2CPSA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in sodium dodecyl sulphate micelles, 25 lowest energy structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
b'AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M13 MAJOR COAT PROTEIN
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpsA00
1HGVA 1FDMA 1IFDA 2MJZA 1NH4A 2C0WA 1HH0A 1IFJA 1IFIA 2CPBA 1HGZA 2C0XA 2CPSA
chains in the Genus database with same CATH superfamily
2FFDA 3HE4B 2LXCB 2XU6A 3HD7C 2DW3A 2N1TB 3P8CE 3L72J 3H6PA 1GL2B 2LR2A 5AVYB 2WQYC 4UB6H 5BVZA 3CMEP 1FZCA 3BATA 2E74B 1SLQA 2E76D 2HODA 5APUA 1ZRTD 1JTHA 1URQC 4DZOA 1YBKA 2XNXA 4H44D 2QVAA 1NTZK 2WITA 4I7ZC 4GDOA 1HJ0A 2WPRA 1HBWA 4UB8E 1SFCA 3II6A 4WY4A 2M3EA 5CCGA 3G9RA 3B5NA 3O8ZA 3H1JG 1JO5A 1EXJA 2YO3A 5KLIB 1PPJE 5AW7B 1YJ9P 4OVNF 4XA4A 1L4AC 3V4WA 1OX3A 2WMMA 1ZRTE 1RHZB 3M0DA 1G1IA 3L71G 1E5WA 1MUUA 2AXTE 1KQSO 2HPCA 4Z1MH 4L74A 5KTBA 4EI2A 3GG2A 1JY3O 3PP5A 2A06G 2AEJA 2D2CB 1NJIQ 3IAOA 3JSVC 3IR9A 4PD4D 2JEEA 4L75A 3PRJA 1EDLA 2P10A 1U7JA 1VF5B 1MZ9A 4NPFX 1KYOI 3A0HE 3VMXA 3GHGC 2RN0A 2OTKE 3HTKA 4BRYB 1W5CE 4GIFA 1RQUA 1FOSE 2A45H 2FXMA 4B86A 1VDFA 1CSBA 4YTPC 4OH8B 1GK6A 2IX7C 2ZXEB 1FZAA 3BRTB 2Q3EA 3KHUA 4PD4E 1P84I 1L0NK 2OARA 3H1JJ 3CXHE 3H1ID 3RK3B 3I56P 3CCQP 3G6EP 1X0TA 3H1HD 2JDIH 2WSCJ 2Q1KA 1NGMB 4RESB 1RY3A 2ZAEB 4AQRD 3L71J 1HWTC 2FXPA 5GTHE 1IO4A 1M56D 5BU8B 2QM8A 5K5GB 1BSHA 3H1IE 1AQTA 3S4RA 5KKZB 1Y47A 2IYPA 3H1HE 4KJMA 2QJYB 4KT0J 2JKVA 3H25A 2FYUK 1U7MA 5E79H 2PP6A 1PGQA 4L76A 1N73C 3M91A 2OYHC 2QIWA 4JF7A 3V5BA 2QEXP 3CLQA 3FXDA 2KSEA 4IFMA 2ZVOB 1SQPK 1N8RQ 2WTYA 3VN0A 3O6QA 3RK2D 1BDCA 1AVYA 2OYIC 1IFMA 2C9LY 1ZR4A 1ZXGA 2B87A 1JY3N 1JB0J 2C0XA 1FZGA 3CWBD 3L75G 1RF1A 3MZWB 3KXDA 1YQ3C 2B89A 3H1KD 3A2AA 1KC8Q 3S9OA 1LP1A 4ASWA 3QH9A 2E5TA 1QX8A 5KLIC 3MUDC 1UIIA 2J5UA 1LTBC 1L0LG 1M7LA 1BGYD 1YTZI 1JCCA 1SQQD 2IPPA 3L74D 1VQ7P 2W8ZA 3VP9A 1T6AA 3OAKA 2XDJA 1YIJP 2K1AA 2NPSB 3LIEA 3H1KE 1MKMA 1K73Q 3P8MC 2C9NY 1R5SA 4C46A 2VRSA 1BGYE 2YIUC 1M8OB 1SQQE 3D71A 3D6ZA 3N4XA 1D7MA 5KLVD 4YPCA 3V2PA 3ABVC 4W7YA 3WUUA 3PJSK 4IL6H 4H13C 4M3LA 1HUCA 3KZIE 1OVUA 2N1TD 5TISE 2QJPB 1GL2D 5KJ7C 2FFDB 3CCMP 3CCJP 2E74D 1A02J 2H88C 5H2FE 1LNQA 1EDIA 1HH0A 1DX7A 1LTJA 2YXQB 3WUTA 1HF9A 1FZCB 1SQVK 3KQGA 3GMAA 2H43A 4WBAA 5TISH 1OW6A 1M1KQ 2GM4A 2HODB 1PZQA 3AE2C 1GW3A 1JTHB 2ZT9C 1NTZG 1SQBK 3H1HJ 1N2DC 3T97A 3CXHI 3CWBG 3WMM0 3BCCG 3L70G 2OTJP 5KKZC 1SFCB 4WY4B 3CCRP 3B5NB 2QJYC 5AW6B 5AW1B 3AE6C 3AE7C 1VQ5P 4WB4A 1RE4C 2QA4P 1KYOH 4XFJA 2E76C 3KDPB 3L74G 2D2CD 1GK4A 2Y0DA 1OVRA 2HPCB 3A0BH 2WVRA 4YXWH 3TSIA 1KILA 2MJZA 4H44C 2HR3A 5AW5B 1SQXK 4KHXA 3TK1A 1VF5D 1P84H 1YHQP 3L71D 1EZVD 2P1JA 3PTZA 1OZHA 4NPEA 3FWLA 2WSFJ 5AW0B 2OTLP 3TNUB 1Q86Q 5KAFE 1HGVA 2K3RA 4U7JA 5KLVG 3HTKB 1LTSC 2K88A 3IN6A 1N7SA 3CWBJ 3RK3D 2QJKC 4RO0A 3HUSA 4RJTA 3L71E 1L0NG 3FWNA 3Q3DA 1EZVE 3H1KJ 3CCUP 4XE5B 1H8AA 3D70A 1FAVA 2R3CA 2NPSC 4D6TG 2A06E 4HYTB 5AVQB 4JYBA 3HD7A 1S5LH 3VTPC 1VPCA 1BGYJ 1OIPA 2YKPA 2WSCH 3CL3D 3JCUE 2GUVA 5M1BA 1PGJA 1SQQJ 3L74J 2MKVA 1S9KD 2G8YA 3RK3E 4PJ0E 1J1EC 1RE3A 1JMBA 3CC4P 2WSSH 2KP8A 2OQQA 1URQA 1NVOA 1IFNA 1T2KD 4AYCA 4Y28J 3B4SA 3CPWO 2FYUG 1M1JA 3VOPA 4U3FG 1NKNA 2L5GB 1KTMA 4PJ0H 1S9KE 4I1LA 5KLVJ 1L4AA 3I55P 2FFDC 4I6MC 4JPZB 2Q3IA 1SQPG 4R4MA 2XNDH 1LT9C 2PGDA 3GLMA 1NU1K 4W7ZA 3ITKA 3O6QB 1FZCC 5CJ4A 1KORA 1JM0A 4LLHA 5AW9B 4BWNA 1KFMA 2B87B 4D6TJ 4UB8H 2FBWC 1EZVG 4N3YB 4PV1B 1RF1B 1N86A 3F89A 1NTMK 3G71P 2QM7A 5AVVB 3SSUA 4WY4C 1LP1B 2M3BA 5CCGC 1KN7A 3IF4A 5GTIE 5AW8B 4AUWA 3GHGA 1HVVA 4Y99B 1K04A 1VQNP 3L75D 1YJWP 2HYNA 2NPSD 2AXTH 1NHLA 2R3SA 2B9BA 1JY3P 3RK2C 2FYUJ 3M0DC 3H32A 4C7RA 1M90Q 3M06A 1FC2C 2KS1A 1JEKA 1QEXA 1T8ZA 1L0LD 3FXEA 4JYCA 4A7PA 1DEEG 2Y0CA 