2CPSA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in sodium dodecyl sulphate micelles, 25 lowest energy structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M13 MAJOR COAT PROTEIN
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpsA00
1IFDA 1FDMA 2CPBA 2CPSA 1HGZA 1HGVA 1NH4A 1IFIA 2C0WA 1HH0A 2MJZA 1IFJA 2C0XA
chains in the Genus database with same CATH superfamily
3HD7A 2M3BA 1LTSC 4ASVA 2W6BA 5H2FE 3CWBD 1PFIA 1MZ9A 3VOPA 1FOSE 4JBZA 1IC2A 3PH0A 3E7KA 4GOEA 2XV5A 1WRGA 1FZBA 3RK3C 1LWUC 5KLVK 2JDIH 3AE1C 3VMXA 2FXOA 3H32B 2A45I 2O01N 1HGZA 1M1JA 2ZT9B 2YNYA 1KV4A 2E5YA 1ZV8A 1JTHA 2FYNC 3H1JE 4YPCA 3RL0C 5M1BA 3GHGA 2E42A 3MUDA 1KYOD 2Y9YA 3PJSK 3HD7C 3NMDA 1SQQD 1DD4A 3CC2P 1Q82Q 1M8OB 4M3LA 2G3AA 2K88A 1LNQA 2FBWC 1VF5B 3F89A 3WU2H 1SQBG 2O1KA 1EZVG 2FY8A 5AW7B 3TNUA 1VQOP 4GOFA 1H8AA 4IFMA 3HD7D 3IN6A 3P8CD 1M1JC 1SQQK 5APWA 3I55P 5APSA 4WWIA 1BCCJ 3WMM0 3GW6A 4U3FG 2VRSA 2FXPA 4PD4E 2LKMA 2WITA 2GUVA 3GHGC 3BRTB 1DEEG 2R5DA 3MUDC 2WSSH 1OVUA 3L75E 4Y28J 3W68A 1OMIA 3TGUG 3L70G 1PP9G 5AW3B 5CCGA 2KUBA 3P32A 2ZJSE 2JKVA 2PAJA 3L73G 4KJMA 5KJ7A 3RK3B 1LWUB 2XZRA 1LTTC 1JUNA 2J5UA 4Y99C 1J1EC 3R4YA 2P58A 2JWDA 3OJAB 1Y9BA 1SQBD 3BATA 1EZVD 1A02J 2XDJA 1EZVI 2WSFJ 4YTPC 1BGYG 4N78E 4BRYA 2MKVA 3RL0B 4YXWH 2OYIC 3H1KG 5B66H 3G6EP 1VQ9P 4N3YB 1YIJP 4I1LA 1YJWP 2QJPC 3O6QB 3HD7B 1VQMP 1MKMA 3CX5D 2E5TA 3H1HJ 5CCGC 1USDA 1SQBK 4U3FJ 3GLMA 4PV1D 1M56D 5CBNA 3CX5I 3CPWO 1SP4A 1YYCA 1VQ8P 1RF0C 2IFNA 3TGUD 1EXJA 3L70D 1PP9D 4ZKPA 1YBKA 1W2EA 1OW8A 2K37A 1QVFO 3TF5A 3TGUJ 2KI7B 2PGDA 1IFIA 2GUSA 2W6AA 1NHLA 1R5SA 2CPBA 3H1LJ 4I6MC 5CCGD 1AFOA 3TYYA 1M1JB 2LXBA 2B9BA 1JCCA 4U7JA 3L73J 1URQA 1RE4C 1JTHB 4RO0A 5KJ7D 1T8ZA 4D6TE 1S1CX 3U1AA 5APVA 4H0LC 1GMJA 3C9IA 1BGYD 1SQPE 5AW1B 3S9OA 3H1KD 4OH8B 1BGYJ 3RL0g 2I1KA 1GK4A 4XFJA 3CC4P 1SQXE 3H1KJ 2NPSD 3RK2D 1X9VA 