2CP8A

Solution structure of the rsgi ruh-046, a uba domain from human next to brca1 gene 1 protein (kiaa0049 protein) r923h variant
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
54
structure length
54
Chain Sequence
GSSGSSGQTAALMAHLFEMGFCDRQLNLRLLKKHNYNILQVVTELLQLSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RSGI RUH-046, a UBA domain from human Next to BRCA1 gene 1 protein (KIAA0049 protein) R923H variant
rcsb
source organism Homo sapiens
molecule tags Protein binding
molecule keywords Next to BRCA1 gene 1 protein
total genus 9
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2005-05-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.8.10 Mainly Alpha Orthogonal Bundle Helicase, Ruva Protein; domain 3 DNA helicase RuvA subunit, C-terminal domain 2cp8A00
1WR1B 2DAMA 2JUJA 2JNHA 2JY6B 1SG9A 3E21A 2DENA 2LVQD 1T6OA 1E94E 1HQYE 1OAIA 2ZTCA 4HEOA 1JR3E 1IXSA 2WZJA 1DV0A 3B89A 1C7YA 4GEWA 1KYIA 4DBGB 1BVSA 1WGLA 2K0BX 2R0IA 1T43A 2JP7A 1UFZA 3GLGE 1EFUB 2B3TA 2DKLA 2LTUA 2LVPC 2EKKA 1VEJA 1WIVA 1OKSA 1CUKA 5DFLA 3FE3A 2JY8A 3IHPA 3MMPA 2OO9A 1VQ1A 2RRUA 3FRIA 2LVAA 2KHHA 2HAKA 3T6PA 2HWJA 2QSFX 4WP2A 1TR8A 2L4EA 1WJ7A 3GLIE 2KNZA 1HT1E 1V92A 1Q02A 1IM2A 2JY7A 2MGWA 2LVOC 3BBZA 3H4JA 2DI0A 1OQYA 2DZLA 1NV9A 1YLAA 2DAGA 1Y8GA 2EKFA 2KNAA 3F92A 4F1IA 2LVNC 2H5XA 1ZMVA 3K9OA 2BWBA 1G4AE 2JY5A 4G3OA 4UN2B 1ZMWA 1QZEA 2JZ0A 2DHYA 1NV8A 2MR9A 4Q7JA 4R71A 2QHOB 3LCUA 2DNAA 1XXHE 2MROB 2O25A 1VEKA 1XB2B 1ZMUA 1ZV1A 3GLFE 4F2LA 3FRHA 2G3QA 1PGYA 1DO0A 1VEGA 2ZTDA 1OTRA 2OOBA 2OOAA 2KNVA 3IECA 1GO5A 1DO2A 2DAIA 1HT2E 2EJSA 2MJ5B 2BWEA 1F4IA 2L2DA 1WGNA 3E46A 1MN3A 2JZ1A 3LCVB 1VG5A 1AIPC 1G3IA 2K9DA 2DAEA 1IFYA 1WHCA 1P3QQ 1G41A 1VDLA 2QNJA 3GLHE 2L4FA 2CP8A 2LBCA 5JI2E 2CWBA 2DAKA 1HJPA 1TTEA 1R4GA 1A5TA 3K9PA
chains in the Genus database with same CATH superfamily
4GH9A 2XSZA 1DGHB 2JNHA 2I7NA 1UM8A 2Y21A 2CHQA 3E21A 3L27A 4B3SM 4MGKE 3Q8XA 1PJIA 3U6PA 4IBJA 3HHYA 2GNOA 2XLJA 2YR0A 5EP1A 5KPTA 1IXSA 2GQFA 3FTDA 2LHGA 3U6OA 4GEWA 2R4EA 4CISA 1J09A 4Y28F 2QPAA 4FVMA 4MM3B 2D7EA 2K0BX 1NHGC 3U61B 3SASA 1K82A 3KOZE 2QBYB 3KS8A 2UUBM 1T43A 3EIHA 2M60A 2DWLA 2JP7A 4FCTA 2LNHC 4AZFA 3AKZA 1DGFA 1IN5A 2LTUA 3SC3A 1OIZA 3A46A 1I4WA 1VEJA 1W5TA 2Z7JA 1GL6A 2UXCM 4L4UA 3IHPA 3SYLA 4QOZC 1IXSB 5FTLA 2OO9A 1VQ1A 2O5RA 2RRUA 4LGMA 2WSEF 4KLNA 3GQ3A 1TF0B 2QP9X 4X65M 2R45A 1XXHA 3W0FA 3FRIA 1L2CA 1HR0M 2V1UA 3HX3A 1GJSA 4IBCA 1K3XA 4GRIA 1XHBA 2C5RA 4LZJA 2HWJA 4Z8XA 2QSFX 4WP2A 3H4MA 3LVWA 1R2YA 3FUTA 4NRWA 1OFHA 3L29A 4D80A 1PJTA 1OQYA 4LF4M 3SHFA 1GVNA 1NSFA 1TGUA 3L28A 4DV0M 1R2ZA 1K3WA 1Y8GA 4NOOB 2UXBM 2DWMA 3UZUA 3F92A 4R3DA 5F3WA 4P16A 3AOGA 3HJSA 1L1ZA 