2CPRA

Solution structure of the hrdc domain of human exosome component 10
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
124
structure length
124
Chain Sequence
GSSGSSGKPIFTDESYLELYRKQKKHLNTQQLTAFQLLFAWRDKTARREDESYGYVLPNHMMLKIAEELPKEPQGIIACCNPVPPLVRQQINEMHLLIQQAREMPLLKSEVAAGVKKSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Exosome component 10
publication title Solution structure of the HRDC domain of human Exosome component 10
rcsb
source organism Homo sapiens
molecule tags Gene regulation
total genus 23
structure length 124
sequence length 124
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00570 HRDC HRDC domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.80 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase; domain 1 2cprA01
5C0YA 2HBLA 4CGZA 1GO3F 4O3MA 3SAHA 4NLBA 4NLCA 1D8BA 4QJFB 2RRDA 3SAGA 4QIWF 2HBJA 4CDGA 2HBKA 1WUDA 2DGZA 2KV2A 1YT3A 3CYMA 4OO1J 2HBMA 2RHFA 2E1FA 3SAFA 2MA1A 2CPRA 2E1EA
chains in the Genus database with same CATH superfamily
2W9AA 4P4MA 3C2KA 3ALRA 5EE1A 3UMBA 1L7MA 1KBUA 5ALUA 3K1RB 1UA0A 2UVVA 2KICA 2KJ5A 5AK4A 9ICCA 5E79U 4KLIA 3HT3A 2HBLA 2F76X 4LVSA 3R9KA 1ZQMA 3WK4A 4F93B 1Z3EB 3RB3A 5AKZA 5CRXA 4NY8A 3TADC 4QZ9A 5KFJA 5H2FU 4M9LA 2VJ5A 7ICMA 4RQ6A 9ICHA 7ICLA 4DFKA 3KHRA 3H0RB 3RJKA 4C7YA 3LK9A 4C4SA 1X6JA 3TAPA 4Y2SA 5AM4A 3KD3A 3F2CA 3C5FA 3QXGA 3RRHA 4NLCA 1NK6A 4ELUA 1D8BA 1VDVA 1T4GA 3E58A 5DLFA 3OSNA 4RNNA 2KZ3A 2FMPA 4EZ6A 3NS1A 4I29A 2J6TA 4KN7A 1BPBA 1QSSA 5G5HA 1SXDA 4NJ8A 9ICQA 5KFLA 4F71A 3PW2A 1ZQOA 5ALRA 3QUCA 3RH4A 9ICFA 5AIBA 4Y2QA 1TK0A 2I9GA 4PH5A 2EZZA 5KFBA 5J2BA 2BR0A 2YMPA 2AXTU 4OD0A 3QU5A 4G3IA 1IM4A 2EZYA 2HVIA 8ICAA 1IG6A 4I2CA 4CF4A 2B0CA 1SV0A 2QKQA 3ZDAA 5KFPA 1L5UA 3C5GA 2XC9A 1N60A 5ALYA 4B9MA 3TFSA 4ECVA 2ESEA 1ZQVA 4DLGA 2HHUA 1BPYA 1PK3A 2FE9A 4I2EA 3A0HU 3KKAC 4XQ8A 4BX9C 4ECRA 2ALZA 7ICRA 1VLBA 5IIJA 4DQSA 1QQ6A 5J0YA 3N97B 5HMMA 2KHQA 4YMOA 3UM9A 4M9JA 2AGOA 2K8BB 5AKGA 1S0MA 3WKBA 4M9NA 3UXOA 2W3SA 1N5XA 5AM0A 1JMSA 4DSLA 5ALGA 3MC1A 4M2YA 2ISPA 3N7SC 1IXRA 2HW3A 3M7DA 4Y2UA 2R8GA 8ICZA 4P2HA 1ZQDA 1T3QA 4DQRA 4GLXA 4IQUA 4DS4A 2IHNA 1LB2B 2BCVA 1JXLA 3RR8A 5IIIA 3QEBZ 7ICUA 4MHVA 5AM2A 1SKWA 4J9LA 4KLOA 2C2DA 4DFJA 2IMWP 9ICRA 3QUQA 3HX0A 2Q0ZX 2G0AA 2KP7A 3ED5A 4ECQA 3JPSA 5KFHA 9ICVA 2E1FA 4ACOA 4C4RA 3LDAA 1BNOA 4DCCA 4P4OA 2GWSA 3MR3A 2Z7JA 4J03A 4I2DA 1PVQA 2OCEA 1L8LA 3RJJA 4KLMA 2CXYA 2XI9A 5F9LA 3MDAA 3BDPA 5HHHA 3F5EA 4I2FA 1CEZA 2N1RA 4Q43A 3IG5A 4B6JA 1RYRA 5CEHA 4P4PA 1ZQSA 5KFSA 2NRTA 3BS5B 4UB8U 2HMXA 2OYYA 5IIMA 3ZDCA 5J0SA 4CDGA 5JUMA 4USAA 4CRXA 4J9MA 5D49A 2ZTEA 2D8CA 1N5WA 3ETRA 3NRWA 3H4DA 4DSIA 4K4GA 8ICCA 5KFYA 3BS5A 4NL9C 3I1YA 4QWAA 1ZQLA 1QTMA 1O03A 2M9NA 5ALEA 4IRKA 2RDIA 4NM1A 5J2JA 1JI7A 9ICBA 5KT6A 4IS7A 2XO7A 1NK7A 9ICNA 1DK3A 1LKYB 4KN4A 4O9MA 4G9BA 2DL0A 1S5LU 2XIDA 4Y2JA 3N28A 3H0MB 2J6SA 1LKYA 5ALNA 3KHGA 2QARB 3ZD9A 3TFRA 2BPCA 1NJXA 5JU5A 5EWEA 4NLNA 3RRGA 3CRXA 2DPIA 2LMRA 2FPLA 2P6UA 1S97A 2QARA 1VJ5A 4WJ3B 1KSPA 3KBBA 1S8OA 2O6KA 5ALHA 4XA5A 5G5GA 2F77X 2E8NA 4M47A 3MR6A 3C1YA 3OJUA 2PMZF 1RQNA 5DB6A 1N62A 5CB1A 1XSLA 2WF7A 1ZQCA 3EZ5A 1NNLA 3Q8QB 5AKEA 4F2SA 5AI5A 5AKIA 5J8YC 4IC9A 1XWLA 3BJYA 1N48A 1AROP 3A0BU 5ALVA 1QH9A 4Y2YA 4QWCA 2FMSA 2R8KA 7ICTA 5AHXA 4ECYA 2EANA 4OJ6A 2WF9A 5J2IA 1QQ5A 3QZ8A 4JUZA 4OCZA 4YD2A 5ALJA 5L1MA 2VA8A 3RJIA 4TUSA 2H3VA 2NRZA 3M9NB 3UQ0A 7ICFA 3LYSA 5J0QA 4NWIA 3RAQA 5AKKA 4E0DA 3S6JA 3SYZA 2VIXA 4MF8A 1L7NA 2QB1A 3U26A 3GQCA 3E2EA 1UT8A 8ICOA 4IQTA 1SZHA 2ZUCA 3RB4A 3T3FA 3M9OB 4AYBF 4TUQA 1RQLA 3IM1A 2JEGA 2FLNA 4M6WB 2F8KA 3LVVA 4PHDA 4GXKA 2Y0SC 2KE7A 3V7LA 5KT2A 1V97A 3Q8LA 1ZD2P 1FIQA 3JPTA 2ZG6A 4KLSA 1ZJMA 3RBDA 2HHTA 2LPEA 4KLGA 4M6WA 3SENA 2RRDA 3L4PA 4UBCA 4Y2RA 2GOLA 3LWMA 2BPFA 5C5JA 1WWUA 3NGDA 2QB0B 1JUDA 5ALPA 2EH9A 2AGPA 3RJGA 4JV0A 5DGAA 1TAQA 1Z00B 4DL5A 1ZOLA 5AK5A 1ZJNA 1NZBA 4QZAA 2QB0A 2H3QA 2KD1A 4FBTA 5AKLA 5D4BA 2JZBB 3PZPA 2ZTDA 4UB3A 3BQTA 2BCQA 2LYHA 3E0FA 2ES6A 1Z00A 2KN7A 4YR3A 1SZPA 2YN4A 2W54A 2JZBA 4ECTA 5KG1A 1KLNA 2E8MA 4JV1A 2RP5A 3H8WA 3C23A 3NRZA 1Q3UA 4NV0A 3T5KA 5AI4A 4PL1A 3EYZA 2W3RA 2KJ8A 4YP3A 3DDHA 7ICKA 5JTIA 4J9QA 3RH5A 2KZMA 2V9WA 4YFKA 4F4KA 4DL7A 9ICOA 3THVA 2F1HA 3ZDBA 