1IFMA 2KLVA 2LR2A 1HF9A 2E74C 5CCHA 2XNXA 3CCUP 1OWAA 3TNUB 4UB8E 4Z1MH 3A0BH 2FFDA 4Y99B 3FGAD 1J1EB 3VP9A 1K04A 1OXZA 2O1JA 3U1CA 3AE6C 2A06E 2WSFH 5KAIH 1LTJC 1URQC 2Q6QA 3MZWB 2E74D 4DT0A 2OYIB 2V4HA 3AE4C 1QEXA 4L73A 2WZ7A 3L37A 1EDLA 1Q2NA 1FJKA 2QJPB 2KXPB 1FZCA 1RF1A 4MN4C 1KILA 2CK3H 3FWLA 1URQD 2P67A 1NTKJ 3H1IG 2K9JA 2YKQA 4OGQD 1DH3A 2XU6A 1HWTC 1NU1G 1HVVA 5CCHC 2Q9IA 1N7SA 3IR9A 2YMKA 4IFDK 2O3JA 2WPSA 1N86A 2ZYAA 1KB9H 3SWFA 2IBZI 1NGMB 1ZR2A 2IFMA 2H8PD 1YQ4C 2M0BA 4H44C 2KNCA 1NAYA 2IBZE 4HB1A 5CCHD 1A02F 4HYTB 4TLFA 3JCUH 1ZMEC 3L74J 4H0LB 1OIPA 2KB7P 1GU4A 2YMYA 1H88A 1N73C 1FZCC 1RF1C 4WBAA 3M9BA 2HODA 5K5GB 1RY3A 1USEA 3E1IA 1DX7A 5GTIE 4GODA 3USSA 2JEEA 1OW6A 1PPJG 2OYOA 2W8ZA 2FYUG 1LT9A 2M5AA 2ZXEB 2E74B 1L0NJ 1QX8A 3QH9A 3H1ID 3BCCE 1N7SC 1KILD 1LTBC 1NH4A 1FZFA 1NU1D 3NXSA 1LJ2A 2KP8A 3L71J 3V6IA 2R5BA 1HUCA 1JEKA 1LTJB 1URQB 1LTGC 1KILE 3D6YA 3HE5A 2OTLP 3G9RA 3GMAA 3S4RA 3CC7P 1IO4A 1NTZJ 1PGQA 1NVOA 5GTHH 3HTKA 2PP6A 2JO1A 2N1TC 5KAFE 1NU1K 2K1AA 4EDFA 2Y9ZA 2V7QJ 1SQVE 4ZKUA 2B87A 3L72J 5APQA 1PPJD 2GA1A 1PV3A 4C46A 3B71A 5AW6B 3H1JG 2FYUD 4UB6H 3Q3DA 1L0LJ 3A3YB 2C0WA 1KORA 2IZ1A 1YTZT 2CPSA 1ZRTD 2Z4EA 1EDIA 4C7RA 1FU1A 4W7ZA 2KS1A 4H44B 3A5TA 5AVUB 2OTKE 3PLNA 1FZEA 3EFGA 4XA4A 3WU2E 1FAVA 2FYUK 4ZMDA 1N73B 3MP7B 2KZIA 1FZCB 1RF1B 1GU5A 4WVZA 2WMMA 5APXA 1GW3A 5AVTB 2WPVB 1LP1A 5KLVJ 1DIPA 1N7LA 2K9JB 2IDBA 4NPDA 1M1KQ 2M3EA 3N4XA 2OYHA 3SFDC 4C7NB 4IOIH 5AVQB 2BEQD 3AEBC 5DJTB 1N7SB 3CWBJ 3BASA 1JB0J 3OW2O 1EC5A 1H0TA 1VQ7P 2PFXA 2BCCE 2KIKA 3L75G 1IK9A 1N2DC 3CLQA 3H1JD 1SLQA 3V5BA 4B86A 2P7JA 1G1IA 1IFPA 2K3RA 3H25A 2IX7C 2ZFCA 3Q5RA 3V2QA 3T97A 2RH0A 1YI2P 1Z56A 1KQLA 2DW3A 3VMAA 2N1TB 2HODB 1KN7A 2ZVOB 3SWYA 2HFED 3OA7A 1W2BO 1MFZA 2V7QH 3PRJA 3II6A 5APTA 5KLIC 2YO2A 2OYHC 3NTNA 1QLED 5CBOA 5APUA 1SQQJ 1HH0A 3AECC 2W83C 1KD1Q 2OARA 