2CPRA

Solution structure of the hrdc domain of human exosome component 10
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
GSSGSSGKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Solution structure of the HRDC domain of human Exosome component 10
rcsb
source organism Homo sapiens
molecule tags Gene regulation
molecule keywords Exosome component 10
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cprA01
4NLCA 2CPRA 2HBMA 3SAGA 1GO3F 2RHFA 4O3MA 4QJFB 3SAFA 4CGZA 2HBJA 3CYMA 1D8BA 5C0YA 2E1EA 2E1FA 2HBKA 4NLBA 2DGZA 2KV2A 2RRDA 1YT3A 2HBLA 2MA1A 3SAHA 4QIWF 1WUDA 4OO1J 4CDGA
chains in the Genus database with same CATH superfamily
5DB6A 5AKHA 2MRLA 4UATA 1SXEA 1S76D 3N7RC 5KFIA 2P6UA 3Q8QB 8ICVA 3BQ7A 4Y2XA 1DGJA 5AKXA 2XGQA 3IG5A 1QQ6A 2HW3A 1Y88A 5IIIA 2ZG6A 4F5QA 2MUTB 4ECQA 9ICFA 5DBCA 2GOLA 2ZIXA 1UA0A 5KFHA 2BQRA 1DGSA 2ATLA 2OM6A 3JPRA 2KG5A 1JI7A 1QSLA 5G5HA 2XC9A 1N2XA 4UAWA 1SWWA 3ZDCA 4ED2A 5KTQA 1U47A 3K4GA 1Z00A 2FLLA 3A0HU 1K1QA 4QZ8A 2ZTDA 3QUTA 5L1MA 2E1FA 2HBKA 2BGWA 2HOFA 3ZDAA 3PR4A 3PMNA 3I76A 4RZRA 5HHIA 1DRGA 1CEZA 3H0RB 1ZYQA 1ZQUA 2LBOA 1N48A 2FMQA 5L9XA 3KBBA 1ZQWA 3PV8A 4NWIA 1A76A 1ZQZA 2CRXA 2I5HA 4J9KA 5JU5A 2GO7A 2YQEA 2PI5A 4P4MA 4DQIA 2QARB 1L6NA 3GDXA 5ALIA 2IHNA 2YTUA 2HDOA 5J2GA 3BQ1A 3L5KA 5KG6A 1LVHA 2HSZA 5A0LA 3DEEA 5AK3A 3QX7A 1ZD3A 3M9MB 4CF4A 4BXOB 4DOCA 5DLFA 4DSJA 3TAPA 4FBUA 8ICPA 1BPBA 4DSIA 1JXLA 5KFGA 4YD2A 2FPLA 4OJLA 4J9NA 4NLGA 1ZQYA 4B9NA 3KFUF 9ICWA 1NK5A 2KJ9A 4PHPA 9ICPA 2B6GA 4M0AA 5FP0A 2DBYA 2G08A 5J0XA 1L7MA 4RQ4A 9ICTA 4I2GA 3MDCA 4QWDA 2BCVA 3ALRA 2KZ3A 3F5EA 3TANA 3N7SC 2NRVA 1JRPA 5DGBA 4R64A 2W3SA 4F4ZA 1S8OA 5AI6A 4GC6A 4RUCA 4QZ9A 4ELVA 7ICFA 4UBBA 1KRPA 2HHXA 4DQPA 3HX0A 2IA6A 5EE0A 4NJ8A 1UPHA 4OJ6A 1COOA 4DL3A 3NASA 1VDVA 1HUOA 7ICVA 3RB0A 3N4MB 4OCZA 2PFNA 1V97A 9ICRA 1Q3VA 4YFKA 3PY8A 2EANA 1HEKA 7ICTA 4KLIA 1L3VA 2E8NA 5ALZA 2E5SA 2G06A 3JPNA 2ISOA 2QLTA 4M9HA 5ALOA 2CXYA 5KFEA 2JV3A 2MUTA 2W54A 1NKCA 4GXJA 4P2HA 5C0YA 2E1EA 3OHBA 1LB2B 2DGZA 3ETRA 4Y2TA 1SV0C 2ZXIA 4F4YA 4DQQA 2A1AA 3HKZF 2E8PA 2VJ4A 1URJA 3BQ2A 2J6UA 2K4PA 3QUBA 4RQ7A 5EWGA 2BCQA 4YQWA 4DF4A 5ALRA 1UT5A 2EZXA 1BVSA 4ED8A 1Q3UA 2Y1JA 2ZXHA 4NLNA 4I29A 4DOBA 3FDSA 4TQSA 1LV5A 1NZPA 3RJEA 4O3OA 5AI5A 1BPEA 4UB2A 1BPDA 3RFAA 5KG2A 4JV1A 3SR6A 2I1QA 2LHTA 3LK9A 1D8YA 5AHXA 3LVWA 1SL0A 5KNIA 4UQGA 5HNKA 5KFKA 1ED1A 1X9XA 4AYBC 5J2JA 5KG1A 3IG8A 1NJXA 2Q4TA 3OPXA 4OJ5A 7ICSA 5HMMA 3T5LA 4YMMA 1K1SA 4DL7A 5ALSA 2W03A 3UM9A 4M6WA 3AM9A 2F3NA 3E0FA 3C29A 1ZETA 4YMOA 5AK4A 4RPZA 1SZHA 5AKIA 3WK4A 5KFVA 4RQ6A 1PK1B 4KX3A 5J0OA 1RYRA 3VCBA 4ACOA 2KKVA 3V7KA 2H5XA 3EPGA 1IM4A 2R8GA 1B4FA 4JB3A 2FJ6A 4RQ8A 2I6XA 3NUQA 3V6KA 1S77D 4J9LA 4J9SA 3GIJA 5ALPA 2LYAA 8ICIA 5KL8B 3H0LB 3RB4A 9ICXA 3AMZA 4NLKA 3S6JA 4C8LA 4QZBA 4CCHA 2A3VA 5J8YA 4JV2A 4HYKA 4F2RA 2ZTCA 3LWLA 4TUPA 3G6VA 4KN7A 5DB9A 3OGUA 2B0CA 1B43A 3NVYA 1PVRA 1ZQPA 3QU2A 2EZYA 9ICEA 2AHOB 3EZ5A 5HR6A 5KFQA 3N7PD 4GC7A 4UB6U 4QZAA 2W9BA 1WCLA 4I2BA 3H8SA 1ZJNA 1KSPA 1Z3EB 2AJQA 1ZRNA 2P66A 2GH1A 4P4PA 4KMUA 3ZI4A 2K8CB 1MA7A 5ALGA 4XUSA 3RR7A 4YCXA 2M0NA 5EE3A 1Z1BA 3EYZA 1WUDA 5DQIA 1X9MA 2HHSA 2NO5A 2K60A 2KICA 1SGGA 2KK0A 2W55A 2KHVA 5CB1A 5D4BA 5ALWA 4I2HA 4UB3A 4XRHA 3GILA 1BGXT 1LKYA 1XU4A 2W9CA 4RUAA 2E3TA 1X42A 4FS1A 4ECRA 3QE9Y 2ZJ5A 5ALFA 5AKEA 5KG5A 3UXOA 1N5XA 1IV8A 3Q8LA 2ZIWB 2E8OA 4TUSA 4DL5A 4LZDA 1XSLA 4IQWA 5ALYA 4IRCA 4YN4A 2FLNA 4U7CA 4I2AA 2IOFA 2EQYA 4BDPA 4EBEA 1X40A 7ICLA 1ZQ1C 4IC9A 3HKZC 4RU9A 3RJJA 1RYUA 1ZQTA 2W8KA 4B6JA 5DLGA 3C28A 4M6WB 1ZQJA 4MF2A 2RHFA 2ASDA 5J8YC 3H0MB 3F2BA 2KIVA 3C5FA 3RJKA 2KZMA 3EPIA 2G0AA 4PHAA 4PGYA 3TACB 1XSNA 4IQUA 7ICEA 4OD0A 3DV9A 1WG8A 1V38A 4EYHB 5KFLA 3QNMA 3RH6A 4C8MA 2OWOA 3CYMA 3RRHA 1NJZA 4OJOA 3KZIU 2YMLA 4EBDA 1N63A 2A19A 4C4SA 2CN1A 5KG0A 5F9LA 1SXDA 3TADA 4DLEA 4YR0A 5AM0A 5ALJA 2K4HA 4UAZA 8ICHA 7ICQA 1V9PA 4F4WA 1H38A 1T8EA 3K1RB 4DSKA 4PL1A 2HBJA 2AU0A 1SKSA 4RQ2A 5B5EU 2ZIVA 2K4IA 2HI0A 3WK9A 2BKEA 5BPCA 7ICHA 2ZUDA 4YMNA 3C1YA 2ESEA 4O5EA 1FFUA 4FBTA 3F2DA 2ASJA 1XNSA 4FE3A 2WF5A 5F3XB 4EELA 4DLGA 2C22A 2PFPA 3E2EA 1IG6A 2KJ8A 2F1IA 2AGQA 4DL6A 3GU3A 5J29A 1DK3A 3RH5A 2BZFA 2W7OA 2F77X 