3BXWA 4I81A 4NC6A 4HLQA 2KA6B 4OVZB 1LTMA 4FCWA 3W67A 4DUZM 4B3TM 4I4LA 1QZEA 4OU7A 2DHYA 1JR3A 1SXJB 3VK7A 1XMQM 4JV5M 4R71A 4JI0M 2QHOB 1MU5A 2NQ8C 2VQEM 4JI4M 2DNAA 1XXHE 2ERCA 4L8RC 4RF1A 1QYRA 3FUXA 4QHSA 4XGIA 3TWMA 4JYAM 1VEKA 2HCBA 2KW0A 3J7BA 1PRBA 1ZMUA 3GRRA 3U6SA 3GLFE 1XXHB 1C1KA 4TUWA 4G4NA 2DHRA 1Q39A 3DZDA 3HHXA 4BBAA 2UUAM 2EA0A 2ZTDA 4JI2M 2UXDM 2F5QA 5KQ8A 4AQYM 4MGIE 4DUYM 2KNVA 3A45A 1Q3CA 4CGYB 1HT2E 2EJSA 2MJ5B 1H6UA 3SAVA 3R8FA 2HL7A 3KFUG 3SATA 4AG5A 4XK8F 3C3DA 2KZSA 2XSZD 3FD9A 1WGNA 3FUUA 4I5SA 1VDDA 4LRTA 3E46A 3W0LB 4ZPXA 3TL4X 4PCZA 2JZ1A 1HQCA 2LHCA 1OFIA 4I8OA 4LGYA 2QNJA 2OPFA 1IBMM 2Z8YM 4LFBM 2CP8A 5BR8M 4KHPM 5JI2E 3HHWA 3KDSE 1EIJA 1PJJA 4JI8M 3J81S 2C99A 3K9PA 1WR1B 2JUJA 1AUAA 2JY6B 3GLIA 3U6EA 4GIPA 2ZAMA 4K0KM 4DR6M 1E94E 4PDGA 2YQZA 2VIIA 1QZMA 2D7HA 4QNMA 4MB7A 3HKPA 3VDUA 3VKHA 4B3MM 3Q8GA 4REZA 3QYBA 2ZTCA 5C1BA 4B08A 2WZJA 3SARA 3I51A 3A42A 1KYIA 3B7ZA 4DBGB 4JI3M 3PXGA 1TH3A 1WGLA 1LV7A 4M9XA 3GPYA 3HGIA 1XNQM 2J7NA 2R0IA 4LJ8A 2ZAOA 2CRUA 1QDTA 5FLXS 1UFZA 2CUZA 3GLGE 1EFUB 4NSOB 2KRKA 1L1TA 1OKSA 2ZBKB 1E32A 2JY8A 3MMPA 2L7IA 2LH0A 3GLHA 4FD2A 4DV7M 5KQDA 1NO1A 1NY5A 2CV0A 2LVAA 5JI3E 4JI6M 1XNRM 4JXJA 3U5ZB 3CGWA 4NSRA 2FS1A 4KT0F 1IN8A 4B7HA 3T6PA 3CF2A 4AKHA 1IN6A 3KS4A 5BPVA 2CV1A 1SXJA 4AG6A 3J27B 4MGYE 2L4EA 4CHTB 2R62A 3GLIE 2KNZA 1Z5CA 1V92A 2HKJA 3AFHA 1Q02A 1Z6TA 2JY7A 2QENA 3PFIA 3H4JA 4LJ5A 1IBKM 3FTEA 2VF7A 3UMMA 2CE7A 2KXEA 2WSFF 4LZZA 5H37D 1NV9A 3DOAA 1PM5A 3GLIB 2XZFA 5EP4A 3AJIB 3LMMA 1D0MA 3HU3A 4IBGA 3KW6A 5IZ7D 1V34A 3GLFB 4F1IA 2LVNC 3VK8A 1ZMVA 3K9OA 4JI1M 4NRVA 8CATA 5L8RF 1G4AE 1SXJE 2AHMA 4LJ7A 2C98A 2DWZB 3HZJA 4RF0A 1NJFA 1NV8A 3HY5A 4G6ZA 3LCUA 3GQ4A 1N34M 1L2BA 5EP3A 3WHKA 3FTFA 4KO8A 2O25A 4DR5M 1PJSA 3HJQA 4LRSA 5ITQA 3GPPA 2E5LM 3E4RA 3I4VA 2CV2A 3V76A 4NXMM 1E9SA 2CFOA 5EXTA 4DR3M 3KVWA 4GHAA 3FRHA 3U6QA 3DA1A 3AL0C 1OTRA 1IN7A 4PT5A 2OOAA 4QOSA 1Z59A 3JR5A 1XC8A 1SXJC 3HHZA 4BB9A 5DNYA 4X62M 4D82A 4G4RA 4AKGA 3J2PB 4LG2A 3B74A 2L09A 2L2DA 2ZANA 3B7NA 3HWSA 4R7GA 4IBEA 4M9SA 2JXNA 5GKNA 4LFCM 3U6MA 2G8LA 3HU1A 4LF7M 1QAOA 3ZC7B 1VG5A 1AIPC 4B7FA 1ZQ9A 3UK6A 3GRYA 4LCBA 1P3QQ 4JN6A 1VDLA 3M0EA 1QUSA 1YUBA 1DGBA 3VFDA 3D8LA 4OVZA 2DAKA 1TH4A 3BOSA 1R7RA 4LJ6A 1R4GA 4FW9A 4IBBA 1A5TA 3I01M 3GPUA 5EP2A 3QYEA 1N77A 4QNRA 3K8ZA 2YFQA 2DAMA 3KSJA 4QHTA 1Q3BA 1SG9A 1E9RA 3LVVA 3NBIA 3THGA 2DENA 2LVQD 4L6V6 3VLFB 3HJ8A 2CHGA 1QAQA 2R44A 3ZQJA 4HL4A 3PVSA 1DV0A 3U6DA 3RFWA 4XBOA 4BLCA 3MK6A 1C7YA 4LF8M 4L16A 2I7PA 1OJLA 4EIWA 1HNZM 2UUCM 2DXIA 3HU2A 3SMSA 5ITUA 1T3TA 4DV5M 4S12A 1DGHA 2M5ZA 3K92A 2KEBA 2J5YA 3DFZA 5E6JA 2DKLA 3SHGB 2R6FA 3SFZA 2EKKA 5DFLA 4IBDA 1CUKA 1IY2A 2Z4SA 