2CPRA

Solution structure of the hrdc domain of human exosome component 10
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Exosome component 10
publication title Solution structure of the HRDC domain of human Exosome component 10
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cprA01
1WUDA 1GO3F 1YT3A 4NLCA 1D8BA 2E1FA 2E1EA 2MA1A 4OO1J 2HBMA 4O3MA 3CYMA 3SAFA 4NLBA 4CDGA 2RHFA 2HBLA 2CPRA 3SAGA 4CGZA 2DGZA 2KV2A 4QIWF 2HBJA 2RRDA 2HBKA 3SAHA 5C0YA 4QJFB
chains in the Genus database with same CATH superfamily
1JRPA 5L1IA 3T79A 1ZOLA 4P4OA 2FMSA 1OW5A 4P4PA 1X9SA 2OH2A 1ZQDA 2R18A 1COOA 2EDUA 3PNCA 5EWFA 5ALFA 4F2RA 1ZQPA 4UASA 1S10A 2KJ9A 2HSZA 1KBUA 2FPMA 5J0PA 4NLZA 3NVVA 3ZDEA 3BZKA 4JWNA 2NRWA 2G5IB 1TAMA 4UW9A 2W9CA 5KFOA 3B0XA 1N48A 4O3PA 3ZDBA 4ICAA 2JGAA 4US9A 4C80A 4FBUA 9ICAA 2UVRA 4UB6U 2NRVA 9ICCA 3N7RC 4C8LA 2ASJA 4QJFB 3JPPA 3KKAA 5HNKA 5DKWA 4F91B 2G06A 4PHEA 3EZ5A 3HT3A 1D9FA 2K89A 1TAQA 3PSFA 2DPIA 3KHGA 4QZHA 4QZIA 4U6PA 2B0CA 3BS5B 1SXEA 1UCVA 3QZ8A 3RRHA 3NVYA 5KG1A 1XWLA 3AN1A 3Q8LA 4DLGA 2KOBA 2JEGA 2W7PA 3KBBA 4JB3A 2F76X 3LVWA 5J8YA 4RQ2A 3BZCA 1MN8A 2R8HA 4DOBA 4DL4A 7ICFA 9ICHA 1K1QA 5DQGA 5DG8A 3RAQA 3PO4A 1BPDA 4DOAA 1U4BA 2G5HB 1QSLA 1Z3EB 5L1KA 4QW8A 5IIMA 4KITB 2A3VA 2FDRA 1L3TA 2DBYA 4PPXA 5DG7A 4DS4A 3PY8A 1P7DA 2E8NA 3UXPA 2KNJA 3MFHA 5KFVA 5TISU 5KFUA 2HHTA 5EE0A 5ALWA 4YN4A 4RUAA 4UAZA 3RJEA 3UXOA 1YZ6A 3C1YA 5AM5A 2JXJA 2YN4A 1NNLA 2MUTB 4B9LA 2A1JA 3ZD9A 2BCQA 5KFNA 5DGAA 3LWLA 2JRZA 2KV2A 3SZ2A 1PVQA 3T5KA 8ICWA 4O3OA 3H8SA 1NZPA 3RF9A 1SL2A 1VDVA 2KN7A 1ED1A 4C4TA 5KFSA 4XA5A 5KFYA 8ICGA 5J0UA 1ZQEA 4TUSA 5KG3A 4P0PB 3I28A 1KDHA 4DSFA 1RQLA 1L3SA 5A0LA 4CRXA 2FPKA 5CP2A 4QWCA 3T5HA 2RQ5A 3PVXA 1NKBA 9ICFA 2K4IA 4A8EA 4M9GA 3H0MB 5ALPA 4PJ0U 4ECUA 7ICTA 3UMGA 5KFZA 2P6UA 2RDJA 5ALGA 4K4HA 4P2HA 2KTQA 3JPOA 1XSLA 3PX0A 3DDHA 2W54A 4YP3A 4LZGA 5ALRA 1CEZA 4NV0A 5AKZA 4ELTA 1T3NA 5AI8A 1S0OA 4IR1A 5J0OA 4QZCA 4ECSA 3AM9A 1HEKA 8ICLA 9ICGA 2PXIA 5AIAA 3H8JA 5ALVA 4G3IA 4KLDA 3QUTA 5AI9A 3GQCA 3WKEA 2P66A 2E8PA 5AKJA 2JMGA 3F53A 3K1ZA 3MDCA 4O3RA 1RQNA 4NL9A 2FPLA 4UB3A 3T5JA 2HHQA 3UQ0A 3RJKA 5J2FA 4R66A 4EENA 3AQFA 3KD3A 4I2AA 3V7KA 2DQNB 3JPNA 1X42A 3JPTA 3CW2C 2H3VA 1L3UA 2IA6A 4DWIA 1ZD2P 5KL8B 4IRDA 5KFIA 3Q8KA 5J8YC 4F3OA 4CF4A 1QH9A 4F72A 4I2IA 1X6IA 4UBBA 8ICIA 4JMUA 2ODGA 3TADA 5IILA 4RQ3A 1X66A 2ZIWB 3LDAA 4B9UA 3D2NA 4CDGA 3QEBZ 2DGZA 5KFTA 3RR7A 4TQSA 1J2MA 1QQ6A 4RQNA 4UB1A 5DLGA 3V6HA 1ZQRA 4DL3A 4QWBA 2I5HA 3PW7A 1ZQGA 3V7LA 4O3QA 2KP7A 3VCBA 4C8KA 2WF7A 3LK9A 4Y2PA 5ALMA 2XGPA 3NRWA 2E8OA 2RHFA 3BS7A 2ZJAA 1ZD4A 4RT2A 2IHNA 3NS1A 5L1JA 3CP8A 3DV9A 3WKBA 4NLCA 4GC7A 1KEJA 4I29A 4FS2A 2XC9A 1A77A 1K1SA 3SENA 2H3IA 2FLPA 2LPEA 3HILA 3LYSA 3BS5A 3SD7A 4Y2TA 8ICXA 1BPZA 4RQ5A 3HP6A 2BKEA 4CF3A 1A76A 2G08A 3PZPA 5AM3A 5EE1A 9ICOA 1IV8A 1MSWD 3L3FX 5CWRA 1UHUA 4MFAA 2EZZA 2LHTA 1AQ6A 3MFIA 5KFQA 1KRPA 1QLNA 3F2BA 5TZVA 5AICA 5L1LA 5AK5A 1QTMA 4MEXA 1HJPA 3TFSA 3HWTA 5KG4A 4AYBF 4LJXA 5KFGA 5AI6A 4RUCA 3PSPA 4PGYA 1SB3C 3MC1A 4GIBA 4J9RA 5DQIA 3KZXA 4NXZA 2YMQA 1XSNA 2VKQA 3KHHA 3ZDDA 3Q8QB 2R8KA 1JI7A 3BQ2A 5J2KA 2JZBB 3OGUA 4O5EA 5HR6A 5IIOA 4I2GA 3RJGA 5ALEA 2HI0A 2KG5A 4O5KA 4JV0A 1RXVA 2IOFA 4UB4A 2NO4A 1T3QA 4RQ1A 1S97A 4NLBA 2MUTA 1OXJA 4DO9A 1NK6A 4NL9C 2W9BB 4EYHB 7ICJA 1COKA 5KT2A 4DS5A 1KKXA 5KFWA 5CRXA 1X2IA 2LM1A 3PSTA 8ICRA 8ICVA 1AROP 4MF8A 4NM1A 4KMUA 4KLIA 5D46A 2F8KA 4KX5A 2LBOA 3GIIA 1UA0A 5KTQA 2UVUA 9ICPA 1B43A 2VJ5A 4QZ8A 5DB9A 1XS9D 1PZNA 3TADC 3N28A 3N4MB 1OUQA 5AK3A 3KHLA 2BCVA 4U7CA 3MBYA 1NK8A 1Y88A 8ICQA 3C21A 5KG7A 1NK0A 8ICJA 2QARB 3HX0A 4ECWA 2ZXIA 1Z4NA 1BPBA 3ETLA 2Y9TA 5EE3A 5ALZA 2EAMA 5KAFU 4M2YA 4DF8A 4UB8U 3SI8A 4RQMA 2DWQA 2XVTA 4DQSA 3SAGA 2ASDA 4EZ6A 4RQ7A 3C29A 3PW5A 1UA1A 3AL0B 1Z19A 4Z6CA 1N56A 3GILA 1XO1A 4EX7A 4KLGA 2BQRA 3MR6A 2W11A 4C8NA 4IRCA 1X6JA 5BPCA 3IP4B 5BOMA 3WK8A 2FLLA 4O3MA 3O0FA 4ED1A 4NLNA 4ED6A 7ICRA 2HOFA 2E3TA 4DCCA 4M9NA 2OXOA 1NK9A 2VA3A 4AP9A 5D49A 1XC9A 5GTIU 4DQIA 5ALTA 2BDUA 4RU9A 4IS7A 2ZIVB 3R9KA 2IHMA 4K4GA 3NUQA 1SKRA 2WAQF 4C4RA 8ICKA 3G6VA 2I6XA 3EPGA 2KEYA 2EAOA 1QQ5A 4F4KA 4YD2A 2W7OA 4RT3A 3NASA 2HHWA 3L4PA 