1P7DA 2BHNA 3H7IA 5KT3A 3HT3A 3PW2A 2J6SA 2QKQA 2IBKA 3WK6A 3KTQA 2WAQC 3Q8KA 4ECXA 9ICBA 2HVHA 1L5UA 2HCFA 5DG7A 3AQEA 2XGPA 2BPCA 3M1YA 3MABA 4FS2A 4ED6A 1XO0A 3ONNA 4IQTA 3C5GA 5ALXA 3H8MA 3PX6A 2W7PA 5ALQA 4GXIA 4IS7A 1TV9A 4EBCA 3H4BA 4C0ZA 2V4QA 4DO9A 5DG9A 3OSNA 5EWEA 1U48A 3SAHA 5CP2A 3WK5A 4BGDA 4ECYA 4Y2VA 2FDRA 2AGPA 1O03A 3IM1A 8ICOA 5CJ7A 4EX6A 3RB6A 3SD7A 1HIWA 4XA5A 4DFMA 1ZQRA 3CP8A 4RPXA 5AIAA 3ZD8A 4KLOA 3MGHA 2AXTU 3NTUA 4C80A 4EZ9A 4A8EA 2KZZA 4F72A 3RAQA 4UASA 4TUQA 2VJ5A 4C8OA 5AKGA 3BJYA 2KSOB 5DGAA 2JRZA 1JALA 2PFOA 9ICSA 8ICTA 3KHGA 3V6HA 3RAXA 5DG8A 2KVSA 2RLTA 3MGIA 2KE7A 1NJWA 9ICJA 5EWFA 5ALNA 1PVQA 2M9NA 5DB7A 1YZ7A 8ICAA 3QU4A 2QB1A 1TAUA 1NOMA 4I2IA 4BJQA 2VA2A 2KKPA 1FO4A 4Y2RA 4KMOB 3KD3A 4UARA 1SB3C 1SL1A 2QB0A 2DUYA 3NS1A 2IOHA 4FZMA 2G07A 3NRZA 4CDGA 1NK4A 1N61A 3QUQA 8ICMA 2BCRA 2H3FA 2UVVA 4PH5A 2NYVA 4LVSA 2XCPA 4KLMA 3IN5A 3QU5A 3OJSA 3V7JA 4GXKA 5J0WA 3A0BU 3O0FA 9ICLA 2LPEA 8ICRA 4Q8FA 1NK0A 2LYHA 5CA7A 3JPOA 2YX8A 4NL9A 5TISU 3M8RA 1A6SA 2MU2A 2PKEA 3BS5A 2DQNB 9ICCA 3ORYA 5IIJA 3PSTA 4TQRA 1ZQCA 2C2RA 3QUCA 5HMLA 4MFCA 1MN8A 2EAPA 3NVVA 5AI0A 5EE9A 3AL0B 2LMRA 4QZFA 4U6PA 5KFRA 2J6TA 1Z19A 1UCVA 1ZRMA 3ISDA 2KEYA 2D8CA 2JEGA 3PX0A 4KLJA 1MC8A 3AQFA 3TKAA 4J03A 1L3UA 3Q8PB 3RTVA 2V9WA 4O9MA 3GV8B 2EDUA 3HPOA 4C7YA 1PZNA 1J97A 2JXJA 3HP6A 4QJFB 3RF9A 2BQUA 1S0MA 1QSSA 5KFTA 8ICYA 3WKBA 4RT2A 4R8UB 3UQ0A 4TURA 3LWMA 4QIWC 5J2BA 2KMDA 4J9PA 5CWRA 3C2LA 4PJ0U 3BQ0A 5KG7A 2NRWA 3M6KA 9ICQA 2AGOA 3M7DA 1D9DA 5J2AA 1ZQEA 4NL9C 1VJ5A 2W04A 5ALDA 8ICZA 4P0QB 2B21A 3SEIA 5KFCA 7ICKA 5KFWA 5KL1B 4UB4A 4EYIB 8ICJA 3QEAZ 1TFRA 3UMCA 4UAUA 1JIHA 2JMGA 3KHRA 1FEZA 2KD1A 4Q43A 5IINA 2NRXA 1AROP 1L7PA 3UMGA 5DQGA 4F5OA 1ZQKA 3MDAA 5F9NA 1UT8A 4DWIA 1X66A 3PMLA 2KJ5A 3TARA 1X9SA 5J0RA 4US8A 4O3NA 1NK9A 2G5IB 4R8UA 1YZ6A 1KEJA 1KFTA 8ICLA 2RQ5A 2P35A 1RPLA 1T3NA 4M9LA 4BWJA 1D9FA 5D49A 1ZQDA 3PO5A 5J0SA 2HBMA 3GZFA 4F4KA 2WB1C 2DKZA 1N60A 1KFDA 2FMPA 2F2AB 2Y9UA 3RR8A 1KKXA 2EAMA 4JMUA 1F44A 3D6JA 2KOBA 1RDFA 1M6YA 3N28A 4B9UA 5JTIA 1F0MA 2R8HA 2G5HB 5KT6A 5AIBA 5B66U 3L3FX 4QWCA 4MFAA 5BOLA 1AQ6A 4J9OA 4I27A 2VA8A 3V7LA 4GLXA 4RQNA 2VANA 2V4RA 3MR2A 1ZD5A 1X9WA 4C8KA 5DKWA 2Y0SF 4MEXA 3N97B 2DWQA 2O6KA 3WKEA 3QU7A 3MR6A 4NY8A 4RNOA 4UAYA 3BS5B 9ICOA 1U9LA 1UHUA 8ICFA 3ED5A 2YY6A 3ETLA 5IIKA 3T5JA 3OHAA 2HHVA 2WF9A 2ALZA 3PZPA 4F8RA 4ED7A 1ZQVA 1TAMA 5G5GA 5IIOA 5KFBA 1NZBA 2OCEA 1QLNA 2YMQA 2OHFA 3UQ2A 1PVPA 4RQ3A 3V72A 3SV4A 5KT7A 2ZJAA 4O5CA 1ZQAA 2Y0SC 4ZH4A 1WWUA 1SL2A 2AQ4A 4IL6U 4DQRA 4PPXA 3AUOA 9ICHA 2PI4A 4NLBA 2A1JB 2ES6A 4UB1A 2R18A 2XI9A 8ICSA 2F8KA 4KLUA 1L8OA 4UW9A 2R8KA 1T3QA 1A0PA 5DBAA 3IRUA 3H8JA 5AKYA 3WKCA 2D6FC 3KKAA 2UVUA 1HUZA 3RJHA 4F71A 2NRTA 5J2EA 4QWEA 2VA3A 1PUZA 2XICA 2E8MA 1ZQFA 1SIJA 2XIDA 2FI1A 7ICUA 2KFNA 4US9A 3EWAA 4DFPA 4NV0A 4RQ5A 3PW5A 5KG4A 2Q0ZX 1ZQNA 5L1IA 9ICGA 4DL2A 5KFDA 1BNPA 4QZDA 3T5HA 3LYSA 4YR2A 2MA1A 5J0TA 5DQHA 3EW9A 2FE9A 4FZLA 4YXMA 4UB5A 4PHDA 1GO3F 1SWVA 7ICRA 5AI4A 4ED3A 3M8SA 4DCCA 3RJIA 1UA1A 5AM2A 2F44A 2OYYA 5AM3A 1KBUA 1Q8KA 9ICMA 4K4IA 2MSNA 1XS9D 3JPTA 4KLQA 4B9MA 3H40A 1NK8A 3ZDDA 2Y9TA 4ECSA 9ICIA 3HILA 2YMMA 4I28A 2DL0A 1J2MA 3SMVA 4C4TA 2LI6A 2ZTEA 4BUGA 5J0UA 4IR9A 3JPPA 2RDIA 2KV2A 3FC4A 1COKA 4F3OA 3LVVA 4JWNA 9ICKA 4QNLA 4Z6EA 1ZQIA 1RG6A 2F1JA 2JEJA 3UPQA 1XO1A 3MGVA 4Q44A 4Q45A 5K4LA 7ICPA 3IHQB 2DPIA 2KVCA 3RRGA 2EZZA 5IILA 2QARA 2C28A 2DFLA 2XCAA 2KTQA 5DB8A 3F5AA 4KLFA 4C4RA 4RNMA 5HR7A 3FM9A 3GIIA 1U45A 4K4HA 4EX7A 4I2CA 2NV3A 5J2FA 4I2EA 4EEYA 3Q8MA 5CRXA 5KFAA 5CEHA 2W43A 2PXIA 4Y2QA 1MQ3A 3ISBA 5J0YA 1SV0A 3RJGA 4MF8A 3GFKB 3R9KA 1Z00B 2WB1F 4B9SA 4RQ1A 5KT4A 3RB3A 3IDWA 4RNNA 3PR5B 3I1YA 4JV0A 1RM6C 1RZTA 1BPXA 2HHQA 2ZIXB 3T79A 3SI8A 3QXGA 4GFJA 4PGQA 2YB4A 4O3RA 3SV3A 5AKKA 4DFDA 2KP7A 5AK6A 3ZD9A 4QZIA 4KLDA 5J2HA 2HMXA 4O3MA 3SAFA 5DDYA 4C8NA 1U4BA 3D2NA 1S0NA 5DBBA 4F4XA 4ELUA 5AI8A 4P0QA 3JPQA 1TK5A 2EH9A 3C21A 4O3SA 3M9NB 3ISCA 4ECVA 4Q8EA 5JUMA 2W9MA 2XO7A 3OTQA 2ZIUB 4F92B 3H4DA 3PW4A 1NKEA 1NKBA 2HVIA 2GWSA 5AM4A 2R8JA 5ALKA 4KLHA 2LM4A 5TZVA 3WKDA 2JH1A 1TK0A 4B9TA 4DSLA 4IQVA 4Y2YA 3CRXA 3GV7B 2FMSA 4YP3A 1S97A 4QZGA 5AM1A 2ZIWA 2LM1A 