2CPRA

Solution structure of the hrdc domain of human exosome component 10
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
b'GSSGSSGKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Exosome component 10
publication title Solution structure of the HRDC domain of human Exosome component 10
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cprA01
4OO1J 4CGZA 5C0YA 3SAHA 1WUDA 2KV2A 4QIWF 2HBJA 4NLCA 4O3MA 3CYMA 4QJFB 2HBMA 2HBKA 2RRDA 4CDGA 2CPRA 4NLBA 2E1EA 2DGZA 1D8BA 3SAFA 3SAGA 1YT3A 2MA1A 2E1FA 2RHFA 2HBLA 1GO3F
chains in the Genus database with same CATH superfamily
5BOLA 4M9HA 4Y2SA 5KT2A 3HKZF 1RYUA 4NWIA 5GTHU 3Q8KA 1IXRA 2K60A 2KFZA 3RJJA 1NK5A 3F2CA 3NASA 4DS5A 1D9DA 4R66A 2KNJA 1Z00A 7ICFA 1KFSA 5EWGA 2BPCA 5IIKA 4IQWA 3AL0B 4DSEA 3RTVA 2KHQA 5DGAA 4F4KA 4KLUA 1JUDA 1ZQAA 2J6UA 1L6NA 4QWAA 3V7KA 5ALRA 1RXVA 3OSNA 1RXWA 2W03A 4NXZA 4RQ0A 2DFLA 2W9BA 3LWMA 4F2SA 2KOBA 4B9TA 3MABA 3WK5A 7ICVA 5KFTA 2D3DA 4QWDA 3RRHA 7ICGA 1O03A 3GU3A 4JMUA 2G5HB 4FO6A 3ISDA 1NZBA 1KBUA 5GTIU 4JB3A 5AI4A 4UASA 3T5JA 5L1LA 1RYSA 1X2IA 1PK1B 3THVA 1ZQTA 4KLSA 3PR4A 4RNMA 4PGXA 2KVSA 2HOIA 1RQNA 3MC1A 1ZRMA 5F9LA 4TURA 3VC8A 2XICA 3NVZA 2PFQA 4M47A 1ZQBA 7ICSA 4F5OA 1DGSA 4KLIA 4I29A 3BQ1A 4F5RA 8ICNA 4F2RA 3V7JA 3LVWA 2YMQA 1NK4A 3Q8LA 4F72A 4F5PA 2HBJA 5AKXA 4BXOB 2HOQA 5KL1B 2ASJA 1SWVA 2ZJ8A 3CW2C 3OHAA 2YMPA 5KFLA 2H3QA 2GWSA 3HWTA 1X6IA 1COKA 4EYHB 4YXJA 2NRVA 4M6WA 2H5XA 1TVAA 1WUDA 2DL0A 2ZIVA 7ICOA 4C80A 3KHRA 1K1SA 1X9WA 5AKJA 1N48A 2E8PA 5D4BA 1ZD4A 5KFSA 2G0AA 2BDUA 3UMCA 2HSZA 3GV8B 5J0PA 3A0BU 3SAFA 3GIMA 2HHQA 1CRXA 4TUPA 1XNSA 4DSLA 1KL9A 4B6JA 3RF9A 4ECTA 1SB3C 3TQ1A 3PX6A 1ECWA 4UW9A 1JX4A 2Y9UA 2E5SA 2R8IA 3AMZA 1F44A 5ALEA 8ICPA 5IIOA 3F5AA 4KLHA 4QW8A 2W9CA 3UMBA 3RAQA 3N7RC 4DQQA 4UB6U 1NKEA 2Y0SF 3RB4A 5ALLA 4U7CA 3H7IA 5JUMA 2QLTA 4K4GA 2BPGA 4DQRA 2OEHA 3SV3A 4NL9A 2YTUA 2HHUA 1NZPA 1ZXIA 1S5LU 4C8LA 2BCRA 5KG4A 4Y2YA 5DQGA 1L8OA 4NLNA 2MU2A 1EXNA 3QZ8A 4EZ9A 3NVVA 2H3ZA 1ZQGA 1YZ7A 3C23A 5CWRA 4BJQA 5ALIA 2RQ5A 5KFKA 4C0ZA 4AYBC 4P4MA 5IIIA 3RJKA 1LV5A 1WWVA 2D8CA 1ZQFA 4X5VA 3SMVA 2M9NA 3PW2A 5KFJA 4FBUA 3ISCA 4MFFA 5HMLA 5JTIA 1SL0A 3C1YA 5TZVA 9ICHA 2EZZA 1CI4A 1L7NA 2FMPA 4TQRA 4NLCA 4RNOA 3ZDCA 2AGPA 4EX6A 2PFNA 4DSKA 1NJYA 4I2FA 1NK6A 4KN7A 2WAQF 2WF6A 2BQ3A 1J97A 3QU9A 2ZIXA 3T5KA 3D2NA 1Q3UA 1J2NA 1QH9A 1JMSA 3MGIA 2WB1F 2W7OA 3IG8A 4GFJA 9ICOA 2W04A 2H3VA 1XWLA 5B66U 4I2HA 4CRXA 4R8UA 3A0HU 4RQ7A 4IR9A 4K4IA 4UBBA 3WK4A 9ICJA 1TK5A 4JV2A 2JEFA 2E8MA 2AQ0A 3M9MB 5CR0A 1KKXA 4MEXA 2I6XA 5AIAA 2KSOB 4RZRA 1XSLA 2FMQA 2BKEA 5AM1A 3WKBA 4BWMA 1FO4A 2RP5A 3H8WA 4OCZA 5KG5A 4RUAA 2AHOB 5DB8A 3PO4A 2KKPA 4DF4A 4UARA 1CUKA 4M9NA 4OJOA 2P35A 4B9LA 4XA5A 2XIDA 4KLTA 1S8OA 4UAUA 2HDOA 2ISPA 3H40A 2QKQA 2XC9A 1ZD2P 1TK0A 1KFDA 1MSWD 4LZGA 1BNOA 2OM6A 3KKAA 1S0MA 2CRXA 3JPNA 3RR7A 2PI4A 1MN8A 2E1FA 2ODGA 3H8SA 2JV3A 4ECZA 1NK7A 5ALUA 3QYPA 9ICUA 3UPQA 5F3XB 4C4RA 3CP8A 5AK4A 1FEZA 1ZQRA 1TE2A 1IG6A 3PSPA 8ICYA 3G6XA 8ICLA 4CDGA 4BGDA 1XC9A 5ALHA 4NLBA 2MUTA 3RRGA 2XCAA 5KTQA 3ZDAA 4ELTA 4NJ8A 4KLFA 2OHFA 9ICCA 1KFTA 2EQYA 4ED0A 4PZOA 3HKZC 4Y2TA 4I2GA 2R8GA 3BZCA 1NKBA 5EE9A 7ICEA 3IP4B 1S0NA 3AQEA 2F44A 2BQUA 3TFRA 1ZD5A 3E58A 3RB6A 2FJ6A 4O3NA 5KAIU 3T3FA 1JXLA 4DOCA 1KEJA 5G5GA 1ZQQA 9ICRA 1U4BA 1WYGA 1FIQA 4PH5A 1P7DA 4Z6CA 1V85A 3UXNA 2CXYA 7ICJA 1HEKA 1S97A 2K4HA 4QZEA 1LKYB 1KRPA 1K1QA 2YB1A 2ZUDA 5DLFA 3SEIA 3FM9A 3JPSA 2K89A 3OTQA 4DSIA 2JZBA 2W7PA 3TAPA 4M0AA 3KOOA 3PX0A 3E2EA 3E0FA 4DFKA 1UCVA 2LM4A 2MAXA 3Q8QB 3C5FA 1COOA 2UVRA 5ALDA 4PL2A 3TACB 2F3NA 3QUCA 5D49A 1JRPA 4NM1A 1U45A 4MFAA 5BPCA 2E1EA 2BCUA 3Q8RB 5KNIA 1SKRA 5EE1A 2W9MA 2ZIWB 4Q8FA 1ZQXA 1DK3A 1X40A 2LBOA 2DWQA 1Z19A 1SZPA 9ICWA 2FPKA 2F1HA 3HILA 3TKAA 1M6YA 1N56A 3AEVA 3NRZA 4RQ1A 4M04A 1F0MA 9ICMA 4FZLA 5KT6A 3OSPA 5DB9A 5J2JA 3VCBA 1YT3A 4KMUA 2NRXA 3G6VA 4JUZA 1MA7A 4ZOHC 4EYIB 5KL8B 5J0RA 4ED3A 4QZIA 2WF5A 2K8AA 4F5NA 3UMGA 4RNNA 1KSPA 3SQIA 3PV8A 2B21A 3J81j 4I2DA 2PFOA 1NK8A 2AXTU 3GV5B 3L3FX 9ICGA 4F71A 2F8LA 2HVHA 2UVWA 4C8OA 4YD1A 4DL4A 5F9NA 2W9BB 4NLKA 4OD0A 1V9PA 3C28A 2ZXIA 2ZUBA 5JRTA 5L1JA 3PSIA 1LVHA 3H0LB 5KT7A 3NS1A 4RQ5A 2YMLA 2YMMA 