3BQ2A 4XUSA 4QZEA 5D46A 4F92B 2A3VA 5BPCA 4Z6CA 1D9FA 4M9GA 4ED8A 4EEKA 5KT3A 1COKA 4Z6FA 3F5AA 1WUDA 4QZFA 4QW8A 1X6IA 5AICA 3NVYA 1RM6C 3IV6A 2JEIA 4PHAA 4KITB 4FS2A 1RZTA 3DV9A 2JH7A 2EAMA 3G6YA 8ICQA 2KVCA 4YXMA 3C21A 5KG5A 4DOCA 4ECZA 3T5JA 1N61A 1ZQHA 3PMLA 1KFDA 2ZUDA 3TAQA 4ED1A 3ZD8A 2HHVA 5J2CA 2KOBA 4YR2A 3M9MB 5AIAA 3PW0A 1XNSA 4DL2A 2HVHA 3OGUA 2ASLA 8ICNA 1S76D 4QWDA 1JN3A 3SAGA 2HBJA 2DGZA 4FZNA 5KFTA 2MU2A 3PX4A 1JROA 3NUQA 1KDHA 4IQVA 3SAFA 3C2LA 1SL0A 3NVWA 4O3RA 2PFQA 4C80A 3SQIA 8ICKA 2LHTA 2AQ0A 4R65A 4BXOB 2Y1JA 3GILA 2W9CB 1S9FA 5EE3A 2NYVA 4MFAA 2PI4A 3QX7A 3NVVA 4YD1A 1T3NA 2W04A 1Z19A 2KTQA 4BXOA 1NKCA 1COOA 5DKWA 2W9CA 4PPXA 5J2HA 3C2MA 3N7PD 2EAPA 3RH6A 9ICEA 5AI9A 3IP4B 1B22A 3Q8RB 3SZ2A 4MEXA 4HYKA 4F72A 3FYHA 4Q8EA 1ZYQA 3OHBA 2R18A 1L6NA 1UPHA 2PMZC 2XCPA 3FDSA 1U4BA 4QZ8A 2WB1F 2KKPA 1A76A 3AL0B 3C28A 2XCAA 1KL9A 1SKRA 2WTFA 3UXNA 3UQ2A 3V7JA 1A77A 3PO4A 2XGPA 7ICJA 1K5OA 1ZQNA 1QQ7A 1HJPA 3EUB2 5IIKA 2BDPA 4EBEA 5IINA 2FPKA 2RHFA 3CW2C 3PSIA 5J0XA 3WK5A 4YMMA 1SWWA 3AUOA 3WKDA 2YTUA 1L3TA 4DFDA 1C7YA 3V7KA 4P0PB 2HSZA 4US9A 4U6PA 3PY8A 2W9BB 4DEZA 8ICJA 5ALXA 3Q8SB 4C8NA 5AM3A 2BCUA 5L9XA 4I2AA 3D6JA 1T8EA 4F50A 4AYBC 1FFVA 5ALDA 4P0PA 1D9DA 5AI8A 1XO1A 2W9BA 4I2JA 3GIJA 3PMNA 2HDOA 4F4ZA 5KL8B 3WU2U 1L8OA 5AKJA 4J9SA 2W7PA 1BPDA 4R66A 5AKYA 7ICOA 4LJXA 1TFRA 3OJSA 7ICNA 4OJPA 1FO4A 4M04A 5EE9A 4CGZA 3SR6A 1F5SA 2KMDA 9ICKA 2FI1A 5TISU 4B9VA 1X66A 4IR1A 4BWMA 4EYHB 2ZIUB 2PKEA 1DK2A 1X9WA 5HP4A 2DPJA 3RJFA 1P7DA 4DSKA 8ICIA 4F2RA 8ICPA 5KL1B 2K8AA 2ZIUA 1L3VA 2KSOB 1SKSA 1ZQTA 3FM9A 3KZXA 2W8KA 4I28A 4EBDA 4QJFB 1F44A 1RG6A 3AMZA 5DG7A 1ED1A 1JIHA 4F4WA 4GIBA 4UW9A 4QWBA 2WAQF 4RQ5A 1TK8A 3MR2A 2KSOA 5JRTA 4O0IA 4I2BA 5B5EU 3QU7A 4HAIA 5KAFU 4UASA 5CHGA 1CRXA 2W55A 1ZQQA 4O3SA 4BGDA 2HOFA 4QW9A 5EWFA 2KIVA 3ICXA 2LYBA 3PW4A 5KFXA 2BCRA 5DDMA 3H40A 3GDXA 4US8A 5KG7A 2ZUBA 2BQ3A 2EAOA 5ALFA 3RF9A 3PW7A 1TKDA 2W11A 3KTQA 5AM1A 2ZXIA 4DL3A 1Z4NA 2G5HB 4NLZA 2HHSA 4NM2A 1ZQUA 5KFWA 1SXEA 1PVPA 5L1LA 2DKZA 2I6XA 1QLNA 2ASJA 9ICTA 3PSTA 2HCFA 2UVRA 2NRXA 1X9SA 1TVAA 2YX8A 2XVTA 2KIWA 5DB8A 2XY6A 1Q3VA 1NKBA 3HKZF 2KHVA 1TK5A 1D8LA 3F53A 5IIOA 3RR7A 2E8OA 4ZOHC 2E3TA 4QZBA 5L1IA 4J9OA 4UAUA 3TQ1A 1FEZA 5KFFA 4FZLA 1J2MA 2BHNA 3GIKA 5DBAA 4EBCA 1KW4A 4UAVA 7ICEA 1DOQA 1PK1B 4YQWA 1MC8A 4TQSA 5T14A 2LBOA 1CI4A 2VJ4A 3CNHA 2JMGA 1SWVA 3GFKB 1PUZA 7ICPA 1QCKA 2DFLA 2PFOA 1PK1A 3VCBA 4RNOA 1PVRA 4MEYA 4IR9A 1HUOA 4F5NA 3WK9A 8ICTA 2Y9UA 4IL6U 1Z4OA 3G6VA 2WHEA 1SL1A 1JRPA 3MGIA 4CCHA 5KG4A 3LVWA 5J2KA 2V4QA 2K60A 1T94A 5ALSA 2A1AA 1DXSA 3DEEA 4K4IA 1SL2A 2F44A 2WB1C 3L5KA 1ZXIA 1U9LA 9ICIA 5KFIA 2G08A 5KFNA 5HR6A 3JPQA 5J0PA 3JPPA 1N2XA 3H8JA 3PV8A 3QNMA 3PR4A 2BZFA 5EWGA 1K1SA 4R64A 4DQPA 3TI0A 4ED0A 9ICSA 2KV2A 4GXIA 5J2EA 1QSLA 4DLEA 1L7OA 4UB2A 3QYPA 2OHFA 2ZXHA 1DGJA 1NI3A 2ZJ5A 4RZRA 2KVSA 1DGSA 3WKEA 1DRGA 1UA1A 3QU4A 2L5YA 8ICLA 3AQEA 4DS5A 1D8YA 2CN1A 2W43A 1RXWA 4UB1A 1WCNA 4GFJA 1J97A 2C28A 1KEJA 2ZIVA 5CA7A 4FBUA 2EZXA 2EDUA 1Z1VA 5AI6A 5KFEA 3AQFA 1RPLA 4FE3A 5DGBA 3J81j 2NV3A 3T79A 4RUAA 4PGQA 4CF3A 3LWLA 4J9NA 2ATLA 1MSWD 3NASA 2I5HA 4PL2A 1FFUA 3AU2A 3QUBA 1JALA 4JB3A 4O3OA 4MF2A 3MFIA 8ICVA 5J0OA 4R8UB 1LV5A 4NLBA 4Y2XA 3AN1A 2XY7A 3I28A 4CE6A 2HHQA 9ICWA 2H3ZA 4QIWF 4IQWA 4R8UA 3ZDEA 5F3XB 8ICXA 3EPIA 4PZNA 9ICAA 2KEYA 3AEVA 1Q46A 4NLGA 1RDFA 1IV8A 2YMLA 2OH2A 1C20A 2JV3A 4DF8A 2FMQA 1YZ6A 1BPZA 4RT2A 4P0QA 3IRUA 4FO6A 5AKXA 5HNKA 1N63A 4OJ5A 2HHXA 4EENA 1OUQA 1NK5A 1UHUA 1T7PA 2IOFA 2ODGA 2WAQC 3PNCA 5J2FA 3EWAA 4I27A 4PGXA 4JK1A 2ZTCA 2KG5A 2VA2A 4Y2PA 1SV0C 2JXJA 5ALMA 4EX7A 9ICUA 2LYAA 5CR0A 2K8CB 4DO9A 4FFDA 1KQQA 3CYMA 1UQVA 3HRDD 4O5CA 2LI6A 5KFCA 5DQHA 3GU3A 2IHMA 1SV4A 2BDUA 3V6HA 3HJEA 4KLJA 2OEHA 4ELTA 3MR5A 4BWJA 3KOOA 2FLLA 5HR7A 4EEYA 5B66U 5DB9A 3TACB 5DG8A 3ZDDA 2M0NA 2HBKA 1NK0A 4YG2A 5J2AA 4Z6EA 2NO4A 3N7RC 2IBKA 3EW9A 4EX6A 3HW8A 2MA1A 3M6KA 4MFCA 5A0LA 4NL9A 3H8MA 3WK7A 4Q44A 2V4RA 4RUCA 1GO3F 4DSJA 3HKZC 1KFTA 8ICBA 3OTQA 2BQUA 2AU0A 4ECUA 4DOAA 2EQYA 5KT5A 9ICJA 1X2IA 4DL6A 4F5OA 3WKCA 3I76A 2GLEA 5KT4A 1RXVA 2DUYA 1L3UA 1SIJA 5DLGA 2OXOA 4YVZA 3OHAA 5KFKA 2G5IB 2CRXA 4GC6A 1XS9D 3PSFA 3TARA 1JX4A 4IRDA 2PXIA 5DQGA 2H5XA 3CP8A 1ZQYA 