2G09A 2FMQA 2N1RA 4J9LA 4ECVA 9ICBA 2KVCA 4Y2XA 3NGDA 4UB5A 4F8RA 2V4RA 1L5UA 3M6KA 4EYIB 3THVA 7ICNA 2ZIWA 2WF6A 2MRLA 2KZZA 3PX4A 2HHVA 3NVZA 3KOOA 3K4GA 1L7MA 1DK3A 8ICAA 3SAHA 2ES6A 4FZLA 3Q8PB 2XGQA 5AK6A 3ZDCA 1L7NA 1ZD3A 3RTVA 2DF4B 2WB1F 5HMLA 2VIXA 2WHEA 2R8JA 4B9MA 3OSNA 1SV0A 3RR8A 2YB1A 4UARA 1YZ7A 2NRTA 4RPYA 5AKHA 3IDWA 4TURA 4EBEA 4KLOA 1SL1A 2D6FC 4LVSA 4FFDA 2F44A 2B21A 5KFKA 2CXYA 1M6YA 1S77D 4JV1A 2F8LA 2PFNA 9ICMA 5KFLA 4C8OA 4F71A 3DEEA 2RRDA 5KFMA 4KLQA 2KJ8A 1ZQVA 4JK1A 4KLMA 4MEYA 3E2EA 2KZMA 3G6XA 2C2RA 1DGJA 2FE9A 3M8RA 4F2SA 4B6JA 4UAWA 1S0VA 4E0DA 3HKZF 1ZQBA 4R64A 4CGZA 1ZJMA 2JH1A 2HBJA 5CA7A 5DG9A 1ZQMA 4O3SA 3IN5A 3K75D 2BPGA 2KZ3A 3JPSA 3V6JA 3C5FA 5B5EU 4BGDA 2K4EA 2W9AA 5KFCA 2LKYA 1RPLA 1KW4A 2HBLA 2CPRA 1HUZA 3QXGA 4TUPA 1DOQA 1BNOA 1ZYQA 1ZRNA 1S0MA 2JZBA 3RJHA 2D3DA 7ICSA 4J9PA 2AJQA 4PHAA 5BOLA 2K60A 1A6SA 5AKYA 4XQ8A 4YVZA 5KFEA 2WFAA 2JEFA 4DFJA 3MR5A 5J2BA 4F5QA 2ISPA 1ZRMA 3SMVA 4EBDA 5EOZA 2QB0B 3GV8B 1KFTA 2W9BA 3AQEA 4BJQA 4M9HA 5KG0A 5ALNA 8ICZA 1WUDA 1SL0A 1A0PA 3PR4A 1PVPA 1T7PA 2BDPA 2KFZA 3OJSA 3C1ZA 1NJXA 2H3ZA 1N61A 1D8YA 8ICEA 2XY5A 4F50A 5AKEA 4AYBC 4KLJA 4C0ZA 3AMZA 4NY8A 3J81j 2EQYA 2D8CA 2KICA 2IOHA 5J0XA 3UQ2A 3OTQA 3S6JA 4B9NA 2QARA 5ALQA 7ICVA 2UVVA 4M9JA 4ED7A 4YD1A 5JUMA 3H4DA 4BDPA 3CYMA 4O3NA 3RRGA 4DQPA 4J03A 1DK2A 1F0MA 2OCEA 1XSPA 5J2JA 4P0QA 1DXSA 4KLLA 1Z00B 7ICGA 5KT6A 1RYRA 3BQ7A 4FO6A 3KZIU 4I2CA 3D6JA 2KVSA 1N62A 1SV0C 3V6KA 1ZQJA 4EELA 2KSOB 5AI4A 5EWEA 5C5JA 3GIMA 9ICWA 3A0HU 8ICSA 2F1IA 4YCXA 4RNOA 3U26A 4KLUA 1ZQ1C 1FEZA 8ICUA 2L5YA 5ALYA 2EZYA 4KTQA 3GZFA 2H5XA 2B6GA 2KE7A 8ICHA 1N63A 1ZQFA 4KMOB 2GH1A 3JPQA 3KKAC 5AKXA 5E79U 4R8UA 3MABA 2W9MA 2WF5A 1X40A 5DBCA 2HHSA 1V85A 4FE3A 4F5RA 3BQTA 1YT3A 2ZJ8A 2IBKA 1ZQZA 3Q8SB 1FFUA 4QW9A 1UQVA 4GC6A 1CRXA 9ICRA 5J2CA 2DFLA 2ZIXB 3H0LB 2A19A 1X9XA 4DOCA 4Z6FA 3GIKA 1FIQA 1TK0A 4ECQA 2DUYA 5J0RA 5KL1B 5AKIA 3C23A 4C7YA 3ISBA 4QWEA 4J9NA 2E1EA 1IG6A 3RH5A 4KN7A 3WK9A 3KFUF 2H3QA 8ICYA 2V9WA 2LM4A 4I2BA 4MFFA 3MGVA 4YMNA 2BHNA 2DL0A 4KLEA 5J0TA 1ZQXA 1ZQYA 5HHHA 4OCZA 1XU4A 2BR0A 2HW3A 4NLKA 4DFDA 4ED3A 9ICJA 4KN4A 3BQ0A 2JH7A 4BXOB 3N7SC 4F4WA 3RAXA 1D8LA 5JRTA 2EH9A 3OJUA 3BQ1A 2QB1A 1KLNA 4DFMA 4DLEA 4Y2SA 2OM6A 5JTIA 4QZDA 3D2SA 3C5GA 1ZXIA 7ICIA 4PGXA 1TK5A 2BZFA 2W43A 4QIWF 3SEIA 1X9MA 1WCNA 1IIPA 1XNSA 5F9NA 4F4YA 3FYHA 2GWSA 4RZRA 3PMLA 1S76D 3HRDD 3TAQA 2G07A 2VANA 2C28A 9ICNA 5KT5A 3TARA 3ALRA 5ALJA 1KFDA 2F1HA 3CNHA 4PGQA 4M0AA 5L1MA 2VA2A 5KFRA 4G9BA 1TFRA 5DB6A 3JPRA 2LYBA 2JR5A 2HBKA 1SKSA 3F5AA 2BPCA 2DPJA 3MGIA 5JU5A 3M7DA 2QKQA 5J0WA 5AM4A 3WU2U 3M6ZA 1U45A 3M9OB 3M1YA 3ONNA 1Q3VA 4X5VA 5D4BA 2DKZA 3QE9Y 4YFKA 5KT3A 2KK0A 5IINA 1KSPA 2QB0A 1KTQA 2XO7A 1V38A 5J2HA 3ISDA 3F2DA 1N2XA 1ZQQA 4DL6A 3HKZC 4QWAA 5AM2A 3SR6A 1ZQNA 1D9DA 1BNPA 1S5LU 3LWMA 3SAFA 5ALKA 1NKCA 1RM6C 5HP4A 3H8WA 3MR3A 2K4HA 4QZBA 4HAIA 5KNIA 3OHAA 2ZUBA 3WKCA 1D8BA 4DFKA 2UVWA 4ED2A 5J2IA 1S8OA 2AGOA 5ALXA 4ZOHC 1Z1BA 3H40A 4DSJA 1NI3A 3LVVA 4YR3A 1T8EA 5KG5A 4P0PA 2ESEA 3WK5A 1T94A 5ALIA 3GFKB 1Q8KA 5IIIA 4M9LA 3GV7B 4IC9A 2MU2A 5KG6A 4OJLA 5CHGA 2KSOA 3TFRA 3H4BA 3AU2A 4RPXA 7ICEA 4I2JA 1S9FA 1NJWA 1C7YA 4ELUA 4KLHA 5AI5A 3WK7A 2RDIA 5ALLA 3QX7A 3QU7A 4DL5A 1Z1VA 3PW0A 1PVRA 2FJ6A 1U48A 1LKYB 1RYUA 3SV4A 4BWJA 4QNLA 4RQ4A 1URJA 2Y9UA 4F5PA 1RDFA 2YB4A 8ICCA 2JHDA 3ICXA 3GV5B 4FZNA 2HHUA 2W55A 1BGXT 4UAVA 2OHFA 5DB7A 5J0SA 4ECRA 3UPQA 1U49A 5DBBA 1NK4A 1ZQUA 2ZIXA 5ALHA 4UQGA 4EEKA 1MQ3A 5CJ7A 4F4ZA 2XICA 1ZQIA 5DDYA 4LZDA 4IQUA 2HOQA 2ATLA 1GO3F 2W3RA 3ZD8A 1SWVA 2HOIA 2P6RA 7ICHA 3C28A 3ZDAA 2MAXA 2ZXHA 2W3SA 7ICQA 2QLTA 4Y2VA 4UATA 1V9PA 2YY6A 1L6NA 1WWUA 2BQ3A 1QSYA 1PK1B 1CI4A 2E8MA 4DL2A 2KD1A 3RB4A 4DQRA 1MQ2A 7ICUA 1LV5A 4GFJA 2KIVA 4I2EA 9ICQA 1DGSA 2MA1A 2Y1IA 5J2GA 4CE6A 3HPOA 4BXOA 3RB3A 3H8MA 1WG8A 5AKLA 5AIBA 2G0AA 2RP5A 4YXMA 2ZG6A 2ZTDA 9ICLA 3IG8A 7ICOA 4MHVA 1HIWA 2VJ4A 9ICKA 3TACB 3ISCA 2K8BB 3UMCA 2XCPA 1SV4A 4EX6A 2WF8A 4YQWA 3QNMA 4YMOA 4DSEA 1EXNA 4QZAA 4RQ6A 3QUCA 1TK8A 3RFAA 4M6WB 1O03A 3EW9A 4J9QA 3OSPA 2BQUA 4FBTA 1NK5A 5ALUA 1N5XA 4PZOA 4K4IA 1ZD5A 4C8MA 1IXRA 2ASLA 2AQ0A 2DKXA 2YX8A 4F4XA 2HVIA 3H0RB 