1XS9D 1ZQOA 1WG8A 2A1JA 4RT2A 1TAQA 4C4TA 2DUYA 3U26A 1ZQHA 2Z7JA 1S10A 1PK3A 4GC7A 2XO7A 5ALJA 4M9GA 3WKAA 2LHTA 1RG6A 4YD2A 2BZFA 2W8LA 4I2JA 3BS5A 4C4SA 5IILA 2Y0SC 2O6KA 4EBDA 2HHVA 4I27A 4YMMA 3B9JA 4F5QA 4YQWA 4OJLA 3WU2U 2LKYA 3MDCA 2HHXA 5HMMA 2ZJAA 4NY8A 1UPHA 3EW9A 3M7DA 3ORYA 2Y1IA 2JMGA 4M6WB 2ZIVB 2P66A 3CRXA 1V97A 5KFWA 2JGAA 3RR8A 2RDJA 1Z3EB 1BPBA 4UAVA 2DGZA 1MQ2A 4UB5A 2UVVA 5HNKA 3QUQA 4QZGA 2HHWA 1BGXT 3IN5A 5AI9A 2HW3A 4A8EA 2QARB 2NRWA 1RM6C 1N62A 1JXEA 1N61A 2EZXA 2XCPA 4P4PA 2WAQC 1ZQPA 3WK6A 4DL6A 1U9LA 2W9CB 3TAQA 3T5LA 1IM4A 2ZIUB 5ALTA 5J0QA 2W54A 2H3IA 1XSPA 5KG6A 1H38A 2WB1C 1Z4NA 2KTQA 4M9LA 1MC8A 5KFOA 3CYMA 4XUSA 3EPGA 5ALKA 1BPEA 2ASLA 1ZD3A 4DCCA 2NO5A 2F8KA 3K75D 2KZMA 4J03A 5L1IA 4PHEA 4ED1A 4Y2QA 5T14A 3RJEA 2FDRA 3MGHA 1NOMA 3KHHA 2LPEA 3QXGA 1UT8A 5AKZA 4OO1J 3I1YA 4Q8EA 3ETRA 2F1IA 4K4HA 1D8YA 2ASDA 8ICUA 4GXKA 4KLLA 1UQVA 2HHTA 1QCKA 5KG0A 1X6JA 9ICTA 5EWEA 5HP4A 4DL2A 4DWIA 4I2BA 3QU2A 9ICSA 4KLGA 3PZPA 3PMNA 1L3TA 4P0QA 4US9A 2MA1A 2JXJA 4J9QA 4DEZA 2FMSA 2K4EA 1L3VA 3N97B 5KFDA 3H0MB 3AQFA 3EWAA 8ICKA 1UHUA 2DKZA 4Y2JA 2BDPA 5J29A 4DS4A 1A6SA 1VDVA 4NM2A 1FFVA 3ONNA 4RQ6A 4B9UA 1B4FA 2EAMA 5ALVA 4RQ8A 4FBTA 2WF8A 7ICNA 4ED2A 3JPOA 3EYZA 8ICRA 1T3QA 2ZIXB 3QE9Y 5D46A 1UT5A 5L9XA 5J0SA 2JEGA 3M8SA 3HX0A 1ZJNA 1L8LA 2ESEA 1B0XA 1BPZA 4R8UB 2WF9A 1SV0C 4ECQA 4RPXA 2JHDA 3M6ZA 5DBCA 4JV0A 1BVSA 1DGJA 3EZ5A 4J9KA 3KFUF 3ZD9A 2FE9A 1D9FA 4C8MA 2BHNA 4P4OA 1T8EA 1TK8A 3TI0A 5J2CA 3OJSA 8ICCA 1PZNA 4IRDA 3QEAZ 1XO0A 4IL6U 3G6YA 1ZQIA 1ZJMA 5KFHA 1NJXA 4DL3A 5KFRA 3K1ZA 3PW7A 3T79A 4G3IA 4DQIA 1HJPA 5CJ7A 3AU6A 3F5EA 4MFCA 3RJFA 1ZQEA 3KZXA 2XY7A 4IQTA 4DOAA 2QB1A 3GIKA 4EEYA 2K8BB 2W11A 5HR6A 4RQMA 3N28A 7ICQA 5TISU 4O3PA 1ZQSA 5EE0A 9ICEA 9ICKA 5HHIA 2B6GA 5CEHA 1UA0A 4O3QA 3OGUA 4RPYA 1T3NA 3OPXA 2ZTCA 2KE7A 5H2FU 4EEKA 2NRZA 3IM1A 3TADA 1ZQNA 4KX3A 3C2LA 1X42A 4GXJA 4WJ3B 3B0XA 4YR2A 1TKDA 3NVYA 1JN3A 1PVQA 7ICMA 2MUTB 3SAGA 2YN4A 5L1KA 9ICAA 1WCNA 5ALMA 2WF7A 3L4PA 3QNMA 4DFDA 1HUZA 3FYHA 2QB0A 4DOBA 1U47A 2XY5A 4DFJA 5EWFA 4HAIA 1D8BA 2C2EA 2KZ3A 4FFDA 2PXIA 1N60A 2R8HA 4YMOA 2YQEA 1SXDA 1U49A 3C1ZA 4RQ2A 1QSLA 1SIJA 2OYYA 2E8OA 2IHNA 3V6HA 1N5WA 3PSFA 4UATA 5IIJA 3LYSA 2KJ5A 2DF4B 3C2KA 4JWMA 2A3VA 2ZJ5A 5G5HA 3KHGA 4FS2A 5J0XA 2EDUA 5J2AA 3DV9A 8ICBA 4NLGA 3AUOA 3JPQA 2VA8A 4NL9C 2JZBB 5J2KA 4UBCA 3I28A 4J9NA 3QU5A 1V38A 4IRKA 4Y2RA 3ZI4A 4J9PA 3QZ7A 4MF8A 3PX4A 3ED5A 1ZQUA 2DPJA 1ZQDA 8ICIA 2HHSA 8ICHA 2J6SA 5AK6A 1PVPA 3D2SA 2V4RA 5KFPA 3GQCA 4F91B 5K4LA 3HW8A 2F77X 5DGBA 4ECWA 4B9VA 1ZQ1C 5KFNA 4GIBA 1XSNA 1FFUA 5DDYA 1HUOA 2KJ8A 2NO4A 4RUCA 1MQ3A 4TQSA 2EAPA 2ES6A 4ED6A 2EZYA 2LM1A 5KG3A 3RB0A 1QQ7A 4Y2UA 2BGWA 4QIWF 2LYHA 3M1YA 2E8NA 1OXJA 4RU9A 3LK9A 2HBMA 3LWLA 1WWUA 2ZTDA 5J2IA 4F3OA 2KHVA 5CRXA 2HVIA 3WKCA 8ICTA 5J2GA 1ZYQA 1NK9A 4KMOB 5CB1A 3PNCA 1X9SA 4UB4A 2W3SA 2BPFA 7ICIA 2PMZF 4J9OA 1NI3A 3I76A 3RBDA 3SD7A 3C21A 3IG5A 5J8YA 2KJ9A 3N7PD 1X66A 1VLBA 5KFFA 7ICKA 4QZHA 3SENA 3C5GA 3KD3A 4F4YA 3IRUA 4ICAA 4F4ZA 4KTQA 3MDAA 3HP6A 4ACOA 3MGVA 5DBBA 2JR5A 3HRDD 3LVVA 2A1JB 3IDWA 3MFIA 2KSOA 3CNHA 3OHBA 3SZ2A 1RYRA 2FLNA 4AYBF 4ED7A 3N4MB 1ZQWA 2DKXA 2JH7A 2WTFA 3GIIA 4I2AA 3GZFA 2OXOA 1PVRA 2FPLA 3RJGA 5ALWA 3K4GA 9ICVA 1RDFA 3BS5B 5DB6A 4QWCA 4M9JA 4QZCA 2FI1A 5DQIA 3HT3A 3GV7B 4NLZA 3SR6A 4CNQA 3KKAC 2Y9TA 4DSFA 4BX9C 2IMWP 8ICMA 3UQ2A 4U6PA 5AI6A 5AK3A 2HBKA 2EAOA 4F50A 4E0DA 1ZETA 2IOHA 4CE6A 8ICJA 3M6KA 1ZQZA 5J0YA 9ICQA 3RH4A 9ICNA 1GO3F 2YB4A 3TFSA 4PPXA 3MR2A 2K4IA 1Z00B 2KMDA 2L5YA 3QUBA 1DRGA 1T94A 4KLJA 5KG2A 3QUTA 3RFAA 4F4XA 2RRDA 2FPMA 5IINA 2KD1A 4TUSA 3JPRA 4I2CA 5IIMA 2K8CB 2FLPA 3ICXA 1SGGA 4Z6FA 3FDSA 3H4BA 4O0IA 4F8RA 5ALPA 2G09A 2KEYA 3PW5A 3R9KA 2IOFK 8ICGA 4ECXA 1SKWA 1S77D 4DQSA 4KLOA 3TARA 4DO9A 2KZZA 3M8RA 1A76A 2DQNB 4DFMA 1A0PA 1IV8A 4FS1A 1SL2A 1UA1A 2G06A 3C29A 4DL5A 3SYZA 2HI0A 4UB2A 4RQ4A 1O08A 3B0YA 5KG1A 3GDXA 3PW4A 4BWJA 5ALFA 5J2HA 1D8LA 3HJEA 4DFPA 7ICHA 1TFRA 3UXOA 4CF5A 2I5HA 2RDIA 4QNLA 4LVSA 8ICFA 2LI6A 2V4QA 2R8KA 2GOLA 2ISOA 1X9XA 2JRZA 3JPPA 4QWBA 3D6JA 8ICOA 5KFCA 2ZIWA 4O3RA 4P0QB 3AN1A 4DSJA 2K4PA 5FP0A 2XGPA 4EBCA 1ZQKA 4B9SA 5AI8A 5JU5A 4QZFA 4QWEA 