3FE3A 3GO8A 3EIEA 1IXRC 1GJTA 2HHHM 3RGSA 1QANA 4AW4A 5FTKA 4DR2M 3KOWE 2KHHA 3ZCBB 2VDBB 1J5EM 1J7KA 2HAKA 3K1JA 5IWAM 1EE8A 5ITXA 3ZH9B 1RU3A 3T38A 2QZ4A 3U6CA 4DR7M 2C96A 4MGZE 3U60B 2K47A 1WJ7A 4FCVA 3KSXA 5ITYA 1HNXM 3TQSA 5LMNM 2FNAA 1N32M 2LVOC 3BBZA 2Y0TA 4LJ9A 1FJGM 2DZLA 2L6OA 3ILKA 3M7GA 4GMQA 1IXZA 2FH0A 2Z3XA 1QVRA 2DAGA 3KP1E 1NY6A 4Z6YA 3PNVA 2KNAA 4A3VB 4G4OA 2J7OA 4AI6A 2H5XA 2QQ8A 3FTCA 1N78A 5ITTA 3C58A 4DR4M 2BWBA 2R18A 3CF0A 2JY5A 4OW0A 4G3OA 2ZM6M 2MR9A 1OAOC 1YSYA 3TE6A 3T1YM 2XFTA 3KOXE 3TWKA 3U60A 3L2AA 4LF5M 5EXSA 3SAUA 2UU9M 2MROB 3NWLA 5DYIA 1XB2B 2R4JA 4GC5A 2EO2A 1ZV1A 1JR3D 1TDZA 1S3SA 2QBYA 2DZNB 2XF3A 3E9SA 3W68A 5A2QS 3GRUA 4DR1M 1PGYA 1DO0A 4YHHM 4L78A 3UJNA 1IQPA 2BJVA 4LJAA 3GP1A 5LMUM 4IIWA 3GLGB 3I04M 1Z5BA 1DO2A 2DAIA 2QCUA 1NNJA 2FOIC 1MX0A 5EXPA 5ITRA 4L15A 5IT9S 2V1CA 2BWEA 1F4IA 2G5GX 2XZUA 2DWNA 4LF9M 2O01F 2H1RA 4GC9A 7CATA 1L8QA 2VF8A 5FTMA 3AV0A 4IJEA 5KPRA 4M0WA 1ORYB 2DVWB 1G8PA 1IFYA 1WHCA 1OIPA 4MH0E 3JR4A 4JI7M 3LQQA 5C18A 4WURA 1D0KA 1G59A 3VDPA 1DGGA 2F5NA 1N75A 2CWBA 1HJPA 1TTEA 3FYCA 5DYGA 3TPZA 3GRVA 2FE8A 3GLGA 3FKEA 3UGJA 3U6LA 5FTJA 1JB0F 3QWLA 1T6OA 2XH9A 4JI5M 4B3RM 2W82A 4D81A 3GLHB 4WW0A 1IY0A 4DV6M 1HQYE 1OAIA 2C9CA 3RGPA 3GPXA 1QDRA 4HEOA 4X64M 1JR3E 3B89A 3LW5F 2OQ4A 2LXEA 1BVSA 2EUCA 2DZOB 3RE8A 4PD2A 1NVMA 2CEAA 3K2LA 4GHLA 4G4QA 4CIZA 5FTNA 4DV3M 2L7HA 4RKUF 2B3TA 1SXJD 3SBJA 3SAWA 4M0DA 2LVPC 1XWIA 1WIVA 2C9OA 4IBFA 2BJWA 4P17A 4RNAA 3AOEC 2N35A 4FWGA 1IN4A 2Y0QA 2LWXA 2V6ZM 4GITA 3OTOM 3LQRA 4DV4M 4PDIA 3U61A 2P5TA 5ITXE 2BNKA 2FFJA 3FYDA 3R9XB 1WXQA 3U5ZA 4M9ZA 1N33M 1I94M 2KZUA 3CF6E 4IJFA 4MGHA 2F5SA 1G71A 1ZAEA 2RKOA 1TR8A 2RGHA 3FUWA 5IREB 4NL4H 4LF6M 4AKIA 1KSFX 1HT1E 1QUTA 4GKJM 1IM2A 2MGWA 4DV1M 4II7A 1GL7A 2DI0A 2JWSA 3L26A 4LFAM 3I4YA 1PJQA 1NHWC 2X49A 2F5OA 4NXNM 1QAMA 1FNNA 1YLAA 2JA2A 2Z4RA 3J80S 2EKFA 4IBKA 1D2NA 4ANRA 3D8BA 3KXEC 3QAUA 1TH2A 3VKGA 3JAMS 3NBXX 4IBIA 2R65A 1IY1A 4UN2B 1IBLM 2JZ0A 1ZMWA 5E26A 4B7GA 2Q2EB 2YNMD 4Q7JA 2APLA 5FSWA 1L2DA 2XEPA 3SMPA 3L25A 3IG8A 1D0LA 2KRUA 3KOYE 3J7AS 1GKIA 1NJGA 1X37A 1NNUC 4LJ4A 5EJCA 2Y20A 3WHLA 5KO3A 3IG5A 4F2LA 4DV2M 2CHVA 2G3QA 2A5YB 1YE9A 1VEGA 3A98B 3TWLA 3C9PA 2K6BA 1KFVA 2OOBA 1JQJC 3GLFA 3IECA 5KPZA 3T15A 2R46A 5EXXA 1GO5A 4KODA 3M6AA 4X66M 2XFSA 2X4AA 1R5LA 1V33A 1TDHA 4CJ6A 1GABA 3FUVA 4W5WA 2WSCF 3CTWB 3MJ5A 1MN3A 1R6BX 4ITQA 1HNWM 1XMOM 3B7QA 2RGOA 2XGNA 3GQ5A 1Z5AA 3B9PA 3LCVB 4FWDA 1G3IA 2K9DA 2VQFM 1QQWA 2DAEA 3AOEA 2KDLA 3MHVC 4FWHA 1G41A 3GLHE 2D7GA 3PNYA 5EQTA 2L4FA 3C3EA 2LBCA 4LY6A 1GLNA 1MJGM 2X8AA 2F4VM 3SYKA 2F5PA 4GKKM 1W5SA 1N36M 4OX9M 2MH8A 3T1HM 4YY3M 3KP0E
chains in the Genus database with same CATH topology