2HLOA 1H0TA 1LTAC 1PP9D 3RBZA 1J1DC 2E43A 1SQPJ 2O01J 5EFWB 3I5CA 1EC5A 2PRRA 3L75E 1NTKD 3MD0A 4H0LD 3A0HH 1FE6A 1RH5B 2NRGA 4ZNCA 4O9BA 2BCCG 3R4YA 1L0LE 1N7LA 1NAYA 3MGNA 4PD4H 1PP9E 3CXHH 3AECC 2N9YB 1N73A 4IOIH 2OYHA 4EIJA 1LTGC 3N7NA 3C9IA 2Y0EA 3D6YA 3WU2E 2IZ0A 5DJTB 3CC7P 1FDMA 3C8VA 1SQVG 5GTHH 2I8DA 4ZMDA 2J58A 1LTJB 4HJGH 2Y9ZA 5L8RJ 2FYNB 3A3YB 5CCHA 1IFDA 1ZMEC 1KB9D 1SFCD 4WY4D 1FJPA 1Q81Q 5CCGD 1MFZA 1SQBG 3H1LG 3VP8A 3B5ND 2OYIA 5APYA 1Z56A 2RMZA 1ZW0A 3T97B 2N1TC 2AEMA 3USSA 3CD6P 1K9MQ 1GL2C 2A45G 1FZFA 4IFFA 5AVXB 1OMIA 1S3JA 2O1KA 1GU4A 4LC1A 2E74C 4HB1A 1S2EA 1NTZD 1GTWA 4GKGA 5BU5A 3M9BA 3AE9C 2KB7P 2RKLA 1KFNA 3BCCD 1FDOA 1IFIA 3L70D 1KB9E 3MUDA 3R2PA 2HFED 5CBNA 2Q7CA 3E7KA 1AFOA 1PGPA 3TGUG 1M57D 4I2LC 1LT1A 3OJAB 3SWKA 2W90A 1SQXG 1L2PA 2J59M 1KILB 3Q5RA 2JWAA 2WSEJ 1GZLA 3MP7B 1NTZE 2AEFA 1PP9G 1NO4A 1NTMD 3CWBE 3BCCE 3L70E 4EYYQ 1QVFO 3GF3A 4OGQB 1Q90D 1NTKG 3TDKA 5AVRB 2O3JA 1QLED 5B66E 2WT7A 1H89A 1NYHA 1MFTA 1SQBJ 5TJHA 1GW4A 2V7QJ 5APQA 3AEAC 2D2CC 1YTZT 2Z5HA 1N7SB 2IBZG 1ZN5A 1IK7A 3OA7A 1QL2A 1WRGA 1H88A 3HUSB 2P58A 1GDTA 2B88A 3L74E 1VF5C 3CCSP 4DOJA 2M5AA 1SP4A 5KJ7A 1VQMP 3MTUE 2KNCA 4IFDK 4H0LB 1KQFB 2R5BA 3HD7B 3L75J 1L0ND 3AE5C 3U1AA 1NH4A 1LTIC 4GT1A 3LW5J 4JQ0D 3HRNA 1CZQA 1LWUA 1FU1A 3CX5D 1PL5A 4D6TD 2WPQA 3OW2O 1S1CX 3RK3C 1L0LJ 1W2EA 1URQB 5KLVE 3RBXA 1PP9J 2WZ7A 2I1JA 4I7ZB 5APVA 3AEEC 1M1JB 1JY2O 3KZIH 3AEBC 4IL6X 2QE7H 3L73G 1L0NE 2KZJA 1NTKJ 1SS1A 3EWKA 4N6JA 5CMZA 1OXZA 4PD4I 1L4AB 5H2FH 3CX5E 2L91A 2POHA 1LJ2A 2FYUD 1RE4A 4D6TE 1FOSF 4U3FD 1NU1G 4ASVA 2OGUA 3IFMA 1IFJA 4PV1D 1KZUB 1T2KC 4C7NA 1SQPD 2P2UA 2Q5UA 3KYQA 2KYVA 2XKMA 3BASA 1NTMG 3AE1C 2FYUE 3HE5A 3E1IA 1VQ8P 4U3FE 3VMYA 1QL1A 1PFIA 1DH3A 1RF0C 3GHGB 2KLVA 1BCCD 2M8RA 3RL0B 1CI6A 3F5HA 2SPZA 1SQPE 3SFDC 2ZJSE 5APTA 1EDKA 3CI9A 3WUVA 3H32B 3L72G 2BASA 1XTCC 2KS1B 2Q6QA 3L37A 1NTZJ 3JC22 1KILC 1JCDA 2IDBA 3BCCJ 3AEGC 3L70J 3SWFA 1H0TB 3A7OA 1X9VA 1OW8A 2IZ1A 1NU1J 4ZKPA 2O01H 2FY8A 2IFMA 1KB9I 2PFXA 4OGQC 5KAFH 2YXRB 2JWDA 1HJBA 4HKZH 1IJDB 1CW5A 1WMKA 2YKQA 2WPVB 1NTMJ 3EQ2A 2I1KA 1YYCA 1ZLLA 3V4QA 3PHLA 1JY2N 1JOCA 4OWFA 3NFQA 1EDJA 3NXSA 1AVOA 4UB6E 5CHXA 2K9JA 2WWWA 1N73B 2OYHB 2BCCD 3CCVP 1G1JA 4RKUJ 2HG5D 1X8YA 3Q2YA 1S5LX 3JCUH 3L4FA 1T3UA 4H0LC 1FZEA 1LT9A 1HTLC 1BE3G 5AVWB 2IYOA 1R8EA 2WPSA 2QJPC 2GUSA 3K5BA 1PPJD 1Q82Q 1OW7A 1VQKP 1RE3C 2OYIB 3P32A 3A5TA 1SQVD 1KMIZ 1NOHA 2BCCE 1L0NJ 4JBZA 1G2CA 1Q2NA 2KK7A 1USDA 5AVTB 2CK3H 4TLFA 1M1JC 1SQBD 3H1LD 2K37A 2LKMA 1T3JA 1U57A 2KUBA 1ZP0C 1BCCG 1ZV8A 1KILD 1AJYA 1X79B 3V6IA 2O1JA 1SFCC 1SQVE 2O01N 3NMDA 3B5NC 2IFNA 3M9QA 4HH2A 4OGQD 1SQQK 1SQBE 2WSEH 3VMZA 3H1LE 2FKWB 3AE8C 1NAFA 1E79H 3GW6A 3TF5A 3L36A 3TGUD 4U3FJ 3Q5SA 1OVVA 2RH0A 1SQXD 1KILE 3NTNA 1BE3J 3CX5I 1N7SD 5AVUB 3CXHD 2E75B 2YIUB 2YMKA 5GTIH 1DD4A 5APSA 2QRXA 3Q5PA 2W27A 2WT7B 3VMAA 2QG4A 2YO2A 3TNUA 2W6BA 2H89C 2PAJA 2QSIA 1AA0A 2NZ2A 2V7QH 3RL0C 1BSNA 4DJGA 4DT0A 5KLVK 3EFGA 3HD7D 3TGUE 4H13B 2E5YA 3AEDC 1JMMA 3CCLP 1SQXE 1KV4A 2M5AB 2IBZD 2KNCB 1BCCJ 1Q7YQ 2KZIA 1URQD 3QWOC 3CC2P 3LW5H 1LWUB 2R32A 5APWA 1NTKE 1PPJG 5E79E 4WWIA 4NPDA 1QGKB 3HE4A 3BRVB 2JO1A 2ZT9B 5C39A 1KQGB 2P67A 2ZYDA 3LIDA 4WVZA 3C1LA 2N1TA 1Y8AA 1L4AD 2IBZE 3TYYA 1GL2A 1PIXA 2LXBA 4GODA 5AW2B 2BEZF 2KI7B 2E42A 3Q1MA 3S1KA 1EZVI 2ZVNB 3B71A 3WU2H 3RL0g 1VQ9P 1EQ7A 3MHVA 1S4XA 2W6AA 3L73D 2C0WA 1VL2A 1RQVA 3FX0A 2E76B 2R5DA 1GD2E 5CCHC 5AVSB 2BCCJ 4H44B 4YXDC 1HGZA 4C7NB 1JUNA 4DCKA 1NU1D 2KLUA 3CCEP 1ZR2A 3PLNA 3AE3C 2ZXXA 3RL0D 3HE5B 3L73E 3UIAA 2W83C 2H7HA 1KB9H 3E1RA 4LGDE 1SQVJ 3FGAD 1CI6B 1OWAA 3GF7A 3SWYA 4PV1C 1NU1E 2QJKB 1RF1C 1ZOYC 1JNMA 2WSFH 3H1LJ 1AQ5A 2P7JA 1QVGO 4Y99C 2H8PD 3H1IG 1OFCX 1FZBA 2ZYAA 2Y9YA 4BRYA 1UIXA 3L72D 