1A77A 1NK0A 4F92B 1LB2B 5AK5A 9ICFA 2VJ4A 2KP7A 3IHQB 2AJQA 5HR7A 1KLNA 4JK1A 4RPZA 4EX7A 3AM9A 4O9MA 1S9FA 1TAUA 2A19A 4DLEA 2C28A 4IQUA 1RQLA 2VKQA 8ICEA 1Z1BA 1QQ5A 2G5IB 1DOQA 4KN4A 3C2MA 3GIJA 2NRTA 5HHHA 5KAFU 1SV0A 1KDHA 7ICUA 9ICIA 4PGQA 3MR5A 4PHAA 1U48A 2G08A 3QU4A 5J2DA 4IR1A 1AQ6A 3MR6A 4FZMA 4I2EA 1RPLA 4C8NA 5ALYA 3EPIA 4CF3A 4PHPA 4YFKA 5ALXA 3MR3A 5KFYA 4EBEA 4P0PA 1C7YA 1Q8KA 2R18A 1DXSA 3FAHA 1J2MA 4JV1A 4UB1A 3ZDEA 4TUQA 4GC6A 2KICA 4Y2XA 4F93B 2MSNA 5AKKA 2ZG6A 3RH6A 3KZIU 4Q44A 3SV4A 4C7ZA 5AIBA 5KFZA 4US8A 4QW9A 4ELVA 2P6RA 3T5HA 4YP3A 1Z4OA 5J2BA 5KFVA 3WKDA 3BQ0A 4BUGA 5KT3A 3L5KA 1L7OA 1JI7A 3BQ7A 5J2EA 2A1AA 1F5SA 4R64A 3ZDBA 4DF8A 1N2XA 1L3UA 1CEZA 2HMXA 3ZDDA 2KK0A 5AI0A 2EH9A 3M9NB 4DLGA 1L7PA 3H8MA 1SKSA 9ICBA 3RJIA 2C22A 4GLXA 4O5EA 5KFUA 4ECSA 4KLMA 4P2HA 2IBKA 2QB0B 3F2DA 5KFMA 2AGOA 2W8KA 3WKEA 4YR3A 1QLNA 1KN5A 5AKLA 5DG8A 4ED8A 2QARA 2R8JA 2BCVA 2RHFA 5A0LA 2B0CA 4QIWC 3M9OB 2KVCA 4OJ5A 3PSTA 2M0NA 2IA6A 5KFQA 4QZ8A 1TAMA 3BDPA 5CHGA 2PKEA 2JH1A 4FE3A 3PR5B 2ZIUA 1OW5A 1PK1A 3PY8A 4J9MA 1Z1VA 2PMZC 3IV6A 2XY6A 5KFGA 4QJFB 4AP9A 8ICAA 1K5OA 4O3SA 2V9WA 4C8KA 1Q46A 1QTMA 1VJ5A 5DBAA 2NV3A 4Y2PA 4ZH4A 2W55A 1ZQVA 5ALGA 2HOFA 7ICLA 4O3OA 3RB3A 3Q8SB 3SAHA 1L5UA 5AM5A 2LYAA 3H8JA 1B43A 2CN1A 5KFAA 3ISBA 2AQ4A 4BXOA 4Y2VA 4KLEA 1BNPA 4UQGA 2P6UA 2VIXA 4YR0A 2W43A 4O5KA 1C20A 4DQPA 5AKGA 1OUQA 1KQQA 3GILA 1S76D 4MEYA 2W3RA 1JALA 1XO1A 4OJ6A 4YCXA 3BQTA 4I28A 2UVUA 3O0FA 4O5CA 5J0UA 1Y88A 4QZDA 3NTUA 2EANA 5ALOA 3EUB2 3F2BA 2HBLA 1ZOLA 4CGZA 1SZHA 2PI5A 3DDHA 1BPXA 2WFAA 2MRLA 1Q3VA 9ICLA 7ICRA 5KFEA 2C2DA 5EOZA 1B22A 5DG9A 7ICPA 2KKVA 4PHDA 8ICSA 3S6JA 3NUQA 4KITB 4YMNA 1XU4A 3JPTA 5EE3A 1NJZA 1JIHA 3V72A 1NKCA 4M2YA 3ETLA 4RQNA 4Q45A 1N63A 5ALNA 5CA7A 5AM4A 2ALZA 2AU0A 4USAA 4B9MA 3GFKB 5AICA 2YX8A 4J9RA 5E79U 5KG7A 1SV4A 1YZ6A 2I1QA 5C0YA 2KN7A 4DL7A 1TV9A 2GH1A 4ECUA 3OJUA 2H3FA 3Q8PB 4OJPA 4GXIA 3BZKA 2Q0ZX 5J2FA 9ICPA 8ICVA 1L3SA 4C7YA 2E3TA 4B9NA 4UAWA 1ZQLA 3MBYA 4Z6EA 5L1MA 3TADC 9ICXA 5CP2A 2NYVA 1ZQMA 2C2RA 2VJ5A 2W9AA 4PJ0U 5AM2A 2F1JA 3BJYA 4EENA 3FC4A 5ALZA 5AI5A 2FLLA 2ZUCA 1NJWA 5KT5A 3RJHA 1AROP 3WK9A 5DG7A 4IRCA 4UAZA 4UB3A 2PFPA 5DLGA 2F76X 5KFXA 4RT3A 4FZNA 2ZXHA 4MHVA 5AHXA 1T7PA 5AM3A 5ALQA 1S0VA 3AU2A 4JWNA 3RAXA 1KW4A 5AKIA 4J9SA 2DPIA 4BDPA 2N1RA 2ATLA 4PZNA 1SXEA 3H0RB 2RLTA 2ZTEA 1QSYA 2I9GA 3PMLA 2KIVA 3RBEA 2IOFA 4YVZA 2VANA 3UM9A 4QZAA 1S0OA 1SL1A 3NRWA 2XVTA 4XQ8A 3QU7A 2VA2A 7ICTA 2WHEA 3Q8MA 5KFIA 1X9MA 2G07A 8ICXA 3KHLA 5C5JA 4G9BA 4IS7A 3ALRA 2VA3A 2HCFA 2BQRA 4NV0A 3BS7A 1BPYA 4R65A 1ED1A 3WK7A 1QQ6A 4ECYA 2LYBA 4RQ3A 3DEEA 4ECVA 4LJXA 4MF2A 5BOMA 3V6KA 3PVXA 3F53A 3KTQA 2AGQA 2OCEA 2J6TA 1ZQYA 3UXPA 5ALSA 4PL1A 3WK8A 1N5XA 4HYKA 2AH5A 1PUZA 1ZRNA 3KBBA 4Z6DA 2F2AB 4EELA 3V7LA 1L7MA 2DBYA 1T4GA 2JEJA 2D6FC 1QSSA 5B5EU 4IC9A 3UQ0A 3SI8A 3PW0A 5KT4A 4YG2A 2BCQA 3NGDA 1URJA 1ZQJA 2KIWA 2BCSA 2JEIA 4XRHA 4F4WA 5AM0A 1SWWA 4PGYA 3H4DA 2KV2A 4YXMA 4O3MA 3N7SC 4KX5A 4J9LA 5AKHA 5KFBA 3HPOA 1ZQCA 3ZD8A 2CPRA 4ECRA 1IIPA 3K1RB 1KTQA 5J8YC 4UAYA 3MFHA 5J0TA 5DKWA 4YN4A 8ICQA 4KLQA 4CCHA 5AKEA 4CF4A 5AKYA 1LKYA 3RH5A 1WCLA 2KFNA 3PO5A 2IHMA 1BPDA 2KG5A 5DB7A 3LDAA 2BR0A 2XGQA 4QZBA 1DK2A 3QX7A 5J0OA 4P0PB 2YY6A 4KLDA 4EZ6A 2GO7A 4QZ9A 8ICZA 2LMRA 5DDMA 5J0WA 3TANA 3D2QA 1HIWA 3NVWA 2XI9A 3QEBZ 3BQ2A 4Q43A 4LZDA 2Y1JA 4UB8U 2OH2A 4R63A 5DQHA 4I2IA 1JROA 2OWOA 4IQVA 4ELUA 8ICWA 1NNLA 3V6JA 1RZTA 2Q4TA 2GLEA
chains in the Genus database with same CATH topology
2ZIUB 4OJOA 3E0FA 2H3IA 3HKZF 4BJQA 2G09A 2KEYA 2OYYA 3LVWA 2WB1C 2PMZF 2XIDA 4NWIA 4C0ZA 4AYBC 2VJ5A 2Z7JA 1OUQA 2F2AB 2HBJA 3IG5A 1XO0A 3CYMA 3F2DA 2KJ9A 3N7PD 4PL2A 2VKQA 4OJ6A 3PSFA 1Z1BA 3K1ZA 2LHTA 2D6FC 2HOQA 5KL1B 3LYSA 2KJ5A 2DF4B 3T79A 4IC9A 2G5IB 3SMVA 2A3VA 2E1EA 3O0FA 2OM6A 2CRXA 3F2CA 4ICAA 5T14A 2H3QA 2E1FA 1URJA 2KIWA 2Y0SC 3F5EA 2RHFA 4ACOA 2DQNB 2HBLA 2ZIWB 3MGVA 3F2BA 2F76X 1A0PA 4OO1J 3KZXA 4CGZA 1SZHA 5A0LA 3LVVA 2KNJA 2LBOA 2G06A 1Z19A 4FZNA 1WUDA 2K8BB 4QIWC 2ZIVA 2ZXHA 2KV2A 3C29A 2G08A 4AYBF 4OJLA 5HR6A 3CP8A 4FZMA 2KVCA 2LKYA 4NLCA 4OJ5A 2MRLA 1Q3VA 3N7SC 3PSPA 3PSTA 4KX5A 2M0NA 4O3MA 2JH7A 4FZLA 4CDGA 3AL0B 2G0AA 