5AM5A 4O3PA 4UQGA 4Z6DA 2ZJ8A 3SAHA 2GO7A 4EZ9A 2E8PA 2VANA 1PZNA 2WF8A 1NJWA 2GH1A 5FP0A 3D2NA 2H3FA 4TQRA 1WYGA 1KKXA 2DBYA 3MDCA 4F5RA 7ICVA 3GV8B 4O5EA 1S0VA 5KG6A 3HWTA 1NK9A 5J8YA 2JRZA 4F91B 5BOLA 1NK4A 5DG9A 3EPGA 3D2SA 3B0XA 4DFPA 5GTHU 4QNLA 3RFAA 1QSYA 4RU9A 4J9RA 1NJZA 4RQNA 4UAWA 2P35A 1X40A 2IA6A 4F8RA 3HILA 4LZGA 8ICEA 5J0UA 3MGVA 1AQ6A 4O3QA 3GIMA 2F2AB 4F5QA 3UMCA 4RPYA 8ICYA 3JPRA 1S10A 5BOMA 3OPXA 4FS1A 3RB0A 2YMQA 4U7CA 4RQ1A 5EE0A 3QE9Y 3NVZA 2BGWA 2ASDA 5KG0A 3QEAZ 3H4BA 3K1ZA 5AI0A 4GC7A 1RYSA 3HPOA 4Y2TA 4ED2A 4ZH4A 1URJA 4UBBA 1BGXT 1RYUA 2PFPA 2PI5A 4UAYA 1ZD3A 9ICXA 3GZFA 4UB5A 3HP6A 3JPNA 2NRVA 3PW5A 3RTVA 4LZDA 8ICHA 1F0MA 2ZIXB 2KZZA 3NTUA 2P6RA 4PGYA 5HMLA 4C4TA 5HHIA 4QIWC 4KX5A 1HEKA 5KFVA 3Q8KA 2XICA 5TZVA 4OO1J 2ZIXA 1IIPA 1XO0A 4JV2A 2WF5A 4B9UA 3MGHA 5GTIU 1BPEA 4KMOB 5CWRA 2YB1A 5ALIA 1Q8KA 1K1QA 1V85A 1XSNA 5KFDA 1A6SA 3VC8A 3BZCA 3Q8MA 3IDWA 1ZQZA 3K75D 5ALKA 4ECWA 2W7OA 3UPQA 2Y0SF 2FJ6A 2PFNA 1WCLA 1ZQIA 4RQ8A 3UMGA 2A1JB 2FLPA 4RT3A 3IN5A 4ELVA 3FC4A 1ZQWA 4J9KA 1WG8A 1ZRMA 1MQ2A 2A1JA 4RQ2A 3WK6A 4X5VA 3ISBA 2K4EA 2MRLA 2HBMA 4KLQA 1NJYA 4RPZA 1OXJA 4ICAA 1TV9A 1ZQPA 5J0RA 3ISCA 1KFSA 7ICQA 4RQ4A 2J6UA 1XC9A 4F3OA 4B9NA 5KFZA 2R8HA 5KFUA 4QZHA 5L1KA 2C2RA 4NLKA 5KFAA 2IOHA 4PHEA 3KFUF 2R8IA 4QWEA 4C8KA 2ZJAA 3OSPA 2VKQA 2LKYA 8ICWA 1V9PA 5J2DA 2JH1A 2KJ9A 3QU9A 3QZ7A 1EXNA 2IOFK 2JHDA 4F4XA 2AQ4A 1J2NA 1ZRNA 5F9NA 1B43A 4EYIB 1H38A 3UXPA 4CNQA 2ISOA 2Y9TA 3FAHA 3GV5B 8ICFA 4ED7A 4O5KA 5KNIA 2AHOB 1N56A 3F2DA 4F5PA 2HOIA 5KTQA 3PSPA 2A19A 5EOZA 4YXJA 2JR5A 1ECWA 2RDJA 4DSEA 1A0PA 5J2GA 4Y2VA 1LVHA 4OJLA 3O0FA 4UARA 3M8RA 2ZIWB 1U45A 5KT7A 4MFFA 4Q8FA 4DL4A 4M9HA 4A8EA 2Q4TA 2B21A 3TKAA 5KFOA 1ZQEA 2K89A 2ZIWA 2Y1IA 4O3MA 3V72A 2G09A 5DB7A 2HHWA 3B9JA 5IILA 2AJQA 7ICGA 1ZQFA 5ALWA 1HUZA 1S0OA 1UT5A 4DFMA 3TADA 2F1IA 5KFGA 2BPGA 4DWIA 1MQ3A 3D2QA 2DWQA 4O3NA 2W03A 2LM4A 3IG8A 3RAXA 1TAMA 3M1YA 1M6YA 3SD7A 1O08A 2OWOA 4PZOA 2D6FC 4KLUA 3BQ0A 3T5LA 4ECXA 1ZQRA 1Y88A 4BJQA 1SB3C 2MSNA 4B9LA 2WF6A 4IRCA 4PHPA 3ONNA 2AH5A 2YY6A 2D3DA 5CJ7A 2UVUA 3SI8A 5ALZA 1HIWA 4DQQA 2JEFA 4JWMA 4DOBA 4KLLA 4KLDA 4M0AA 2BCSA 2G07A 4EELA 4JMUA 3RB6A 1UCVA 2MUTB 5KAIU 2NRWA 5ALQA 3H7IA 1NOMA 3BQ7A 4KLTA 5DBBA 1L7PA 2QLTA 4AP9A 3RBEA 2MUTA 2DKXA 3MBYA 1NK8A 5C0YA 4R63A 1Z1BA 2UVWA 5J29A 2B6GA 4ED3A 3F2BA 2K4IA 4TURA 2R8JA 4UAZA 2C22A 2ZIVB 1SGGA 5AK3A 1ZQJA 3WK8A 2I1QA 4FZMA 1ZQBA 2OM6A 5KG2A 4RQMA 3GV7B 5KFRA 4RQ7A 5ALLA 4QZGA 3ZI4A 3C1ZA 4F4YA 1U47A 2G06A 2WFAA 2VA3A 4C7ZA 3ETLA 4RPXA 2YMMA 3KKAA 1U49A 3MABA 1MA7A 2FPMA 3PO5A 8ICGA 1ZQKA 3Q8PB 3K4GA 1MN8A 1X42A 8ICUA 4Q45A 4YR0A 7ICIA 5KG3A 2C2EA 4C8OA 3B0YA 4I2GA 1BVSA 9ICPA 2MAXA 2LM1A 5ALOA 2KFNA 3GIIA 3BS7A 2AGQA 9ICLA 1CUKA 4OJOA 4P0QB 3V6KA 2NO5A 3PVXA 4KLHA 3SMVA 1NKEA 1YZ7A 3KZIU 4GXJA 8ICRA 1ZD4A 2RQ5A 5DQIA 4UB4A 2DF4B 3PR5B 2F1JA 4XRHA 2K4HA 7ICSA 3BQ1A 1XSPA 1WWVA 3TANA 1ZETA 4JWNA 4NXZA 3H8SA 2W9MA 2W8LA 2F3NA 2JGAA 1L3SA 2BKEA 1XU4A 1B4FA 1ZQXA 4BDPA 2P66A 4RNMA 4ED6A 3G6XA 4K4HA 4RQ0A 2BQRA 1KTQA 1TE2A 1V38A 5J0TA 2YB4A 3JPOA 4DSFA 1ZD5A 2E1EA 3KHLA 1BPXA 3V6JA 3M8SA 2JEJA 3ORYA 3AM9A 1S0NA 4PJ0U 3RJHA 5AK6A 4QZDA 4RQ3A 3QU2A 5DDYA 8ICSA 1YT3A 4C8LA 3SV3A 3M6ZA 2YQEA 2H3IA 3H0LB 4KMUA 2HOQA 3KHHA 3IHQB 2CPRA 1TAUA 1OW5A 7ICHA 5L1JA 4B9SA 5KFQA 2XY5A 1U48A 1ZQGA 4YCXA 4I2HA 4BUGA 5KFMA 1ZQAA 8ICMA 3RJEA 4QZCA 4YN4A 2K4PA 4QZIA 3ISDA 1JXEA 1S77D 4I2IA 3L3FX 3PX0A 1ZQ1C 2E5SA 4UATA 2KNJA 3BZKA 4YMNA 2KK0A 4KX3A 5ALTA 1NZPA 2F8LA 2DQNB 3SV4A 4C8MA 4KLFA 5J0WA 1X9MA 2XGQA 1KN5A 5AKHA 2HI0A 3SEIA 4DQIA 2FDRA 3T5HA 2KKVA 9ICMA 3WKAA 1X9XA 9ICGA 4KLEA 5DBCA 3MFHA 2KFZA 1B0XA 5CP2A 4B9TA 4C0ZA 2RLTA 3C29A 4UB6U 4ECSA 1KRPA 3PX6A 4DF4A 4CF5A 4J9PA 5K4LA 4KTQA 3N4MB 4TUPA 1BNPA 3QUTA 3AU6A
chains in the Genus database with same CATH topology