4GLXA 3N7PD 4P4MA 2PI4A 4I2FA 2NRXA 1ZQHA 2C2DA 1WWVA 4F92B 1FO4A 1F5SA 1SGGA 5CR0A 3RJIA 2IMWP 5ALOA 4J9SA 5J0QA 1UT8A 4Z6DA 4QWDA 3ZI4A 2KHVA 5T14A 3AUOA 5KAIU 4Z6EA 5KFHA 5AK4A 1WCLA 4OJOA 2HVHA 3AEVA 5AM0A 3GIJA 2PMZF 2LYHA 2Q4TA 2M0NA 2LI6A 3E0FA 5J2EA 4ECXA 4QZFA 2KJ5A 2OYYA 4HYKA 3TANA 4XRHA 1JXLA 4CF5A 4IQWA 3KTQA 1BVSA 1B22A 3RBDA 1MC8A 2GOLA 3EUB2 4QIWC 4BUGA 4IR9A 4MFCA 2I1QA 5AKGA 2O6KA 1Q3UA 4MF2A 4Y2JA 3ETRA 3V7JA 1X9WA 4RQ8A 2MSNA 3MR2A 2BPFA 3PW4A 2EAPA 2V4QA 5HHIA 4R63A 2WTFA 1U9LA 4OO1J 5J2DA 5F3XB 1UPHA 2Z7JA 4F5NA 3PMNA 3PO5A 4ECTA 3GDXA 4FZMA 1VJ5A 2FLNA 1JUDA 3GU3A 4QZEA 4I28A 3IRUA 4M47A 9ICXA 1L7PA 8ICMA 2AH5A 5J29A 4KLSA 1JIHA 2HBMA 2Y0SF 2J6UA 1SKWA 2ALZA 4NWIA 2YMPA 1JXEA 3TI0A 2C2EA 3QU4A 1RZTA 4OJ5A 3NRZA 2NYVA 2AQ4A 3RH4A 3EWAA 5DQHA 5KG2A 2ZUDA 3ORYA 4OJ6A 1JX4A 4DFPA 4YG2A 2PKEA 1SIJA 4J9KA 3C2MA 4B9TA 4Y2UA 4NJ8A 3RJJA 1LKYA 1KQQA 4O5CA 1RG6A 4ECYA 3RJFA 2J6TA 4KLTA 5HR7A 2YMLA 2KHQA 5CEHA 4Q8FA 4Q43A 4JV2A 3AU6A 1TV9A 3OPXA 4KX3A 2EZXA 3NVWA 1XO0A 2W8KA 2XCAA 2ZIVA 3TQ1A 1QCKA 4KLFA 2AGQA 4PL1A 2BCRA 1JROA 3SYZA 1NJZA 3N97B 1RYSA 8ICBA 4JWMA 2YMMA 1QSSA 1MA7A 2K4PA 3KHRA 4GXIA 2AXTU 2OEHA 5ALDA 2E1FA 4IQVA 2PFPA 4Y2QA 3M8SA 5G5HA 3Q8MA 3F2CA 3G6YA 1J97A 2BCUA 1PK1A 1Z4OA 1B4FA 4YR2A 4F5OA 2NO5A 4RQ0A 2F2AB 2K8CB 2Q0ZX 5FP0A 5C0YA 5ALSA 4YR0A 1JN3A 2KIWA 3C2LA 3TAPA 2ZTEA 2JEIA 1ECWA 9ICUA 2ZTCA 2JEJA 4IRKA 1ZJNA 4YXJA 5KFDA 2WF9A 4ZH4A 9ICTA 2J6SA 3PR5B 7ICMA 3M9NB 3QUQA 1ZETA 3FAHA 4YMMA 2WAQC 5J2AA 1TE2A 5AI0A 1PUZA 4QZGA 1HUOA 1KFSA 2PFQA 4PHPA 3I76A 3ED5A 5KT7A 3B9JA 2PFOA 1ZQLA 1L8OA 3PW2A 4M6WA 1N5WA 1QQ7A 4WJ3B 2ZIUB 5CB1A 4RPZA 4XUSA 3QU9A 2F1JA 3C2KA 5DBAA 2F3NA 3FDSA 5KFXA 5DLFA 4Y2RA 3QEAZ 2KMDA 4O9MA 9ICIA 4GXKA 4DSIA 5EWGA 4UBCA 2R8GA 1Q46A 2P35A 2OWOA 4UAUA 4J9OA 1TAUA 7ICLA 1ZQOA 1SZPA 5IIKA 3SQIA 4PZNA 2WB1C 5KFJA 4UAYA 4TQRA 5GTHU 2YTUA 2AHOB 3E58A 3Q8RB 2W9CB 2HCFA 3A0BU 1JMSA 4IQTA 1BPYA 3QUBA 4CCHA 2R8IA 8ICTA 3WKAA 4ELVA 2JV3A 2CRXA 5J0YA 2Y1JA 2K8AA 3D2QA 4I2HA 5AM1A 3VC8A 4NLGA 4R65A 5IIJA 3QZ7A 1U47A 2PI5A 4B9SA 4M04A 4BX9C 1BPEA 2HHXA 4EEYA 1S0NA 1JALA 1NOMA 3H7IA 1H38A 3WK6A 5EE9A 1ZQAA 2GO7A 2LYAA 4ECZA 4ACOA 3WKDA 4JUZA 5L9XA 3IHQB 3I1YA 5AHXA 2ZJ5A 1KL9A 2AU0A 3IG5A 1B0XA 5AKKA 3RB6A 2XY7A 2VA8A 2F77X 3QU2A 1BPXA 2H3FA 2LMRA 4IL6U 5K4LA 4DL7A 3PX6A 5DGBA 2XY6A 1TKDA 3RBEA 4Q45A 5B66U 1NZBA 2PMZC 3T5LA 2GLEA 4DQQA 2IOFK 4ED0A 3HW8A 2AGPA 2HDOA 4EZ9A 4OJPA 4QZ9A 4OD0A 4DSKA 1KN5A 1Z00A 3HJEA 4USAA 3FC4A 2KKVA 1K5OA 1SWWA 2NRZA 1F44A 9ICSA 3QYPA 2XIDA 4GXJA 1J2NA 1FFVA 3PV8A 4B9VA 5KFFA 3EPIA 2I9GA 2NV3A 9ICVA 4I2DA 3K1RB 1NJYA 2A1JB 3UXNA 4RNNA 1LB2B 1ZQKA 2E5SA 3WK4A 1SZHA 4DF4A 1CUKA 3OHBA 5KT4A 7ICPA 1DRGA 3RH6A 4Q8EA 4EBCA 4Y2YA 1ZQSA 5F9LA 5DB8A 4I27A 8ICOA 2A1AA 7ICKA 4DSLA 4FS1A 2FI1A 3BJYA 4P0QB 3FM9A 2ZUCA 1LVHA 1N60A 2Y0SC 4PH5A 4DEZA 4TUQA 1UT5A 3RB0A 1RXWA 1TVAA 3B0YA 4UB2A 2M9NA 5KFAA 3M9MB 8ICPA 1ZQWA 3SV3A 1T4GA 3EYZA 2C22A 2KKPA 1L8LA 1VLBA 5KFBA 1O08A 2FMPA 4PHDA 5HMMA 3T3FA 1ZQTA 3V72A 1NKEA 1V97A 3BDPA 2RLTA 5KFPA 1WYGA 2BCSA 3UM9A 4F93B 1SXDA 2W04A 2HMXA 3IV6A 3MGHA 4R8UB 4ED8A 1IM4A 4CNQA 2ISOA 5H2FU 3PSIA 2CN1A 2KFNA 2XI9A 4RNMA 2BGWA 4PL2A 4NM2A 2W03A 3NTUA 2W8LA 4C4SA 4US8A 4O0IA 4Q44A 4C7ZA 1L7OA 3CRXA 3L5KA 3TKAA 9ICEA 5G5GA 1L3VA 1NK7A 8ICNA 1PK3A 3QU5A 1C20A 4BWMA 2EANA 3F5EA 2YQEA 2ZIUA 3MDAA 3UMBA 5DDMA 1ZQCA 3IM1A 8ICFA 4J9MA
chains in the Genus database with same CATH topology
2G09A 3GU3A 2K8AA 1DRGA 3D2QA 4NLCA 2N1RA 3T79A 5CRXA 3HKZC 4NV0A 2KVCA 3VC8A 2KIWA 3PSTA 2G5HB 3M6KA 1ECWA 2OH2A 2HBMA 2JH7A 2K4EA 2R18A 2Y0SF 3SAFA 2YX8A 2LKYA 2ZIXA 2H3IA 4NWIA 4BX9C 2ZIWA 3N7SC 2MRLA 3H0RB 1HEKA 4KX5A 2XICA 3N7PD 2LBOA 2HBLA 3IN5A 2CPRA 4OJ5A 2A3VA 4P0QB 3LYSA 2VJ5A 1ZQ1C 2K4HA 2KJ9A 1KBUA 4OJ6A 2HOQA 3SAHA 2Y0SC 2LYAA 1OUQA 4ACOA 1GO3F 4U7CA 4FZLA 2WAQC 1P7DA 2JMGA 2HOIA 3F53A 3K1ZA 3C28A 1D8BA 2G08A 2KNJA 1A6SA 2G5IB 2OM6A 3GZFA 3PZPA 1TAMA 2ZXIA 3D2SA 2KHVA 2ZXHA 5T14A 2DF4B 2WB1F 3IG5A 3L3FX 2F77X 5C0YA 2H3FA 2VIXA 4KMOB 2GH1A 4ICAA 5HR7A 4OJOA 1Z1BA 3SMVA 2KHQA 2JGAA 2LHTA 3AQFA 1L6NA 3LVVA 2XVTA 3F2BA 2PMZF 2DQNB 2Q4TA 2YB1A 3SAGA 2KV2A 2M0NA 3E0FA 