2WAQF 3GZFA 2CPRA 2OXOA 2KHQA 2BDUA 4NLBA 1TAMA 1PVRA 3VCBA 3SAFA 1PVPA 3PZPA 3D2SA 2KKVA 1UPHA 1IIPA 2JH1A 3NUQA 4FE3A 4P0QA 1YT3A 2MA1A 3M7DA 2ZIUA 2N1RA 1CRXA 4P0PA 1L6NA 1XNSA 2W03A 2ZIXA 3HKZC 2K4EA 3H0RB 3RF9A 1MA7A 2R18A 2F77X 2PMZC 3D2NA 1ECWA 3OPXA 2JMGA 1Q3UA 3H0MB 5KL8B 3AQFA 1ZQ1C 2E5SA 4QNLA 2ZIVB 2W7PA 2KOBA 2WB1F 2W7OA 3IG8A 4GFJA 2KICA 4BX9C 3IP4B 4KX3A 2K8AA 2W04A 2H3VA 4WJ3B 2GOLA 4QJFB 3CRXA 4CRXA 1A6SA 4U6PA 2JGAA 3AQEA 2HBKA 1F44A 3ONNA 3SQIA 2KJ8A 2ZG6A 3F5AA 3GU3A 1PVQA 4JMUA 2G5HB 2NV3A 2DGZA 3NRWA 3M6KA 3SAGA 1NZBA 1KBUA 3L3FX 2XVTA 3N7RC 2ZIWA 2F8LA 3IN5A 4P0QB 2HOFA 4A8EA 4P0PB 2G07A 2YX8A 1GO3F 2Y0SF 2YB4A 5C0YA 4U7CA 2ZIXB 3SAHA 4BUGA 2LYAA 3ALRA 2K4IA 2GH1A 4QIWF 1P7DA 1DRGA 1T94A 2H3FA 3D2QA 1HIWA 2CN1A 4NV0A 4OJPA 2XI9A 2HOIA 1HEKA 3C28A 2K4HA 2ZXIA 1ED1A 2HBMA 2WAQC 2HMXA 2RP5A 2RRDA 3RFAA 2OH2A 2VJ4A 3VC8A 2LYBA 2YB1A 2XICA 3H0LB 3PSIA 3DEEA 2KD1A 2KHVA 2JHDA 1D8BA 3M6ZA 2K89A 5CRXA 3F53A 2K8CB 3ICXA 5HR7A 2H3ZA 2KKPA 3KFUF 2VIXA 4KMOB 4PL1A 2Q4TA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4OO1 J;  4CGZ A;  5C0Y A;  3SAH A;  1WUD A;  2KV2 A;  4QIW F;  2HBJ A;  4NLC A;  4O3M A;  3CYM A;  4QJF B;  2HBM A;  2HBK A;  2RRD A;  4CDG A;  2CPR A;  4NLB A;  2E1E A;  2DGZ A;  1D8B A;  3SAF A;  3SAG A;  1YT3 A;  2MA1 A;  2E1F A;  2RHF A;  2HBL A;  1GO3 F; 
#chains in the Genus database with same CATH topology
 5BOL A;  4M9H A;  4Y2S A;  5KT2 A;  3HKZ F;  1RYU A;  4NWI A;  5GTH U;  3Q8K A;  1IXR A;  2K60 A;  2KFZ A;  3RJJ A;  1NK5 A;  3F2C A;  3NAS A;  4DS5 A;  1D9D A;  4R66 A;  2KNJ A;  1Z00 A;  7ICF A;  1KFS A;  5EWG A;  2BPC A;  5IIK A;  4IQW A;  3AL0 B;  4DSE A;  3RTV A;  2KHQ A;  5DGA A;  4F4K A;  4KLU A;  1JUD A;  1ZQA A;  2J6U A;  1L6N A;  4QWA A;  3V7K A;  5ALR A;  1RXV A;  3OSN A;  1RXW A;  2W03 A;  4NXZ A;  4RQ0 A;  2DFL A;  2W9B A;  3LWM A;  4F2S A;  2KOB A;  4B9T A;  3MAB A;  3WK5 A;  7ICV A;  5KFT A;  2D3D A;  4QWD A;  3RRH A;  7ICG A;  1O03 A;  3GU3 A;  4JMU A;  2G5H B;  4FO6 A;  3ISD A;  1NZB A;  1KBU A;  5GTI U;  4JB3 A;  5AI4 A;  4UAS A;  3T5J A;  5L1L A;  1RYS A;  1X2I A;  1PK1 B;  3THV A;  1ZQT A;  4KLS A;  3PR4 A;  4RNM A;  4PGX A;  2KVS A;  2HOI A;  1RQN A;  3MC1 A;  1ZRM A;  5F9L A;  4TUR A;  3VC8 A;  2XIC A;  3NVZ A;  2PFQ A;  4M47 A;  1ZQB A;  7ICS A;  4F5O A;  1DGS A;  4KLI A;  4I29 A;  3BQ1 A;  4F5R A;  8ICN A;  4F2R A;  3V7J A;  3LVW A;  2YMQ A;  1NK4 A;  3Q8L A;  4F72 A;  4F5P A;  2HBJ A;  5AKX A;  4BXO B;  2HOQ A;  5KL1 B;  2ASJ A;  1SWV A;  2ZJ8 A;  3CW2 C;  3OHA A;  2YMP A;  5KFL A;  2H3Q A;  2GWS A;  3HWT A;  1X6I A;  1COK A;  4EYH B;  4YXJ A;  2NRV A;  4M6W A;  2H5X A;  1TVA A;  1WUD A;  2DL0 A;  2ZIV A;  7ICO A;  4C80 A;  3KHR A;  1K1S A;  1X9W A;  5AKJ A;  1N48 A;  2E8P A;  5D4B A;  1ZD4 A;  5KFS A;  2G0A A;  2BDU A;  3UMC A;  2HSZ A;  3GV8 B;  5J0P A;  3A0B U;  3SAF A;  3GIM A;  2HHQ A;  1CRX A;  4TUP A;  1XNS A;  4DSL A;  1KL9 A;  4B6J A;  3RF9 A;  4ECT A;  1SB3 C;  3TQ1 A;  3PX6 A;  1ECW A;  4UW9 A;  1JX4 A;  2Y9U A;  2E5S A;  2R8I A;  3AMZ A;  1F44 A;  5ALE A;  8ICP A;  5IIO A;  3F5A A;  4KLH A;  4QW8 A;  2W9C A;  3UMB A;  3RAQ A;  3N7R C;  4DQQ A;  4UB6 U;  1NKE A;  2Y0S F;  3RB4 A;  5ALL A;  4U7C A;  3H7I A;  5JUM A;  2QLT A;  4K4G A;  2BPG A;  4DQR A;  2OEH A;  3SV3 A;  4NL9 A;  2YTU A;  2HHU A;  1NZP A;  1ZXI A;  1S5L U;  4C8L A;  2BCR A;  5KG4 A;  4Y2Y A;  5DQG A;  1L8O A;  4NLN A;  2MU2 A;  1EXN A;  3QZ8 A;  4EZ9 A;  3NVV A;  2H3Z A;  1ZQG A;  1YZ7 A;  3C23 A;  5CWR A;  4BJQ A;  5ALI A;  2RQ5 A;  5KFK A;  4C0Z A;  4AYB C;  4P4M A;  5III A;  3RJK A;  1LV5 A;  1WWV A;  2D8C A;  1ZQF A;  4X5V A;  3SMV A;  2M9N A;  3PW2 A;  5KFJ A;  4FBU A;  3ISC A;  4MFF A;  5HML A;  5JTI A;  1SL0 A;  3C1Y A;  5TZV A;  9ICH A;  2EZZ A;  1CI4 A;  1L7N A;  2FMP A;  4TQR A;  4NLC A;  4RNO A;  3ZDC A;  2AGP A;  4EX6 A;  2PFN A;  4DSK A;  1NJY A;  4I2F A;  1NK6 A;  4KN7 A;  2WAQ F;  2WF6 A;  2BQ3 A;  1J97 A;  3QU9 A;  2ZIX A;  3T5K A;  3D2N A;  1Q3U A;  1J2N A;  1QH9 A;  1JMS A;  3MGI A;  2WB1 F;  2W7O A;  3IG8 A;  4GFJ A;  9ICO A;  2W04 A;  2H3V A;  1XWL A;  5B66 U;  4I2H A;  4CRX A;  4R8U