3WU2U 5J0PA 4QWBA 1KFSA 4O0IA 1ZQHA 2ISPA 1C7YA 4M9GA 5J2DA 2XY5A 3NVWA 2JEFA 3KHHA 2KIWA 1EXNA 2C2DA 1YT3A 3SZ2A 1A77A 1XC9A 3Q8RB 2MAXA 2EAOA 3PVXA 2JZBB 5KG3A 1CUKA 8ICWA 3B9JA 3BZCA 3RBDA 1L7NA 4Z6CA 4BX9C 2KN7A 3L4PA 8ICEA 4DL4A 4NLZA 3BQTA 4Y2SA 2VKQA 4IRDA 1T7PA 4JUZA 3K75D 3OSPA 2HHWA 5KFOA 4XQ8A 1IIPA 4YR3A 3HJEA 4JWMA 4KLTA 1ZQOA 3NRWA 9ICNA 2ZUCA 5KFMA 2W9BB 4YXJA 4NM2A 1MQ2A 7ICNA 3BS7A 3AU6A 1UQVA 2P6RA 2WF7A 2OH2A 1HJPA 4UB8U 4ECWA 4LJXA 4RT3A 1J2NA 3T5KA 1KN5A 4CF5A 2K8BB 3ICXA 1D8LA 1V85A 5AICA 2W9CB 2AQ0A 4P4OA 1IXRA 3M6ZA 1KW4A 3QYPA 4I2DA 7ICMA 2W8LA 4IR1A 4LZGA 4WJ3B 1NK7A 3DDHA 1S0VA 1CI4A 5AI9A 3C2KA 7ICOA 3KHLA 4PZOA 1ZJMA 4P0PA 2WTFA 5AKJA 4DEZA 3MBYA 1VLBA 5C5JA 3TQ1A 2BPGA 2DPJA 1WYGA 2PFQA 2F1HA 1PK3A 3B0YA 5AKZA 2K4EA 4J9MA 4FO6A 3MC1A 2DF4B 5GTIU 4NM1A 2Z7JA 2CPRA 3SAGA 4MFFA 2BDPA 3CNHA 1RXWA 2HOIA 4AYBF 3RJFA 1L7OA 3UXNA 4ECUA 1ZQGA 3H8WA 4YVZA 2NO4A 3OJUA 9ICUA 2HOQA 2F76X 3F53A 1U49A 1KTQA 5KT5A 4ED1A 3FYHA 3QEBZ 4JK1A 1O08A 5J2CA 3PW7A 1Z1VA 3PO4A 2Y1IA 1RXVA 2HHUA 4UBCA 4KLLA 1XWLA 3PSFA 4DSEA 1K5OA 3IV6A 5KAFU 2JHDA 2NRZA 4F91B 5ALLA 1ZQMA 1JROA 2ODGA 2WHEA 4F5RA 1ZOLA 4F5PA 1N62A 4KX5A 1Q46A 3GV5B 5L1KA 1S10A 4KLSA 3UXPA 8ICCA 5KAIU 4QWAA 1DK2A 2L5YA 5KT2A 1QH9A 3D2SA 2BCUA 2K89A 2ASLA 4DF8A 4QW9A 5ALHA 4DFKA 2BQ3A 5DDMA 1QQ7A 5AK5A 1KL9A 1OUQA 1S9FA 1OXJA 3JPSA 5T14A 3HRDD 3PSIA 4YG2A 1C20A 2I9GA 4B9LA 5BOMA 5KFSA 4Z6FA 1OW5A 3SQIA 5AM5A 8ICQA 1BPZA 1X6IA 2RP5A 4M47A 4Z6DA 4ECZA 4M2YA 3C2MA 2OXOA 2YMPA 3PNCA 5EE1A 1L3TA 8ICKA 8ICGA 4USAA 3PSPA 4KLEA 2JR5A 4C7ZA 1N5WA 2FLPA 2GLEA 4ED0A 5D46A 3U26A 2BDUA 3TADC 3VC8A 4EENA 4K4GA 5ALUA 1TK8A 1RQNA 4KTQA 2WF6A 2KSOA 5ALEA 2OEHA 1JXEA 5L1LA 3AEVA 4O3QA 3CW2C 4RQ0A 4G9BA 2H3QA 4QZEA 8ICXA 3BZKA 3TFSA 2F8LA 1S0OA 1QTMA 2FPMA 3KZXA 4I2FA 1BNOA 4EEKA 8ICNA 1ZQXA 1MSWD 3UMBA 1QSYA 1T4GA 2VIXA 4QW8A 2XVTA 3LDAA 4J9QA 3TI0A 3T3FA 2FPKA 3TFRA 8ICUA 4BXOA 1Z4NA 5HHHA 3MR3A 3E58A 3C23A 2A1JA 2JGAA 4FZNA 4PHEA 3GIKA 3NGDA 1NK6A 3TAQA 2LKYA 3RBEA 3WK8A 4BWMA 3ZDBA 1SKWA 2AH5A 2H3IA 3PW0A 5CHGA 2YN4A 5CR0A 1NNLA 2XY6A 4R66A 4M04A 3V6JA 3NVZA 1Z4OA 3KKAC 5HP4A 3IP4B 3EUB2 1L8LA 2H3ZA 4OO1J 1SZPA 2DKXA 3GQCA 2N1RA 4GIBA 4E0DA 8ICBA 1RQLA 1QCKA 1X2IA 3D2QA 7ICJA 4CGZA 1SV4A 4MHVA 5KFZA 2UVRA 1LKYB 2KNJA 3WKAA 1WWVA 3I28A 4M9NA 2PMZC 3M9OB 4DS4A 1TVAA 2IHMA 4DQSA 4KITB 1B22A 2UVWA 2C2EA 4G3IA 3C1ZA 3QU9A 1ECWA 2HHTA 4RPYA 1ZQQA 1FFVA 2JEIA 2IMWP 1CRXA 1N56A 2ZJ8A 4P0PB 1ZQLA 2YB1A 5J2IA 1TAQA 2XY7A 4DOAA 4UAVA 9ICVA 2ZIVB 1XSPA 3MFHA 3MFIA 4OJPA 5KFFA 2WF8A 4HAIA 3B0XA 4O5KA 3K1ZA 1BPYA 1DOQA 5KFXA 4KLGA 5ALTA 3FAHA 5AKLA 3SENA 3BDPA 4EZ6A 1JMSA 3Q8SB 3SYZA 5JRTA 5KFNA 2IOFK 3THVA 2HBLA 4Y2PA 4M9JA 5L1JA 4CRXA 3PX4A 3AU2A 4QZCA 3QZ7A 4NLCA 3HWTA 1DXSA 2R8IA 2WFAA 1JN3A 1SKRA 4PGXA 4J9RA 2KFZA 4PL2A 4YD1A 3F2CA 4KN4A 1KQQA 5J2KA 1X6JA 3MR5A 3QZ8A 4RQMA 4AP9A 2LYBA 3J81j 7ICGA 4Y2JA 1QQ5A 1TKDA 1KDHA 1WCNA 2RRDA 4CF3A 1TE2A 2W3RA 1KLNA 4I2JA 4ELTA 1T94A 1RYSA 4F50A 4Y2UA 5EOZA 1PK1A 1ZQBA 1L3SA 3G6XA 2H3VA 1F5SA 4R63A 1NI3A 2RDJA 1FIQA 4ICAA 4FFDA 1ZD2P 4IRKA 2KHQA 7ICIA 4QZHA 2BR0A 2PMZF 2ZUBA 2BCSA 1ZQSA 1JX4A 4NXZA 2JZBA 1NJYA 2BPFA 3RH4A 5IIMA 2WAQF 3KOOA 5KFPA 4CE6A 2W9AA 4O3PA 5E79U 1D8BA 4R65A 4F2SA 4X5VA 5H2FU 5KFUA 1S5LU 1ZXIA 2W11A 4QIWF 4B9VA 5GTHU 3HW8A 3WK7A 5J0QA 5KFJA 4F93B 2G09A 2D3DA 5ALVA 2K8AA 2QB0B 3AN1A 4MEYA 5ALMA 4PZNA 5KFYA 9ICAA 4DFJA 4F5NA 4DSFA 1JUDA 3GIMA 3ZDEA 1ZD4A 1B0XA 4CNQA 4ZOHC 4ECTA 2JH7A 2ZIUA 4DS5A 3G6YA
chains in the Genus database with same CATH topology
2XIDA 2ZIWA 1OUQA 4NLCA 1P7DA 3L3FX 4OJLA 3C28A 2MRLA 3F5AA 3N7RC 5T14A 4NV0A 3PSIA 2RHFA 4PL2A 4QJFB 3F2CA 4BJQA 3KFUF 3RF9A 2KJ9A 5HR7A 2H3IA 2WAQC 3H0MB 3F2BA 2G08A 2KKPA 2ZXHA 2Y0SF 1Q3UA 3IG5A 2NV3A 2LYBA 4KMOB 2ZG6A 1PVRA 3SQIA 2GOLA 2KIWA 2ZIXA 5CRXA 2K4EA 3ALRA 3AQEA 4QIWC 2RRDA 1YT3A 3LYSA 3F5EA 2MA1A 3N7PD 5HR6A 2OM6A 3N7SC 2DF4B 3VC8A 3IP4B 2H3ZA 2G0AA 3ONNA 4FZMA 4FZLA 2G07A 1XO0A 4OO1J 2RP5A 4CDGA 3RFAA 2Z7JA 2CPRA 3SAGA 1T94A 2LHTA 1GO3F 2N1RA 3LVWA 3M6KA 2H3FA 3M7DA 1ED1A 2W7PA 3PZPA 2OXOA 4AYBC 2WB1F 4BX9C 3D2QA 2HOIA 4AYBF 2GH1A 2W04A 4CGZA 1TAMA 2H3VA 3CYMA 3PSPA 3IG8A 4C0ZA 4OJOA 