1XTGB 3H1HG 1EXIA 1NTME 2OYOA 5B66H 1AV1A 3G3ZA 3W68A 4IL6E 2XZRA 2KOGA 1J1EB 2E75C 3ZDMA 5KAIE 1K05A 2FXOA 5CBOA 1NKZB 1YQ4C 3P7KA 3AEFC 2G3AA 3TGUJ 4GOFA 1Y9BA 1VQ6P 2V4HA 4BXLA 5B5EE 1SQXJ 1FS0E 2YMYA 2Z4EA 4CPGA 1YI2P 3L72E 2K9JB 2YNYA 1BDDA 2UWJE 2ZYGA 1USEA 5CCHD 2A45I 1KYOD 5KAIH 2GA1A 2Q9IA 2YKOA 3V2QA 1X22A 1IC2A 3BVHA 4W80A 1J2JB 3AE4C 1LT9B 4N78D 5B5EH 1W2BO 1VQOP 1DEBA 3V2NA 1JY2P 1LWUC 1P84D 1VQLP 3KPEA 3H1IJ 1MV8A 1BE3D 2ITAA 1KYOE 4TT3H 2KXPB 1G2CB 1LTJC 1KD1Q 3M9HA 2FYNC 4QMAA 4GOEA 1YITP 4MN4C 4K3AA 1KQLA 2BEQD 4N78E 1R5LA 3A0BE 2Z5IA 3CX5H 1FJKA 3H1KG 1RF0A 1S72P 1PV3A 2JP3A 1A02F 4EOTA 1P84E 4K35A 2XV5A 3RK2B 1BGYG 2KSJA 2N9BA 3EFFK 1BE3E 4ZKUA 1FDIA 1SQQG 3H1JD 1VQ4P 3U59A 1LGHB 2IBZI 5CJ0A 1DD3A 1TU3F 2E75D 2K9YA 2W6JH 4R4LA 3L73J 1J1DB 1WT6A 1L0LK 1IZNB 5AVZB 2R44A 3V2RA 1IK9A 1GU5A 4EDFA 3B8EB 3PH0A 3RGUA 4H13D 2JJLA 2NPSA 1NWQA 2A06D 3H1JE 3L35A 1NTKK 1BCCE 2FYZA 1LTTC 5KJ7D 3VYIA 3M0AA 1S5LE 3SFEC 2CPSA 4L73A 1IFPA 2AXCA 3G4SP 2JR8A 1GMJA 3CMAP 5DJUB 3W67A 3MIWA 1VQPP 5AW3B 5APXA 3P8CD 2ZFCA 1YJNP 5AW4B 1N7SC 3U1CA 2KIKA 1K8AQ 3HUSC 1SVFA 2ZT9D 1DIPA 1PGOA 2M0BA 1FBMA 2CPBA
chains in the Genus database with same CATH topology
3WMM0 3RL0C 2FFDA 1SFCB 3HE4B 5KLVK 4WY4B 1GZLA 3EFGA 3HD7D 3B5NB 5AW6B 1JMMA 2XU6A 3HD7C 1NO4A 2N1TB 3P8CE 5AW1B 3H6PA 1GL2B 5AVYB 5BVZA 1FZCA 4WB4A 1RE4C 3BATA 5AVRB 1SLQA 2HODA 5APUA 2WT7A 1H89A 1URQD 3KDPB 1JTHA 1URQC 1GW4A 1GK4A 4DZOA 2HPCB 5APQA 3LW5H 1LWUB 1YTZT 2XNXA 2R32A 5APWA 2Z5HA 1N7SB 3TSIA 1NTZK 1KILA 1ZN5A 2WITA 2MJZA 3OA7A 1QL2A 1WRGA 2WPRA 1H88A 5AW5B 1HBWA 1SQXK 4KHXA 3HUSB 1SFCA 3HE4A 3II6A 4WY4A 3BRVB 3TK1A 1GDTA 5CCGA 2P67A 3B5NA 3LIDA 3O8ZA 2N1TA 1JO5A 4DOJA 2YO3A 1L4AD 1SP4A 3TYYA 5KJ7A 2P1JA 5AW7B 1GL2A 4XA4A 1L4AC 3V4WA 3MTUE 4IFDK 5AW2B 2R5BA 3HD7B 5AW0B 3M0DA 1G1IA 3TNUB 2E42A 3U1AA 1NH4A 1HGVA 1E5WA 1LTIC 1MUUA 4GT1A 3HTKB 1EQ7A 3HRNA 1LTSC 1CZQA 2HPCA 1LWUA 1FU1A 2W6AA 1N7SA 5KTBA 3RK3D 2C0WA 2WPQA 3RK3C 3HUSA 2R5DA 1W2EA 1JY3O 3PP5A 1URQB 1GD2E 5CCHC 2WZ7A 4XE5B 2I1JA 3IR9A 5AVSB 5APVA 1H8AA 1M1JB 1JY2O 3T97A 2JEEA 1HGZA 4C7NB 1JUNA 1FAVA 2R3CA 2NPSC 4HYTB 5AVQB 1MZ9A 1ZR2A 4JYBA 3HD7A 3VTPC 1VPCA 2YKPA 2WSCH 3CL3D 3VMXA 4N6JA 3GHGC 2GUVA 3RL0D 5CMZA 1OXZA 1L4AB 3HE5B 3HTKA 1S9KD 2POHA 4GIFA 3UIAA 1RE4A 1FOSF 1J1EC 1RE3A 1FOSE 2A45H 2FXMA 4B86A 1VDFA 2KP8A 1CSBA 2H7HA 4OH8B 1GK6A 3IFMA 2IX7C 1URQA 2ZXEB 4LGDE 1FZAA 3BRTB 1IFNA 1CI6B 1L0NK 1OWAA 1IFJA 2OARA 1T2KD 1KZUB 3SWYA 4AYCA 1T2KC 1M1JA 3VOPA 1RF1C 3RK3B 4C7NA 1NKNA 1JNMA 2P2UA 2L5GB 2Q5UA 2WSFH 3KYQA 1AQ5A 4RESB 1RY3A 2KYVA 3BASA 2P7JA 2XKMA 4AQRD 1S9KE 4Y99C 4I1LA 1HWTC 2H8PD 1FZBA 1L4AA 3HE5A 3E1IA 2FFDC 4I6MC 3VMYA 1QL1A 1PFIA 1IO4A 2Q3IA 5BU8B 1XTGB 1LT9C 2QM8A 1DH3A 1RF0C 3GHGB 2KLVA 1NU1K 4W7ZA 2M8RA 3RL0B 3G3ZA 1FZCC 1CI6A 5CJ4A 2XZRA 2KOGA 1J1EB 5APTA 4LLHA 5AW9B 3CI9A 3H32B 1KFMA 1NKZB 2BASA 1XTCC 2FYUK 2PP6A 3P7KA 1N73C 3M91A 3L37A 2OYHC 4N3YB 1KILC 1JCDA 4JF7A 2YMYA 2Z4EA 1RF1B 1N86A 1NTMK 3V5BA 3SWFA 2QM7A 5AVVB 4WY4C 3A7OA 1X9VA 2M3BA 2YNYA 5CCGC 3CLQA 4ZKPA 5AW8B 5CCHD 4IFMA 4AUWA 2A45I 2O01H 3GHGA 1HVVA 4Y99B 1SQPK 2WTYA 3VN0A 2Q9IA 2IFMA 2YKOA 3V2QA 2HYNA 2NPSD 3RK2D 1IC2A 3BVHA 4W80A 1NHLA 1J2JB 1JY3P 3RK2C 2OYIC 1LT9B 1IFMA 4N78D 2C9LY 1HJBA 3M0DC 1ZR4A 1IJDB 3H32A 1CW5A 4C7RA 1JY3N 3M06A 2YKQA 2C0XA 1FZGA 1DEBA 3V2NA 1JY2P 1LWUC 1T8ZA 3EQ2A 2I1KA 1YYCA 4JYCA 1ZLLA 3V4QA 3KPEA 1JY2N 1JOCA 1RF1A 2HLOA 1MV8A 3NFQA 3NXSA 5CHXA 1LTAC 3A2AA 1J1DC 2WWWA 1N73B 2E43A 2OYHB 1G1JA 1G2CB 1LTJC 3I5CA 2HG5D 3M9HA 1X8YA 1LTBC 3MD0A 1M7LA 3L4FA 1T3UA 1KQLA 1YTZI 4N78E 1FZEA 2Z5IA 1JCCA 2IPPA 1FJKA 1LT9A 1HTLC 1RF0A 5AVWB 4O9BA 3VP9A 1A02F 4EOTA 2WPSA 3OAKA 2XDJA 2GUSA 2XV5A 1N7LA 3MGNA 1RE3C 2NPSB 3LIEA 