1WR1B 2DAMA 2JUJA 2JNHA 2JY6B 1SG9A 3E21A 2DENA 2LVQD 1T6OA 1E94E 1HQYE 1OAIA 2ZTCA 4HEOA 1JR3E 1IXSA 2WZJA 1DV0A 3B89A 1C7YA 4GEWA 1KYIA 4DBGB 1BVSA 1WGLA 2K0BX 2R0IA 1T43A 2JP7A 1UFZA 3GLGE 1EFUB 2B3TA 2DKLA 2LTUA 2LVPC 2EKKA 1VEJA 1WIVA 1OKSA 1CUKA 5DFLA 3FE3A 2JY8A 3IHPA 3MMPA 2OO9A 1VQ1A 2RRUA 3FRIA 2LVAA 2KHHA 2HAKA 3T6PA 2HWJA 2QSFX 4WP2A 1TR8A 2L4EA 1WJ7A 3GLIE 2KNZA 1HT1E 1V92A 1Q02A 1IM2A 2JY7A 2MGWA 2LVOC 3BBZA 3H4JA 2DI0A 1OQYA 2DZLA 1NV9A 1YLAA 2DAGA 1Y8GA 2EKFA 2KNAA 3F92A 4F1IA 2LVNC 2H5XA 1ZMVA 3K9OA 2BWBA 1G4AE 2JY5A 4G3OA 4UN2B 1ZMWA 1QZEA 2JZ0A 2DHYA 1NV8A 2MR9A 4Q7JA 4R71A 2QHOB 3LCUA 2DNAA 1XXHE 2MROB 2O25A 1VEKA 1XB2B 1ZMUA 1ZV1A 3GLFE 4F2LA 3FRHA 2G3QA 1PGYA 1DO0A 1VEGA 2ZTDA 1OTRA 2OOBA 2OOAA 2KNVA 3IECA 1GO5A 1DO2A 2DAIA 1HT2E 2EJSA 2MJ5B 2BWEA 1F4IA 2L2DA 1WGNA 3E46A 1MN3A 2JZ1A 3LCVB 1VG5A 1AIPC 1G3IA 2K9DA 2DAEA 1IFYA 1WHCA 1P3QQ 1G41A 1VDLA 2QNJA 3GLHE 2L4FA 2CP8A 2LBCA 5JI2E 2CWBA 2DAKA 1HJPA 1TTEA 1R4GA 1A5TA 3K9PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WR1 B;  2DAM A;  2JUJ A;  2JNH A;  2JY6 B;  1SG9 A;  3E21 A;  2DEN A;  2LVQ D;  1T6O A;  1E94 E;  1HQY E;  1OAI A;  2ZTC A;  4HEO A;  1JR3 E;  1IXS A;  2WZJ A;  1DV0 A;  3B89 A;  1C7Y A;  4GEW A;  1KYI A;  4DBG B;  1BVS A;  1WGL A;  2K0B X;  2R0I A;  1T43 A;  2JP7 A;  1UFZ A;  3GLG E;  1EFU B;  2B3T A;  2DKL A;  2LTU A;  2LVP C;  2EKK A;  1VEJ A;  1WIV A;  1OKS A;  1CUK A;  5DFL A;  3FE3 A;  2JY8 A;  3IHP A;  3MMP A;  2OO9 A;  1VQ1 A;  2RRU A;  3FRI A;  2LVA A;  2KHH A;  2HAK A;  3T6P A;  2HWJ A;  2QSF X;  4WP2 A;  1TR8 A;  2L4E A;  1WJ7 A;  3GLI E;  2KNZ A;  1HT1 E;  1V92 A;  1Q02 A;  1IM2 A;  2JY7 A;  2MGW A;  2LVO C;  3BBZ A;  3H4J A;  2DI0 A;  1OQY A;  2DZL A;  1NV9 A;  1YLA A;  2DAG A;  1Y8G A;  2EKF A;  2KNA A;  3F92 A;  4F1I A;  2LVN C;  2H5X A;  1ZMV A;  3K9O A;  2BWB A;  1G4A E;  2JY5 A;  4G3O A;  4UN2 B;  1ZMW A;  1QZE A;  2JZ0 A;  2DHY A;  1NV8 A;  2MR9 A;  4Q7J A;  4R71 A;  2QHO B;  3LCU A;  2DNA A;  1XXH E;  2MRO B;  2O25 A;  1VEK A;  1XB2 B;  1ZMU A;  1ZV1 A;  3GLF E;  4F2L A;  3FRH A;  2G3Q A;  1PGY A;  1DO0 A;  1VEG A;  2ZTD A;  1OTR A;  2OOB A;  2OOA A;  2KNV A;  3IEC A;  1GO5 A;  1DO2 A;  2DAI A;  1HT2 E;  2EJS A;  2MJ5 B;  2BWE A;  1F4I A;  2L2D A;  1WGN A;  3E46 A;  1MN3 A;  2JZ1 A;  3LCV B;  1VG5 A;  1AIP C;  1G3I A;  2K9D A;  2DAE A;  1IFY A;  1WHC A;  1P3Q Q;  1G41 A;  1VDL A;  2QNJ A;  3GLH E;  2L4F A;  2CP8 A;  2LBC A;  5JI2 E;  2CWB A;  2DAK A;  1HJP A;  1TTE A;  1R4G A;  1A5T A;  3K9P A; 
#chains in the Genus database with same CATH topology