3IN5A 1NZBA 4P0QB 2Q4TA 3OPXA 2VKQA 2K8CB 2OYYA 4ICAA 2E1FA 2HBKA 4OJ5A 2KNJA 5KL1B 1Z1BA 1MA7A 2HOFA 2JMGA 2KD1A 2KHQA 3O0FA 1KBUA 2PMZC 1DRGA 2HOQA 1IIPA 2ZIXB 3SAHA 3T79A 2F76X 2M0NA 2PMZF 2BDUA 1UPHA 2CN1A 3F53A 3H0RB 4GFJA 1WUDA 2YX8A 4OJ6A 2YB4A 1PVPA 2LBOA 1A6SA 3NRWA 2K4HA 4NWIA 2KJ5A 2KICA 2W03A 1ECWA 2HMXA 2DQNB 4O3MA 2WAQF 2CRXA 2KHVA 3SAFA 2Y0SC 1CRXA 2G5IB 2HBJA 3D2NA 4PL1A 3SMVA 1Q3VA 2OH2A 3E0FA 3C29A 3PSFA 1D8BA 4P0QA 4BUGA 2ZIVA 2K4IA 1HEKA 2H3QA 4NLBA 4P0PB 1SZHA 2KV2A 1HIWA 2F8LA 3KZXA 4KX3A 2YB1A 1L6NA 3PSTA 3CP8A 4QIWF 2K8BB 3VCBA 4ACOA 2KKVA 2E5SA 2ZIVB 2R18A 2JHDA 3ICXA 3LVVA 2ZIWB 4QNLA 2XI9A 3F2DA 2ZIUB 2G06A 2HBMA 3NUQA 3GZFA 2G09A 2VIXA 4OJPA 3M6ZA 3AL0B 4A8EA 2WB1C 2XVTA 4KX5A 2K8AA 3MGVA 4U6PA 5A0LA 2VJ5A 1A0PA 3DEEA 3K1ZA 1Z19A 1XNSA 2D6FC 2LYAA 4WJ3B 4FE3A 2F2AB 2KVCA 2JH1A 4U7CA 2KEYA 5KL8B 3H0LB 5C0YA 2E1EA 4JMUA 1ZQ1C 2DGZA 2KJ8A 4IC9A 1F44A 2KOBA 3AQFA 2ZXIA 3HKZC 2JGAA 2A3VA 2HBLA 4FZNA 2XICA 3CRXA 1PVQA 4CRXA 3HKZF 3GU3A 2JH7A 4P0PA 2K89A 3D2SA 2G5HB 2ZIUA 2VJ4A 2W7OA 1URJA 2F77X 2LKYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLC A;  2CPR A;  2HBM A;  3SAG A;  1GO3 F;  2RHF A;  4O3M A;  4QJF B;  3SAF A;  4CGZ A;  2HBJ A;  3CYM A;  1D8B A;  5C0Y A;  2E1E A;  2E1F A;  2HBK A;  4NLB A;  2DGZ A;  2KV2 A;  2RRD A;  1YT3 A;  2HBL A;  2MA1 A;  3SAH A;  4QIW F;  1WUD A;  4OO1 J;  4CDG A; 
#chains in the Genus database with same CATH topology
 5DB6 A;  5AKH A;  2MRL A;  4UAT A;  1SXE A;  1S76 D;  3N7R C;  5KFI A;  2P6U A;  3Q8Q B;  8ICV A;  3BQ7 A;  4Y2X A;  1DGJ A;  5AKX A;  2XGQ A;  3IG5 A;  1QQ6 A;  2HW3 A;  1Y88 A;  5III A;  2ZG6 A;  4F5Q A;  2MUT B;  4ECQ A;  9ICF A;  5DBC A;  2GOL A;  2ZIX A;  1UA0 A;  5KFH A;  2BQR A;  1DGS A;  2ATL A;  2OM6 A;  3JPR A;  2KG5 A;  1JI7 A;  1QSL A;  5G5H A;  2XC9 A;  1N2X A;  4UAW A;  1SWW A;  3ZDC A;  4ED2 A;  5KTQ A;  1U47 A;  3K4G A;  1Z00 A;  2FLL A;  3A0H U;  1K1Q A;  4QZ8 A;  2ZTD A;  3QUT A;  5L1M A;  2E1F A;  2HBK A;  2BGW A;  2HOF A;  3ZDA A;  3PR4 A;  3PMN A;  3I76 A;  4RZR A;  5HHI A;  1DRG A;  1CEZ A;  3H0R B;  1ZYQ A;  1ZQU A;  2LBO A;  1N48 A;  2FMQ A;  5L9X A;  3KBB A;  1ZQW A;  3PV8 A;  4NWI A;  1A76 A;  1ZQZ A;  2CRX A;  2I5H A;  4J9K A;  5JU5 A;  2GO7 A;  2YQE A;  2PI5 A;  4P4M A;  4DQI A;  2QAR B;  1L6N A;  3GDX A;  5ALI A;  2IHN A;  2YTU A;  2HDO A;  5J2G A;  3BQ1 A;  3L5K A;  5KG6 A;  1LVH A;  2HSZ A;  5A0L A;  3DEE A;  5AK3 A;  3QX7 A;  1ZD3 A;  3M9M B;  4CF4 A;  4BXO B;  4DOC A;  5DLF A;  4DSJ A;  3TAP A;  4FBU A;  8ICP A;  1BPB A;  4DSI A;  1JXL A;  5KFG A;  4YD2 A;  2FPL A;  4OJL A;  4J9N A;  4NLG A;  1ZQY A;  4B9N A;  3KFU F;  9ICW A;  1NK5 A;  2KJ9 A;  4PHP A;  9ICP A;  2B6G A;  4M0A A;  5FP0 A;  2DBY A;  2G08 A;  5J0X A;  1L7M A;  4RQ4 A;  9ICT A;  4I2G A;  3MDC A;  4QWD A;  2BCV A;  3ALR A;  2KZ3 A;  3F5E A;  3TAN A;  3N7S C;  2NRV A;  1JRP A;  5DGB A;  4R64 A;  2W3S A;  4F4Z A;  1S8O A;  5AI6 A;  4GC6 A;  4RUC A;  4QZ9 A;  4ELV A;  7ICF A;  4UBB A;  1KRP A;  2HHX A;  4DQP A;  3HX0 A;  2IA6 A;  5EE0 A;  4NJ8 A;  1UPH A;  4OJ6 A;  1COO A;  4DL3 A;  3NAS A;  1VDV A;  1HUO A;  7ICV A;  3RB0 A;  3N4M B;  4OCZ A;  2PFN A;  1V97 A;  9ICR A;  1Q3V A;  4YFK A;  3PY8 A;  2EAN A;  1HEK A;  7ICT A;  4KLI A;  1L3V A;  2E8N A;  5ALZ A;  2E5S A;  2G06 A;  3JPN A;  2ISO A;  2QLT A;  4M9H A;  5ALO A;  2CXY A;  5KFE A;  2JV3 A;  2MUT A;  2W54 A;  1NKC A;  4GXJ A;  4P2H A;  5C0Y A;  2E1E A;  3OHB A;  1LB2 B;  2DGZ A;  3ETR A;  4Y2T A;  1SV0 C;  2ZXI A;  4F4Y A;  4DQQ A;  2A1A A;  3HKZ F;  2E8P A;  2VJ4 A;  1URJ A;  3BQ2 A;  2J6U A;  2K4P A;  3QUB A;  4RQ7 A;  5EWG A;  2BCQ A;  4YQW A;  4DF4 A;  5ALR A;  1UT5 A;  2EZX A;  1BVS A;  4ED8 A;  1Q3U A;  2Y1J A;  2ZXH A;  4NLN A;  4I29 A;  4DOB A;  3FDS A;  4TQS A;  1LV5 A;  1NZP A;  3RJE A;  4O3O A;  5AI5 A;  1BPE A;  4UB2 A;  1BPD A;  3RFA A;  5KG2 A;  4JV1 A;  3SR6 A;  2I1Q A;  2LHT A;  3LK9 A;  1D8Y A;  5AHX A;  3LVW A;  1SL0 A;  5KNI A;  4UQG A;  5HNK A;  5KFK A;  1ED1 A;  1X9X A;  4AYB C;  5J2J A;  5KG1 A;  3IG8 A;  1NJX A;  2Q4T A;  3OPX A;  4OJ5 A;  7ICS A;  5HMM A;  3T5L A;  4YMM A;  1K1S A;  4DL7 A;  5ALS A;  2W03 