4IL6E 1FC2C 2H89C 3A2AA 5B66E 2Q7CA 1PIXA 1JCDA 5AW8B 2FYZA 1GTWA 4PD4D 1ZLLA 1FS0E 2N9YB 3C8VA 3HE5B 4PD4I 3D71A 3L75D 5AVZB 3CXHH 3G71P 1R5LA 1RH5B 1QL2A 2OTJP 1G1JA 1S72P 3HTKB 2W6JH 3CI9A 1P84H 5TJHA 1Q7YQ 1HGVA 3CCLP 4EYYQ 4TT3H 1JY3O 1BCCE 2ZYDA 1IJDB 1J2JB 4EOTA 2B88A 3L35A 4RKUJ 4JF7A 1WT6A 2WSCJ 1JO5A 3WUTA 4D6TG 1EDKA 2FKWB 2J58A 1NOHA 4WB4A 2A45H 4OVNF 4N78D 1SQPG 2KS1B 3M06A 1SQBJ 4PV1C 1D7MA 1SQXG 1Y8AA 3S1KA 2FYNB 2WWWA 3AEAC 1FE6A 2NPSA 4CPGA 1BE3E 1PL5A 1RQUA 2H43A 3AEGC 3A0BE 3TSIA 1LP1B 1KYOH 3Q5SA 5BU8B 1S4XA 2WVRA 5KLIB 1JMBA 3A7OA 3AE9C 2OYHB 1SFCA 2A06G 2QVAA 3M0AA 1MV8A 1FDMA 3IF4A 2Q3IA 5KJ7C 4DOJA 1E79H 3L70J 1PP9J 3KQGA 1K8AQ 2RMZA 4D6TD 2B89A 1PGJA 2E75C 2G8YA 2I1JA 1NTME 3N7NA 2YO3A 1SQPD 2YXRB 3T97B 2NPSC 3RK2C 1X8YA 2QSIA 3GHGB 5CHXA 3G4SP 3G3ZA 4K3AA 1SQXD 3L4FA 3H1LE 1KB9I 5CJ0A 2PRRA 2J59M 1CZQA 2E75D 2YXQB 2AXTE 2BASA 1KB9E 2WT7A 1KTMA 4JYCA 1N8RQ 3I5CA 3CMEP 2WSCH 1SQPK 2KSJA 2IBZG 2A06D 3AE3C 1U57A 3PHLA 2HG5D 1SQXK 4A7PA 2ZAEB 3D6ZA 1SFCD 3RGUA 2M8RA 2SPZA 4PV1B 2L91A 1GL2A 2QA4P 1U7JA 1MFTA 3TDKA 4OGQC 4IL6X 5AVVB 2ZXXA 1FBMA 4AUWA 3U59A 3BCCG 1JNMA 1X0TA 3ITKA 4L74A 3AE7C 4JQ0D 1NKZB 3B5NA 1BDDA 1EDJA 3CX5H 1FDOA 2I8DA 1AQ5A 1OZHA 1HJBA 2KK7A 2JR8A 4QMAA 1NYHA 3O8ZA 2FFDC 2KSEA 5TISE 1NKNA 1GDTA 2IBZD 2E75B 4GKGA 3FWNA 2ITAA 1NTKE 3TK1A 3OAKA 1S5LE 1VQ5P 1FZGA 1FJPA 1OVVA 3V2NA 3KXDA 3KZIE 1GL2C 1SQVG 2JJLA 1T2KD 1YQ3C 2NPSB 4BRYB 3BRVB 3RK2B 1S9KE 2WTYA 1IFNA 3H32A 1H89A 4UB6E 3Q5PA 3MD0A 3SSUA 1KILC 3VP8A 3B5NC 3VN0A 1W5CE 1GL2D 3BCCD 3L36A 4AQRD 3SFEC 4ASWA 1OX3A 2N9BA 2ZVNB 3L74E 1QL1A 2IPPA 2JWAA 3B5ND 3VYIA 1T6AA 3H1IJ 1S3JA 1NU1J 4NPEA 4OGQB 1ZR4A 1NJIQ 1L0NE 5AW5B 5EFWB 1PGOA 1WMKA 1ZP0C 4IFFA 1SQVD 1S2EA 1VPCA 1YITP 1E5WA 3L71E 3QWOC 1IZNB 2BCCG 2P2UA 1SQVJ 2IZ0A 3LIDA 4W80A 4LC1A 1TU3F 1LT9C 3CCQP 2P10A 1RHZB 1JY2P 5AW2B 