3AQEA 3N7RC 2KKPA 4QIWF 3C29A 4P0PA 1T94A 2H3VA 2KJ5A 2OYYA 4BJQA 3AL0B 2ZIUB 5KL8B 1IIPA 1Z19A 2KD1A 1XNSA 1PVQA 4WJ3B 4FE3A 4QJFB 1WUDA 1YT3A 4GFJA 3OPXA 3RF9A 1A0PA 4AYBF 1NZBA 4KX3A 2G07A 1PVPA 2G06A 4IC9A 3PSPA 1XO0A 1ED1A 2MA1A 2D6FC 2ZIVA 4JMUA 2PMZC 1CRXA 4OJLA 3IP4B 3ALRA 3KZXA 2GOLA 4QIWC 2H3ZA 4O3MA 4BUGA 2ZIXB 3H0LB 2K89A 3O0FA 2ZIWB 3PSFA 4PL1A 2VKQA 1Q3UA 2F8LA 4U6PA 3D2NA 4OJPA 4CDGA 2W04A 2HMXA 4AYBC 2HOFA 4C0ZA 2G0AA 2DGZA 2RP5A 3DEEA 5KL1B 2ZG6A 4P0PB 2LYBA 2RRDA 2HBKA 3F5AA 3PSIA 2OXOA 3SQIA 2CN1A 2KJ8A 3IG8A 1MA7A 2KKVA 2KICA 2WB1C 2XI9A 5A0LA 5HR6A 3M7DA 2BDUA 1F44A 4CRXA 4PL2A 1HIWA 1PVRA 2E1FA 2VJ4A 2W03A 2XIDA 2E1EA 2ZIVB 2K8BB 3M6ZA 3VCBA 2H3QA 3KFUF 3ONNA 3CRXA 4OO1J 3NUQA 1Q3VA 2K4IA 4A8EA 1UPHA 2KOBA 2WAQF 2Z7JA 3CYMA 4QNLA 2CRXA 1URJA 2W7PA 2F76X 3H0MB 2NV3A 3NRWA 3F2CA 4NLBA 3LVWA 3HKZF 2KEYA 2YB4A 3MGVA 2RHFA 2JHDA 2E5SA 3ICXA 4FZMA 4P0QA 4CGZA 2JH1A 3RFAA 1SZHA 2HBJA 2W7OA 4FZNA 3CP8A 3F5EA 2ZIUA 3F2DA 2F2AB 2K8CB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WUD A;  1GO3 F;  1YT3 A;  4NLC A;  1D8B A;  2E1F A;  2E1E A;  2MA1 A;  4OO1 J;  2HBM A;  4O3M A;  3CYM A;  3SAF A;  4NLB A;  4CDG A;  2RHF A;  2HBL A;  2CPR A;  3SAG A;  4CGZ A;  2DGZ A;  2KV2 A;  4QIW F;  2HBJ A;  2RRD A;  2HBK A;  3SAH A;  5C0Y A;  4QJF B; 
#chains in the Genus database with same CATH topology
 1JRP A;  5L1I A;  3T79 A;  1ZOL A;  4P4O A;  2FMS A;  1OW5 A;  4P4P A;  1X9S A;  2OH2 A;  1ZQD A;  2R18 A;  1COO A;  2EDU A;  3PNC A;  5EWF A;  5ALF A;  4F2R A;  1ZQP A;  4UAS A;  1S10 A;  2KJ9 A;  2HSZ A;  1KBU A;  2FPM A;  5J0P A;  4NLZ A;  3NVV A;  3ZDE A;  3BZK A;  4JWN A;  2NRW A;  2G5I B;  1TAM A;  4UW9 A;  2W9C A;  5KFO A;  3B0X A;  1N48 A;  4O3P A;  3ZDB A;  4ICA A;  2JGA A;  4US9 A;  4C80 A;  4FBU A;  9ICA A;  2UVR A;  4UB6 U;  2NRV A;  9ICC A;  3N7R C;  4C8L A;  2ASJ A;  4QJF B;  3JPP A;  3KKA A;  5HNK A;  5DKW A;  4F91 B;  2G06 A;  4PHE A;  3EZ5 A;  3HT3 A;  1D9F A;  2K89 A;  1TAQ A;  3PSF A;  2DPI A;  3KHG A;  4QZH A;  4QZI A;  4U6P A;  2B0C A;  3BS5 B;  1SXE A;  1UCV A;  3QZ8 A;  3RRH A;  3NVY A;  5KG1 A;  1XWL A;  3AN1 A;  3Q8L A;  4DLG A;  2KOB A;  2JEG A;  2W7P A;  3KBB A;  4JB3 A;  2F76 X;  3LVW A;  5J8Y A;  4RQ2 A;  3BZC A;  1MN8 A;  2R8H A;  4DOB A;  4DL4 A;  7ICF A;  9ICH A;  1K1Q A;  5DQG A;  5DG8 A;  3RAQ A;  3PO4 A;  1BPD A;  4DOA A;  1U4B A;  2G5H B;  1QSL A;  1Z3E B;  5L1K A;  4QW8 A;  5IIM A;  4KIT B;  2A3V A;  2FDR A;  1L3T A;  2DBY A;  4PPX A;  5DG7 A;  4DS4 A;  3PY8 A;  1P7D A;  2E8N A;  3UXP A;  2KNJ A;  3MFH A;  5KFV A;  5TIS U;  5KFU A;  2HHT A;  5EE0 A;  5ALW A;  4YN4 A;  4RUA A;  4UAZ A;  3RJE A;  3UXO A;  1YZ6 A;  3C1Y A;  5AM5 A;  2JXJ A;  2YN4 A;  1NNL A;  2MUT B;  4B9L A;  2A1J A;  3ZD9 A;  2BCQ A;  5KFN A;  5DGA A;  3LWL A;  2JRZ A;  2KV2 A;  3SZ2 A;  1PVQ A;  3T5K A;  8ICW A;  4O3O A;  3H8S A;  1NZP A;  3RF9 A;  1SL2 A;  1VDV A;  2KN7 A;  1ED1 A;  4C4T A;  5KFS A;  4XA5 A;  5KFY A;  8ICG A;  5J0U A;  1ZQE A;  4TUS A;  5KG3 A;  4P0P B;  3I28 A;  1KDH A;  4DSF A;  1RQL A;  1L3S A;  5A0L A;  4CRX A;  2FPK A;  5CP2 A;  4QWC A;  3T5H A;  2RQ5 A;  3PVX A;  1NKB A;  9ICF A;  2K4I A;  4A8E A;  4M9G A;  3H0M B;  5ALP A;  4PJ0 U;  4ECU A;  7ICT A;  3UMG A;  5KFZ A;  2P6U A;  2RDJ A;  5ALG A;  4K4H A;  4P2H A;  2KTQ A;  3JPO A;  1XSL A;  3PX0 A;  3DDH A;  2W54 A;  4YP3 A;  4LZG A;  5ALR A;  1CEZ A;  4NV0 A;  5AKZ A;  4ELT A;  1T3N A;  5AI8 A;  1S0O A;  4IR1 A;  5J0O A;  4QZC A;  4ECS A;  3AM9 A;  1HEK A;  8ICL A;  9ICG A;  2PXI A;  5AIA A;  3H8J A;  5ALV A;  4G3I A;  4KLD A;  3QUT A;  5AI9 A;  3GQC A;  3WKE A;  2P66 A;  2E8P A;  5AKJ A;  2JMG A;  3F53 A;  3K1Z A;  3MDC A;  4O3R A;  1RQN A;  4NL9 A;  2FPL A;  4UB3 A;  3T5J A;  2HHQ A;  3UQ0 A;  3RJK A;  5J2F A;  4R66 A;  4EEN A;  3AQF A;  3KD3 A;  4I2A A;  3V7K A;  2DQN B;  3JPN A;  1X42 A;  3JPT A;  3CW2 C;  2H3V A;  1L3U A;  2IA6 A;  4DWI A;  1ZD2 P;  5KL8 B;  4IRD A;  5KFI A;  3Q8K A;  5J8Y C;  4F3O A;  4CF4 A;  1QH9 A;  4F72 A;  4I2I A;  1X6I A;  4UBB A;  8ICI A;  4JMU A;  2ODG A;  3TAD A;  5IIL A;  4RQ3 A;  1X66 A;  2ZIW B;  3LDA A;  4B9U A;  3D2N A;  4CDG