A;  3A0H U;  4RQ7 A;  4IR9 A;  4K4I A;  4UBB A;  3WK4 A;  9ICJ A;  1TK5 A;  4JV2 A;  2JEF A;  2E8M A;  2AQ0 A;  3M9M B;  5CR0 A;  1KKX A;  4MEX A;  2I6X A;  5AIA A;  2KSO B;  4RZR A;  1XSL A;  2FMQ A;  2BKE A;  5AM1 A;  3WKB A;  4BWM A;  1FO4 A;  2RP5 A;  3H8W A;  4OCZ A;  5KG5 A;  4RUA A;  2AHO B;  5DB8 A;  3PO4 A;  2KKP A;  4DF4 A;  4UAR A;  1CUK A;  4M9N A;  4OJO A;  2P35 A;  4B9L A;  4XA5 A;  2XID A;  4KLT A;  1S8O A;  4UAU A;  2HDO A;  2ISP A;  3H40 A;  2QKQ A;  2XC9 A;  1ZD2 P;  1TK0 A;  1KFD A;  1MSW D;  4LZG A;  1BNO A;  2OM6 A;  3KKA A;  1S0M A;  2CRX A;  3JPN A;  3RR7 A;  2PI4 A;  1MN8 A;  2E1F A;  2ODG A;  3H8S A;  2JV3 A;  4ECZ A;  1NK7 A;  5ALU A;  3QYP A;  9ICU A;  3UPQ A;  5F3X B;  4C4R A;  3CP8 A;  5AK4 A;  1FEZ A;  1ZQR A;  1TE2 A;  1IG6 A;  3PSP A;  8ICY A;  3G6X A;  8ICL A;  4CDG A;  4BGD A;  1XC9 A;  5ALH A;  4NLB A;  2MUT A;  3RRG A;  2XCA A;  5KTQ A;  3ZDA A;  4ELT A;  4NJ8 A;  4KLF A;  2OHF A;  9ICC A;  1KFT A;  2EQY A;  4ED0 A;  4PZO A;  3HKZ C;  4Y2T A;  4I2G A;  2R8G A;  3BZC A;  1NKB A;  5EE9 A;  7ICE A;  3IP4 B;  1S0N A;  3AQE A;  2F44 A;  2BQU A;  3TFR A;  1ZD5 A;  3E58 A;  3RB6 A;  2FJ6 A;  4O3N A;  5KAI U;  3T3F A;  1JXL A;  4DOC A;  1KEJ A;  5G5G A;  1ZQQ A;  9ICR A;  1U4B A;  1WYG A;  1FIQ A;  4PH5 A;  1P7D A;  4Z6C A;  1V85 A;  3UXN A;  2CXY A;  7ICJ A;  1HEK A;  1S97 A;  2K4H A;  4QZE A;  1LKY B;  1KRP A;  1K1Q A;  2YB1 A;  2ZUD A;  5DLF A;  3SEI A;  3FM9 A;  3JPS A;  2K89 A;  3OTQ A;  4DSI A;  2JZB A;  2W7P A;  3TAP A;  4M0A A;  3KOO A;  3PX0 A;  3E2E A;  3E0F A;  4DFK A;  1UCV A;  2LM4 A;  2MAX A;  3Q8Q B;  3C5F A;  1COO A;  2UVR A;  5ALD A;  4PL2 A;  3TAC B;  2F3N A;  3QUC A;  5D49 A;  1JRP A;  4NM1 A;  1U45 A;  4MFA A;  5BPC A;  2E1E A;  2BCU A;  3Q8R B;  5KNI A;  1SKR A;  5EE1 A;  2W9M A;  2ZIW B;  4Q8F A;  1ZQX A;  1DK3 A;  1X40 A;  2LBO A;  2DWQ A;  1Z19 A;  1SZP A;  9ICW A;  2FPK A;  2F1H A;  3HIL A;  3TKA A;  1M6Y A;  1N56 A;  3AEV A;  3NRZ A;  4RQ1 A;  4M04 A;  1F0M A;  9ICM A;  4FZL A;  5KT6 A;  3OSP A;  5DB9 A;  5J2J A;  3VCB A;  1YT3 A;  4KMU A;  2NRX A;  3G6V A;  4JUZ A;  1MA7 A;  4ZOH C;  4EYI B;  5KL8 B;  5J0R A;  4ED3 A;  4QZI A;  2WF5 A;  2K8A A;  4F5N A;  3UMG A;  4RNN A;  1KSP A;  3SQI A;  3PV8 A;  2B21 A;  3J81 j;  4I2D A;  2PFO A;  1NK8 A;  2AXT U;  3GV5 B;  3L3F X;  9ICG A;  4F71 A;  2F8L A;  2HVH A;  2UVW A;  4C8O A;  4YD1 A;  4DL4 A;  5F9N A;  2W9B B;  4NLK A;  4OD0 A;  1V9P A;  3C28 A;  2ZXI A;  2ZUB A;  5JRT A;  5L1J A;  3PSI A;  1LVH A;  3H0L B;  5KT7 A;  3NS1 A;  4RQ5 A;  2YML A;  2YMM A;  1XS9 D;  1ZQO A;  1WG8 A;  2A1J A;  4RT2 A;  1TAQ A;  4C4T A;  2DUY A;  3U26 A;  1ZQH A;  2Z7J A;  1S10 A;  1PK3 A;  4GC7 A;  2XO7 A;  5ALJ A;  4M9G A;  3WKA A;  2LHT A;  1RG6 A;  4YD2 A;  2BZF A;  2W8L A;  4I2J A;  3BS5 A;  4C4S A;  5IIL A;  2Y0S C;  2O6K A;  4EBD A;  2HHV A;  4I27 A;  4YMM A;  3B9J A;  4F5Q A;  4YQW A;  4OJL A;  3WU2 U;  2LKY A;  3MDC A;  2HHX A;  5HMM A;  2ZJA A;  4NY8 A;  1UPH A;  3EW9 A;  3M7D A;  3ORY A;  2Y1I A;  2JMG A;  4M6W B;  2ZIV B;  2P66 A;  3CRX A;  1V97 A;  5KFW A;  2JGA A;  3RR8 A;  2RDJ A;  1Z3E B;  1BPB A;  4UAV A;  2DGZ A;  1MQ2 A;  4UB5 A;  2UVV A;  5HNK A;  3QUQ A;  4QZG A;  2HHW A;  1BGX T;  3IN5 A;  5AI9 A;  2HW3 A;  4A8E A;  2QAR B;  2NRW A;  1RM6 C;  1N62 A;  1JXE A;  1N61 A;  2EZX A;  2XCP A;  4P4P A;  2WAQ C;  1ZQP A;  3WK6 A;  4DL6 A;  1U9L A;  2W9C B;  3TAQ A;  3T5L A;  1IM4 A;  2ZIU B;  5ALT A;  5J0Q A;  2W54 A;  2H3I A;  1XSP A;  5KG6 A;  1H38 A;  2WB1 C;  1Z4N A;  2KTQ A;  4M9L A;  1MC8 A;  5KFO A;  3CYM A;  4XUS A;  3EPG A;  5ALK A;  1BPE A;  2ASL A;  1ZD3 A;  4DCC A;  2NO5 A;  2F8K A;  3K75 D;  2KZM A;  4J03 A;  5L1I A;  4PHE A;  4ED1 A;  4Y2Q A;  5T14 A;  3RJE A;  2FDR A;  3MGH A;  1NOM A;  3KHH A;  2LPE A;  3QXG A;  1UT8 A;  5AKZ A;  4OO1 J;  3I1Y A;  4Q8E A;  3ETR A;  2F1I A;  4K4H A;  1D8Y A;  2ASD A;  8ICU A;  4GXK A;  4KLL A;  1UQV A;  2HHT A;  1QCK A;  5KG0 A;  1X6J A;  9ICT A;  5EWE A;  5HP4 A;  4DL2 A;  4DWI A;  4I2B A;  3QU2 A;  9ICS A;  4KLG A;  3PZP A;  3PMN A;  1L3T A;  4P0Q A;  4US9 A;  2MA1 A;  2JXJ A;  4J9Q A;  4DEZ A;  2FMS A;  2K4E