A;  3UM9 A;  4M6W A;  3AM9 A;  2F3N A;  3E0F A;  3C29 A;  1ZET A;  4YMO A;  5AK4 A;  4RPZ A;  1SZH A;  5AKI A;  3WK4 A;  5KFV A;  4RQ6 A;  1PK1 B;  4KX3 A;  5J0O A;  1RYR A;  3VCB A;  4ACO A;  2KKV A;  3V7K A;  2H5X A;  3EPG A;  1IM4 A;  2R8G A;  1B4F A;  4JB3 A;  2FJ6 A;  4RQ8 A;  2I6X A;  3NUQ A;  3V6K A;  1S77 D;  4J9L A;  4J9S A;  3GIJ A;  5ALP A;  2LYA A;  8ICI A;  5KL8 B;  3H0L B;  3RB4 A;  9ICX A;  3AMZ A;  4NLK A;  3S6J A;  4C8L A;  4QZB A;  4CCH A;  2A3V A;  5J8Y A;  4JV2 A;  4HYK A;  4F2R A;  2ZTC A;  3LWL A;  4TUP A;  3G6V A;  4KN7 A;  5DB9 A;  3OGU A;  2B0C A;  1B43 A;  3NVY A;  1PVR A;  1ZQP A;  3QU2 A;  2EZY A;  9ICE A;  2AHO B;  3EZ5 A;  5HR6 A;  5KFQ A;  3N7P D;  4GC7 A;  4UB6 U;  4QZA A;  2W9B A;  1WCL A;  4I2B A;  3H8S A;  1ZJN A;  1KSP A;  1Z3E B;  2AJQ A;  1ZRN A;  2P66 A;  2GH1 A;  4P4P A;  4KMU A;  3ZI4 A;  2K8C B;  1MA7 A;  5ALG A;  4XUS A;  3RR7 A;  4YCX A;  2M0N A;  5EE3 A;  1Z1B A;  3EYZ A;  1WUD A;  5DQI A;  1X9M A;  2HHS A;  2NO5 A;  2K60 A;  2KIC A;  1SGG A;  2KK0 A;  2W55 A;  2KHV A;  5CB1 A;  5D4B A;  5ALW A;  4I2H A;  4UB3 A;  4XRH A;  3GIL A;  1BGX T;  1LKY A;  1XU4 A;  2W9C A;  4RUA A;  2E3T A;  1X42 A;  4FS1 A;  4ECR A;  3QE9 Y;  2ZJ5 A;  5ALF A;  5AKE A;  5KG5 A;  3UXO A;  1N5X A;  1IV8 A;  3Q8L A;  2ZIW B;  2E8O A;  4TUS A;  4DL5 A;  4LZD A;  1XSL A;  4IQW A;  5ALY A;  4IRC A;  4YN4 A;  2FLN A;  4U7C A;  4I2A A;  2IOF A;  2EQY A;  4BDP A;  4EBE A;  1X40 A;  7ICL A;  1ZQ1 C;  4IC9 A;  3HKZ C;  4RU9 A;  3RJJ A;  1RYU A;  1ZQT A;  2W8K A;  4B6J A;  5DLG A;  3C28 A;  4M6W B;  1ZQJ A;  4MF2 A;  2RHF A;  2ASD A;  5J8Y C;  3H0M B;  3F2B A;  2KIV A;  3C5F A;  3RJK A;  2KZM A;  3EPI A;  2G0A A;  4PHA A;  4PGY A;  3TAC B;  1XSN A;  4IQU A;  7ICE A;  4OD0 A;  3DV9 A;  1WG8 A;  1V38 A;  4EYH B;  5KFL A;  3QNM A;  3RH6 A;  4C8M A;  2OWO A;  3CYM A;  3RRH A;  1NJZ A;  4OJO A;  3KZI U;  2YML A;  4EBD A;  1N63 A;  2A19 A;  4C4S A;  2CN1 A;  5KG0 A;  5F9L A;  1SXD A;  3TAD A;  4DLE A;  4YR0 A;  5AM0 A;  5ALJ A;  2K4H A;  4UAZ A;  8ICH A;  7ICQ A;  1V9P A;  4F4W A;  1H38 A;  1T8E A;  3K1R B;  4DSK A;  4PL1 A;  2HBJ A;  2AU0 A;  1SKS A;  4RQ2 A;  5B5E U;  2ZIV A;  2K4I A;  2HI0 A;  3WK9 A;  2BKE A;  5BPC A;  7ICH A;  2ZUD A;  4YMN A;  3C1Y A;  2ESE A;  4O5E A;  1FFU A;  4FBT A;  3F2D A;  2ASJ A;  1XNS A;  4FE3 A;  2WF5 A;  5F3X B;  4EEL A;  4DLG A;  2C22 A;  2PFP A;  3E2E A;  1IG6 A;  2KJ8 A;  2F1I A;  2AGQ A;  4DL6 A;  3GU3 A;  5J29 A;  1DK3 A;  3RH5 A;  2BZF A;  2W7O A;  2F77 X;  1P7D A;  2BHN A;  3H7I A;  5KT3 A;  3HT3 A;  3PW2 A;  2J6S A;  2QKQ A;  2IBK A;  3WK6 A;  3KTQ A;  2WAQ C;  3Q8K A;  4ECX A;  9ICB A;  2HVH A;  1L5U A;  2HCF A;  5DG7 A;  3AQE A;  2XGP A;  2BPC A;  3M1Y A;  3MAB A;  4FS2 A;  4ED6 A;  1XO0 A;  3ONN A;  4IQT A;  3C5G A;  5ALX A;  3H8M A;  3PX6 A;  2W7P A;  5ALQ A;  4GXI A;  4IS7 A;  1TV9 A;  4EBC A;  3H4B A;  4C0Z A;  2V4Q A;  4DO9 A;  5DG9 A;  3OSN A;  5EWE A;  1U48 A;  3SAH A;  5CP2 A;  3WK5 A;  4BGD A;  4ECY A;  4Y2V A;  2FDR A;  2AGP A;  1O03 A;  3IM1 A;  8ICO A;  5CJ7 A;  4EX6 A;  3RB6 A;  3SD7 A;  1HIW A;  4XA5 A;  4DFM A;  1ZQR A;  3CP8 A;  4RPX A;  5AIA A;  3ZD8 A;  4KLO A;  3MGH A;  2AXT U;  3NTU A;  4C80 A;  4EZ9 A;  4A8E A;  2KZZ A;  4F72 A;  3RAQ A;  4UAS A;  4TUQ A;  2VJ5 A;  4C8O A;  5AKG A;  3BJY A;  2KSO B;  5DGA A;  2JRZ A;  1JAL A;  2PFO A;  9ICS A;  8ICT A;  3KHG A;  3V6H A;  3RAX A;  5DG8 A;  2KVS A;  2RLT A;  3MGI A;  2KE7 A;  1NJW A;  9ICJ A;  5EWF A;  5ALN A;  1PVQ A;  2M9N A;  5DB7 A;  1YZ7 A;  8ICA A;  3QU4 A;  2QB1 A;  1TAU A;  1NOM A;  4I2I A;  4BJQ A;  2VA2 A;  2KKP A;  1FO4 A;  4Y2R A;  4KMO B;  3KD3 A;  4UAR A;  1SB3 C;  1SL1 A;  2QB0 A;  2DUY A;  3NS1 A;  2IOH A;  4FZM A;  2G07 A;  3NRZ A;  4CDG A;  1NK4 A;  1N61 A;  3QUQ A;  8ICM A;  2BCR A;  2H3F A;  2UVV A;  4PH5 A;  2NYV A;  4LVS A;  2XCP A;  4KLM A;  3IN5 A;  3QU5 A;  3OJS A;  3V7J A;  4GXK A;  5J0W A;  3A0B U;  3O0F A;  9ICL A;  2LPE A;  8ICR A;  4Q8F A;  1NK0 A;  2LYH A;  5CA7 A;  3JPO A;  2YX8 A;  4NL9 A;  5TIS U;  3M8R A;  1A6S A;  2MU2 A;  2PKE A;  3BS5 A;  2DQN B;  9ICC A;  3ORY A;  5IIJ A;  3PST A;  4TQR A;  1ZQC