3RK2B 2OYIB 3P32A 2KSJA 3A5TA 2N9BA 4ZKUA 1NOHA 3U59A 1LGHB 3P8MC 1N73A 2C9NY 2OYHA 4EIJA 4C46A 5CJ0A 1G2CA 1LTGC 5AVTB 3N7NA 2VRSA 3C9IA 1M1JC 1FDMA 2LKMA 1J1DB 1T3JA 1WT6A 1L0LK 2J58A 1LTJB 3N4XA 5AVZB 1ZV8A 3A3YB 1KILD 5CCHA 3V2RA 3V2PA 1IK9A 1IFDA 1GU5A 4W7YA 3B8EB 1X79B 1SFCD 4WY4D 1FJPA 2O1JA 5CCGD 1SFCC 1MFZA 2JJLA 2NPSA 1NWQA 3VP8A 3B5ND 2OYIA 5APYA 3L35A 1HUCA 1Z56A 3NMDA 4M3LA 1NTKK 3B5NC 2FYZA 2N1TD 1LTTC 2IFNA 5KJ7D 2N1TC 1GL2D 3M9QA 4HH2A 5KJ7C 3VYIA 3M0AA 1GL2C 2A45G 1FZFA 1SQQK 2FFDB 4IFFA 2CPSA 5AVXB 2WSEH 3VMZA 2FKWB 1NAFA 1A02J 2O1KA 1GU4A 4LC1A 3L36A 1GTWA 4GKGA 1HH0A 5BU5A 3MIWA 5AW3B 3M9BA 5APXA 2KB7P 3P8CD 1DX7A 1LTJA 2ZFCA 3NTNA 1KFNA 1FZCB 1IFIA 1N7SD 1SQVK 3KQGA 5AVUB 5AW4B 2H43A 3MUDA 3R2PA 2HFED 1N7SC 4WBAA 2Q7CA 3U1CA 5APSA 2GM4A 1AFOA 2HODB 2W27A 2WT7B 1GW3A 3HUSC 1SVFA 1JTHB 2YO2A 1FBMA 3TNUA 2W6BA 4I2LC 1SQBK 3OJAB 2PAJA 2CPBA 1N2DC 2J59M 1KILB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGV A;  1FDM A;  1IFD A;  2MJZ A;  1NH4 A;  2C0W A;  1HH0 A;  1IFJ A;  1IFI A;  2CPB A;  1HGZ A;  2C0X A;  2CPS A; 
#chains in the Genus database with same CATH topology
 2FFD A;  3HE4 B;  2LXC B;  2XU6 A;  3HD7 C;  2DW3 A;  2N1T B;  3P8C E;  3L72 J;  3H6P A;  1GL2 B;  2LR2 A;  5AVY B;  2WQY C;  4UB6 H;  5BVZ A;  3CME P;  1FZC A;  3BAT A;  2E74 B;  1SLQ A;  2E76 D;  2HOD A;  5APU A;  1ZRT D;  1JTH A;  1URQ C;  4DZO A;  1YBK A;  2XNX A;  4H44 D;  2QVA A;  1NTZ K;  2WIT A;  4I7Z C;  4GDO A;  1HJ0 A;  2WPR A;  1HBW A;  4UB8 E;  1SFC A;  3II6 A;  4WY4 A;  2M3E A;  5CCG A;  3G9R A;  3B5N A;  3O8Z A;  3H1J G;  1JO5 A;  1EXJ A;  2YO3 A;  5KLI B;  1PPJ E;  5AW7 B;  1YJ9 P;  4OVN F;  4XA4 A;  1L4A C;  3V4W A;  1OX3 A;  2WMM A;  1ZRT E;  1RHZ B;  3M0D A;  1G1I A;  3L71 G;  1E5W A;  1MUU A;  2AXT E;  1KQS O;  2HPC A;  4Z1M H;  4L74 A;  5KTB A;  4EI2 A;  3GG2 A;  1JY3 O;  3PP5 A;  2A06 G;  2AEJ A;  2D2C B;  1NJI Q;  3IAO A;  3JSV C;  3IR9 A;  4PD4 D;  2JEE A;  4L75 A;  3PRJ A;  1EDL A;  2P10 A;  1U7J A;  1VF5 B;  1MZ9 A;  4NPF X;  1KYO I;  3A0H E;  3VMX A;  3GHG C;  2RN0 A;  2OTK E;  3HTK A;  4BRY B;  1W5C E;  4GIF A;  1RQU A;  1FOS E;  2A45 H;  2FXM A;  4B86 A;  1VDF A;  1CSB A;  4YTP C;  4OH8 B;  1GK6 A;  2IX7 C;  2ZXE B;  1FZA A;  3BRT B;  2Q3E A;  3KHU A;  4PD4 E;  1P84 I;  1L0N K;  2OAR A;  3H1J J;  3CXH E;  3H1I D;  3RK3 B;  3I56 P;  3CCQ P;  3G6E P;  1X0T A;  3H1H D;  2JDI H;  2WSC J;  2Q1K A;  1NGM B;  4RES B;  1RY3 A;  2ZAE B;  4AQR D;  3L71 J;  1HWT C;  2FXP A;  5GTH E;  1IO4 A;  1M56 D;  5BU8 B;  2QM8 A;  5K5G B;  1BSH A;  3H1I E;  1AQT A;  3S4R A;  5KKZ B;  1Y47 A;  2IYP A;  3H1H E;  4KJM A;  2QJY B;  4KT0 J;  2JKV A;  3H25 A;  2FYU K;  1U7M A;  5E79 H;  2PP6 A;  1PGQ A;  4L76 A;  1N73 C;  3M91 A;  2OYH C;  2QIW A;  4JF7 A;  3V5B A;  2QEX P;  3CLQ A;  3FXD A;  2KSE A;  4IFM A;  2ZVO B;  1SQP K;  1N8R Q;  2WTY A;  3VN0 A;  3O6Q A;  3RK2 D;  1BDC A;  1AVY A;  2OYI C;  1IFM A;  2C9L Y;  1ZR4 A;  1ZXG A;  2B87 A;  1JY3 N;  1JB0 J;  2C0X A;  1FZG A;  3CWB D;  3L75 G;  1RF1 A;  3MZW B;  3KXD A;  1YQ3 C;  2B89 A;  3H1K D;  3A2A A;  1KC8 Q;  3S9O A;  1LP1 A;  4ASW A;  3QH9 A;  2E5T A;  1QX8 A;  5KLI C;  3MUD C;  1UII A;  2J5U A;  1LTB C;  1L0L G;  1M7L A;  1BGY D;  1YTZ I;  1JCC A;  1SQQ D;  2IPP A;  3L74 D;  1VQ7 P;  2W8Z A;  3VP9 A;  1T6A A;  3OAK A;  2XDJ A;  1YIJ P;  2K1A A;  2NPS B;  3LIE A;  3H1K E;  1MKM A;  1K73 Q;  3P8M C;  2C9N Y;  1R5S A;  4C46 A;  2VRS A;  1BGY E;  2YIU C;  1M8O B;  1SQQ E;  3D71 A;  3D6Z A;  3N4X A;  1D7M A;  5KLV D;  4YPC A;  3V2P A;  3ABV C;  4W7Y A;  3WUU A;  3PJS K;  4IL6 H;  4H13 C;  4M3L A;  1HUC A;  3KZI E;  1OVU A;  2N1T D;  5TIS E;  2QJP B;  1GL2 D;  5KJ7 C;  2FFD B;  3CCM P;  3CCJ P;  