A;  3QEB Z;  2DGZ A;  5KFT A;  3RR7 A;  4TQS A;  1J2M A;  1QQ6 A;  4RQN A;  4UB1 A;  5DLG A;  3V6H A;  1ZQR A;  4DL3 A;  4QWB A;  2I5H A;  3PW7 A;  1ZQG A;  3V7L A;  4O3Q A;  2KP7 A;  3VCB A;  4C8K A;  2WF7 A;  3LK9 A;  4Y2P A;  5ALM A;  2XGP A;  3NRW A;  2E8O A;  2RHF A;  3BS7 A;  2ZJA A;  1ZD4 A;  4RT2 A;  2IHN A;  3NS1 A;  5L1J A;  3CP8 A;  3DV9 A;  3WKB A;  4NLC A;  4GC7 A;  1KEJ A;  4I29 A;  4FS2 A;  2XC9 A;  1A77 A;  1K1S A;  3SEN A;  2H3I A;  2FLP A;  2LPE A;  3HIL A;  3LYS A;  3BS5 A;  3SD7 A;  4Y2T A;  8ICX A;  1BPZ A;  4RQ5 A;  3HP6 A;  2BKE A;  4CF3 A;  1A76 A;  2G08 A;  3PZP A;  5AM3 A;  5EE1 A;  9ICO A;  1IV8 A;  1MSW D;  3L3F X;  5CWR A;  1UHU A;  4MFA A;  2EZZ A;  2LHT A;  1AQ6 A;  3MFI A;  5KFQ A;  1KRP A;  1QLN A;  3F2B A;  5TZV A;  5AIC A;  5L1L A;  5AK5 A;  1QTM A;  4MEX A;  1HJP A;  3TFS A;  3HWT A;  5KG4 A;  4AYB F;  4LJX A;  5KFG A;  5AI6 A;  4RUC A;  3PSP A;  4PGY A;  1SB3 C;  3MC1 A;  4GIB A;  4J9R A;  5DQI A;  3KZX A;  4NXZ A;  2YMQ A;  1XSN A;  2VKQ A;  3KHH A;  3ZDD A;  3Q8Q B;  2R8K A;  1JI7 A;  3BQ2 A;  5J2K A;  2JZB B;  3OGU A;  4O5E A;  5HR6 A;  5IIO A;  4I2G A;  3RJG A;  5ALE A;  2HI0 A;  2KG5 A;  4O5K A;  4JV0 A;  1RXV A;  2IOF A;  4UB4 A;  2NO4 A;  1T3Q A;  4RQ1 A;  1S97 A;  4NLB A;  2MUT A;  1OXJ A;  4DO9 A;  1NK6 A;  4NL9 C;  2W9B B;  4EYH B;  7ICJ A;  1COK A;  5KT2 A;  4DS5 A;  1KKX A;  5KFW A;  5CRX A;  1X2I A;  2LM1 A;  3PST A;  8ICR A;  8ICV A;  1ARO P;  4MF8 A;  4NM1 A;  4KMU A;  4KLI A;  5D46 A;  2F8K A;  4KX5 A;  2LBO A;  3GII A;  1UA0 A;  5KTQ A;  2UVU A;  9ICP A;  1B43 A;  2VJ5 A;  4QZ8 A;  5DB9 A;  1XS9 D;  1PZN A;  3TAD C;  3N28 A;  3N4M B;  1OUQ A;  5AK3 A;  3KHL A;  2BCV A;  4U7C A;  3MBY A;  1NK8 A;  1Y88 A;  8ICQ A;  3C21 A;  5KG7 A;  1NK0 A;  8ICJ A;  2QAR B;  3HX0 A;  4ECW A;  2ZXI A;  1Z4N A;  1BPB A;  3ETL A;  2Y9T A;  5EE3 A;  5ALZ A;  2EAM A;  5KAF U;  4M2Y A;  4DF8 A;  4UB8 U;  3SI8 A;  4RQM A;  2DWQ A;  2XVT A;  4DQS A;  3SAG A;  2ASD A;  4EZ6 A;  4RQ7 A;  3C29 A;  3PW5 A;  1UA1 A;  3AL0 B;  1Z19 A;  4Z6C A;  1N56 A;  3GIL A;  1XO1 A;  4EX7 A;  4KLG A;  2BQR A;  3MR6 A;  2W11 A;  4C8N A;  4IRC A;  1X6J A;  5BPC A;  3IP4 B;  5BOM A;  3WK8 A;  2FLL A;  4O3M A;  3O0F A;  4ED1 A;  4NLN A;  4ED6 A;  7ICR A;  2HOF A;  2E3T A;  4DCC A;  4M9N A;  2OXO A;  1NK9 A;  2VA3 A;  4AP9 A;  5D49 A;  1XC9 A;  5GTI U;  4DQI A;  5ALT A;  2BDU A;  4RU9 A;  4IS7 A;  2ZIV B;  3R9K A;  2IHM A;  4K4G A;  3NUQ A;  1SKR A;  2WAQ F;  4C4R A;  8ICK A;  3G6V A;  2I6X A;  3EPG A;  2KEY A;  2EAO A;  1QQ5 A;  4F4K A;  4YD2 A;  2W7O A;  4RT3 A;  3NAS A;  2HHW A;  3L4P A;  2G09 A;  2FMQ A;  2N1R A;  4J9L A;  4ECV A;  9ICB A;  2KVC A;  4Y2X A;  3NGD A;  4UB5 A;  4F8R A;  2V4R A;  1L5U A;  3M6K A;  4EYI B;  3THV A;  7ICN A;  2ZIW A;  2WF6 A;  2MRL A;  2KZZ A;  3PX4 A;  2HHV A;  3NVZ A;  3KOO A;  3K4G A;  1L7M A;  1DK3 A;  8ICA A;  3SAH A;  2ES6 A;  4FZL A;  3Q8P B;  2XGQ A;  5AK6 A;  3ZDC A;  1L7N A;  1ZD3 A;  3RTV A;  2DF4 B;  2WB1 F;  5HML A;  2VIX A;  2WHE A;  2R8J A;  4B9M A;  3OSN A;  1SV0 A;  3RR8 A;  2YB1 A;  4UAR A;  1YZ7 A;  2NRT A;  4RPY A;  5AKH A;  3IDW A;  4TUR A;  4EBE A;  4KLO A;  1SL1 A;  2D6F C;  4LVS A;  4FFD A;  2F44 A;  2B21 A;  5KFK A;  2CXY A;  1M6Y A;  1S77 D;  4JV1 A;  2F8L A;  2PFN A;  9ICM A;  5KFL A;  4C8O A;  4F71 A;  3DEE A;  2RRD A;  5KFM A;  4KLQ A;  2KJ8 A;  1ZQV A;  4JK1 A;  4KLM A;  4MEY A;  3E2E A;  2KZM A;  3G6X A;  2C2R A;  1DGJ A;  2FE9 A;  3M8R A;  4F2S A;  4B6J A;  4UAW A;  1S0V A;  4E0D A;  3HKZ F;  1ZQB A;  4R64 A;  4CGZ A;  1ZJM A;  2JH1 A;  2HBJ A;  5CA7 A;  5DG9 A;  1ZQM A;  4O3S A;  3IN5 A;  3K75 D;  2BPG A;  2KZ3 A;  3JPS A;  3V6J A;  3C5F A;  5B5E U;  4BGD A;  2K4E A;  2W9A A;  5KFC A;  2LKY A;  1RPL A;  1KW4 A;  2HBL A;  2CPR A;  1HUZ A;  3QXG A;  4TUP A;  1DOQ A;  1BNO A;  1ZYQ A;  1ZRN A;  1S0M A;  2JZB A;  3RJH A;  2D3D A;  7ICS A;  4J9P A;  2AJQ A;  4PHA A;  5BOL A;  2K60 A;  1A6S A;  5AKY A;  4XQ8 A;  4YVZ A;  5KFE A;  2WFA A;  2JEF A;  4DFJ A;  3MR5 A;  5J2B A;  4F5Q A;  2ISP A;  1ZRM A;  3SMV A;  4EBD A;  5EOZ A;  2QB0 B;  3GV8 B;  1KFT A;  2W9B A;  3AQE A;  