A;  1L3V A;  3N97 B;  5KFD A;  3H0M B;  3AQF A;  3EWA A;  8ICK A;  1UHU A;  2DKZ A;  4Y2J A;  2BDP A;  5J29 A;  4DS4 A;  1A6S A;  1VDV A;  4NM2 A;  1FFV A;  3ONN A;  4RQ6 A;  4B9U A;  1B4F A;  2EAM A;  5ALV A;  4RQ8 A;  4FBT A;  2WF8 A;  7ICN A;  4ED2 A;  3JPO A;  3EYZ A;  8ICR A;  1T3Q A;  2ZIX B;  3QE9 Y;  5D46 A;  1UT5 A;  5L9X A;  5J0S A;  2JEG A;  3M8S A;  3HX0 A;  1ZJN A;  1L8L A;  2ESE A;  1B0X A;  1BPZ A;  4R8U B;  2WF9 A;  1SV0 C;  4ECQ A;  4RPX A;  2JHD A;  3M6Z A;  5DBC A;  4JV0 A;  1BVS A;  1DGJ A;  3EZ5 A;  4J9K A;  3KFU F;  3ZD9 A;  2FE9 A;  1D9F A;  4C8M A;  2BHN A;  4P4O A;  1T8E A;  1TK8 A;  3TI0 A;  5J2C A;  3OJS A;  8ICC A;  1PZN A;  4IRD A;  3QEA Z;  1XO0 A;  4IL6 U;  3G6Y A;  1ZQI A;  1ZJM A;  5KFH A;  1NJX A;  4DL3 A;  5KFR A;  3K1Z A;  3PW7 A;  3T79 A;  4G3I A;  4DQI A;  1HJP A;  5CJ7 A;  3AU6 A;  3F5E A;  4MFC A;  3RJF A;  1ZQE A;  3KZX A;  2XY7 A;  4IQT A;  4DOA A;  2QB1 A;  3GIK A;  4EEY A;  2K8B B;  2W11 A;  5HR6 A;  4RQM A;  3N28 A;  7ICQ A;  5TIS U;  4O3P A;  1ZQS A;  5EE0 A;  9ICE A;  9ICK A;  5HHI A;  2B6G A;  5CEH A;  1UA0 A;  4O3Q A;  3OGU A;  4RPY A;  1T3N A;  3OPX A;  2ZTC A;  2KE7 A;  5H2F U;  4EEK A;  2NRZ A;  3IM1 A;  3TAD A;  1ZQN A;  4KX3 A;  3C2L A;  1X42 A;  4GXJ A;  4WJ3 B;  3B0X A;  4YR2 A;  1TKD A;  3NVY A;  1JN3 A;  1PVQ A;  7ICM A;  2MUT B;  3SAG A;  2YN4 A;  5L1K A;  9ICA A;  1WCN A;  5ALM A;  2WF7 A;  3L4P A;  3QNM A;  4DFD A;  1HUZ A;  3FYH A;  2QB0 A;  4DOB A;  1U47 A;  2XY5 A;  4DFJ A;  5EWF A;  4HAI A;  1D8B A;  2C2E A;  2KZ3 A;  4FFD A;  2PXI A;  1N60 A;  2R8H A;  4YMO A;  2YQE A;  1SXD A;  1U49 A;  3C1Z A;  4RQ2 A;  1QSL A;  1SIJ A;  2OYY A;  2E8O A;  2IHN A;  3V6H A;  1N5W A;  3PSF A;  4UAT A;  5IIJ A;  3LYS A;  2KJ5 A;  2DF4 B;  3C2K A;  4JWM A;  2A3V A;  2ZJ5 A;  5G5H A;  3KHG A;  4FS2 A;  5J0X A;  2EDU A;  5J2A A;  3DV9 A;  8ICB A;  4NLG A;  3AUO A;  3JPQ A;  2VA8 A;  4NL9 C;  2JZB B;  5J2K A;  4UBC A;  3I28 A;  4J9N A;  3QU5 A;  1V38 A;  4IRK A;  4Y2R A;  3ZI4 A;  4J9P A;  3QZ7 A;  4MF8 A;  3PX4 A;  3ED5 A;  1ZQU A;  2DPJ A;  1ZQD A;  8ICI A;  2HHS A;  8ICH A;  2J6S A;  5AK6 A;  1PVP A;  3D2S A;  2V4R A;  5KFP A;  3GQC A;  4F91 B;  5K4L A;  3HW8 A;  2F77 X;  5DGB A;  4ECW A;  4B9V A;  1ZQ1 C;  5KFN A;  4GIB A;  1XSN A;  1FFU A;  5DDY A;  1HUO A;  2KJ8 A;  2NO4 A;  4RUC A;  1MQ3 A;  4TQS A;  2EAP A;  2ES6 A;  4ED6 A;  2EZY A;  2LM1 A;  5KG3 A;  3RB0 A;  1QQ7 A;  4Y2U A;  2BGW A;  4QIW F;  2LYH A;  3M1Y A;  2E8N A;  1OXJ A;  4RU9 A;  3LK9 A;  2HBM A;  3LWL A;  1WWU A;  2ZTD A;  5J2I A;  4F3O A;  2KHV A;  5CRX A;  2HVI A;  3WKC A;  8ICT A;  5J2G A;  1ZYQ A;  1NK9 A;  4KMO B;  5CB1 A;  3PNC A;  1X9S A;  4UB4 A;  2W3S A;  2BPF A;  7ICI A;  2PMZ F;  4J9O A;  1NI3 A;  3I76 A;  3RBD A;  3SD7 A;  3C21 A;  3IG5 A;  5J8Y A;  2KJ9 A;  3N7P D;  1X66 A;  1VLB A;  5KFF A;  7ICK A;  4QZH A;  3SEN A;  3C5G A;  3KD3 A;  4F4Y A;  3IRU A;  4ICA A;  4F4Z A;  4KTQ A;  3MDA A;  3HP6 A;  4ACO A;  3MGV A;  5DBB A;  2JR5 A;  3HRD D;  3LVV A;  2A1J B;  3IDW A;  3MFI A;  2KSO A;  3CNH A;  3OHB A;  3SZ2 A;  1RYR A;  2FLN A;  4AYB F;  4ED7 A;  3N4M B;  1ZQW A;  2DKX A;  2JH7 A;  2WTF A;  3GII A;  4I2A A;  3GZF A;  2OXO A;  1PVR A;  2FPL A;  3RJG A;  5ALW A;  3K4G A;  9ICV A;  1RDF A;  3BS5 B;  5DB6 A;  4QWC A;  4M9J A;  4QZC A;  2FI1 A;  5DQI A;  3HT3 A;  3GV7 B;  4NLZ A;  3SR6 A;  4CNQ A;  3KKA C;  2Y9T A;  4DSF A;  4BX9 C;  2IMW P;  8ICM A;  3UQ2 A;  4U6P A;  5AI6 A;  5AK3 A;  2HBK A;  2EAO A;  4F50 A;  4E0D A;  1ZET A;  2IOH A;  4CE6 A;  8ICJ A;  3M6K A;  1ZQZ A;  5J0Y A;  9ICQ A;  3RH4 A;  9ICN A;  1GO3 F;  2YB4 A;  3TFS A;  4PPX A;  3MR2 A;  2K4I A;  1Z00 B;  2KMD A;  2L5Y A;  3QUB A;  1DRG A;  1T94 A;  4KLJ A;  5KG2 A;  3QUT A;  3RFA A;  4F4X A;  2RRD A;  2FPM A;  5IIN A;  2KD1 A;  4TUS A;  3JPR A;  4I2C A;  5IIM A;  2K8C B;  2FLP A;  3ICX A;  1SGG A;  4Z6F A;  3FDS A;  3H4B A;  4O0I A;  4F8R A;  5ALP A;  2G09 A;  2KEY A;  3PW5 A;  3R9K A;  2IOF K;  8ICG A;  4ECX A;  1SKW A;  1S77 D;  4DQS A;  4KLO A;  3TAR A;  4DO9 A;  2KZZ A;  3M8R A;  1A76 A;  2DQN B;  4DFM A;  1A0P A;  1IV8 A;  4FS1 A;  1SL2 A;  1UA1 A;  