2E74 D;  1A02 J;  2H88 C;  5H2F E;  1LNQ A;  1EDI A;  1HH0 A;  1DX7 A;  1LTJ A;  2YXQ B;  3WUT A;  1HF9 A;  1FZC B;  1SQV K;  3KQG A;  3GMA A;  2H43 A;  4WBA A;  5TIS H;  1OW6 A;  1M1K Q;  2GM4 A;  2HOD B;  1PZQ A;  3AE2 C;  1GW3 A;  1JTH B;  2ZT9 C;  1NTZ G;  1SQB K;  3H1H J;  1N2D C;  3T97 A;  3CXH I;  3CWB G;  3WMM 0;  3BCC G;  3L70 G;  2OTJ P;  5KKZ C;  1SFC B;  4WY4 B;  3CCR P;  3B5N B;  2QJY C;  5AW6 B;  5AW1 B;  3AE6 C;  3AE7 C;  1VQ5 P;  4WB4 A;  1RE4 C;  2QA4 P;  1KYO H;  4XFJ A;  2E76 C;  3KDP B;  3L74 G;  2D2C D;  1GK4 A;  2Y0D A;  1OVR A;  2HPC B;  3A0B H;  2WVR A;  4YXW H;  3TSI A;  1KIL A;  2MJZ A;  4H44 C;  2HR3 A;  5AW5 B;  1SQX K;  4KHX A;  3TK1 A;  1VF5 D;  1P84 H;  1YHQ P;  3L71 D;  1EZV D;  2P1J A;  3PTZ A;  1OZH A;  4NPE A;  3FWL A;  2WSF J;  5AW0 B;  2OTL P;  3TNU B;  1Q86 Q;  5KAF E;  1HGV A;  2K3R A;  4U7J A;  5KLV G;  3HTK B;  1LTS C;  2K88 A;  3IN6 A;  1N7S A;  3CWB J;  3RK3 D;  2QJK C;  4RO0 A;  3HUS A;  4RJT A;  3L71 E;  1L0N G;  3FWN A;  3Q3D A;  1EZV E;  3H1K J;  3CCU P;  4XE5 B;  1H8A A;  3D70 A;  1FAV A;  2R3C A;  2NPS C;  4D6T G;  2A06 E;  4HYT B;  5AVQ B;  4JYB A;  3HD7 A;  1S5L H;  3VTP C;  1VPC A;  1BGY J;  1OIP A;  2YKP A;  2WSC H;  3CL3 D;  3JCU E;  2GUV A;  5M1B A;  1PGJ A;  1SQQ J;  3L74 J;  2MKV A;  1S9K D;  2G8Y A;  3RK3 E;  4PJ0 E;  1J1E C;  1RE3 A;  1JMB A;  3CC4 P;  2WSS H;  2KP8 A;  2OQQ A;  1URQ A;  1NVO A;  1IFN A;  1T2K D;  4AYC A;  4Y28 J;  3B4S A;  3CPW O;  2FYU G;  1M1J A;  3VOP A;  4U3F G;  1NKN A;  2L5G B;  1KTM A;  4PJ0 H;  1S9K E;  4I1L A;  5KLV J;  1L4A A;  3I55 P;  2FFD C;  4I6M C;  4JPZ B;  2Q3I A;  1SQP G;  4R4M A;  2XND H;  1LT9 C;  2PGD A;  3GLM A;  1NU1 K;  4W7Z A;  3ITK A;  3O6Q B;  1FZC C;  5CJ4 A;  1KOR A;  1JM0 A;  4LLH A;  5AW9 B;  4BWN A;  1KFM A;  2B87 B;  4D6T J;  4UB8 H;  2FBW C;  1EZV G;  4N3Y B;  4PV1 B;  1RF1 B;  1N86 A;  3F89 A;  1NTM K;  3G71 P;  2QM7 A;  5AVV B;  3SSU A;  4WY4 C;  1LP1 B;  2M3B A;  5CCG C;  1KN7 A;  3IF4 A;  5GTI E;  5AW8 B;  4AUW A;  3GHG A;  1HVV A;  4Y99 B;  1K04 A;  1VQN P;  3L75 D;  1YJW P;  2HYN A;  2NPS D;  2AXT H;  1NHL A;  2R3S A;  2B9B A;  1JY3 P;  3RK2 C;  2FYU J;  3M0D C;  3H32 A;  4C7R A;  1M90 Q;  3M06 A;  1FC2 C;  2KS1 A;  1JEK A;  1QEX A;  1T8Z A;  1L0L D;  3FXE A;  4JYC A;  4A7P A;  1DEE G;  2Y0C A;  2HLO A;  1H0T A;  1LTA C;  1PP9 D;  3RBZ A;  1J1D C;  2E43 A;  1SQP J;  2O01 J;  5EFW B;  3I5C A;  1EC5 A;  2PRR A;  3L75 E;  1NTK D;  3MD0 A;  4H0L D;  3A0H H;  1FE6 A;  1RH5 B;  2NRG A;  4ZNC A;  4O9B A;  2BCC G;  3R4Y A;  1L0L E;  1N7L A;  1NAY A;  3MGN A;  4PD4 H;  1PP9 E;  3CXH H;  3AEC C;  2N9Y B;  1N73 A;  4IOI H;  2OYH A;  4EIJ A;  1LTG C;  3N7N A;  3C9I A;  2Y0E A;  3D6Y A;  3WU2 E;  2IZ0 A;  5DJT B;  3CC7 P;  1FDM A;  3C8V A;  1SQV G;  5GTH H;  2I8D A;  4ZMD A;  2J58 A;  1LTJ B;  4HJG H;  2Y9Z A;  5L8R J;  2FYN B;  3A3Y B;  5CCH A;  1IFD A;  1ZME C;  1KB9 D;  1SFC D;  4WY4 D;  1FJP A;  1Q81 Q;  5CCG D;  1MFZ A;  1SQB G;  3H1L G;  3VP8 A;  3B5N D;  2OYI A;  5APY A;  1Z56 A;  2RMZ A;  1ZW0 A;  3T97 B;  2N1T C;  2AEM A;  3USS A;  3CD6 P;  1K9M Q;  1GL2 C;  2A45 G;  1FZF A;  4IFF A;  5AVX B;  1OMI A;  1S3J A;  2O1K A;  1GU4 A;  4LC1 A;  2E74 C;  4HB1 A;  1S2E A;  1NTZ D;  1GTW A;  4GKG A;  5BU5 A;  3M9B A;  3AE9 C;  2KB7 P;  2RKL A;  1KFN A;  3BCC D;  1FDO A;  1IFI A;  3L70 D;  1KB9 E;  3MUD A;  3R2P A;  2HFE D;  5CBN A;  2Q7C A;  3E7K A;  1AFO A;  1PGP A;  3TGU G;  1M57 D;  4I2L C;  1LT1 A;  3OJA B;  3SWK A;  2W90 A;  1SQX G;  1L2P A;  2J59 M;  1KIL B;  3Q5R A;  2JWA A;  2WSE J;  1GZL A;  3MP7 B;  1NTZ E;  2AEF A;  1PP9 G;  1NO4 A;  1NTM D;  3CWB E;  3BCC E;  3L70 E;  4EYY Q;  1QVF O;  3GF3 A;  4OGQ B;  1Q90 D;  1NTK G;  3TDK