4BJQ A;  4M9H A;  5KG0 A;  5ALN A;  8ICZ A;  1WUD A;  1SL0 A;  1A0P A;  3PR4 A;  1PVP A;  1T7P A;  2BDP A;  2KFZ A;  3OJS A;  3C1Z A;  1NJX A;  2H3Z A;  1N61 A;  1D8Y A;  8ICE A;  2XY5 A;  4F50 A;  5AKE A;  4AYB C;  4KLJ A;  4C0Z A;  3AMZ A;  4NY8 A;  3J81 j;  2EQY A;  2D8C A;  2KIC A;  2IOH A;  5J0X A;  3UQ2 A;  3OTQ A;  3S6J A;  4B9N A;  2QAR A;  5ALQ A;  7ICV A;  2UVV A;  4M9J A;  4ED7 A;  4YD1 A;  5JUM A;  3H4D A;  4BDP A;  3CYM A;  4O3N A;  3RRG A;  4DQP A;  4J03 A;  1DK2 A;  1F0M A;  2OCE A;  1XSP A;  5J2J A;  4P0Q A;  1DXS A;  4KLL A;  1Z00 B;  7ICG A;  5KT6 A;  1RYR A;  3BQ7 A;  4FO6 A;  3KZI U;  4I2C A;  3D6J A;  2KVS A;  1N62 A;  1SV0 C;  3V6K A;  1ZQJ A;  4EEL A;  2KSO B;  5AI4 A;  5EWE A;  5C5J A;  3GIM A;  9ICW A;  3A0H U;  8ICS A;  2F1I A;  4YCX A;  4RNO A;  3U26 A;  4KLU A;  1ZQ1 C;  1FEZ A;  8ICU A;  2L5Y A;  5ALY A;  2EZY A;  4KTQ A;  3GZF A;  2H5X A;  2B6G A;  2KE7 A;  8ICH A;  1N63 A;  1ZQF A;  4KMO B;  2GH1 A;  3JPQ A;  3KKA C;  5AKX A;  5E79 U;  4R8U A;  3MAB A;  2W9M A;  2WF5 A;  1X40 A;  5DBC A;  2HHS A;  1V85 A;  4FE3 A;  4F5R A;  3BQT A;  1YT3 A;  2ZJ8 A;  2IBK A;  1ZQZ A;  3Q8S B;  1FFU A;  4QW9 A;  1UQV A;  4GC6 A;  1CRX A;  9ICR A;  5J2C A;  2DFL A;  2ZIX B;  3H0L B;  2A19 A;  1X9X A;  4DOC A;  4Z6F A;  3GIK A;  1FIQ A;  1TK0 A;  4ECQ A;  2DUY A;  5J0R A;  5KL1 B;  5AKI A;  3C23 A;  4C7Y A;  3ISB A;  4QWE A;  4J9N A;  2E1E A;  1IG6 A;  3RH5 A;  4KN7 A;  3WK9 A;  3KFU F;  2H3Q A;  8ICY A;  2V9W A;  2LM4 A;  4I2B A;  4MFF A;  3MGV A;  4YMN A;  2BHN A;  2DL0 A;  4KLE A;  5J0T A;  1ZQX A;  1ZQY A;  5HHH A;  4OCZ A;  1XU4 A;  2BR0 A;  2HW3 A;  4NLK A;  4DFD A;  4ED3 A;  9ICJ A;  4KN4 A;  3BQ0 A;  2JH7 A;  4BXO B;  3N7S C;  4F4W A;  3RAX A;  1D8L A;  5JRT A;  2EH9 A;  3OJU A;  3BQ1 A;  2QB1 A;  1KLN A;  4DFM A;  4DLE A;  4Y2S A;  2OM6 A;  5JTI A;  4QZD A;  3D2S A;  3C5G A;  1ZXI A;  7ICI A;  4PGX A;  1TK5 A;  2BZF A;  2W43 A;  4QIW F;  3SEI A;  1X9M A;  1WCN A;  1IIP A;  1XNS A;  5F9N A;  4F4Y A;  3FYH A;  2GWS A;  4RZR A;  3PML A;  1S76 D;  3HRD D;  3TAQ A;  2G07 A;  2VAN A;  2C28 A;  9ICN A;  5KT5 A;  3TAR A;  3ALR A;  5ALJ A;  1KFD A;  2F1H A;  3CNH A;  4PGQ A;  4M0A A;  5L1M A;  2VA2 A;  5KFR A;  4G9B A;  1TFR A;  5DB6 A;  3JPR A;  2LYB A;  2JR5 A;  2HBK A;  1SKS A;  3F5A A;  2BPC A;  2DPJ A;  3MGI A;  5JU5 A;  3M7D A;  2QKQ A;  5J0W A;  5AM4 A;  3WU2 U;  3M6Z A;  1U45 A;  3M9O B;  3M1Y A;  3ONN A;  1Q3V A;  4X5V A;  5D4B A;  2DKZ A;  3QE9 Y;  4YFK A;  5KT3 A;  2KK0 A;  5IIN A;  1KSP A;  2QB0 A;  1KTQ A;  2XO7 A;  1V38 A;  5J2H A;  3ISD A;  3F2D A;  1N2X A;  1ZQQ A;  4DL6 A;  3HKZ C;  4QWA A;  5AM2 A;  3SR6 A;  1ZQN A;  1D9D A;  1BNP A;  1S5L U;  3LWM A;  3SAF A;  5ALK A;  1NKC A;  1RM6 C;  5HP4 A;  3H8W A;  3MR3 A;  2K4H A;  4QZB A;  4HAI A;  5KNI A;  3OHA A;  2ZUB A;  3WKC A;  1D8B A;  4DFK A;  2UVW A;  4ED2 A;  5J2I A;  1S8O A;  2AGO A;  5ALX A;  4ZOH C;  1Z1B A;  3H40 A;  4DSJ A;  1NI3 A;  3LVV A;  4YR3 A;  1T8E A;  5KG5 A;  4P0P A;  2ESE A;  3WK5 A;  1T94 A;  5ALI A;  3GFK B;  1Q8K A;  5III A;  4M9L A;  3GV7 B;  4IC9 A;  2MU2 A;  5KG6 A;  4OJL A;  5CHG A;  2KSO A;  3TFR A;  3H4B A;  3AU2 A;  4RPX A;  7ICE A;  4I2J A;  1S9F A;  1NJW A;  1C7Y A;  4ELU A;  4KLH A;  5AI5 A;  3WK7 A;  2RDI A;  5ALL A;  3QX7 A;  3QU7 A;  4DL5 A;  1Z1V A;  3PW0 A;  1PVR A;  2FJ6 A;  1U48 A;  1LKY B;  1RYU A;  3SV4 A;  4BWJ A;  4QNL A;  4RQ4 A;  1URJ A;  2Y9U A;  4F5P A;  1RDF A;  2YB4 A;  8ICC A;  2JHD A;  3ICX A;  3GV5 B;  4FZN A;  2HHU A;  2W55 A;  1BGX T;  4UAV A;  2OHF A;  5DB7 A;  5J0S A;  4ECR A;  3UPQ A;  1U49 A;  5DBB A;  1NK4 A;  1ZQU A;  2ZIX A;  5ALH A;  4UQG A;  4EEK A;  1MQ3 A;  5CJ7 A;  4F4Z A;  2XIC A;  1ZQI A;  5DDY A;  4LZD A;  4IQU A;  2HOQ A;  2ATL A;  1GO3 F;  2W3R A;  3ZD8 A;  1SWV A;  2HOI A;  2P6R A;  7ICH A;  3C28 A;  3ZDA A;  2MAX A;  2ZXH A;  2W3S A;  7ICQ A;  2QLT A;  4Y2V A;  4UAT A;  1V9P A;  2YY6 A;  1L6N A;  1WWU A;  2BQ3 A;  1QSY A;  1PK1 B;  1CI4 A;  2E8M A;  4DL2 A;  2KD1 A;  3RB4 A;  4DQR A;  1MQ2 A;  7ICU A;  1LV5 A;  4GFJ A;  2KIV A;  4I2E A;  9ICQ A;  1DGS A;  2MA1 A;  2Y1I A;  5J2G A;  4CE6 