 4GH9 A;  2XSZ A;  1DGH B;  2JNH A;  2I7N A;  1UM8 A;  2Y21 A;  2CHQ A;  3E21 A;  3L27 A;  4B3S M;  4MGK E;  3Q8X A;  1PJI A;  3U6P A;  4IBJ A;  3HHY A;  2GNO A;  2XLJ A;  2YR0 A;  5EP1 A;  5KPT A;  1IXS A;  2GQF A;  3FTD A;  2LHG A;  3U6O A;  4GEW A;  2R4E A;  4CIS A;  1J09 A;  4Y28 F;  2QPA A;  4FVM A;  4MM3 B;  2D7E A;  2K0B X;  1NHG C;  3U61 B;  3SAS A;  1K82 A;  3KOZ E;  2QBY B;  3KS8 A;  2UUB M;  1T43 A;  3EIH A;  2M60 A;  2DWL A;  2JP7 A;  4FCT A;  2LNH C;  4AZF A;  3AKZ A;  1DGF A;  1IN5 A;  2LTU A;  3SC3 A;  1OIZ A;  3A46 A;  1I4W A;  1VEJ A;  1W5T A;  2Z7J A;  1GL6 A;  2UXC M;  4L4U A;  3IHP A;  3SYL A;  4QOZ C;  1IXS B;  5FTL A;  2OO9 A;  1VQ1 A;  2O5R A;  2RRU A;  4LGM A;  2WSE F;  4KLN A;  3GQ3 A;  1TF0 B;  2QP9 X;  4X65 M;  2R45 A;  1XXH A;  3W0F A;  3FRI A;  1L2C A;  1HR0 M;  2V1U A;  3HX3 A;  1GJS A;  4IBC A;  1K3X A;  4GRI A;  1XHB A;  2C5R A;  4LZJ A;  2HWJ A;  4Z8X A;  2QSF X;  4WP2 A;  3H4M A;  3LVW A;  1R2Y A;  3FUT A;  4NRW A;  1OFH A;  3L29 A;  4D80 A;  1PJT A;  1OQY A;  4LF4 M;  3SHF A;  1GVN A;  1NSF A;  1TGU A;  3L28 A;  4DV0 M;  1R2Z A;  1K3W A;  1Y8G A;  4NOO B;  2UXB M;  2DWM A;  3UZU A;  3F92 A;  4R3D A;  5F3W A;  4P16 A;  3AOG A;  3HJS A;  1L1Z A;  3BXW A;  4I81 A;  4NC6 A;  4HLQ A;  2KA6 B;  4OVZ B;  1LTM A;  4FCW A;  3W67 A;  4DUZ M;  4B3T M;  4I4L A;  1QZE A;  4OU7 A;  2DHY A;  1JR3 A;  1SXJ B;  3VK7 A;  1XMQ M;  4JV5 M;  4R71 A;  4JI0 M;  2QHO B;  1MU5 A;  2NQ8 C;  2VQE M;  4JI4 M;  2DNA A;  1XXH E;  2ERC A;  4L8R C;  4RF1 A;  1QYR A;  3FUX A;  4QHS A;  4XGI A;  3TWM A;  4JYA M;  1VEK A;  2HCB A;  2KW0 A;  3J7B A;  1PRB A;  1ZMU A;  3GRR A;  3U6S A;  3GLF E;  1XXH B;  1C1K A;  4TUW A;  4G4N A;  2DHR A;  1Q39 A;  3DZD A;  3HHX A;  4BBA A;  2UUA M;  2EA0 A;  2ZTD A;  4JI2 M;  2UXD M;  2F5Q A;  5KQ8 A;  4AQY M;  4MGI E;  4DUY M;  2KNV A;  3A45 A;  1Q3C A;  4CGY B;  1HT2 E;  2EJS A;  2MJ5 B;  1H6U A;  3SAV A;  3R8F A;  2HL7 A;  3KFU G;  3SAT A;  4AG5 A;  4XK8 F;  3C3D A;  2KZS A;  2XSZ D;  3FD9 A;  1WGN A;  3FUU A;  4I5S A;  1VDD A;  4LRT A;  3E46 A;  3W0L B;  4ZPX A;  3TL4 X;  4PCZ A;  2JZ1 A;  1HQC A;  2LHC A;  1OFI A;  4I8O A;  4LGY A;  2QNJ A;  2OPF A;  1IBM M;  2Z8Y M;  4LFB M;  2CP8 A;  5BR8 M;  4KHP M;  5JI2 E;  3HHW A;  3KDS E;  1EIJ A;  1PJJ A;  4JI8 M;  3J81 S;  2C99 A;  3K9P A;  1WR1 B;  2JUJ A;  1AUA A;  2JY6 B;  3GLI A;  3U6E A;  4GIP A;  2ZAM A;  4K0K M;  4DR6 M;  1E94 E;  4PDG A;  2YQZ A;  2VII A;  1QZM A;  2D7H A;  4QNM A;  4MB7 A;  3HKP A;  3VDU A;  3VKH A;  4B3M M;  3Q8G A;  4REZ A;  3QYB A;  2ZTC A;  5C1B A;  4B08 A;  2WZJ A;  3SAR A;  3I51 A;  3A42 A;  1KYI A;  3B7Z A;  4DBG B;  4JI3 M;  3PXG A;  1TH3 A;  1WGL A;  1LV7 A;  4M9X A;  3GPY A;  3HGI A;  1XNQ M;  2J7N A;  2R0I A;  4LJ8 A;  