A;  5AVR B;  2O3J A;  1QLE D;  5B66 E;  2WT7 A;  1H89 A;  1NYH A;  1MFT A;  1SQB J;  5TJH A;  1GW4 A;  2V7Q J;  5APQ A;  3AEA C;  2D2C C;  1YTZ T;  2Z5H A;  1N7S B;  2IBZ G;  1ZN5 A;  1IK7 A;  3OA7 A;  1QL2 A;  1WRG A;  1H88 A;  3HUS B;  2P58 A;  1GDT A;  2B88 A;  3L74 E;  1VF5 C;  3CCS P;  4DOJ A;  2M5A A;  1SP4 A;  5KJ7 A;  1VQM P;  3MTU E;  2KNC A;  4IFD K;  4H0L B;  1KQF B;  2R5B A;  3HD7 B;  3L75 J;  1L0N D;  3AE5 C;  3U1A A;  1NH4 A;  1LTI C;  4GT1 A;  3LW5 J;  4JQ0 D;  3HRN A;  1CZQ A;  1LWU A;  1FU1 A;  3CX5 D;  1PL5 A;  4D6T D;  2WPQ A;  3OW2 O;  1S1C X;  3RK3 C;  1L0L J;  1W2E A;  1URQ B;  5KLV E;  3RBX A;  1PP9 J;  2WZ7 A;  2I1J A;  4I7Z B;  5APV A;  3AEE C;  1M1J B;  1JY2 O;  3KZI H;  3AEB C;  4IL6 X;  2QE7 H;  3L73 G;  1L0N E;  2KZJ A;  1NTK J;  1SS1 A;  3EWK A;  4N6J A;  5CMZ A;  1OXZ A;  4PD4 I;  1L4A B;  5H2F H;  3CX5 E;  2L91 A;  2POH A;  1LJ2 A;  2FYU D;  1RE4 A;  4D6T E;  1FOS F;  4U3F D;  1NU1 G;  4ASV A;  2OGU A;  3IFM A;  1IFJ A;  4PV1 D;  1KZU B;  1T2K C;  4C7N A;  1SQP D;  2P2U A;  2Q5U A;  3KYQ A;  2KYV A;  2XKM A;  3BAS A;  1NTM G;  3AE1 C;  2FYU E;  3HE5 A;  3E1I A;  1VQ8 P;  4U3F E;  3VMY A;  1QL1 A;  1PFI A;  1DH3 A;  1RF0 C;  3GHG B;  2KLV A;  1BCC D;  2M8R A;  3RL0 B;  1CI6 A;  3F5H A;  2SPZ A;  1SQP E;  3SFD C;  2ZJS E;  5APT A;  1EDK A;  3CI9 A;  3WUV A;  3H32 B;  3L72 G;  2BAS A;  1XTC C;  2KS1 B;  2Q6Q A;  3L37 A;  1NTZ J;  3JC2 2;  1KIL C;  1JCD A;  2IDB A;  3BCC J;  3AEG C;  3L70 J;  3SWF A;  1H0T B;  3A7O A;  1X9V A;  1OW8 A;  2IZ1 A;  1NU1 J;  4ZKP A;  2O01 H;  2FY8 A;  2IFM A;  1KB9 I;  2PFX A;  4OGQ C;  5KAF H;  2YXR B;  2JWD A;  1HJB A;  4HKZ H;  1IJD B;  1CW5 A;  1WMK A;  2YKQ A;  2WPV B;  1NTM J;  3EQ2 A;  2I1K A;  1YYC A;  1ZLL A;  3V4Q A;  3PHL A;  1JY2 N;  1JOC A;  4OWF A;  3NFQ A;  1EDJ A;  3NXS A;  1AVO A;  4UB6 E;  5CHX A;  2K9J A;  2WWW A;  1N73 B;  2OYH B;  2BCC D;  3CCV P;  1G1J A;  4RKU J;  2HG5 D;  1X8Y A;  3Q2Y A;  1S5L X;  3JCU H;  3L4F A;  1T3U A;  4H0L C;  1FZE A;  1LT9 A;  1HTL C;  1BE3 G;  5AVW B;  2IYO A;  1R8E A;  2WPS A;  2QJP C;  2GUS A;  3K5B A;  1PPJ D;  1Q82 Q;  1OW7 A;  1VQK P;  1RE3 C;  2OYI B;  3P32 A;  3A5T A;  1SQV D;  1KMI Z;  1NOH A;  2BCC E;  1L0N J;  4JBZ A;  1G2C A;  1Q2N A;  2KK7 A;  1USD A;  5AVT B;  2CK3 H;  4TLF A;  1M1J C;  1SQB D;  3H1L D;  2K37 A;  2LKM A;  1T3J A;  1U57 A;  2KUB A;  1ZP0 C;  1BCC G;  1ZV8 A;  1KIL D;  1AJY A;  1X79 B;  3V6I A;  2O1J A;  1SFC C;  1SQV E;  2O01 N;  3NMD A;  3B5N C;  2IFN A;  3M9Q A;  4HH2 A;  4OGQ D;  1SQQ K;  1SQB E;  2WSE H;  3VMZ A;  3H1L E;  2FKW B;  3AE8 C;  1NAF A;  1E79 H;  3GW6 A;  3TF5 A;  3L36 A;  3TGU D;  4U3F J;  3Q5S A;  1OVV A;  2RH0 A;  1SQX D;  1KIL E;  3NTN A;  1BE3 J;  3CX5 I;  1N7S D;  5AVU B;  3CXH D;  2E75 B;  2YIU B;  2YMK A;  5GTI H;  1DD4 A;  5APS A;  2QRX A;  3Q5P A;  2W27 A;  2WT7 B;  3VMA A;  2QG4 A;  2YO2 A;  3TNU A;  2W6B A;  2H89 C;  2PAJ A;  2QSI A;  1AA0 A;  2NZ2 A;  2V7Q H;  3RL0 C;  1BSN A;  4DJG A;  4DT0 A;  5KLV K;  3EFG A;  3HD7 D;  3TGU E;  4H13 B;  2E5Y A;  3AED C;  1JMM A;  3CCL P;  1SQX E;  1KV4 A;  2M5A B;  2IBZ D;  2KNC B;  1BCC J;  1Q7Y Q;  2KZI A;  1URQ D;  3QWO C;  3CC2 P;  3LW5 H;  1LWU B;  2R32 A;  5APW A;  1NTK E;  1PPJ G;  5E79 E;  4WWI A;  4NPD A;  1QGK B;  3HE4 A;  3BRV B;  2JO1 A;  2ZT9 B;  5C39 A;  1KQG B;  2P67 A;  2ZYD A;  3LID A;  4WVZ A;  3C1L A;  2N1T A;  1Y8A A;  1L4A D;  2IBZ E;  3TYY A;  1GL2 A;  1PIX A;  2LXB A;  4GOD A;  5AW2 B;  2BEZ F;  2KI7 B;  2E42 A;  3Q1M A;  3S1K A;  1EZV I;  2ZVN B;  3B71 A;  3WU2 H;  3RL0 g;  1VQ9 P;  1EQ7 A;  3MHV A;  1S4X A;  2W6A A;  3L73 D;  2C0W A;  1VL2 A;  1RQV A;  3FX0 A;  2E76 B;  2R5D A;  1GD2 E;  5CCH C;  5AVS B;  2BCC J;  