A;  3HPO A;  4BXO A;  3RB3 A;  3H8M A;  1WG8 A;  5AKL A;  5AIB A;  2G0A A;  2RP5 A;  4YXM A;  2ZG6 A;  2ZTD A;  9ICL A;  3IG8 A;  7ICO A;  4MHV A;  1HIW A;  2VJ4 A;  9ICK A;  3TAC B;  3ISC A;  2K8B B;  3UMC A;  2XCP A;  1SV4 A;  4EX6 A;  2WF8 A;  4YQW A;  3QNM A;  4YMO A;  4DSE A;  1EXN A;  4QZA A;  4RQ6 A;  3QUC A;  1TK8 A;  3RFA A;  4M6W B;  1O03 A;  3EW9 A;  4J9Q A;  3OSP A;  2BQU A;  4FBT A;  1NK5 A;  5ALU A;  1N5X A;  4PZO A;  4K4I A;  1ZD5 A;  4C8M A;  1IXR A;  2ASL A;  2AQ0 A;  2DKX A;  2YX8 A;  4F4X A;  2HVI A;  3H0R B;  4GLX A;  3N7P D;  4P4M A;  2PI4 A;  4I2F A;  2NRX A;  1ZQH A;  2C2D A;  1WWV A;  4F92 B;  1FO4 A;  1F5S A;  1SGG A;  5CR0 A;  3RJI A;  2IMW P;  5ALO A;  4J9S A;  5J0Q A;  1UT8 A;  4Z6D A;  4QWD A;  3ZI4 A;  2KHV A;  5T14 A;  3AUO A;  5KAI U;  4Z6E A;  5KFH A;  5AK4 A;  1WCL A;  4OJO A;  2HVH A;  3AEV A;  5AM0 A;  3GIJ A;  2PMZ F;  2LYH A;  2Q4T A;  2M0N A;  2LI6 A;  3E0F A;  5J2E A;  4ECX A;  4QZF A;  2KJ5 A;  2OYY A;  4HYK A;  3TAN A;  4XRH A;  1JXL A;  4CF5 A;  4IQW A;  3KTQ A;  1BVS A;  1B22 A;  3RBD A;  1MC8 A;  2GOL A;  3EUB 2;  4QIW C;  4BUG A;  4IR9 A;  4MFC A;  2I1Q A;  5AKG A;  2O6K A;  1Q3U A;  4MF2 A;  4Y2J A;  3ETR A;  3V7J A;  1X9W A;  4RQ8 A;  2MSN A;  3MR2 A;  2BPF A;  3PW4 A;  2EAP A;  2V4Q A;  5HHI A;  4R63 A;  2WTF A;  1U9L A;  4OO1 J;  5J2D A;  5F3X B;  1UPH A;  2Z7J A;  4F5N A;  3PMN A;  3PO5 A;  4ECT A;  3GDX A;  4FZM A;  1VJ5 A;  2FLN A;  1JUD A;  3GU3 A;  4QZE A;  4I28 A;  3IRU A;  4M47 A;  9ICX A;  1L7P A;  8ICM A;  2AH5 A;  5J29 A;  4KLS A;  1JIH A;  2HBM A;  2Y0S F;  2J6U A;  1SKW A;  2ALZ A;  4NWI A;  2YMP A;  1JXE A;  3TI0 A;  2C2E A;  3QU4 A;  1RZT A;  4OJ5 A;  3NRZ A;  2NYV A;  2AQ4 A;  3RH4 A;  3EWA A;  5DQH A;  5KG2 A;  2ZUD A;  3ORY A;  4OJ6 A;  1JX4 A;  4DFP A;  4YG2 A;  2PKE A;  1SIJ A;  4J9K A;  3C2M A;  4B9T A;  4Y2U A;  4NJ8 A;  3RJJ A;  1LKY A;  1KQQ A;  4O5C A;  1RG6 A;  4ECY A;  3RJF A;  2J6T A;  4KLT A;  5HR7 A;  2YML A;  2KHQ A;  5CEH A;  4Q8F A;  4Q43 A;  4JV2 A;  3AU6 A;  1TV9 A;  3OPX A;  4KX3 A;  2EZX A;  3NVW A;  1XO0 A;  2W8K A;  2XCA A;  2ZIV A;  3TQ1 A;  1QCK A;  4KLF A;  2AGQ A;  4PL1 A;  2BCR A;  1JRO A;  3SYZ A;  1NJZ A;  3N97 B;  1RYS A;  8ICB A;  4JWM A;  2YMM A;  1QSS A;  1MA7 A;  2K4P A;  3KHR A;  4GXI A;  2AXT U;  2OEH A;  5ALD A;  2E1F A;  4IQV A;  2PFP A;  4Y2Q A;  3M8S A;  5G5H A;  3Q8M A;  3F2C A;  3G6Y A;  1J97 A;  2BCU A;  1PK1 A;  1Z4O A;  1B4F A;  4YR2 A;  4F5O A;  2NO5 A;  4RQ0 A;  2F2A B;  2K8C B;  2Q0Z X;  5FP0 A;  5C0Y A;  5ALS A;  4YR0 A;  1JN3 A;  2KIW A;  3C2L A;  3TAP A;  2ZTE A;  2JEI A;  1ECW A;  9ICU A;  2ZTC A;  2JEJ A;  4IRK A;  1ZJN A;  4YXJ A;  5KFD A;  2WF9 A;  4ZH4 A;  9ICT A;  2J6S A;  3PR5 B;  7ICM A;  3M9N B;  3QUQ A;  1ZET A;  3FAH A;  4YMM A;  2WAQ C;  5J2A A;  1TE2 A;  5AI0 A;  1PUZ A;  4QZG A;  1HUO A;  1KFS A;  2PFQ A;  4PHP A;  3I76 A;  3ED5 A;  5KT7 A;  3B9J A;  2PFO A;  1ZQL A;  1L8O A;  3PW2 A;  4M6W A;  1N5W A;  1QQ7 A;  4WJ3 B;  2ZIU B;  5CB1 A;  4RPZ A;  4XUS A;  3QU9 A;  2F1J A;  3C2K A;  5DBA A;  2F3N A;  3FDS A;  5KFX A;  5DLF A;  4Y2R A;  3QEA Z;  2KMD A;  4O9M A;  9ICI A;  4GXK A;  4DSI A;  5EWG A;  4UBC A;  2R8G A;  1Q46 A;  2P35 A;  2OWO A;  4UAU A;  4J9O A;  1TAU A;  7ICL A;  1ZQO A;  1SZP A;  5IIK A;  3SQI A;  4PZN A;  2WB1 C;  5KFJ A;  4UAY A;  4TQR A;  5GTH U;  2YTU A;  2AHO B;  3E58 A;  3Q8R B;  2W9C B;  2HCF A;  3A0B U;  1JMS A;  4IQT A;  1BPY A;  3QUB A;  4CCH A;  2R8I A;  8ICT A;  3WKA A;  4ELV A;  2JV3 A;  2CRX A;  5J0Y A;  2Y1J A;  2K8A A;  3D2Q A;  4I2H A;  5AM1 A;  3VC8 A;  4NLG A;  4R65 A;  5IIJ A;  3QZ7 A;  1U47 A;  2PI5 A;  4B9S A;  4M04 A;  4BX9 C;  1BPE A;  2HHX A;  4EEY A;  1S0N A;  1JAL A;  1NOM A;  3H7I A;  1H38 A;  3WK6 A;  5EE9 A;  1ZQA A;  2GO7 A;  2LYA A;  4ECZ A;  4ACO A;  3WKD A;  4JUZ A;  5L9X A;  3IHQ B;  3I1Y A;  5AHX A;  2ZJ5 A;  1KL9 A;  2AU0 A;  3IG5 A;  1B0X A;  5AKK A;  3RB6 A;  2XY7 A;  2VA8 A;  2F77 X;  3QU2 A;  1BPX A;  2H3F A;  2LMR A;  4IL6 U;  5K4L A;  4DL7 A;  3PX6 A;  5DGB A;  2XY6 A;  1TKD A;  3RBE A;  4Q45 A;  5B66 U;  1NZB A;  2PMZ C;  3T5L A;  2GLE A;  4DQQ A;  2IOF