2ZAO A;  2CRU A;  1QDT A;  5FLX S;  1UFZ A;  2CUZ A;  3GLG E;  1EFU B;  4NSO B;  2KRK A;  1L1T A;  1OKS A;  2ZBK B;  1E32 A;  2JY8 A;  3MMP A;  2L7I A;  2LH0 A;  3GLH A;  4FD2 A;  4DV7 M;  5KQD A;  1NO1 A;  1NY5 A;  2CV0 A;  2LVA A;  5JI3 E;  4JI6 M;  1XNR M;  4JXJ A;  3U5Z B;  3CGW A;  4NSR A;  2FS1 A;  4KT0 F;  1IN8 A;  4B7H A;  3T6P A;  3CF2 A;  4AKH A;  1IN6 A;  3KS4 A;  5BPV A;  2CV1 A;  1SXJ A;  4AG6 A;  3J27 B;  4MGY E;  2L4E A;  4CHT B;  2R62 A;  3GLI E;  2KNZ A;  1Z5C A;  1V92 A;  2HKJ A;  3AFH A;  1Q02 A;  1Z6T A;  2JY7 A;  2QEN A;  3PFI A;  3H4J A;  4LJ5 A;  1IBK M;  3FTE A;  2VF7 A;  3UMM A;  2CE7 A;  2KXE A;  2WSF F;  4LZZ A;  5H37 D;  1NV9 A;  3DOA A;  1PM5 A;  3GLI B;  2XZF A;  5EP4 A;  3AJI B;  3LMM A;  1D0M A;  3HU3 A;  4IBG A;  3KW6 A;  5IZ7 D;  1V34 A;  3GLF B;  4F1I A;  2LVN C;  3VK8 A;  1ZMV A;  3K9O A;  4JI1 M;  4NRV A;  8CAT A;  5L8R F;  1G4A E;  1SXJ E;  2AHM A;  4LJ7 A;  2C98 A;  2DWZ B;  3HZJ A;  4RF0 A;  1NJF A;  1NV8 A;  3HY5 A;  4G6Z A;  3LCU A;  3GQ4 A;  1N34 M;  1L2B A;  5EP3 A;  3WHK A;  3FTF A;  4KO8 A;  2O25 A;  4DR5 M;  1PJS A;  3HJQ A;  4LRS A;  5ITQ A;  3GPP A;  2E5L M;  3E4R A;  3I4V A;  2CV2 A;  3V76 A;  4NXM M;  1E9S A;  2CFO A;  5EXT A;  4DR3 M;  3KVW A;  4GHA A;  3FRH A;  3U6Q A;  3DA1 A;  3AL0 C;  1OTR A;  1IN7 A;  4PT5 A;  2OOA A;  4QOS A;  1Z59 A;  3JR5 A;  1XC8 A;  1SXJ C;  3HHZ A;  4BB9 A;  5DNY A;  4X62 M;  4D82 A;  4G4R A;  4AKG A;  3J2P B;  4LG2 A;  3B74 A;  2L09 A;  2L2D A;  2ZAN A;  3B7N A;  3HWS A;  4R7G A;  4IBE A;  4M9S A;  2JXN A;  5GKN A;  4LFC M;  3U6M A;  2G8L A;  3HU1 A;  4LF7 M;  1QAO A;  3ZC7 B;  1VG5 A;  1AIP C;  4B7F A;  1ZQ9 A;  3UK6 A;  3GRY A;  4LCB A;  1P3Q Q;  4JN6 A;  1VDL A;  3M0E A;  1QUS A;  1YUB A;  1DGB A;  3VFD A;  3D8L A;  4OVZ A;  2DAK A;  1TH4 A;  3BOS A;  1R7R A;  4LJ6 A;  1R4G A;  4FW9 A;  4IBB A;  1A5T A;  3I01 M;  3GPU A;  5EP2 A;  3QYE A;  1N77 A;  4QNR A;  3K8Z A;  2YFQ A;  2DAM A;  3KSJ A;  4QHT A;  1Q3B A;  1SG9 A;  1E9R A;  3LVV A;  3NBI A;  3THG A;  2DEN A;  2LVQ D;  4L6V 6;  3VLF B;  3HJ8 A;  2CHG A;  1QAQ A;  2R44 A;  3ZQJ A;  4HL4 A;  3PVS A;  1DV0 A;  3U6D A;  3RFW A;  4XBO A;  4BLC A;  3MK6 A;  1C7Y A;  4LF8 M;  4L16 A;  2I7P A;  1OJL A;  4EIW A;  1HNZ M;  2UUC M;  2DXI A;  3HU2 A;  3SMS A;  5ITU A;  1T3T A;  4DV5 M;  4S12 A;  1DGH A;  2M5Z A;  3K92 A;  2KEB A;  2J5Y A;  3DFZ A;  5E6J A;  2DKL A;  3SHG B;  2R6F A;  3SFZ A;  2EKK A;  5DFL A;  4IBD A;  1CUK A;  1IY2 A;  2Z4S A;  3FE3 A;  3GO8 A;  3EIE A;  1IXR C;  1GJT A;  2HHH M;  3RGS A;  1QAN A;  4AW4 A;  5FTK A;  4DR2 M;  3KOW E;  2KHH A;  3ZCB B;  2VDB B;  1J5E M;  1J7K A;  2HAK A;  3K1J A;  5IWA M;  1EE8 A;  