4H44 B;  4YXD C;  1HGZ A;  4C7N B;  1JUN A;  4DCK A;  1NU1 D;  2KLU A;  3CCE P;  1ZR2 A;  3PLN A;  3AE3 C;  2ZXX A;  3RL0 D;  3HE5 B;  3L73 E;  3UIA A;  2W83 C;  2H7H A;  1KB9 H;  3E1R A;  4LGD E;  1SQV J;  3FGA D;  1CI6 B;  1OWA A;  3GF7 A;  3SWY A;  4PV1 C;  1NU1 E;  2QJK B;  1RF1 C;  1ZOY C;  1JNM A;  2WSF H;  3H1L J;  1AQ5 A;  2P7J A;  1QVG O;  4Y99 C;  2H8P D;  3H1I G;  1OFC X;  1FZB A;  2ZYA A;  2Y9Y A;  4BRY A;  1UIX A;  3L72 D;  1XTG B;  3H1H G;  1EXI A;  1NTM E;  2OYO A;  5B66 H;  1AV1 A;  3G3Z A;  3W68 A;  4IL6 E;  2XZR A;  2KOG A;  1J1E B;  2E75 C;  3ZDM A;  5KAI E;  1K05 A;  2FXO A;  5CBO A;  1NKZ B;  1YQ4 C;  3P7K A;  3AEF C;  2G3A A;  3TGU J;  4GOF A;  1Y9B A;  1VQ6 P;  2V4H A;  4BXL A;  5B5E E;  1SQX J;  1FS0 E;  2YMY A;  2Z4E A;  4CPG A;  1YI2 P;  3L72 E;  2K9J B;  2YNY A;  1BDD A;  2UWJ E;  2ZYG A;  1USE A;  5CCH D;  2A45 I;  1KYO D;  5KAI H;  2GA1 A;  2Q9I A;  2YKO A;  3V2Q A;  1X22 A;  1IC2 A;  3BVH A;  4W80 A;  1J2J B;  3AE4 C;  1LT9 B;  4N78 D;  5B5E H;  1W2B O;  1VQO P;  1DEB A;  3V2N A;  1JY2 P;  1LWU C;  1P84 D;  1VQL P;  3KPE A;  3H1I J;  1MV8 A;  1BE3 D;  2ITA A;  1KYO E;  4TT3 H;  2KXP B;  1G2C B;  1LTJ C;  1KD1 Q;  3M9H A;  2FYN C;  4QMA A;  4GOE A;  1YIT P;  4MN4 C;  4K3A A;  1KQL A;  2BEQ D;  4N78 E;  1R5L A;  3A0B E;  2Z5I A;  3CX5 H;  1FJK A;  3H1K G;  1RF0 A;  1S72 P;  1PV3 A;  2JP3 A;  1A02 F;  4EOT A;  1P84 E;  4K35 A;  2XV5 A;  3RK2 B;  1BGY G;  2KSJ A;  2N9B A;  3EFF K;  1BE3 E;  4ZKU A;  1FDI A;  1SQQ G;  3H1J D;  1VQ4 P;  3U59 A;  1LGH B;  2IBZ I;  5CJ0 A;  1DD3 A;  1TU3 F;  2E75 D;  2K9Y A;  2W6J H;  4R4L A;  3L73 J;  1J1D B;  1WT6 A;  1L0L K;  1IZN B;  5AVZ B;  2R44 A;  3V2R A;  1IK9 A;  1GU5 A;  4EDF A;  3B8E B;  3PH0 A;  3RGU A;  4H13 D;  2JJL A;  2NPS A;  1NWQ A;  2A06 D;  3H1J E;  3L35 A;  1NTK K;  1BCC E;  2FYZ A;  1LTT C;  5KJ7 D;  3VYI A;  3M0A A;  1S5L E;  3SFE C;  2CPS A;  4L73 A;  1IFP A;  2AXC A;  3G4S P;  2JR8 A;  1GMJ A;  3CMA P;  5DJU B;  3W67 A;  3MIW A;  1VQP P;  5AW3 B;  5APX A;  3P8C D;  2ZFC A;  1YJN P;  5AW4 B;  1N7S C;  3U1C A;  2KIK A;  1K8A Q;  3HUS C;  1SVF A;  2ZT9 D;  1DIP A;  1PGO A;  2M0B A;  1FBM A;  2CPB A; 
#chains in the Genus database with same CATH homology
 3WMM 0;  3RL0 C;  2FFD A;  1SFC B;  3HE4 B;  5KLV K;  4WY4 B;  1GZL A;  3EFG A;  3HD7 D;  3B5N B;  5AW6 B;  1JMM A;  2XU6 A;  3HD7 C;  1NO4 A;  2N1T B;  3P8C E;  5AW1 B;  3H6P A;  1GL2 B;  5AVY B;  5BVZ A;  1FZC A;  4WB4 A;  1RE4 C;  3BAT A;  5AVR B;  1SLQ A;  2HOD A;  5APU A;  2WT7 A;  1H89 A;  1URQ D;  3KDP B;  1JTH A;  1URQ C;  1GW4 A;  1GK4 A;  4DZO A;  2HPC B;  5APQ A;  3LW5 H;  1LWU B;  1YTZ T;  2XNX A;  2R32 A;  5APW A;  2Z5H A;  1N7S B;  3TSI A;  1NTZ K;  1KIL A;  1ZN5 A;  2WIT A;  2MJZ A;  3OA7 A;  1QL2 A;  1WRG A;  2WPR A;  1H88 A;  5AW5 B;  1HBW A;  1SQX K;  4KHX A;  3HUS B;  1SFC A;  3HE4 A;  3II6 A;  4WY4 A;  3BRV B;  3TK1 A;  1GDT A;  5CCG A;  2P67 A;  3B5N A;  3LID A;  3O8Z A;  2N1T A;  1JO5 A;  4DOJ A;  2YO3 A;  1L4A D;  1SP4 A;  3TYY A;  5KJ7 A;  2P1J A;  5AW7 B;  1GL2 A;  4XA4 A;  1L4A C;  3V4W A;  3MTU E;  4IFD K;  5AW2 B;  2R5B A;  3HD7 B;  5AW0 B;  3M0D A;  1G1I A;  3TNU B;  2E42 A;  3U1A A;  1NH4 A;  1HGV A;  1E5W A;  1LTI C;  1MUU A;  4GT1 A;  3HTK B;  1EQ7 A;  3HRN A;  1LTS C;  1CZQ A;  2HPC A;  1LWU A;  1FU1 A;  2W6A A;  1N7S A;  5KTB A;  3RK3 D;  2C0W A;  2WPQ A;  3RK3 C;  3HUS A;  2R5D A;  1W2E A;  1JY3 O;  3PP5 A;  1URQ B;  1GD2 E;  5CCH C;  2WZ7 A;  4XE5 B;  2I1J A;  3IR9 A;  5AVS B;  5APV A;  1H8A A;  1M1J B;  1JY2 O;  3T97 A;  2JEE A;  1HGZ A;  4C7N B;  1JUN A;  1FAV A;  2R3C A;  2NPS C;  4HYT B;  5AVQ B;  1MZ9 A;  1ZR2 A;  4JYB A;  3HD7 A;  3VTP C;  1VPC A;  2YKP A;  2WSC H;  