2K89A 2ZIWA 2F2AB 1GO3F 1CRXA 3ALRA 4O3MA 2KOBA 2F77X 1NZBA 2G09A 2H3QA 2KD1A 2Z7JA 3HKZC 4NLBA 1KBUA 2HOFA 1XNSA 2G06A 3LVWA 3IN5A 3ICXA 2LYBA 1PVQA 2H3ZA 4P0PB 2PMZF 3PZPA 1T94A 3SAGA 4QIWF 4U6PA 2HBJA 3OPXA 3E0FA 2DGZA 4FZNA 2XI9A 1YT3A 2KICA 3DEEA 4U7CA 3M6ZA 1MA7A 2H3IA 2KEYA 2K4EA 2KJ5A 2WB1C 2MRLA 3D2QA 2HBMA 3H0LB 3F5EA 2W03A 2HOQA 4AYBC 3NUQA 4IC9A 3IG8A 2G08A 4P0PA 1TAMA 4ICAA 3SAFA 2OH2A 2CPRA 2RP5A 5HR6A 2N1RA 3RF9A 3IG5A 2HBLA 3SQIA 2F76X 3K1ZA 2LHTA 1Q3UA 4NV0A 4PL1A 4P0QA 2ZXIA 2D6FC 2KJ8A 5KL8B 4BUGA 2G5HB 4OJ6A 5CRXA 1URJA 4BJQA 2OXOA 2HMXA 2OYYA 4OJ5A 1PVPA 4BX9C 4CDGA 3KFUF 2KV2A 2W04A 2VJ5A 3ONNA 2W7PA 1Z19A 1OUQA 3L3FX 4CRXA 2G5IB 2CRXA 3PSFA 4OJOA 3NRWA 1ZQ1C 2H3VA 3GZFA 2WAQC 3N7PD 3PSTA 4P0QB 2E5SA 3LYSA 2A3VA 3CP8A 3IP4B 2ZXHA 2KNJA 1HIWA 4NWIA 2KHQA 2XVTA 2KIWA 2YX8A 4OJPA 3H0RB 2VKQA 2LKYA 3SMVA 1Q3VA 2K8BB 4KX3A 4CGZA 2VIXA 3HKZF 3SAHA 3F2CA 1DRGA 2JH1A 2KHVA 2KJ9A 2ZIXB 2F8LA 4NLCA 1D8BA 2DF4B 2DQNB 2R18A 2G07A 3AQEA 2GH1A 2LYAA 3F53A 3D2NA 3N7SC 4JMUA 1L6NA 1UPHA 2H3FA 2JHDA 2K4HA 1SZHA 2PMZC 3F5AA 2K8CB 4QIWC 1WUDA 3M7DA 4KX5A 1HEKA 2CN1A 3CYMA 2WB1F 2XICA 4OO1J 2ZIXA 2ZIUB 4AYBF 2KKVA 1IIPA 3GU3A 4GFJA 4FZLA 1XO0A 2KKPA 3AL0B 3C28A 3LVVA 2ZIVA 5C0YA 3F2DA 2BDUA 2Y0SC 1P7DA 4KMOB 2HOIA 2JGAA 2JH7A 3PSPA 1Z1BA 2XIDA 2YB1A 3H0MB 5KL1B 3D2SA 1ECWA 2K8AA 2ZG6A 2ZIUA 3MGVA 3F2BA 2KVCA 3AQFA 4C0ZA 3C29A 4QNLA 3KZXA 1A0PA 3RFAA 5HR7A 5T14A 2LBOA 4QJFB 2K4IA 2RRDA 4FE3A 1F44A 2GOLA 2VJ4A 2M0NA 2HBKA 4OJLA 3O0FA 2JMGA 1ED1A 2ZIWB 2ZIVB 2NV3A 1A6SA 2G0AA 3VC8A 3N7RC 3T79A 3CRXA 2WAQF 2Q4TA 4A8EA 4FZMA 4PL2A 2OM6A 3VCBA 2RHFA 2W7OA 2E1FA 3PSIA 4WJ3B 4ACOA 1PVRA 2YB4A 2MA1A 2Y0SF 2E1EA 3M6KA 5A0LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C0Y A;  2HBL A;  4CGZ A;  1GO3 F;  4O3M A;  3SAH A;  4NLB A;  4NLC A;  1D8B A;  4QJF B;  2RRD A;  3SAG A;  4QIW F;  2HBJ A;  4CDG A;  2HBK A;  1WUD A;  2DGZ A;  2KV2 A;  1YT3 A;  3CYM A;  4OO1 J;  2HBM A;  2RHF A;  2E1F A;  3SAF A;  2MA1 A;  2CPR A;  2E1E A; 
#chains in the Genus database with same CATH topology
 2W9A A;  4P4M A;  3C2K A;  3ALR A;  5EE1 A;  3UMB A;  1L7M A;  1KBU A;  5ALU A;  3K1R B;  1UA0 A;  2UVV A;  2KIC A;  2KJ5 A;  5AK4 A;  9ICC A;  5E79 U;  4KLI A;  3HT3 A;  2HBL A;  2F76 X;  4LVS A;  3R9K A;  1ZQM A;  3WK4 A;  4F93 B;  1Z3E B;  3RB3 A;  5AKZ A;  5CRX A;  4NY8 A;  3TAD C;  4QZ9 A;  5KFJ A;  5H2F U;  4M9L A;  2VJ5 A;  7ICM A;  4RQ6 A;  9ICH A;  7ICL A;  4DFK A;  3KHR A;  3H0R B;  3RJK A;  4C7Y A;  3LK9 A;  4C4S A;  1X6J A;  3TAP A;  4Y2S A;  5AM4 A;  3KD3 A;  3F2C A;  3C5F A;  3QXG A;  3RRH A;  4NLC A;  1NK6 A;  4ELU A;  1D8B A;  1VDV A;  1T4G A;  3E58 A;  5DLF A;  3OSN A;  4RNN A;  2KZ3 A;  2FMP A;  4EZ6 A;  3NS1 A;  4I29 A;  2J6T A;  4KN7 A;  1BPB A;  1QSS A;  5G5H A;  1SXD A;  4NJ8 A;  9ICQ A;  5KFL A;  4F71 A;  3PW2 A;  1ZQO A;  5ALR A;  3QUC A;  3RH4 A;  9ICF A;  5AIB A;  4Y2Q A;  1TK0 A;  2I9G A;  4PH5 A;  2EZZ A;  5KFB A;  5J2B A;  2BR0 A;  2YMP A;  2AXT U;  4OD0 A;  3QU5 A;  4G3I A;  1IM4 A;  2EZY A;  2HVI A;  8ICA A;  1IG6 A;  4I2C A;  4CF4 A;  2B0C A;  1SV0 A;  2QKQ A;  3ZDA A;  5KFP A;  1L5U A;  3C5G A;  2XC9 A;  1N60 A;  5ALY A;  4B9M A;  3TFS A;  4ECV A;  2ESE A;  1ZQV A;  4DLG A;  2HHU A;  1BPY A;  1PK3 A;  2FE9 A;  4I2E A;  3A0H U;  3KKA C;  4XQ8 A;  4BX9 C;  4ECR A;  2ALZ A;  7ICR A;  1VLB A;  5IIJ A;  4DQS A;  1QQ6 A;  5J0Y A;  3N97 B;  5HMM A;  2KHQ A;  4YMO A;  3UM9 A;  4M9J A;  2AGO A;  2K8B B;  5AKG A;  1S0M A;  3WKB A;  4M9N A;  3UXO A;  2W3S A;  1N5X A;  5AM0 A;  1JMS A;  4DSL A;  5ALG A;  3MC1 A;  4M2Y A;  2ISP A;  3N7S C;  1IXR A;  2HW3 A;  3M7D A;  4Y2U A;  2R8G A;  8ICZ A;  4P2H A;  1ZQD A;  1T3Q A;  4DQR A;  4GLX A;  4IQU A;  4DS4 A;  2IHN A;  1LB2 B;  2BCV A;  1JXL A;  3RR8 A;  5III A;  3QEB Z;  7ICU A;  4MHV A;  5AM2 A;  1SKW A;  4J9L A;  4KLO A;  2C2D A;  4DFJ A;  2IMW P;  9ICR A;  3QUQ A;  3HX0 A;  2Q0Z X;  2G0A A;  2KP7 A;  3ED5 A;  4ECQ A;  3JPS A;  5KFH A;  9ICV A;  2E1F A;  4ACO A;  4C4R A;  3LDA A;  1BNO A;  4DCC A;  4P4O A;  2GWS A;  3MR3 A;  2Z7J A;  4J03 A;  4I2D A;  1PVQ A;  2OCE A;  1L8L A;  3RJJ A;  4KLM A;  2CXY A;  2XI9 A;  5F9L A;  3MDA A;  3BDP A;  5HHH A;  3F5E A;  4I2F A;  1CEZ A;  2N1R A;  4Q43 A;  3IG5 A;  4B6J A;  1RYR A;  5CEH A;  4P4P A;  1ZQS A;  5KFS A;  2NRT A;  3BS5 B;  4UB8 U;  2HMX A;  2OYY A;  5IIM A;  3ZDC A;  5J0S A;  4CDG A;  5JUM A;  4USA A;  4CRX A;  4J9M A;  5D49 A;  2ZTE A;  2D8C A;  1N5W A;  3ETR A;  3NRW A;  3H4D A;  4DSI A;  4K4G A;  8ICC A;  5KFY A;  3BS5 A;  4NL9 C;  3I1Y A;  4QWA A;  1ZQL A;  1QTM A;  1O03 A;  2M9N A;  