5ITX A;  3ZH9 B;  1RU3 A;  3T38 A;  2QZ4 A;  3U6C A;  4DR7 M;  2C96 A;  4MGZ E;  3U60 B;  2K47 A;  1WJ7 A;  4FCV A;  3KSX A;  5ITY A;  1HNX M;  3TQS A;  5LMN M;  2FNA A;  1N32 M;  2LVO C;  3BBZ A;  2Y0T A;  4LJ9 A;  1FJG M;  2DZL A;  2L6O A;  3ILK A;  3M7G A;  4GMQ A;  1IXZ A;  2FH0 A;  2Z3X A;  1QVR A;  2DAG A;  3KP1 E;  1NY6 A;  4Z6Y A;  3PNV A;  2KNA A;  4A3V B;  4G4O A;  2J7O A;  4AI6 A;  2H5X A;  2QQ8 A;  3FTC A;  1N78 A;  5ITT A;  3C58 A;  4DR4 M;  2BWB A;  2R18 A;  3CF0 A;  2JY5 A;  4OW0 A;  4G3O A;  2ZM6 M;  2MR9 A;  1OAO C;  1YSY A;  3TE6 A;  3T1Y M;  2XFT A;  3KOX E;  3TWK A;  3U60 A;  3L2A A;  4LF5 M;  5EXS A;  3SAU A;  2UU9 M;  2MRO B;  3NWL A;  5DYI A;  1XB2 B;  2R4J A;  4GC5 A;  2EO2 A;  1ZV1 A;  1JR3 D;  1TDZ A;  1S3S A;  2QBY A;  2DZN B;  2XF3 A;  3E9S A;  3W68 A;  5A2Q S;  3GRU A;  4DR1 M;  1PGY A;  1DO0 A;  4YHH M;  4L78 A;  3UJN A;  1IQP A;  2BJV A;  4LJA A;  3GP1 A;  5LMU M;  4IIW A;  3GLG B;  3I04 M;  1Z5B A;  1DO2 A;  2DAI A;  2QCU A;  1NNJ A;  2FOI C;  1MX0 A;  5EXP A;  5ITR A;  4L15 A;  5IT9 S;  2V1C A;  2BWE A;  1F4I A;  2G5G X;  2XZU A;  2DWN A;  4LF9 M;  2O01 F;  2H1R A;  4GC9 A;  7CAT A;  1L8Q A;  2VF8 A;  5FTM A;  3AV0 A;  4IJE A;  5KPR A;  4M0W A;  1ORY B;  2DVW B;  1G8P A;  1IFY A;  1WHC A;  1OIP A;  4MH0 E;  3JR4 A;  4JI7 M;  3LQQ A;  5C18 A;  4WUR A;  1D0K A;  1G59 A;  3VDP A;  1DGG A;  2F5N A;  1N75 A;  2CWB A;  1HJP A;  1TTE A;  3FYC A;  5DYG A;  3TPZ A;  3GRV A;  2FE8 A;  3GLG A;  3FKE A;  3UGJ A;  3U6L A;  5FTJ A;  1JB0 F;  3QWL A;  1T6O A;  2XH9 A;  4JI5 M;  4B3R M;  2W82 A;  4D81 A;  3GLH B;  4WW0 A;  1IY0 A;  4DV6 M;  1HQY E;  1OAI A;  2C9C A;  3RGP A;  3GPX A;  1QDR A;  4HEO A;  4X64 M;  1JR3 E;  3B89 A;  3LW5 F;  2OQ4 A;  2LXE A;  1BVS A;  2EUC A;  2DZO B;  3RE8 A;  4PD2 A;  1NVM A;  2CEA A;  3K2L A;  4GHL A;  4G4Q A;  4CIZ A;  5FTN A;  4DV3 M;  2L7H A;  4RKU F;  2B3T A;  1SXJ D;  3SBJ A;  3SAW A;  4M0D A;  2LVP C;  1XWI A;  1WIV A;  2C9O A;  4IBF A;  2BJW A;  4P17 A;  4RNA A;  3AOE C;  2N35 A;  4FWG A;  1IN4 A;  2Y0Q A;  2LWX A;  2V6Z M;  4GIT A;  3OTO M;  3LQR A;  4DV4 M;  4PDI A;  3U61 A;  2P5T A;  5ITX E;  2BNK A;  2FFJ A;  3FYD A;  3R9X B;  1WXQ A;  3U5Z A;  4M9Z A;  1N33 M;  1I94 M;  2KZU A;  3CF6 E;  4IJF A;  4MGH A;  2F5S A;  1G71 A;  1ZAE A;  2RKO A;  1TR8 A;  2RGH A;  3FUW A;  5IRE B;  4NL4 H;  4LF6 M;  4AKI A;  1KSF X;  1HT1 E;  1QUT A;  4GKJ M;  1IM2 A;  2MGW A;  4DV1 M;  4II7 A;  1GL7 A;  2DI0 A;  2JWS A;  3L26 A;  4LFA M;  3I4Y A;  1PJQ A;  1NHW C;  2X49 A;  2F5O A;  4NXN M;  1QAM A;  1FNN A;  1YLA A;  2JA2 A;  2Z4R A;  3J80 S;  2EKF A;  4IBK A;  1D2N A;  4ANR A;  3D8B A;  3KXE C;  3QAU A;  1TH2 A;  3VKG A;  3JAM S;  3NBX X;  4IBI A;  2R65 A;  1IY1 A;  4UN2 B;  1IBL M;  2JZ0 A;  1ZMW A;  5E26 A;  4B7G A;  2Q2E B;  2YNM D;  4Q7J A;  2APL A;  5FSW A;  1L2D A;  2XEP A;  3SMP A;  3L25 A;  3IG8 A;  1D0L A;  2KRU A;  3KOY E;  3J7A S;  1GKI A;  1NJG A;  1X37 A;  1NNU C;  4LJ4 A;  5EJC A;  2Y20 A;  3WHL A;  5KO3 A;  3IG5 A;  4F2L A;  4DV2 M;  2CHV A;  2G3Q A;  2A5Y B;  1YE9 A;  1VEG A;  3A98 B;  3TWL A;  3C9P A;  2K6B A;  1KFV A;  2OOB A;  1JQJ C;  3GLF A;  3IEC A;  5KPZ A;  3T15 A;  2R46 A;  5EXX A;  1GO5 A;  4KOD A;  3M6A A;  4X66 M;  2XFS A;  2X4A A;  1R5L A;  1V33 A;  1TDH A;  4CJ6 A;  1GAB A;  3FUV A;  4W5W A;  2WSC F;  3CTW B;  3MJ5 A;  1MN3 A;  1R6B X;  4ITQ A;  1HNW M;  1XMO M;  3B7Q A;  2RGO A;  2XGN A;  3GQ5 A;  1Z5A A;  3B9P A;  3LCV B;  4FWD A;  1G3I A;  2K9D A;  2VQF M;  1QQW A;  2DAE A;  3AOE A;  2KDL A;  3MHV C;  4FWH A;  1G41 A;  3GLH E;  2D7G A;  3PNY A;  5EQT A;  2L4F A;  3C3E A;  2LBC A;  4LY6 A;  1GLN A;  1MJG M;  2X8A A;  2F4V M;  3SYK A;  2F5P A;  4GKK M;  1W5S A;  1N36 M;  4OX9 M;  2MH8 A;  3T1H M;  4YY3 M;  3KP0 E; 
#chains in the Genus database with same CATH homology
 1WR1 B;  2DAM A;  2JUJ A;  2JNH A;  2JY6 B;  1SG9 A;  3E21 A;  2DEN A;  2LVQ D;  1T6O A;  1E94 E;  1HQY E;  1OAI A;  2ZTC A;  4HEO A;  1JR3 E;  1IXS A;  2WZJ A;  1DV0 A;  3B89 A;  1C7Y A;  4GEW A;  1KYI A;  4DBG B;  1BVS A;  1WGL A;  2K0B X;  2R0I A;  1T43 A;  2JP7 A;  1UFZ A;  3GLG E;  1EFU B;  2B3T A;  2DKL A;  2LTU A;  2LVP C;  2EKK A;  1VEJ A;  1WIV A;  1OKS A;  1CUK A;  5DFL A;  3FE3 A;  2JY8 A;  3IHP A;  3MMP A;  2OO9 A;  1VQ1 A;  2RRU A;  3FRI A;  2LVA A;  2KHH A;  2HAK A;  3T6P A;  2HWJ A;  2QSF X;  4WP2 A;  1TR8 A;  2L4E A;  1WJ7 A;  3GLI E;  2KNZ A;  1HT1 E;  1V92 A;  1Q02 A;  1IM2 A;  2JY7 A;  2MGW A;  2LVO C;  3BBZ A;  3H4J A;  2DI0 A;  1OQY A;  2DZL A;  1NV9 A;  1YLA A;  2DAG A;  1Y8G A;  2EKF A;  2KNA A;  3F92 A;  4F1I A;  2LVN C;  2H5X A;  1ZMV A;  3K9O A;  2BWB A;  1G4A E;  2JY5 A;  4G3O A;  4UN2 B;  1ZMW A;  1QZE A;  2JZ0 A;  2DHY A;  1NV8 A;  2MR9 A;  4Q7J A;  4R71 A;  2QHO B;  3LCU A;  2DNA A;  1XXH E;  2MRO B;  2O25 A;  1VEK A;  1XB2 B;  1ZMU A;  1ZV1 A;  3GLF E;  4F2L A;  3FRH A;  2G3Q A;  1PGY A;  1DO0 A;  1VEG A;  2ZTD A;  1OTR A;  2OOB A;  2OOA A;  2KNV A;  3IEC A;  1GO5 A;  1DO2 A;  2DAI A;  1HT2 E;  2EJS A;  2MJ5 B;  2BWE A;  1F4I A;  2L2D A;  1WGN A;  3E46 A;  1MN3 A;  2JZ1 A;  3LCV B;  1VG5 A;  1AIP C;  1G3I A;  2K9D A;  2DAE A;  1IFY A;  1WHC A;  1P3Q Q;  1G41 A;  1VDL A;  2QNJ A;  3GLH E;  2L4F A;  2CP8 A;  2LBC A;  5JI2 E;  2CWB A;  2DAK A;  1HJP A;  1TTE A;  1R4G A;  1A5T A;  3K9P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...