A;  2C2R A;  3QUC A;  5HML A;  4MFC A;  1MN8 A;  2EAP A;  3NVV A;  5AI0 A;  5EE9 A;  3AL0 B;  2LMR A;  4QZF A;  4U6P A;  5KFR A;  2J6T A;  1Z19 A;  1UCV A;  1ZRM A;  3ISD A;  2KEY A;  2D8C A;  2JEG A;  3PX0 A;  4KLJ A;  1MC8 A;  3AQF A;  3TKA A;  4J03 A;  1L3U A;  3Q8P B;  3RTV A;  2V9W A;  4O9M A;  3GV8 B;  2EDU A;  3HPO A;  4C7Y A;  1PZN A;  1J97 A;  2JXJ A;  3HP6 A;  4QJF B;  3RF9 A;  2BQU A;  1S0M A;  1QSS A;  5KFT A;  8ICY A;  3WKB A;  4RT2 A;  4R8U B;  3UQ0 A;  4TUR A;  3LWM A;  4QIW C;  5J2B A;  2KMD A;  4J9P A;  5CWR A;  3C2L A;  4PJ0 U;  3BQ0 A;  5KG7 A;  2NRW A;  3M6K A;  9ICQ A;  2AGO A;  3M7D A;  1D9D A;  5J2A A;  1ZQE A;  4NL9 C;  1VJ5 A;  2W04 A;  5ALD A;  8ICZ A;  4P0Q B;  2B21 A;  3SEI A;  5KFC A;  7ICK A;  5KFW A;  5KL1 B;  4UB4 A;  4EYI B;  8ICJ A;  3QEA Z;  1TFR A;  3UMC A;  4UAU A;  1JIH A;  2JMG A;  3KHR A;  1FEZ A;  2KD1 A;  4Q43 A;  5IIN A;  2NRX A;  1ARO P;  1L7P A;  3UMG A;  5DQG A;  4F5O A;  1ZQK A;  3MDA A;  5F9N A;  1UT8 A;  4DWI A;  1X66 A;  3PML A;  2KJ5 A;  3TAR A;  1X9S A;  5J0R A;  4US8 A;  4O3N A;  1NK9 A;  2G5I B;  4R8U A;  1YZ6 A;  1KEJ A;  1KFT A;  8ICL A;  2RQ5 A;  2P35 A;  1RPL A;  1T3N A;  4M9L A;  4BWJ A;  1D9F A;  5D49 A;  1ZQD A;  3PO5 A;  5J0S A;  2HBM A;  3GZF A;  4F4K A;  2WB1 C;  2DKZ A;  1N60 A;  1KFD A;  2FMP A;  2F2A B;  2Y9U A;  3RR8 A;  1KKX A;  2EAM A;  4JMU A;  1F44 A;  3D6J A;  2KOB A;  1RDF A;  1M6Y A;  3N28 A;  4B9U A;  5JTI A;  1F0M A;  2R8H A;  2G5H B;  5KT6 A;  5AIB A;  5B66 U;  3L3F X;  4QWC A;  4MFA A;  5BOL A;  1AQ6 A;  4J9O A;  4I27 A;  2VA8 A;  3V7L A;  4GLX A;  4RQN A;  2VAN A;  2V4R A;  3MR2 A;  1ZD5 A;  1X9W A;  4C8K A;  5DKW A;  2Y0S F;  4MEX A;  3N97 B;  2DWQ A;  2O6K A;  3WKE A;  3QU7 A;  3MR6 A;  4NY8 A;  4RNO A;  4UAY A;  3BS5 B;  9ICO A;  1U9L A;  1UHU A;  8ICF A;  3ED5 A;  2YY6 A;  3ETL A;  5IIK A;  3T5J A;  3OHA A;  2HHV A;  2WF9 A;  2ALZ A;  3PZP A;  4F8R A;  4ED7 A;  1ZQV A;  1TAM A;  5G5G A;  5IIO A;  5KFB A;  1NZB A;  2OCE A;  1QLN A;  2YMQ A;  2OHF A;  3UQ2 A;  1PVP A;  4RQ3 A;  3V72 A;  3SV4 A;  5KT7 A;  2ZJA A;  4O5C A;  1ZQA A;  2Y0S C;  4ZH4 A;  1WWU A;  1SL2 A;  2AQ4 A;  4IL6 U;  4DQR A;  4PPX A;  3AUO A;  9ICH A;  2PI4 A;  4NLB A;  2A1J B;  2ES6 A;  4UB1 A;  2R18 A;  2XI9 A;  8ICS A;  2F8K A;  4KLU A;  1L8O A;  4UW9 A;  2R8K A;  1T3Q A;  1A0P A;  5DBA A;  3IRU A;  3H8J A;  5AKY A;  3WKC A;  2D6F C;  3KKA A;  2UVU A;  1HUZ A;  3RJH A;  4F71 A;  2NRT A;  5J2E A;  4QWE A;  2VA3 A;  1PUZ A;  2XIC A;  2E8M A;  1ZQF A;  1SIJ A;  2XID A;  2FI1 A;  7ICU A;  2KFN A;  4US9 A;  3EWA A;  4DFP A;  4NV0 A;  4RQ5 A;  3PW5 A;  5KG4 A;  2Q0Z X;  1ZQN A;  5L1I A;  9ICG A;  4DL2 A;  5KFD A;  1BNP A;  4QZD A;  3T5H A;  3LYS A;  4YR2 A;  2MA1 A;  5J0T A;  5DQH A;  3EW9 A;  2FE9 A;  4FZL A;  4YXM A;  4UB5 A;  4PHD A;  1GO3 F;  1SWV A;  7ICR A;  5AI4 A;  4ED3 A;  3M8S A;  4DCC A;  3RJI A;  1UA1 A;  5AM2 A;  2F44 A;  2OYY A;  5AM3 A;  1KBU A;  1Q8K A;  9ICM A;  4K4I A;  2MSN A;  1XS9 D;  3JPT A;  4KLQ A;  4B9M A;  3H40 A;  1NK8 A;  3ZDD A;  2Y9T A;  4ECS A;  9ICI A;  3HIL A;  2YMM A;  4I28 A;  2DL0 A;  1J2M A;  3SMV A;  4C4T A;  2LI6 A;  2ZTE A;  4BUG A;  5J0U A;  4IR9 A;  3JPP A;  2RDI A;  2KV2 A;  3FC4 A;  1COK A;  4F3O A;  3LVV A;  4JWN A;  9ICK A;  4QNL A;  4Z6E A;  1ZQI A;  1RG6 A;  2F1J A;  2JEJ A;  3UPQ A;  1XO1 A;  3MGV A;  4Q44 A;  4Q45 A;  5K4L A;  7ICP A;  3IHQ B;  2DPI A;  2KVC A;  3RRG A;  2EZZ A;  5IIL A;  2QAR A;  2C28 A;  2DFL A;  2XCA A;  2KTQ A;  5DB8 A;  3F5A A;  4KLF A;  4C4R A;  4RNM A;  5HR7 A;  3FM9 A;  3GII A;  1U45 A;  4K4H A;  4EX7 A;  4I2C A;  2NV3 A;  5J2F A;  4I2E A;  4EEY A;  3Q8M A;  5CRX A;  5KFA A;  5CEH A;  2W43 A;  2PXI A;  4Y2Q A;  1MQ3 A;  3ISB A;  5J0Y A;  1SV0 A;  3RJG A;  4MF8 A;  3GFK B;  3R9K A;  1Z00 B;  2WB1 F;  4B9S A;  4RQ1 A;  5KT4 A;  3RB3 A;  3IDW A;  4RNN A;  3PR5 B;  3I1Y A;  4JV0 A;  1RM6 C;  1RZT A;  1BPX A;  2HHQ A;  2ZIX B;  3T79 A;  3SI8 A;  3QXG A;  4GFJ A;  4PGQ A;  2YB4 A;  4O3R A;  3SV3 A;  5AKK A;  4DFD A;  2KP7 A;  5AK6 A;  3ZD9 A;  4QZI A;  4KLD A;  5J2H A;  2HMX A;  4O3M A;  3SAF A;  5DDY A;  4C8N A;  1U4B A;  3D2N A;  1S0N A;  