I A;  4LF4 M;  1IN6 A;  5KO3 A;  4KOD A;  2V1U A;  4NOO B;  3SYL A;  4GRI A;  2HAK A;  4MGH A;  5EXP A;  3W0L B;  3GPY A;  4DBG B;  3LW5 F;  1T3T A;  2FOI C;  4PT5 A;  1IN8 A;  2L4F A;  2GQF A;  4QHT A;  4PD2 A;  4M0W A;  1NNU C;  5EP3 A;  3I51 A;  2WSC F;  2XFT A;  1ZMU A;  1Z59 A;  3TL4 X;  3B7N A;  2KA6 B;  3IHP A;  5LMU M;  4G4N A;  4NXM M;  4GIT A;  1S3S A;  2EUC A;  4LJ5 A;  3CF6 E;  3SFZ A;  3GLI A;  2CEA A;  1XWI A;  3TE6 A;  2F5N A;  2B3T A;  2LVQ D;  4NXN M;  3T38 A;  3VK8 A;  4B3M M;  1I94 M;  2DAG A;  2OOB A;  2QHO B;  3SHF A;  2Y21 A;  3U6M A;  2H5X A;  4L15 A;  3DOA A;  5E26 A;  2Y20 A;  5FTM A;  2EKK A;  3CTW B;  4FCV A;  2R46 A;  3K2L A;  1I4W A;  1IXS B;  2CE7 A;  4Z8X A;  4FWH A;  2BNK A;  2QSF X;  3MHV C;  1VEJ A;  3U6E A;  1Z5C A;  1XXH A;  4CJ6 A;  3IEC A;  2LVA A;  1TF0 B;  2L4E A;  2NQ8 C;  3AOG A;  2VQE M;  1N78 A;  5ITQ A;  3HGI A;  4RF1 A;  4IBB A;  2JA2 A;  2R45 A;  2VDB B;  5ITU A;  2N35 A;  4W5W A;  4AG6 A;  1VEK A;  3K8Z A;  1IM2 A;  4DV0 M;  1EE8 A;  4FWG A;  4R7G A;  1HNX M;  4B3S M;  4JN6 A;  4JV5 M;  4Q7J A;  4I5S A;  1C1K A; 
#chains in the Genus database with same CATH homology
 2DZL A;  1XXH E;  1SG9 A;  2LVP C;  2MJ5 B;  3GLH E;  2JZ1 A;  1UFZ A;  2JY5 A;  1G3I A;  3MMP A;  2RRU A;  2DI0 A;  2CP8 A;  3BBZ A;  5JI2 E;  2ZTD A;  1AIP C;  1A5T A;  3FE3 A;  4UN2 B;  1NV9 A;  2ZTC A;  2LBC A;  2EJS A;  4F1I A;  2JY8 A;  1F4I A;  2DAI A;  1CUK A;  3K9O A;  1XB2 B;  2WZJ A;  4R71 A;  2JNH A;  3K9P A;  2DAK A;  4WP2 A;  1P3Q Q;  1NV8 A;  1VDL A;  1YLA A;  1BVS A;  2JZ0 A;  2G3Q A;  1OAI A;  2BWE A;  2MGW A;  3H4J A;  1VQ1 A;  1T6O A;  1HJP A;  2KNV A;  2L2D A;  3F92 A;  1VEG A;  1HT2 E;  2KNA A;  1JR3 E;  1T43 A;  2EKF A;  1C7Y A;  2MRO B;  2MR9 A;  1DV0 A;  1VG5 A;  1EFU B;  2JUJ A;  1E94 E;  1OKS A;  1WGN A;  1ZMW A;  1ZMV A;  3T6P A;  1WR1 B;  1Q02 A;  1OQY A;  2K9D A;  2O25 A;  2OO9 A;  3E21 A;  3FRI A;  1ZV1 A;  2DAM A;  1IXS A;  2DEN A;  3B89 A;  1HT1 E;  2R0I A;  1WIV A;  2DHY A;  2JP7 A;  2DNA A;  1TR8 A;  4HEO A;  2HAK A;  1OTR A;  4DBG B;  4GEW A;  2L4F A;  1R4G A;  1ZMU A;  3GLF E;  3IHP A;  2LVN C;  2OOA A;  3FRH A;  1V92 A;  1G41 A;  2QNJ A;  2KHH A;  1Y8G A;  2BWB A;  2B3T A;  2JY6 B;  2LVQ D;  4G3O A;  1HQY E;  3E46 A;  2DAG A;  2OOB A;  2K0B X;  2QHO B;  1WGL A;  2H5X A;  1G4A E;  2EKK A;  5DFL A;  3LCU A;  1DO2 A;  2HWJ A;  2DKL A;  2QSF X;  1VEJ A;  1TTE A;  2DAE A;  3GLG E;  3GLI E;  3IEC A;  2LVA A;  3LCV B;  2L4E A;  1KYI A;  1WJ7 A;  2CWB A;  2LTU A;  1MN3 A;  1QZE A;  2LVO C;  1IFY A;  1VEK A;  1GO5 A;  1WHC A;  1IM2 A;  1DO0 A;  1PGY A;  2JY7 A;  4F2L A;  2KNZ A;  4Q7J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...