5ALE A;  4IRK A;  2RDI A;  4NM1 A;  5J2J A;  1JI7 A;  9ICB A;  5KT6 A;  4IS7 A;  2XO7 A;  1NK7 A;  9ICN A;  1DK3 A;  1LKY B;  4KN4 A;  4O9M A;  4G9B A;  2DL0 A;  1S5L U;  2XID A;  4Y2J A;  3N28 A;  3H0M B;  2J6S A;  1LKY A;  5ALN A;  3KHG A;  2QAR B;  3ZD9 A;  3TFR A;  2BPC A;  1NJX A;  5JU5 A;  5EWE A;  4NLN A;  3RRG A;  3CRX A;  2DPI A;  2LMR A;  2FPL A;  2P6U A;  1S97 A;  2QAR A;  1VJ5 A;  4WJ3 B;  1KSP A;  3KBB A;  1S8O A;  2O6K A;  5ALH A;  4XA5 A;  5G5G A;  2F77 X;  2E8N A;  4M47 A;  3MR6 A;  3C1Y A;  3OJU A;  2PMZ F;  1RQN A;  5DB6 A;  1N62 A;  5CB1 A;  1XSL A;  2WF7 A;  1ZQC A;  3EZ5 A;  1NNL A;  3Q8Q B;  5AKE A;  4F2S A;  5AI5 A;  5AKI A;  5J8Y C;  4IC9 A;  1XWL A;  3BJY A;  1N48 A;  1ARO P;  3A0B U;  5ALV A;  1QH9 A;  4Y2Y A;  4QWC A;  2FMS A;  2R8K A;  7ICT A;  5AHX A;  4ECY A;  2EAN A;  4OJ6 A;  2WF9 A;  5J2I A;  1QQ5 A;  3QZ8 A;  4JUZ A;  4OCZ A;  4YD2 A;  5ALJ A;  5L1M A;  2VA8 A;  3RJI A;  4TUS A;  2H3V A;  2NRZ A;  3M9N B;  3UQ0 A;  7ICF A;  3LYS A;  5J0Q A;  4NWI A;  3RAQ A;  5AKK A;  4E0D A;  3S6J A;  3SYZ A;  2VIX A;  4MF8 A;  1L7N A;  2QB1 A;  3U26 A;  3GQC A;  3E2E A;  1UT8 A;  8ICO A;  4IQT A;  1SZH A;  2ZUC A;  3RB4 A;  3T3F A;  3M9O B;  4AYB F;  4TUQ A;  1RQL A;  3IM1 A;  2JEG A;  2FLN A;  4M6W B;  2F8K A;  3LVV A;  4PHD A;  4GXK A;  2Y0S C;  2KE7 A;  3V7L A;  5KT2 A;  1V97 A;  3Q8L A;  1ZD2 P;  1FIQ A;  3JPT A;  2ZG6 A;  4KLS A;  1ZJM A;  3RBD A;  2HHT A;  2LPE A;  4KLG A;  4M6W A;  3SEN A;  2RRD A;  3L4P A;  4UBC A;  4Y2R A;  2GOL A;  3LWM A;  2BPF A;  5C5J A;  1WWU A;  3NGD A;  2QB0 B;  1JUD A;  5ALP A;  2EH9 A;  2AGP A;  3RJG A;  4JV0 A;  5DGA A;  1TAQ A;  1Z00 B;  4DL5 A;  1ZOL A;  5AK5 A;  1ZJN A;  1NZB A;  4QZA A;  2QB0 A;  2H3Q A;  2KD1 A;  4FBT A;  5AKL A;  5D4B A;  2JZB B;  3PZP A;  2ZTD A;  4UB3 A;  3BQT A;  2BCQ A;  2LYH A;  3E0F A;  2ES6 A;  1Z00 A;  2KN7 A;  4YR3 A;  1SZP A;  2YN4 A;  2W54 A;  2JZB A;  4ECT A;  5KG1 A;  1KLN A;  2E8M A;  4JV1 A;  2RP5 A;  3H8W A;  3C23 A;  3NRZ A;  1Q3U A;  4NV0 A;  3T5K A;  5AI4 A;  4PL1 A;  3EYZ A;  2W3R A;  2KJ8 A;  4YP3 A;  3DDH A;  7ICK A;  5JTI A;  4J9Q A;  3RH5 A;  2KZM A;  2V9W A;  4YFK A;  4F4K A;  4DL7 A;  9ICO A;  3THV A;  2F1H A;  3ZDB A;  3BQ2 A;  4XUS A;  4QZE A;  5D46 A;  4F92 B;  2A3V A;  5BPC A;  4Z6C A;  1D9F A;  4M9G A;  4ED8 A;  4EEK A;  5KT3 A;  1COK A;  4Z6F A;  3F5A A;  1WUD A;  4QZF A;  4QW8 A;  1X6I A;  5AIC A;  3NVY A;  1RM6 C;  3IV6 A;  2JEI A;  4PHA A;  4KIT B;  4FS2 A;  1RZT A;  3DV9 A;  2JH7 A;  2EAM A;  3G6Y A;  8ICQ A;  2KVC A;  4YXM A;  3C21 A;  5KG5 A;  4DOC A;  4ECZ A;  3T5J A;  1N61 A;  1ZQH A;  3PML A;  1KFD A;  2ZUD A;  3TAQ A;  4ED1 A;  3ZD8 A;  2HHV A;  5J2C A;  2KOB A;  4YR2 A;  3M9M B;  5AIA A;  3PW0 A;  1XNS A;  4DL2 A;  2HVH A;  3OGU A;  2ASL A;  8ICN A;  1S76 D;  4QWD A;  1JN3 A;  3SAG A;  2HBJ A;  2DGZ A;  4FZN A;  5KFT A;  2MU2 A;  3PX4 A;  1JRO A;  3NUQ A;  1KDH A;  4IQV A;  3SAF A;  3C2L A;  1SL0 A;  3NVW A;  4O3R A;  2PFQ A;  4C80 A;  3SQI A;  8ICK A;  2LHT A;  2AQ0 A;  4R65 A;  4BXO B;  2Y1J A;  3GIL A;  2W9C B;  1S9F A;  5EE3 A;  2NYV A;  4MFA A;  2PI4 A;  3QX7 A;  3NVV A;  4YD1 A;  1T3N A;  2W04 A;  1Z19 A;  2KTQ A;  4BXO A;  1NKC A;  1COO A;  5DKW A;  2W9C A;  4PPX A;  5J2H A;  3C2M A;  3N7P D;  2EAP A;  3RH6 A;  9ICE A;  5AI9 A;  3IP4 B;  1B22 A;  3Q8R B;  3SZ2 A;  4MEX A;  4HYK A;  4F72 A;  3FYH A;  4Q8E A;  1ZYQ A;  3OHB A;  2R18 A;  1L6N A;  1UPH A;  2PMZ C;  2XCP A;  3FDS A;  1U4B A;  4QZ8 A;  2WB1 F;  2KKP A;  1A76 A;  3AL0 B;  3C28 A;  2XCA A;  1KL9 A;  1SKR A;  2WTF A;  3UXN A;  3UQ2 A;  3V7J A;  1A77 A;  3PO4 A;  2XGP A;  7ICJ A;  1K5O A;  1ZQN A;  1QQ7 A;  1HJP A;  3EUB 2;  5IIK A;  2BDP A;  4EBE A;  5IIN A;  2FPK A;  2RHF A;  3CW2 C;  3PSI A;  5J0X A;  3WK5 A;  4YMM A;  1SWW A;  3AUO A;  3WKD A;  2YTU A;  1L3T A;  4DFD A;  1C7Y A;  3V7K A;  4P0P B;  2HSZ A;  4US9 A;  4U6P A;  3PY8 A;  2W9B B;  4DEZ A;  8ICJ A;  5ALX A;  3Q8S B;  4C8N A;  5AM3 A;  2BCU A;  5L9X A;  4I2A A;  3D6J A;  1T8E A;  4F50 A;  4AYB C;  1FFV A;  5ALD A;  4P0P A;  1D9D A;  5AI8 A;  1XO1 A;  2W9B A;  4I2J A;  3GIJ A;  3PMN A;  2HDO A;  4F4Z A;  5KL8 B;  3WU2 U;  1L8O A;  5AKJ A;  4J9S A;  