K;  4ED0 A;  3HW8 A;  2AGP A;  2HDO A;  4EZ9 A;  4OJP A;  4QZ9 A;  4OD0 A;  4DSK A;  1KN5 A;  1Z00 A;  3HJE A;  4USA A;  3FC4 A;  2KKV A;  1K5O A;  1SWW A;  2NRZ A;  1F44 A;  9ICS A;  3QYP A;  2XID A;  4GXJ A;  1J2N A;  1FFV A;  3PV8 A;  4B9V A;  5KFF A;  3EPI A;  2I9G A;  2NV3 A;  9ICV A;  4I2D A;  3K1R B;  1NJY A;  2A1J B;  3UXN A;  4RNN A;  1LB2 B;  1ZQK A;  2E5S A;  3WK4 A;  1SZH A;  4DF4 A;  1CUK A;  3OHB A;  5KT4 A;  7ICP A;  1DRG A;  3RH6 A;  4Q8E A;  4EBC A;  4Y2Y A;  1ZQS A;  5F9L A;  5DB8 A;  4I27 A;  8ICO A;  2A1A A;  7ICK A;  4DSL A;  4FS1 A;  2FI1 A;  3BJY A;  4P0Q B;  3FM9 A;  2ZUC A;  1LVH A;  1N60 A;  2Y0S C;  4PH5 A;  4DEZ A;  4TUQ A;  1UT5 A;  3RB0 A;  1RXW A;  1TVA A;  3B0Y A;  4UB2 A;  2M9N A;  5KFA A;  3M9M B;  8ICP A;  1ZQW A;  3SV3 A;  1T4G A;  3EYZ A;  2C22 A;  2KKP A;  1L8L A;  1VLB A;  5KFB A;  1O08 A;  2FMP A;  4PHD A;  5HMM A;  3T3F A;  1ZQT A;  3V72 A;  1NKE A;  1V97 A;  3BDP A;  2RLT A;  5KFP A;  1WYG A;  2BCS A;  3UM9 A;  4F93 B;  1SXD A;  2W04 A;  2HMX A;  3IV6 A;  3MGH A;  4R8U B;  4ED8 A;  1IM4 A;  4CNQ A;  2ISO A;  5H2F U;  3PSI A;  2CN1 A;  2KFN A;  2XI9 A;  4RNM A;  2BGW A;  4PL2 A;  4NM2 A;  2W03 A;  3NTU A;  2W8L A;  4C4S A;  4US8 A;  4O0I A;  4Q44 A;  4C7Z A;  1L7O A;  3CRX A;  3L5K A;  3TKA A;  9ICE A;  5G5G A;  1L3V A;  1NK7 A;  8ICN A;  1PK3 A;  3QU5 A;  1C20 A;  4BWM A;  2EAN A;  3F5E A;  2YQE A;  2ZIU A;  3MDA A;  3UMB A;  5DDM A;  1ZQC A;  3IM1 A;  8ICF A;  4J9M A; 
#chains in the Genus database with same CATH homology
 2G09 A;  3GU3 A;  2K8A A;  1DRG A;  3D2Q A;  4NLC A;  2N1R A;  3T79 A;  5CRX A;  3HKZ C;  4NV0 A;  2KVC A;  3VC8 A;  2KIW A;  3PST A;  2G5H B;  3M6K A;  1ECW A;  2OH2 A;  2HBM A;  2JH7 A;  2K4E A;  2R18 A;  2Y0S F;  3SAF A;  2YX8 A;  2LKY A;  2ZIX A;  2H3I A;  4NWI A;  4BX9 C;  2ZIW A;  3N7S C;  2MRL A;  3H0R B;  1HEK A;  4KX5 A;  2XIC A;  3N7P D;  2LBO A;  2HBL A;  3IN5 A;  2CPR A;  4OJ5 A;  2A3V A;  4P0Q B;  3LYS A;  2VJ5 A;  1ZQ1 C;  2K4H A;  2KJ9 A;  1KBU A;  4OJ6 A;  2HOQ A;  3SAH A;  2Y0S C;  2LYA A;  1OUQ A;  4ACO A;  1GO3 F;  4U7C A;  4FZL A;  2WAQ C;  1P7D A;  2JMG A;  2HOI A;  3F53 A;  3K1Z A;  3C28 A;  1D8B A;  2G08 A;  2KNJ A;  1A6S A;  2G5I B;  2OM6 A;  3GZF A;  3PZP A;  1TAM A;  2ZXI A;  3D2S A;  2KHV A;  2ZXH A;  5T14 A;  2DF4 B;  2WB1 F;  3IG5 A;  3L3F X;  2F77 X;  5C0Y A;  2H3F A;  2VIX A;  4KMO B;  2GH1 A;  4ICA A;  5HR7 A;  4OJO A;  1Z1B A;  3SMV A;  2KHQ A;  2JGA A;  2LHT A;  3AQF A;  1L6N A;  3LVV A;  2XVT A;  3F2B A;  2PMZ F;  2DQN B;  2Q4T A;  2YB1 A;  3SAG A;  2KV2 A;  2M0N A;  3E0F A;  3AQE A;  3N7R C;  2KKP A;  4QIW F;  3C29 A;  4P0P A;  1T94 A;  2H3V A;  2KJ5 A;  2OYY A;  4BJQ A;  3AL0 B;  2ZIU B;  5KL8 B;  1IIP A;  1Z19 A;  2KD1 A;  1XNS A;  1PVQ A;  4WJ3 B;  4FE3 A;  4QJF B;  1WUD A;  1YT3 A;  4GFJ A;  3OPX A;  3RF9 A;  1A0P A;  4AYB F;  1NZB A;  4KX3 A;  2G07 A;  1PVP A;  2G06 A;  4IC9 A;  3PSP A;  1XO0 A;  1ED1 A;  2MA1 A;  2D6F C;  2ZIV A;  4JMU A;  2PMZ C;  1CRX A;  4OJL A;  3IP4 B;  3ALR A;  3KZX A;  2GOL A;  4QIW C;  2H3Z A;  4O3M A;  4BUG A;  2ZIX B;  3H0L B;  2K89 A;  3O0F A;  2ZIW B;  3PSF A;  4PL1 A;  2VKQ A;  1Q3U A;  2F8L A;  4U6P A;  3D2N A;  4OJP A;  4CDG A;  2W04 A;  2HMX A;  4AYB C;  2HOF A;  4C0Z A;  2G0A A;  2DGZ A;  2RP5 A;  3DEE A;  5KL1 B;  2ZG6 A;  4P0P B;  2LYB A;  2RRD A;  2HBK A;  3F5A A;  3PSI A;  2OXO A;  3SQI A;  2CN1 A;  2KJ8 A;  3IG8 A;  1MA7 A;  2KKV A;  2KIC A;  2WB1 C;  2XI9 A;  5A0L A;  5HR6 A;  3M7D A;  2BDU A;  1F44 A;  4CRX A;  4PL2 A;  1HIW A;  1PVR A;  2E1F A;  2VJ4 A;  2W03 A;  2XID A;  2E1E A;  2ZIV B;  2K8B B;  3M6Z A;  3VCB A;  2H3Q A;  3KFU F;  3ONN A;  3CRX A;  4OO1 J;  3NUQ A;  1Q3V A;  2K4I A;  4A8E A;  1UPH A;  2KOB A;  2WAQ F;  2Z7J A;  3CYM A;  4QNL A;  2CRX A;  1URJ A;  2W7P A;  2F76 X;  3H0M B;  2NV3 A;  3NRW A;  3F2C A;  4NLB A;  3LVW A;  3HKZ F;  2KEY A;  2YB4 A;  3MGV A;  2RHF A;  2JHD A;  2E5S A;  3ICX A;  4FZM A;  4P0Q A;  4CGZ A;  2JH1 A;  3RFA A;  1SZH A;  2HBJ A;  2W7O A;  4FZN A;  3CP8 A;  3F5E A;  2ZIU A;  3F2D A;  2F2A B;  2K8C B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...