4HJGH 2AEFA 1AQTA 4HH2A 2FFDB 1DD3A 2ZT9D 3I56P 1SQVK 1UIIA 3IFMA 1T3UA 2FYUJ 3C1LA 3HRNA 2HYNA 1KQGB 1GL2B 4H13C 1K73Q 3CCSP 1SVFA 4DZOA 2YIUC 3LIEA 3RBZA 2P1JA 2KOGA 5E79H 1L0LE 3ABVC 1BDCA 4PJ0H 5AVSB 1KILB 3B5NB 1ZXGA 1NAFA 2HR3A 3EFFK 4H13D 5AVRB 1VQ4P 2H88C 1Q86Q 4KT0J 5BVZA 2LXCB 2BCCD 5AVWB 1X79B 1AVYA 2BCCJ 3GG2A 1KMIZ 3CCRP 3KYQA 2HLOA 2IYOA 1VQNP 5KLVE 1P84E 1BSHA 1NO4A 2WSEJ 2XKMA 3AE2C 1HBWA 1BCCG 2KNCB 4WY4A 3Q2YA 3H1JJ 1LGHB 5C39A 2QJKC 5KAFH 1K05A 3CWBE 3B8EB 4R4LA 1GZLA 3M9QA 4BWNA 2OGUA 1R8EA 5B5EH 1GK6A 3P8MC 1YJNP 2Q5UA 1S5LX 3A0HH 1LT9B 3RK3D 3LW5J 2M5AB 1LTIC 1VQKP 1JY2N 3MTUE 4N6JA 2WPQA 2H7HA 1BE3G 3RK3E 1KYOI 2YKPA 3PP5A 1KYOE 1M7LA 3FX0A 1KZUB 3RL0D 4H13B 1SQQE 2WQYC 1AVOA 3HUSA 4WY4C 2Y0CA 2W90A 1IFDA 3VTPC 2YIUB 3KHUA 4OWFA 1CSBA 3L75J 1VDFA 1BCCD 1IK7A 1L4AA 1T3JA 5H2FH 3M91A 3H1HG 1ZN5A 1QVGO 3V4WA 3P8CE 4WY4D 3E1RA 1CW5A 2B87B 2OYIA 2RN0A 3Q1MA 3MIWA 2Y0DA 5AVYB 3CCMP 1NTMG 1OFCX 2D2CC 3FXDA 3M9HA 3NFQA 2O01J 1JY3P 1KQFB 2YKOA 1NWQA 4LLHA 3H1LG 2WSEH 3MHVA 1YHQP 4LGDE 1BE3D 1RF0A 3AE5C 3BVHA 4GIFA 3P7KA 3HUSC 2C9NY 1BE3J 2D2CD 2QJKB 4W7YA 2KZJA 3KDPB 1XTGB 3K5BA 2HPCA 4NPFX 1ZW0A 1L4AC 1U7MA 3HE4A 3H6PA 4JPZB 1VQLP 3V2PA 1RE4A 3VMYA 1PZQA 3LW5H 4IL6H 1QGKB 1SQBE 3AEEC 3EWKA 1EZVE 5KAIE 3H1HD 5CMZA 1FOSF 4U3FD 1L2PA 1L4AD 1H0TB 1MUUA 2E43A 1NTMD 3H1HE 4U3FE 1NTMJ 4PD4H 3CX5E 4WY4B 2ZYGA 1Y47A 1VL2A 3WUVA 3H1LD 1RE3A 4D6TJ 4GDOA 3TGUE 2W27A 3L70E 1PP9E 1KB9D 3L73D 3PTZA 1SQPJ 4KHXA 4DCKA 5AW0B 4I2LC 1NTMK 2IYPA 1FZAA 2QJYC 2L5GB 1LTJA 5AVXB 4I7ZC 2QM7A 1SQXJ 3GF3A 3L73E 1NTKG 3EQ2A 1SFCC 2MJZA 2RKLA 1FDIA 2O01H 2D2CB 4BXLA 1JY3N 2AEJA 3JCUE 2QG4A 3M0DA 3B4SA 3IAOA 2R32A 1BGYE 4L76A 1LT1A 3H1KE 1SS1A 3HUSB 4H0LD 2E76C 1RE3C 2BEZF 4AYCA 2QRXA 4R4MA 4JYBA 3L74G 2FXMA 2AEMA 2K9YA 1L4AB 3GF7A 1G2CA 2Z5HA 1Q90D 1LTAC 2XNDH 3KPEA 3UIAA 4EI2A 1KQSO 