2W7P A;  1BPD A;  4R66 A;  5AKY A;  7ICO A;  4LJX A;  1TFR A;  3OJS A;  7ICN A;  4OJP A;  1FO4 A;  4M04 A;  5EE9 A;  4CGZ A;  3SR6 A;  1F5S A;  2KMD A;  9ICK A;  2FI1 A;  5TIS U;  4B9V A;  1X66 A;  4IR1 A;  4BWM A;  4EYH B;  2ZIU B;  2PKE A;  1DK2 A;  1X9W A;  5HP4 A;  2DPJ A;  3RJF A;  1P7D A;  4DSK A;  8ICI A;  4F2R A;  8ICP A;  5KL1 B;  2K8A A;  2ZIU A;  1L3V A;  2KSO B;  1SKS A;  1ZQT A;  3FM9 A;  3KZX A;  2W8K A;  4I28 A;  4EBD A;  4QJF B;  1F44 A;  1RG6 A;  3AMZ A;  5DG7 A;  1ED1 A;  1JIH A;  4F4W A;  4GIB A;  4UW9 A;  4QWB A;  2WAQ F;  4RQ5 A;  1TK8 A;  3MR2 A;  2KSO A;  5JRT A;  4O0I A;  4I2B A;  5B5E U;  3QU7 A;  4HAI A;  5KAF U;  4UAS A;  5CHG A;  1CRX A;  2W55 A;  1ZQQ A;  4O3S A;  4BGD A;  2HOF A;  4QW9 A;  5EWF A;  2KIV A;  3ICX A;  2LYB A;  3PW4 A;  5KFX A;  2BCR A;  5DDM A;  3H40 A;  3GDX A;  4US8 A;  5KG7 A;  2ZUB A;  2BQ3 A;  2EAO A;  5ALF A;  3RF9 A;  3PW7 A;  1TKD A;  2W11 A;  3KTQ A;  5AM1 A;  2ZXI A;  4DL3 A;  1Z4N A;  2G5H B;  4NLZ A;  2HHS A;  4NM2 A;  1ZQU A;  5KFW A;  1SXE A;  1PVP A;  5L1L A;  2DKZ A;  2I6X A;  1QLN A;  2ASJ A;  9ICT A;  3PST A;  2HCF A;  2UVR A;  2NRX A;  1X9S A;  1TVA A;  2YX8 A;  2XVT A;  2KIW A;  5DB8 A;  2XY6 A;  1Q3V A;  1NKB A;  3HKZ F;  2KHV A;  1TK5 A;  1D8L A;  3F53 A;  5IIO A;  3RR7 A;  2E8O A;  4ZOH C;  2E3T A;  4QZB A;  5L1I A;  4J9O A;  4UAU A;  3TQ1 A;  1FEZ A;  5KFF A;  4FZL A;  1J2M A;  2BHN A;  3GIK A;  5DBA A;  4EBC A;  1KW4 A;  4UAV A;  7ICE A;  1DOQ A;  1PK1 B;  4YQW A;  1MC8 A;  4TQS A;  5T14 A;  2LBO A;  1CI4 A;  2VJ4 A;  3CNH A;  2JMG A;  1SWV A;  3GFK B;  1PUZ A;  7ICP A;  1QCK A;  2DFL A;  2PFO A;  1PK1 A;  3VCB A;  4RNO A;  1PVR A;  4MEY A;  4IR9 A;  1HUO A;  4F5N A;  3WK9 A;  8ICT A;  2Y9U A;  4IL6 U;  1Z4O A;  3G6V A;  2WHE A;  1SL1 A;  1JRP A;  3MGI A;  4CCH A;  5KG4 A;  3LVW A;  5J2K A;  2V4Q A;  2K60 A;  1T94 A;  5ALS A;  2A1A A;  1DXS A;  3DEE A;  4K4I A;  1SL2 A;  2F44 A;  2WB1 C;  3L5K A;  1ZXI A;  1U9L A;  9ICI A;  5KFI A;  2G08 A;  5KFN A;  5HR6 A;  3JPQ A;  5J0P A;  3JPP A;  1N2X A;  3H8J A;  3PV8 A;  3QNM A;  3PR4 A;  2BZF A;  5EWG A;  1K1S A;  4R64 A;  4DQP A;  3TI0 A;  4ED0 A;  9ICS A;  2KV2 A;  4GXI A;  5J2E A;  1QSL A;  4DLE A;  1L7O A;  4UB2 A;  3QYP A;  2OHF A;  2ZXH A;  1DGJ A;  1NI3 A;  2ZJ5 A;  4RZR A;  2KVS A;  1DGS A;  3WKE A;  1DRG A;  1UA1 A;  3QU4 A;  2L5Y A;  8ICL A;  3AQE A;  4DS5 A;  1D8Y A;  2CN1 A;  2W43 A;  1RXW A;  4UB1 A;  1WCN A;  4GFJ A;  1J97 A;  2C28 A;  1KEJ A;  2ZIV A;  5CA7 A;  4FBU A;  2EZX A;  2EDU A;  1Z1V A;  5AI6 A;  5KFE A;  3AQF A;  1RPL A;  4FE3 A;  5DGB A;  3J81 j;  2NV3 A;  3T79 A;  4RUA A;  4PGQ A;  4CF3 A;  3LWL A;  4J9N A;  2ATL A;  1MSW D;  3NAS A;  2I5H A;  4PL2 A;  1FFU A;  3AU2 A;  3QUB A;  1JAL A;  4JB3 A;  4O3O A;  4MF2 A;  3MFI A;  8ICV A;  5J0O A;  4R8U B;  1LV5 A;  4NLB A;  4Y2X A;  3AN1 A;  2XY7 A;  3I28 A;  4CE6 A;  2HHQ A;  9ICW A;  2H3Z A;  4QIW F;  4IQW A;  4R8U A;  3ZDE A;  5F3X B;  8ICX A;  3EPI A;  4PZN A;  9ICA A;  2KEY A;  3AEV A;  1Q46 A;  4NLG A;  1RDF A;  1IV8 A;  2YML A;  2OH2 A;  1C20 A;  2JV3 A;  4DF8 A;  2FMQ A;  1YZ6 A;  1BPZ A;  4RT2 A;  4P0Q A;  3IRU A;  4FO6 A;  5AKX A;  5HNK A;  1N63 A;  4OJ5 A;  2HHX A;  4EEN A;  1OUQ A;  1NK5 A;  1UHU A;  1T7P A;  2IOF A;  2ODG A;  2WAQ C;  3PNC A;  5J2F A;  3EWA A;  4I27 A;  4PGX A;  4JK1 A;  2ZTC A;  2KG5 A;  2VA2 A;  4Y2P A;  1SV0 C;  2JXJ A;  5ALM A;  4EX7 A;  9ICU A;  2LYA A;  5CR0 A;  2K8C B;  4DO9 A;  4FFD A;  1KQQ A;  3CYM A;  1UQV A;  3HRD D;  4O5C A;  2LI6 A;  5KFC A;  5DQH A;  3GU3 A;  2IHM A;  1SV4 A;  2BDU A;  3V6H A;  3HJE A;  4KLJ A;  2OEH A;  4ELT A;  3MR5 A;  4BWJ A;  3KOO A;  2FLL A;  5HR7 A;  4EEY A;  5B66 U;  5DB9 A;  3TAC B;  5DG8 A;  3ZDD A;  2M0N A;  2HBK A;  1NK0 A;  4YG2 A;  5J2A A;  4Z6E A;  2NO4 A;  3N7R C;  2IBK A;  3EW9 A;  4EX6 A;  3HW8 A;  2MA1 A;  3M6K A;  4MFC A;  5A0L A;  4NL9 A;  3H8M A;  3WK7 A;  4Q44 A;  2V4R A;  4RUC A;  1GO3 F;  4DSJ A;  3HKZ C;  1KFT A;  8ICB A;  3OTQ A;  2BQU A;  2AU0 A;  4ECU A;  4DOA A;  2EQY A;  5KT5 A;  9ICJ A;  1X2I A;  4DL6 A;  4F5O A;  3WKC A;  3I76 A;  2GLE A;  5KT4 A;  1RXV A;  2DUY A;  1L3U A;  1SIJ A;  5DLG A;  2OXO A;  4YVZ A;  3OHA A;  5KFK