3CL3 D;  3VMX A;  4N6J A;  3GHG C;  2GUV A;  3RL0 D;  5CMZ A;  1OXZ A;  1L4A B;  3HE5 B;  3HTK A;  1S9K D;  2POH A;  4GIF A;  3UIA A;  1RE4 A;  1FOS F;  1J1E C;  1RE3 A;  1FOS E;  2A45 H;  2FXM A;  4B86 A;  1VDF A;  2KP8 A;  1CSB A;  2H7H A;  4OH8 B;  1GK6 A;  3IFM A;  2IX7 C;  1URQ A;  2ZXE B;  4LGD E;  1FZA A;  3BRT B;  1IFN A;  1CI6 B;  1L0N K;  1OWA A;  1IFJ A;  2OAR A;  1T2K D;  1KZU B;  3SWY A;  4AYC A;  1T2K C;  1M1J A;  3VOP A;  1RF1 C;  3RK3 B;  4C7N A;  1NKN A;  1JNM A;  2P2U A;  2L5G B;  2Q5U A;  2WSF H;  3KYQ A;  1AQ5 A;  4RES B;  1RY3 A;  2KYV A;  3BAS A;  2P7J A;  2XKM A;  4AQR D;  1S9K E;  4Y99 C;  4I1L A;  1HWT C;  2H8P D;  1FZB A;  1L4A A;  3HE5 A;  3E1I A;  2FFD C;  4I6M C;  3VMY A;  1QL1 A;  1PFI A;  1IO4 A;  2Q3I A;  5BU8 B;  1XTG B;  1LT9 C;  2QM8 A;  1DH3 A;  1RF0 C;  3GHG B;  2KLV A;  1NU1 K;  4W7Z A;  2M8R A;  3RL0 B;  3G3Z A;  1FZC C;  1CI6 A;  5CJ4 A;  2XZR A;  2KOG A;  1J1E B;  5APT A;  4LLH A;  5AW9 B;  3CI9 A;  3H32 B;  1KFM A;  1NKZ B;  2BAS A;  1XTC C;  2FYU K;  2PP6 A;  3P7K A;  1N73 C;  3M91 A;  3L37 A;  2OYH C;  4N3Y B;  1KIL C;  1JCD A;  4JF7 A;  2YMY A;  2Z4E A;  1RF1 B;  1N86 A;  1NTM K;  3V5B A;  3SWF A;  2QM7 A;  5AVV B;  4WY4 C;  3A7O A;  1X9V A;  2M3B A;  2YNY A;  5CCG C;  3CLQ A;  4ZKP A;  5AW8 B;  5CCH D;  4IFM A;  4AUW A;  2A45 I;  2O01 H;  3GHG A;  1HVV A;  4Y99 B;  1SQP K;  2WTY A;  3VN0 A;  2Q9I A;  2IFM A;  2YKO A;  3V2Q A;  2HYN A;  2NPS D;  3RK2 D;  1IC2 A;  3BVH A;  4W80 A;  1NHL A;  1J2J B;  1JY3 P;  3RK2 C;  2OYI C;  1LT9 B;  1IFM A;  4N78 D;  2C9L Y;  1HJB A;  3M0D C;  1ZR4 A;  1IJD B;  3H32 A;  1CW5 A;  4C7R A;  1JY3 N;  3M06 A;  2YKQ A;  2C0X A;  1FZG A;  1DEB A;  3V2N A;  1JY2 P;  1LWU C;  1T8Z A;  3EQ2 A;  2I1K A;  1YYC A;  4JYC A;  1ZLL A;  3V4Q A;  3KPE A;  1JY2 N;  1JOC A;  1RF1 A;  2HLO A;  1MV8 A;  3NFQ A;  3NXS A;  5CHX A;  1LTA C;  3A2A A;  1J1D C;  2WWW A;  1N73 B;  2E43 A;  2OYH B;  1G1J A;  1G2C B;  1LTJ C;  3I5C A;  2HG5 D;  3M9H A;  1X8Y A;  1LTB C;  3MD0 A;  1M7L A;  3L4F A;  1T3U A;  1KQL A;  1YTZ I;  4N78 E;  1FZE A;  2Z5I A;  1JCC A;  2IPP A;  1FJK A;  1LT9 A;  1HTL C;  1RF0 A;  5AVW B;  4O9B A;  3VP9 A;  1A02 F;  4EOT A;  2WPS A;  3OAK A;  2XDJ A;  2GUS A;  2XV5 A;  1N7L A;  3MGN A;  1RE3 C;  2NPS B;  3LIE A;  3RK2 B;  2OYI B;  3P32 A;  2KSJ A;  3A5T A;  2N9B A;  4ZKU A;  1NOH A;  3U59 A;  1LGH B;  3P8M C;  1N73 A;  2C9N Y;  2OYH A;  4EIJ A;  4C46 A;  5CJ0 A;  1G2C A;  1LTG C;  5AVT B;  3N7N A;  2VRS A;  3C9I A;  1M1J C;  1FDM A;  2LKM A;  1J1D B;  1T3J A;  1WT6 A;  1L0L K;  2J58 A;  1LTJ B;  3N4X A;  5AVZ B;  1ZV8 A;  3A3Y B;  1KIL D;  5CCH A;  3V2R A;  3V2P A;  1IK9 A;  1IFD A;  1GU5 A;  4W7Y A;  3B8E B;  1X79 B;  1SFC D;  4WY4 D;  1FJP A;  2O1J A;  5CCG D;  1SFC C;  1MFZ A;  2JJL A;  2NPS A;  1NWQ A;  3VP8 A;  3B5N D;  2OYI A;  5APY A;  3L35 A;  1HUC A;  1Z56 A;  3NMD A;  4M3L A;  1NTK K;  3B5N C;  2FYZ A;  2N1T D;  1LTT C;  2IFN A;  5KJ7 D;  2N1T C;  1GL2 D;  3M9Q A;  4HH2 A;  5KJ7 C;  3VYI A;  3M0A A;  1GL2 C;  2A45 G;  1FZF A;  1SQQ K;  2FFD B;  4IFF A;  2CPS A;  5AVX B;  2WSE H;  3VMZ A;  2FKW B;  1NAF A;  1A02 J;  2O1K A;  1GU4 A;  4LC1 A;  3L36 A;  1GTW A;  4GKG A;  1HH0 A;  5BU5 A;  3MIW A;  5AW3 B;  3M9B A;  5APX A;  2KB7 P;  3P8C D;  1DX7 A;  1LTJ A;  2ZFC A;  3NTN A;  1KFN A;  1FZC B;  1IFI A;  1N7S D;  1SQV K;  3KQG A;  5AVU B;  5AW4 B;  2H43 A;  3MUD A;  3R2P A;  2HFE D;  1N7S C;  4WBA A;  2Q7C A;  3U1C A;  5APS A;  2GM4 A;  1AFO A;  2HOD B;  2W27 A;  2WT7 B;  1GW3 A;  3HUS C;  1SVF A;  1JTH B;  2YO2 A;  1FBM A;  3TNU A;  2W6B A;  4I2L C;  1SQB K;  3OJA B;  2PAJ A;  2CPB A;  1N2D C;  2J59 M;  1KIL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...