5DBB A;  4F4X A;  4ELU A;  5AI8 A;  4P0Q A;  3JPQ A;  1TK5 A;  2EH9 A;  3C21 A;  4O3S A;  3M9N B;  3ISC A;  4ECV A;  4Q8E A;  5JUM A;  2W9M A;  2XO7 A;  3OTQ A;  2ZIU B;  4F92 B;  3H4D A;  3PW4 A;  1NKE A;  1NKB A;  2HVI A;  2GWS A;  5AM4 A;  2R8J A;  5ALK A;  4KLH A;  2LM4 A;  5TZV A;  3WKD A;  2JH1 A;  1TK0 A;  4B9T A;  4DSL A;  4IQV A;  4Y2Y A;  3CRX A;  3GV7 B;  2FMS A;  4YP3 A;  1S97 A;  4QZG A;  5AM1 A;  2ZIW A;  2LM1 A;  3WU2 U;  5J0P A;  4QWB A;  1KFS A;  4O0I A;  1ZQH A;  2ISP A;  1C7Y A;  4M9G A;  5J2D A;  2XY5 A;  3NVW A;  2JEF A;  3KHH A;  2KIW A;  1EXN A;  2C2D A;  1YT3 A;  3SZ2 A;  1A77 A;  1XC9 A;  3Q8R B;  2MAX A;  2EAO A;  3PVX A;  2JZB B;  5KG3 A;  1CUK A;  8ICW A;  3B9J A;  3BZC A;  3RBD A;  1L7N A;  4Z6C A;  4BX9 C;  2KN7 A;  3L4P A;  8ICE A;  4DL4 A;  4NLZ A;  3BQT A;  4Y2S A;  2VKQ A;  4IRD A;  1T7P A;  4JUZ A;  3K75 D;  3OSP A;  2HHW A;  5KFO A;  4XQ8 A;  1IIP A;  4YR3 A;  3HJE A;  4JWM A;  4KLT A;  1ZQO A;  3NRW A;  9ICN A;  2ZUC A;  5KFM A;  2W9B B;  4YXJ A;  4NM2 A;  1MQ2 A;  7ICN A;  3BS7 A;  3AU6 A;  1UQV A;  2P6R A;  2WF7 A;  2OH2 A;  1HJP A;  4UB8 U;  4ECW A;  4LJX A;  4RT3 A;  1J2N A;  3T5K A;  1KN5 A;  4CF5 A;  2K8B B;  3ICX A;  1D8L A;  1V85 A;  5AIC A;  2W9C B;  2AQ0 A;  4P4O A;  1IXR A;  3M6Z A;  1KW4 A;  3QYP A;  4I2D A;  7ICM A;  2W8L A;  4IR1 A;  4LZG A;  4WJ3 B;  1NK7 A;  3DDH A;  1S0V A;  1CI4 A;  5AI9 A;  3C2K A;  7ICO A;  3KHL A;  4PZO A;  1ZJM A;  4P0P A;  2WTF A;  5AKJ A;  4DEZ A;  3MBY A;  1VLB A;  5C5J A;  3TQ1 A;  2BPG A;  2DPJ A;  1WYG A;  2PFQ A;  2F1H A;  1PK3 A;  3B0Y A;  5AKZ A;  2K4E A;  4J9M A;  4FO6 A;  3MC1 A;  2DF4 B;  5GTI U;  4NM1 A;  2Z7J A;  2CPR A;  3SAG A;  4MFF A;  2BDP A;  3CNH A;  1RXW A;  2HOI A;  4AYB F;  3RJF A;  1L7O A;  3UXN A;  4ECU A;  1ZQG A;  3H8W A;  4YVZ A;  2NO4 A;  3OJU A;  9ICU A;  2HOQ A;  2F76 X;  3F53 A;  1U49 A;  1KTQ A;  5KT5 A;  4ED1 A;  3FYH A;  3QEB Z;  4JK1 A;  1O08 A;  5J2C A;  3PW7 A;  1Z1V A;  3PO4 A;  2Y1I A;  1RXV A;  2HHU A;  4UBC A;  4KLL A;  1XWL A;  3PSF A;  4DSE A;  1K5O A;  3IV6 A;  5KAF U;  2JHD A;  2NRZ A;  4F91 B;  5ALL A;  1ZQM A;  1JRO A;  2ODG A;  2WHE A;  4F5R A;  1ZOL A;  4F5P A;  1N62 A;  4KX5 A;  1Q46 A;  3GV5 B;  5L1K A;  1S10 A;  4KLS A;  3UXP A;  8ICC A;  5KAI U;  4QWA A;  1DK2 A;  2L5Y A;  5KT2 A;  1QH9 A;  3D2S A;  2BCU A;  2K89 A;  2ASL A;  4DF8 A;  4QW9 A;  5ALH A;  4DFK A;  2BQ3 A;  5DDM A;  1QQ7 A;  5AK5 A;  1KL9 A;  1OUQ A;  1S9F A;  1OXJ A;  3JPS A;  5T14 A;  3HRD D;  3PSI A;  4YG2 A;  1C20 A;  2I9G A;  4B9L A;  5BOM A;  5KFS A;  4Z6F A;  1OW5 A;  3SQI A;  5AM5 A;  8ICQ A;  1BPZ A;  1X6I A;  2RP5 A;  4M47 A;  4Z6D A;  4ECZ A;  4M2Y A;  3C2M A;  2OXO A;  2YMP A;  3PNC A;  5EE1 A;  1L3T A;  8ICK A;  8ICG A;  4USA A;  3PSP A;  4KLE A;  2JR5 A;  4C7Z A;  1N5W A;  2FLP A;  2GLE A;  4ED0 A;  5D46 A;  3U26 A;  2BDU A;  3TAD C;  3VC8 A;  4EEN A;  4K4G A;  5ALU A;  1TK8 A;  1RQN A;  4KTQ A;  2WF6 A;  2KSO A;  5ALE A;  2OEH A;  1JXE A;  5L1L A;  3AEV A;  4O3Q A;  3CW2 C;  4RQ0 A;  4G9B A;  2H3Q A;  4QZE A;  8ICX A;  3BZK A;  3TFS A;  2F8L A;  1S0O A;  1QTM A;  2FPM A;  3KZX A;  4I2F A;  1BNO A;  4EEK A;  8ICN A;  1ZQX A;  1MSW D;  3UMB A;  1QSY A;  1T4G A;  2VIX A;  4QW8 A;  2XVT A;  3LDA A;  4J9Q A;  3TI0 A;  3T3F A;  2FPK A;  3TFR A;  8ICU A;  4BXO A;  1Z4N A;  5HHH A;  3MR3 A;  3E58 A;  3C23 A;  2A1J A;  2JGA A;  4FZN A;  4PHE A;  3GIK A;  3NGD A;  1NK6 A;  3TAQ A;  2LKY A;  3RBE A;  3WK8 A;  4BWM A;  3ZDB A;  1SKW A;  2AH5 A;  2H3I A;  3PW0 A;  5CHG A;  2YN4 A;  5CR0 A;  1NNL A;  2XY6 A;  4R66 A;  4M04 A;  3V6J A;  3NVZ A;  1Z4O A;  3KKA C;  5HP4 A;  3IP4 B;  3EUB 2;  1L8L A;  2H3Z A;  4OO1 J;  1SZP A;  2DKX A;  3GQC A;  2N1R A;  4GIB A;  4E0D A;  8ICB A;  1RQL A;  1QCK A;  1X2I A;  3D2Q A;  7ICJ A;  4CGZ A;  1SV4 A;  4MHV A;  5KFZ A;  2UVR A;  1LKY B;  2KNJ A;  3WKA A;  1WWV A;  3I28 A;  4M9N A;  2PMZ C;  3M9O B;  4DS4 A;  1TVA A;  2IHM A;  4DQS A;  4KIT B;  1B22 A;  2UVW A;  2C2E A;  4G3I A;  3C1Z A;  3QU9 A;  1ECW A;  2HHT A;  4RPY A;  1ZQQ A;  1FFV A;  2JEI A;  2IMW P;  1CRX A;  1N56 A;  2ZJ8 A;  4P0P B;  1ZQL A;  2YB1 A;  5J2I A;  1TAQ A;  2XY7 A;  4DOA A;  4UAV A;  9ICV A;  2ZIV B;  1XSP A;  3MFH A;  3MFI A;  4OJP A;  5KFF A;  2WF8 A;  4HAI A;  3B0X A;  4O5K A;  3K1Z A;  1BPY A;  1DOQ A;  5KFX A;  4KLG A;  5ALT A;  3FAH A;  5AKL A;  3SEN A;  3BDP A;  4EZ6 A;  1JMS A;  3Q8S B;  3SYZ A;  5JRT A;  5KFN A;  2IOF K;  3THV A;  2HBL A;  4Y2P A;  4M9J A;  5L1J A;  4CRX A;  3PX4 A;  3AU2 A;  4QZC A;  3QZ7 A;  4NLC A;  3HWT A;  1DXS A;  2R8I A;  2WFA A;  1JN3 A;  1SKR A;  4PGX A;  4J9R A;  2KFZ A;  4PL2 A;  4YD1 A;  3F2C A;  4KN4 A;  1KQQ A;  5J2K A;  1X6J A;  3MR5 A;  3QZ8 A;  4RQM A;  4AP9 A;  2LYB A;  3J81 j;  7ICG A;  4Y2J A;  1QQ5 A;  1TKD A;  1KDH A;  1WCN A;  2RRD A;  4CF3 A;  1TE2 A;  2W3R A;  1KLN A;  4I2J A;  4ELT A;  1T94 A;  1RYS A;  4F50 A;  4Y2U A;  5EOZ A;  1PK1 A;  1ZQB A;  1L3S A;  3G6X A;  2H3V A;  1F5S A;  4R63 A;  1NI3 A;  2RDJ A;  1FIQ A;  4ICA A;  4FFD A;  1ZD2 P;  4IRK A;  2KHQ A;  7ICI A;  4QZH A;  2BR0 A;  2PMZ F;  2ZUB A;  2BCS A;  1ZQS A;  1JX4 A;  4NXZ A;  2JZB A;  1NJY A;  2BPF A;  3RH4 A;  5IIM A;  2WAQ F;  3KOO A;  5KFP A;  4CE6 A;  2W9A A;  4O3P A;  5E79 U;  1D8B A;  4R65 A;  4F2S A;  4X5V A;  5H2F U;  5KFU A;  1S5L U;  1ZXI A;  2W11 A;  4QIW F;  4B9V A;  5GTH U;  3HW8 A;  3WK7 A;  5J0Q A;  5KFJ A;  4F93 B;  2G09 A;  2D3D A;  5ALV A;  2K8A A;  2QB0 B;  3AN1 A;  4MEY A;  5ALM A;  4PZN A;  5KFY A;  9ICA A;  4DFJ A;  4F5N A;  4DSF A;  1JUD A;  3GIM A;  3ZDE A;  1ZD4 A;  1B0X A;  4CNQ A;  4ZOH C;  4ECT A;  2JH7 A;  2ZIU A;  4DS5 A;  3G6Y A; 
#chains in the Genus database with same CATH homology
 2XID A;  2ZIW A;  1OUQ A;  4NLC A;  1P7D A;  3L3F X;  4OJL A;  3C28 A;  2MRL A;  3F5A A;  3N7R C;  5T14 A;  4NV0 A;  3PSI A;  2RHF A;  4PL2 A;  4QJF B;  3F2C A;  4BJQ A;  3KFU F;  3RF9 A;  2KJ9 A;  5HR7 A;  2H3I A;  2WAQ C;  3H0M B;  3F2B A;  2G08 A;  2KKP A;  2ZXH A;  2Y0S F;  1Q3U A;  3IG5 A;  2NV3 A;  2LYB A;  4KMO B;  2ZG6 A;  1PVR A;  3SQI A;  2GOL A;  2KIW A;  2ZIX A;  5CRX A;  2K4E A;  3ALR A;  3AQE A;  4QIW C;  2RRD A;  1YT3 A;  3LYS A;  3F5E A;  2MA1 A;  3N7P D;  5HR6 A;  2OM6 A;  3N7S C;  2DF4 B;  3VC8 A;  3IP4 B;  2H3Z A;  2G0A A;  3ONN A;  4FZM A;  4FZL A;  2G07 A;  1XO0 A;  4OO1 J;  2RP5 A;  4CDG A;  3RFA A;  2Z7J A;  2CPR A;  3SAG A;  1T94 A;  2LHT A;  1GO3 F;  2N1R A;  3LVW A;  3M6K A;  2H3F A;  3M7D A;  1ED1 A;  2W7P A;  3PZP A;  2OXO A;  4AYB C;  2WB1 F;  4BX9 C;  3D2Q A;  2HOI A;  4AYB F;  2GH1 A;  2W04 A;  4CGZ A;  1TAM A;  2H3V A;  3CYM A;  3PSP A;  3IG8 A;  4C0Z A;  4OJO A;  3IN5 A;  1NZB A;  4P0Q B;  2Q4T A;  3OPX A;  2VKQ A;  2K8C B;  2OYY A;  4ICA A;  2E1F A;  2HBK A;  4OJ5 A;  2KNJ A;  5KL1 B;  1Z1B A;  1MA7 A;  2HOF A;  2JMG A;  2KD1 A;  2KHQ A;  3O0F A;  1KBU A;  2PMZ C;  1DRG A;  2HOQ A;  1IIP A;  2ZIX B;  3SAH A;  3T79 A;  2F76 X;  2M0N A;  2PMZ F;  2BDU A;  1UPH A;  2CN1 A;  3F53 A;  3H0R B;  4GFJ A;  1WUD A;  2YX8 A;  4OJ6 A;  2YB4 A;  1PVP A;  2LBO A;  1A6S A;  3NRW A;  2K4H A;  4NWI A;  2KJ5 A;  2KIC A;  2W03 A;  1ECW A;  2HMX A;  2DQN B;  4O3M A;  2WAQ F;  2CRX A;  2KHV A;  3SAF A;  2Y0S C;  1CRX A;  2G5I B;  2HBJ A;  3D2N A;  4PL1 A;  3SMV A;  1Q3V A;  2OH2 A;  3E0F A;  3C29 A;  3PSF A;  1D8B A;  4P0Q A;  4BUG A;  2ZIV A;  2K4I A;  1HEK A;  2H3Q A;  4NLB A;  4P0P B;  1SZH A;  2KV2 A;  1HIW A;  2F8L A;  3KZX A;  4KX3 A;  2YB1 A;  1L6N A;  3PST A;  3CP8 A;  4QIW F;  2K8B B;  3VCB A;  4ACO A;  2KKV A;  2E5S A;  2ZIV B;  2R18 A;  2JHD A;  3ICX A;  3LVV A;  2ZIW B;  4QNL A;  2XI9 A;  3F2D A;  2ZIU B;  2G06 A;  2HBM A;  3NUQ A;  3GZF A;  2G09 A;  2VIX A;  4OJP A;  3M6Z A;  3AL0 B;  4A8E A;  2WB1 C;  2XVT A;  4KX5 A;  2K8A A;  3MGV A;  4U6P A;  5A0L A;  2VJ5 A;  1A0P A;  3DEE A;  3K1Z A;  1Z19 A;  1XNS A;  2D6F C;  2LYA A;  4WJ3 B;  4FE3 A;  2F2A B;  2KVC A;  2JH1 A;  4U7C A;  2KEY A;  5KL8 B;  3H0L B;  5C0Y A;  2E1E A;  4JMU A;  1ZQ1 C;  2DGZ A;  2KJ8 A;  4IC9 A;  1F44 A;  2KOB A;  3AQF A;  2ZXI A;  3HKZ C;  2JGA A;  2A3V A;  2HBL A;  4FZN A;  2XIC A;  3CRX A;  1PVQ A;  4CRX A;  3HKZ F;  3GU3 A;  2JH7 A;  4P0P A;  2K89 A;  3D2S A;  2G5H B;  2ZIU A;  2VJ4 A;  2W7O A;  1URJ A;  2F77 X;  2LKY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...