A;  2G5I B;  2CRX A;  4GC6 A;  1XS9 D;  3PSF A;  3TAR A;  1JX4 A;  4IRD A;  2PXI A;  5DQG A;  2H5X A;  3CP8 A;  1ZQY A;  5AM5 A;  4O3P A;  4UQG A;  4Z6D A;  2ZJ8 A;  3SAH A;  2GO7 A;  4EZ9 A;  2E8P A;  2VAN A;  1PZN A;  2WF8 A;  1NJW A;  2GH1 A;  5FP0 A;  3D2N A;  2H3F A;  4TQR A;  1WYG A;  1KKX A;  2DBY A;  3MDC A;  4F5R A;  7ICV A;  3GV8 B;  4O5E A;  1S0V A;  5KG6 A;  3HWT A;  1NK9 A;  5J8Y A;  2JRZ A;  4F91 B;  5BOL A;  1NK4 A;  5DG9 A;  3EPG A;  3D2S A;  3B0X A;  4DFP A;  5GTH U;  4QNL A;  3RFA A;  1QSY A;  4RU9 A;  4J9R A;  1NJZ A;  4RQN A;  4UAW A;  2P35 A;  1X40 A;  2IA6 A;  4F8R A;  3HIL A;  4LZG A;  8ICE A;  5J0U A;  3MGV A;  1AQ6 A;  4O3Q A;  3GIM A;  2F2A B;  4F5Q A;  3UMC A;  4RPY A;  8ICY A;  3JPR A;  1S10 A;  5BOM A;  3OPX A;  4FS1 A;  3RB0 A;  2YMQ A;  4U7C A;  4RQ1 A;  5EE0 A;  3QE9 Y;  3NVZ A;  2BGW A;  2ASD A;  5KG0 A;  3QEA Z;  3H4B A;  3K1Z A;  5AI0 A;  4GC7 A;  1RYS A;  3HPO A;  4Y2T A;  4ED2 A;  4ZH4 A;  1URJ A;  4UBB A;  1BGX T;  1RYU A;  2PFP A;  2PI5 A;  4UAY A;  1ZD3 A;  9ICX A;  3GZF A;  4UB5 A;  3HP6 A;  3JPN A;  2NRV A;  3PW5 A;  3RTV A;  4LZD A;  8ICH A;  1F0M A;  2ZIX B;  2KZZ A;  3NTU A;  2P6R A;  4PGY A;  5HML A;  4C4T A;  5HHI A;  4QIW C;  4KX5 A;  1HEK A;  5KFV A;  3Q8K A;  2XIC A;  5TZV A;  4OO1 J;  2ZIX A;  1IIP A;  1XO0 A;  4JV2 A;  2WF5 A;  4B9U A;  3MGH A;  5GTI U;  1BPE A;  4KMO B;  5CWR A;  2YB1 A;  5ALI A;  1Q8K A;  1K1Q A;  1V85 A;  1XSN A;  5KFD A;  1A6S A;  3VC8 A;  3BZC A;  3Q8M A;  3IDW A;  1ZQZ A;  3K75 D;  5ALK A;  4ECW A;  2W7O A;  3UPQ A;  2Y0S F;  2FJ6 A;  2PFN A;  1WCL A;  1ZQI A;  4RQ8 A;  3UMG A;  2A1J B;  2FLP A;  4RT3 A;  3IN5 A;  4ELV A;  3FC4 A;  1ZQW A;  4J9K A;  1WG8 A;  1ZRM A;  1MQ2 A;  2A1J A;  4RQ2 A;  3WK6 A;  4X5V A;  3ISB A;  2K4E A;  2MRL A;  2HBM A;  4KLQ A;  1NJY A;  4RPZ A;  1OXJ A;  4ICA A;  1TV9 A;  1ZQP A;  5J0R A;  3ISC A;  1KFS A;  7ICQ A;  4RQ4 A;  2J6U A;  1XC9 A;  4F3O A;  4B9N A;  5KFZ A;  2R8H A;  5KFU A;  4QZH A;  5L1K A;  2C2R A;  4NLK A;  5KFA A;  2IOH A;  4PHE A;  3KFU F;  2R8I A;  4QWE A;  4C8K A;  2ZJA A;  3OSP A;  2VKQ A;  2LKY A;  8ICW A;  1V9P A;  5J2D A;  2JH1 A;  2KJ9 A;  3QU9 A;  3QZ7 A;  1EXN A;  2IOF K;  2JHD A;  4F4X A;  2AQ4 A;  1J2N A;  1ZRN A;  5F9N A;  1B43 A;  4EYI B;  1H38 A;  3UXP A;  4CNQ A;  2ISO A;  2Y9T A;  3FAH A;  3GV5 B;  8ICF A;  4ED7 A;  4O5K A;  5KNI A;  2AHO B;  1N56 A;  3F2D A;  4F5P A;  2HOI A;  5KTQ A;  3PSP A;  2A19 A;  5EOZ A;  4YXJ A;  2JR5 A;  1ECW A;  2RDJ A;  4DSE A;  1A0P A;  5J2G A;  4Y2V A;  1LVH A;  4OJL A;  3O0F A;  4UAR A;  3M8R A;  2ZIW B;  1U45 A;  5KT7 A;  4MFF A;  4Q8F A;  4DL4 A;  4M9H A;  4A8E A;  2Q4T A;  2B21 A;  3TKA A;  5KFO A;  1ZQE A;  2K89 A;  2ZIW A;  2Y1I A;  4O3M A;  3V72 A;  2G09 A;  5DB7 A;  2HHW A;  3B9J A;  5IIL A;  2AJQ A;  7ICG A;  1ZQF A;  5ALW A;  1HUZ A;  1S0O A;  1UT5 A;  4DFM A;  3TAD A;  2F1I A;  5KFG A;  2BPG A;  4DWI A;  1MQ3 A;  3D2Q A;  2DWQ A;  4O3N A;  2W03 A;  2LM4 A;  3IG8 A;  3RAX A;  1TAM A;  3M1Y A;  1M6Y A;  3SD7 A;  1O08 A;  2OWO A;  4PZO A;  2D6F C;  4KLU A;  3BQ0 A;  3T5L A;  4ECX A;  1ZQR A;  1Y88 A;  4BJQ A;  1SB3 C;  2MSN A;  4B9L A;  2WF6 A;  4IRC A;  4PHP A;  3ONN A;  2AH5 A;  2YY6 A;  2D3D A;  5CJ7 A;  2UVU A;  3SI8 A;  5ALZ A;  1HIW A;  4DQQ A;  2JEF A;  4JWM A;  4DOB A;  4KLL A;  4KLD A;  4M0A A;  2BCS A;  2G07 A;  4EEL A;  4JMU A;  3RB6 A;  1UCV A;  2MUT B;  5KAI U;  2NRW A;  5ALQ A;  3H7I A;  1NOM A;  3BQ7 A;  4KLT A;  5DBB A;  1L7P A;  2QLT A;  4AP9 A;  3RBE A;  2MUT A;  2DKX A;  3MBY A;  1NK8 A;  5C0Y A;  4R63 A;  1Z1B A;  2UVW A;  5J29 A;  2B6G A;  4ED3 A;  3F2B A;  2K4I A;  4TUR A;  2R8J A;  4UAZ A;  2C22 A;  2ZIV B;  1SGG A;  5AK3 A;  1ZQJ A;  3WK8 A;  2I1Q A;  4FZM A;  1ZQB A;  2OM6 A;  5KG2 A;  4RQM A;  3GV7 B;  5KFR A;  4RQ7 A;  5ALL A;  4QZG A;  3ZI4 A;  3C1Z A;  4F4Y A;  1U47 A;  2G06 A;  2WFA A;  2VA3 A;  4C7Z A;  3ETL A;  4RPX A;  2YMM A;  3KKA A;  1U49 A;  3MAB A;  1MA7 A;  2FPM A;  3PO5 A;  8ICG A;  1ZQK A;  3Q8P B;  3K4G A;  1MN8 A;  1X42 A;  8ICU A;  4Q45 A;  4YR0 A;  7ICI A;  5KG3 A;  2C2E A;  4C8O A;  3B0Y A;  4I2G A;  1BVS A;  9ICP A;  2MAX A;  2LM1 A;  5ALO A;  2KFN A;  3GII A;  3BS7 A;  2AGQ A;  9ICL A;  1CUK A;  4OJO A;  4P0Q B;  3V6K A;  2NO5 A;  3PVX A;  4KLH A;  3SMV A;  1NKE A;  1YZ7 A;  3KZI U;  4GXJ A;  8ICR A;  1ZD4 A;  2RQ5 A;  5DQI A;  4UB4 A;  2DF4 B;  3PR5 B;  2F1J A;  4XRH A;  2K4H A;  7ICS A;  3BQ1 A;  1XSP A;  1WWV A;  3TAN A;  1ZET A;  4JWN A;  4NXZ A;  3H8S A;  2W9M A;  2W8L A;  2F3N A;  2JGA A;  1L3S A;  2BKE A;  1XU4 A;  1B4F A;  1ZQX A;  4BDP A;  2P66 A;  4RNM A;  4ED6 A;  3G6X A;  4K4H A;  4RQ0 A;  2BQR A;  1KTQ A;  1TE2 A;  1V38 A;  5J0T A;  2YB4 A;  3JPO A;  4DSF A;  1ZD5 A;  2E1E A;  3KHL A;  1BPX A;  3V6J A;  3M8S A;  2JEJ A;  3ORY A;  3AM9 A;  1S0N A;  4PJ0 U;  3RJH A;  5AK6 A;  4QZD A;  4RQ3 A;  3QU2 A;  5DDY A;  8ICS A;  1YT3 A;  4C8L A;  3SV3 A;  3M6Z A;  2YQE A;  2H3I A;  3H0L B;  4KMU A;  2HOQ A;  3KHH A;  3IHQ B;  2CPR A;  1TAU A;  1OW5 A;  7ICH A;  5L1J A;  4B9S A;  5KFQ A;  2XY5 A;  1U48 A;  1ZQG A;  4YCX A;  4I2H A;  4BUG A;  5KFM A;  1ZQA A;  8ICM A;  3RJE A;  4QZC A;  4YN4 A;  2K4P A;  4QZI A;  3ISD A;  1JXE A;  1S77 D;  4I2I A;  3L3F X;  3PX0 A;  1ZQ1 C;  2E5S A;  4UAT A;  2KNJ A;  3BZK A;  4YMN A;  2KK0 A;  4KX3 A;  5ALT A;  1NZP A;  2F8L A;  2DQN B;  3SV4 A;  4C8M A;  4KLF A;  5J0W A;  1X9M A;  2XGQ A;  1KN5 A;  5AKH A;  2HI0 A;  3SEI A;  4DQI A;  2FDR A;  3T5H A;  2KKV A;  9ICM A;  3WKA A;  1X9X A;  9ICG A;  4KLE A;  5DBC A;  3MFH A;  2KFZ A;  1B0X A;  5CP2 A;  4B9T A;  4C0Z A;  2RLT A;  3C29 A;  4UB6 U;  4ECS A;  1KRP A;  3PX6 A;  4DF4 A;  4CF5 A;  4J9P A;  5K4L A;  4KTQ A;  3N4M B;  4TUP A;  1BNP A;  3QUT A;  3AU6 A; 
#chains in the Genus database with same CATH homology
 2K89 A;  2ZIW A;  2F2A B;  1GO3 F;  1CRX A;  3ALR A;  4O3M A;  2KOB A;  2F77 X;  1NZB A;  2G09 A;  2H3Q A;  2KD1 A;  2Z7J A;  3HKZ C;  4NLB A;  1KBU A;  2HOF A;  1XNS A;  2G06 A;  3LVW A;  3IN5 A;  3ICX A;  2LYB A;  1PVQ A;  2H3Z A;  4P0P B;  2PMZ F;  3PZP A;  1T94 A;  3SAG A;  4QIW F;  4U6P A;  2HBJ A;  3OPX A;  3E0F A;  2DGZ A;  4FZN A;  2XI9 A;  1YT3 A;  2KIC A;  3DEE A;  4U7C A;  3M6Z A;  1MA7 A;  2H3I A;  2KEY A;  2K4E A;  2KJ5 A;  2WB1 C;  2MRL A;  3D2Q A;  2HBM A;  3H0L B;  3F5E A;  2W03 A;  2HOQ A;  4AYB C;  3NUQ A;  4IC9 A;  3IG8 A;  2G08 A;  4P0P A;  1TAM A;  4ICA A;  3SAF A;  2OH2 A;  2CPR A;  2RP5 A;  5HR6 A;  2N1R A;  3RF9 A;  3IG5 A;  2HBL A;  3SQI A;  2F76 X;  3K1Z A;  2LHT A;  1Q3U A;  4NV0 A;  4PL1 A;  4P0Q A;  2ZXI A;  2D6F C;  2KJ8 A;  5KL8 B;  4BUG A;  2G5H B;  4OJ6 A;  5CRX A;  1URJ A;  4BJQ A;  2OXO A;  2HMX A;  2OYY A;  4OJ5 A;  1PVP A;  4BX9 C;  4CDG A;  3KFU F;  2KV2 A;  2W04 A;  2VJ5 A;  3ONN A;  2W7P A;  1Z19 A;  1OUQ A;  3L3F X;  4CRX A;  2G5I B;  2CRX A;  3PSF A;  4OJO A;  3NRW A;  1ZQ1 C;  2H3V A;  3GZF A;  2WAQ C;  3N7P D;  3PST A;  4P0Q B;  2E5S A;  3LYS A;  2A3V A;  3CP8 A;  3IP4 B;  2ZXH A;  2KNJ A;  1HIW A;  4NWI A;  2KHQ A;  2XVT A;  2KIW A;  2YX8 A;  4OJP A;  3H0R B;  2VKQ A;  2LKY A;  3SMV A;  1Q3V A;  2K8B B;  4KX3 A;  4CGZ A;  2VIX A;  3HKZ F;  3SAH A;  3F2C A;  1DRG A;  2JH1 A;  2KHV A;  2KJ9 A;  2ZIX B;  2F8L A;  4NLC A;  1D8B A;  2DF4 B;  2DQN B;  2R18 A;  2G07 A;  3AQE A;  2GH1 A;  2LYA A;  3F53 A;  3D2N A;  3N7S C;  4JMU A;  1L6N A;  1UPH A;  2H3F A;  2JHD A;  2K4H A;  1SZH A;  2PMZ C;  3F5A A;  2K8C B;  4QIW C;  1WUD A;  3M7D A;  4KX5 A;  1HEK A;  2CN1 A;  3CYM A;  2WB1 F;  2XIC A;  4OO1 J;  2ZIX A;  2ZIU B;  4AYB F;  2KKV A;  1IIP A;  3GU3 A;  4GFJ A;  4FZL A;  1XO0 A;  2KKP A;  3AL0 B;  3C28 A;  3LVV A;  2ZIV A;  5C0Y A;  3F2D A;  2BDU A;  2Y0S C;  1P7D A;  4KMO B;  2HOI A;  2JGA A;  2JH7 A;  3PSP A;  1Z1B A;  2XID A;  2YB1 A;  3H0M B;  5KL1 B;  3D2S A;  1ECW A;  2K8A A;  2ZG6 A;  2ZIU A;  3MGV A;  3F2B A;  2KVC A;  3AQF A;  4C0Z A;  3C29 A;  4QNL A;  3KZX A;  1A0P A;  3RFA A;  5HR7 A;  5T14 A;  2LBO A;  4QJF B;  2K4I A;  2RRD A;  4FE3 A;  1F44 A;  2GOL A;  2VJ4 A;  2M0N A;  2HBK A;  4OJL A;  3O0F A;  2JMG A;  1ED1 A;  2ZIW B;  2ZIV B;  2NV3 A;  1A6S A;  2G0A A;  3VC8 A;  3N7R C;  3T79 A;  3CRX A;  2WAQ F;  2Q4T A;  4A8E A;  4FZM A;  4PL2 A;  2OM6 A;  3VCB A;  2RHF A;  2W7O A;  2E1F A;  3PSI A;  4WJ3 B;  4ACO A;  1PVR A;  2YB4 A;  2MA1 A;  2Y0S F;  2E1E A;  3M6K A;  5A0L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...