2G06 A;  3C29 A;  4DL5 A;  3SYZ A;  2HI0 A;  4UB2 A;  4RQ4 A;  1O08 A;  3B0Y A;  5KG1 A;  3GDX A;  3PW4 A;  4BWJ A;  5ALF A;  5J2H A;  1D8L A;  3HJE A;  4DFP A;  7ICH A;  1TFR A;  3UXO A;  4CF5 A;  2I5H A;  2RDI A;  4QNL A;  4LVS A;  8ICF A;  2LI6 A;  2V4Q A;  2R8K A;  2GOL A;  2ISO A;  1X9X A;  2JRZ A;  3JPP A;  4QWB A;  3D6J A;  8ICO A;  5KFC A;  2ZIW A;  4O3R A;  4P0Q B;  3AN1 A;  4DSJ A;  2K4P A;  5FP0 A;  2XGP A;  4EBC A;  1ZQK A;  4B9S A;  5AI8 A;  5JU5 A;  4QZF A;  4QWE A;  1A77 A;  1NK0 A;  4F92 B;  1LB2 B;  5AK5 A;  9ICF A;  2VJ4 A;  2KP7 A;  3IHQ B;  2AJQ A;  5HR7 A;  1KLN A;  4JK1 A;  4RPZ A;  4EX7 A;  3AM9 A;  4O9M A;  1S9F A;  1TAU A;  2A19 A;  4DLE A;  2C28 A;  4IQU A;  1RQL A;  2VKQ A;  8ICE A;  1Z1B A;  1QQ5 A;  2G5I B;  1DOQ A;  4KN4 A;  3C2M A;  3GIJ A;  2NRT A;  5HHH A;  5KAF U;  1SV0 A;  1KDH A;  7ICU A;  9ICI A;  4PGQ A;  3MR5 A;  4PHA A;  1U48 A;  2G08 A;  3QU4 A;  5J2D A;  4IR1 A;  1AQ6 A;  3MR6 A;  4FZM A;  4I2E A;  1RPL A;  4C8N A;  5ALY A;  3EPI A;  4CF3 A;  4PHP A;  4YFK A;  5ALX A;  3MR3 A;  5KFY A;  4EBE A;  4P0P A;  1C7Y A;  1Q8K A;  2R18 A;  1DXS A;  3FAH A;  1J2M A;  4JV1 A;  4UB1 A;  3ZDE A;  4TUQ A;  4GC6 A;  2KIC A;  4Y2X A;  4F93 B;  2MSN A;  5AKK A;  2ZG6 A;  3RH6 A;  3KZI U;  4Q44 A;  3SV4 A;  4C7Z A;  5AIB A;  5KFZ A;  4US8 A;  4QW9 A;  4ELV A;  2P6R A;  3T5H A;  4YP3 A;  1Z4O A;  5J2B A;  5KFV A;  3WKD A;  3BQ0 A;  4BUG A;  5KT3 A;  3L5K A;  1L7O A;  1JI7 A;  3BQ7 A;  5J2E A;  2A1A A;  1F5S A;  4R64 A;  3ZDB A;  4DF8 A;  1N2X A;  1L3U A;  1CEZ A;  2HMX A;  3ZDD A;  2KK0 A;  5AI0 A;  2EH9 A;  3M9N B;  4DLG A;  1L7P A;  3H8M A;  1SKS A;  9ICB A;  3RJI A;  2C22 A;  4GLX A;  4O5E A;  5KFU A;  4ECS A;  4KLM A;  4P2H A;  2IBK A;  2QB0 B;  3F2D A;  5KFM A;  2AGO A;  2W8K A;  3WKE A;  4YR3 A;  1QLN A;  1KN5 A;  5AKL A;  5DG8 A;  4ED8 A;  2QAR A;  2R8J A;  2BCV A;  2RHF A;  5A0L A;  2B0C A;  4QIW C;  3M9O B;  2KVC A;  4OJ5 A;  3PST A;  2M0N A;  2IA6 A;  5KFQ A;  4QZ8 A;  1TAM A;  3BDP A;  5CHG A;  2PKE A;  2JH1 A;  4FE3 A;  3PR5 B;  2ZIU A;  1OW5 A;  1PK1 A;  3PY8 A;  4J9M A;  1Z1V A;  2PMZ C;  3IV6 A;  2XY6 A;  5KFG A;  4QJF B;  4AP9 A;  8ICA A;  1K5O A;  4O3S A;  2V9W A;  4C8K A;  1Q46 A;  1QTM A;  1VJ5 A;  5DBA A;  2NV3 A;  4Y2P A;  4ZH4 A;  2W55 A;  1ZQV A;  5ALG A;  2HOF A;  7ICL A;  4O3O A;  3RB3 A;  3Q8S B;  3SAH A;  1L5U A;  5AM5 A;  2LYA A;  3H8J A;  1B43 A;  2CN1 A;  5KFA A;  3ISB A;  2AQ4 A;  4BXO A;  4Y2V A;  4KLE A;  1BNP A;  4UQG A;  2P6U A;  2VIX A;  4YR0 A;  2W43 A;  4O5K A;  1C20 A;  4DQP A;  5AKG A;  1OUQ A;  1KQQ A;  3GIL A;  1S76 D;  4MEY A;  2W3R A;  1JAL A;  1XO1 A;  4OJ6 A;  4YCX A;  3BQT A;  4I28 A;  2UVU A;  3O0F A;  4O5C A;  5J0U A;  1Y88 A;  4QZD A;  3NTU A;  2EAN A;  5ALO A;  3EUB 2;  3F2B A;  2HBL A;  1ZOL A;  4CGZ A;  1SZH A;  2PI5 A;  3DDH A;  1BPX A;  2WFA A;  2MRL A;  1Q3V A;  9ICL A;  7ICR A;  5KFE A;  2C2D A;  5EOZ A;  1B22 A;  5DG9 A;  7ICP A;  2KKV A;  4PHD A;  8ICS A;  3S6J A;  3NUQ A;  4KIT B;  4YMN A;  1XU4 A;  3JPT A;  5EE3 A;  1NJZ A;  1JIH A;  3V72 A;  1NKC A;  4M2Y A;  3ETL A;  4RQN A;  4Q45 A;  1N63 A;  5ALN A;  5CA7 A;  5AM4 A;  2ALZ A;  2AU0 A;  4USA A;  4B9M A;  3GFK B;  5AIC A;  2YX8 A;  4J9R A;  5E79 U;  5KG7 A;  1SV4 A;  1YZ6 A;  2I1Q A;  5C0Y A;  2KN7 A;  4DL7 A;  1TV9 A;  2GH1 A;  4ECU A;  3OJU A;  2H3F A;  3Q8P B;  4OJP A;  4GXI A;  3BZK A;  2Q0Z X;  5J2F A;  9ICP A;  8ICV A;  1L3S A;  4C7Y A;  2E3T A;  4B9N A;  4UAW A;  1ZQL A;  3MBY A;  4Z6E A;  5L1M A;  3TAD C;  9ICX A;  5CP2 A;  2NYV A;  1ZQM A;  2C2R A;  2VJ5 A;  2W9A A;  4PJ0 U;  5AM2 A;  2F1J A;  3BJY A;  4EEN A;  3FC4 A;  5ALZ A;  5AI5 A;  2FLL A;  2ZUC A;  1NJW A;  5KT5 A;  3RJH A;  1ARO P;  3WK9 A;  5DG7 A;  4IRC A;  4UAZ A;  4UB3 A;  2PFP A;  5DLG A;  2F76 X;  5KFX A;  4RT3 A;  4FZN A;  2ZXH A;  4MHV A;  5AHX A;  1T7P A;  5AM3 A;  5ALQ A;  1S0V A;  3AU2 A;  4JWN A;  3RAX A;  1KW4 A;  5AKI A;  4J9S A;  2DPI A;  4BDP A;  2N1R A;  2ATL A;  4PZN A;  1SXE A;  3H0R B;  2RLT A;  2ZTE A;  1QSY A;  2I9G A;  3PML A;  2KIV A;  3RBE A;  2IOF A;  4YVZ A;  2VAN A;  3UM9 A;  4QZA A;  1S0O A;  1SL1 A;  3NRW A;  2XVT A;  4XQ8 A;  3QU7 A;  2VA2 A;  7ICT A;  2WHE A;  3Q8M A;  5KFI A;  1X9M A;  2G07 A;  8ICX A;  3KHL A;  5C5J A;  4G9B A;  4IS7 A;  3ALR A;  2VA3 A;  2HCF A;  2BQR A;  4NV0 A;  3BS7 A;  1BPY A;  4R65 A;  1ED1 A;  3WK7 A;  1QQ6 A;  4ECY A;  2LYB A;  4RQ3 A;  3DEE A;  4ECV A;  4LJX A;  4MF2 A;  5BOM A;  3V6K A;  3PVX A;  3F53 A;  3KTQ A;  2AGQ A;  2OCE A;  2J6T A;  1ZQY A;  3UXP A;  5ALS A;  4PL1 A;  3WK8 A;  1N5X A;  4HYK A;  2AH5 A;  1PUZ A;  1ZRN A;  3KBB A;  4Z6D A;  2F2A B;  4EEL A;  3V7L A;  1L7M A;  2DBY A;  1T4G A;  2JEJ A;  2D6F C;  1QSS A;  5B5E U;  4IC9 A;  3UQ0 A;  3SI8 A;  3PW0 A;  5KT4 A;  4YG2 A;  2BCQ A;  3NGD A;  1URJ A;  1ZQJ A;  2KIW A;  2BCS A;  2JEI A;  4XRH A;  4F4W A;  5AM0 A;  1SWW A;  4PGY A;  3H4D A;  2KV2 A;  4YXM A;  4O3M A;  3N7S C;  4KX5 A;  4J9L A;  5AKH A;  5KFB A;  3HPO A;  1ZQC A;  3ZD8 A;  2CPR A;  4ECR A;  1IIP A;  3K1R B;  1KTQ A;  5J8Y C;  4UAY A;  3MFH A;  5J0T A;  5DKW A;  4YN4 A;  8ICQ A;  4KLQ A;  4CCH A;  5AKE A;  4CF4 A;  5AKY A;  1LKY A;  3RH5 A;  1WCL A;  2KFN A;  3PO5 A;  2IHM A;  1BPD A;  2KG5 A;  5DB7 A;  3LDA A;  2BR0 A;  2XGQ A;  4QZB A;  1DK2 A;  3QX7 A;  5J0O A;  4P0P B;  2YY6 A;  4KLD A;  4EZ6 A;  2GO7 A;  4QZ9 A;  8ICZ A;  2LMR A;  5DDM A;  5J0W A;  3TAN A;  3D2Q A;  1HIW A;  3NVW A;  2XI9 A;  3QEB Z;  3BQ2 A;  4Q43 A;  4LZD A;  2Y1J A;  4UB8 U;  2OH2 A;  4R63 A;  5DQH A;  4I2I A;  1JRO A;  2OWO A;  4IQV A;  4ELU A;  8ICW A;  1NNL A;  3V6J A;  1RZT A;  2Q4T A;  2GLE A; 
#chains in the Genus database with same CATH homology
 2ZIU B;  4OJO A;  3E0F A;  2H3I A;  3HKZ F;  4BJQ A;  2G09 A;  2KEY A;  2OYY A;  3LVW A;  2WB1 C;  2PMZ F;  2XID A;  4NWI A;  4C0Z A;  4AYB C;  2VJ5 A;  2Z7J A;  1OUQ A;  2F2A B;  2HBJ A;  3IG5 A;  1XO0 A;  3CYM A;  3F2D A;  2KJ9 A;  3N7P D;  4PL2 A;  2VKQ A;  4OJ6 A;  3PSF A;  1Z1B A;  3K1Z A;  2LHT A;  2D6F C;  2HOQ A;  5KL1 B;  3LYS A;  2KJ5 A;  2DF4 B;  3T79 A;  4IC9 A;  2G5I B;  3SMV A;  2A3V A;  2E1E A;  3O0F A;  2OM6 A;  2CRX A;  3F2C A;  4ICA A;  5T14 A;  2H3Q A;  2E1F A;  1URJ A;  2KIW A;  2Y0S C;  3F5E A;  2RHF A;  4ACO A;  2DQN B;  2HBL A;  2ZIW B;  3MGV A;  3F2B A;  2F76 X;  1A0P A;  4OO1 J;  3KZX A;  4CGZ A;  1SZH A;  5A0L A;  3LVV A;  2KNJ A;  2LBO A;  2G06 A;  1Z19 A;  4FZN A;  1WUD A;  2K8B B;  4QIW C;  2ZIV A;  2ZXH A;  2KV2 A;  3C29 A;  2G08 A;  4AYB F;  4OJL A;  5HR6 A;  3CP8 A;  4FZM A;  2KVC A;  2LKY A;  4NLC A;  4OJ5 A;  2MRL A;  1Q3V A;  3N7S C;  3PSP A;  3PST A;  4KX5 A;  2M0N A;  4O3M A;  2JH7 A;  4FZL A;  4CDG A;  3AL0 B;  2G0A A;  2WAQ F;  3GZF A;  2CPR A;  2OXO A;  2KHQ A;  2BDU A;  4NLB A;  1TAM A;  1PVR A;  3VCB A;  3SAF A;  1PVP A;  3PZP A;  3D2S A;  2KKV A;  1UPH A;  1IIP A;  2JH1 A;  3NUQ A;  4FE3 A;  4P0Q A;  1YT3 A;  2MA1 A;  3M7D A;  2ZIU A;  2N1R A;  1CRX A;  4P0P A;  1L6N A;  1XNS A;  2W03 A;  2ZIX A;  3HKZ C;  2K4E A;  3H0R B;  3RF9 A;  1MA7 A;  2R18 A;  2F77 X;  2PMZ C;  3D2N A;  1ECW A;  3OPX A;  2JMG A;  1Q3U A;  3H0M B;  5KL8 B;  3AQF A;  1ZQ1 C;  2E5S A;  4QNL A;  2ZIV B;  2W7P A;  2KOB A;  2WB1 F;  2W7O A;  3IG8 A;  4GFJ A;  2KIC A;  4BX9 C;  3IP4 B;  4KX3 A;  2K8A A;  2W04 A;  2H3V A;  4WJ3 B;  2GOL A;  4QJF B;  3CRX A;  4CRX A;  1A6S A;  4U6P A;  2JGA A;  3AQE A;  2HBK A;  1F44 A;  3ONN A;  3SQI A;  2KJ8 A;  2ZG6 A;  3F5A A;  3GU3 A;  1PVQ A;  4JMU A;  2G5H B;  2NV3 A;  2DGZ A;  3NRW A;  3M6K A;  3SAG A;  1NZB A;  1KBU A;  3L3F X;  2XVT A;  3N7R C;  2ZIW A;  2F8L A;  3IN5 A;  4P0Q B;  2HOF A;  4A8E A;  4P0P B;  2G07 A;  2YX8 A;  1GO3 F;  2Y0S F;  2YB4 A;  5C0Y A;  4U7C A;  2ZIX B;  3SAH A;  4BUG A;  2LYA A;  3ALR A;  2K4I A;  2GH1 A;  4QIW F;  1P7D A;  1DRG A;  1T94 A;  2H3F A;  3D2Q A;  1HIW A;  2CN1 A;  4NV0 A;  4OJP A;  2XI9 A;  2HOI A;  1HEK A;  3C28 A;  2K4H A;  2ZXI A;  1ED1 A;  2HBM A;  2WAQ C;  2HMX A;  2RP5 A;  2RRD A;  3RFA A;  2OH2 A;  2VJ4 A;  3VC8 A;  2LYB A;  2YB1 A;  2XIC A;  3H0L B;  3PSI A;  3DEE A;  2KD1 A;  2KHV A;  2JHD A;  1D8B A;  3M6Z A;  2K89 A;  5CRX A;  3F53 A;  2K8C B;  3ICX A;  5HR7 A;  2H3Z A;  2KKP A;  3KFU F;  2VIX A;  4KMO B;  4PL1 A;  2Q4T A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...