2NRGA 1JOCA 1HTLC 2E76D 2R3CA 5KKZC 1CI6A 1N73A 1L0NG 1T2KC 1Q81Q 1NTKD 3VMZA 1IFJA 3M0DC 5GTHE 5AW4B 4L75A 4RESB 3L71G 1S9KD 4C7NA 1AJYA 2KYVA 2Y0EA 1XTCC 3CL3D 2GM4A 1EXIA 2AXTH 2HPCB 1X22A 1NTZG 2Z5IA 1HJ0A 1NTKK 4O9BA 3HE4B 3V4QA 2QJYB 4I7ZB 2R3SA 3L74D 2C9LY 4XE5B 3SWKA 3FXEA 1SFCB 1J1DC 3R2PA 3L72G 4UB8H 2C0XA 2Q1KA 2R44A 1DEBA 2QM8A 5APYA 3BCCJ 2N1TA 1KC8Q 4K35A 4YXDC 5E79E 1L0LG 3JC22 4PJ0E 3V2RA 1EQ7A 4ZNCA 3RBXA 4H44D 3D70A 4HKZH 1L0ND 2NZ2A 1YTZI 1UIXA 3CCEP 2E76B 3WUUA 5DJUB 2UWJE 1PGPA 3MGNA 3L71D 1GD2E 3CD6P 3CCJP 5L8RJ 2OQQA 1YJ9P 3H1IE 2ZT9C 5KLVG 1L0NK 1KFMA 5BU5A 5KTBA 1NTZD 1NU1E 2WT7B 2AXCA 1N7SD 1BSNA 5KKZB 2QE7H 5TISH 1JM0A 5CJ4A 1NTZE 1ZOYC 1K9MQ 3CWBG 3F5HA 1VQPP 3L72D 1OVRA 1VQ6P 1S5LH 1JY2O 3JSVC 1M57D 2QEXP 3KZIH 4RJTA 5B5EE 2A45G 1KFNA 1NTZK 2WPRA 3AEFC 1L0LD 1JMMA 1AA0A 3L72E 3A0HE 1M90Q 2QIWA 2KLUA 1VF5C 2N1TD 1LWUA 5GTIH 1PPJE 1G2CB 4EIJA 2FYUE 4GT1A 1RQVA 3AEDC 3AE8C 3CXHD 4DJGA 1ZRTE 1GW4A 1J1DB 2Q3EA 1VF5D 3W67A 1OW7A 1L0LK 2JP3A 3CXHI 3CMAP 1SQQG 2POHA 3CCVP 1CI6B 3ZDMA 5KLVD 1P84D 3CXHE 1AV1A 1P84I 3O6QA 5AW9B
chains in the Genus database with same CATH topology
3HD7A 1JY3P 2M3BA 1SQPK 1LT9A 2KSJA 1LTSC 2W6BA 2ZXEB 2YKOA 1PFIA 1MZ9A 4LLHA 1NWQA 3VOPA 2WSEH 1FOSE 2HG5D 1IC2A 1SQXK 1N7SC 4LGDE 1RF0A 1KILD 2XV5A 1LTBC 1NH4A 1FZFA 3BVHA 1WRGA 1FZBA 3RK3C 1SFCD 4GIFA 3P7KA 1LWUC 3HUSC 5KLVK 2C9NY 3NXSA 2M8RA 2KP8A 4W7YA 3KDPB 1XTGB 3VMXA 2R5BA 1GL2A 3H32B 2A45I 1HGZA 1HUCA 1LTJB 1URQB 1LTGC 1M1JA 2HPCA 3HE5A 2YNYA 5AVVB 1FBMA 1L4AC 3HE4A 3H6PA 4AUWA 1ZV8A 1IO4A 3U59A 1JNMA 1JTHA 3V2PA 1RE4A 1NKZB 3VMYA 3LW5H 3RL0C 3HTKA 2PP6A 3B5NA 2N1TC 3GHGA 1NU1K 2E42A 3MUDA 1AQ5A 5CMZA 1FOSF 1HJBA 3HD7C 3NMDA 4ZKUA 1L4AD 5APQA 3O8ZA 1MUUA 4C46A 2E43A 5AW6B 2FFDC 4M3LA 1NKNA 1GDTA 2O1KA 3A3YB 2C0WA 4GKGA 4WY4B 1YTZT 2CPSA 5AW7B 3TK1A 2Z4EA 3TNUA 3OAKA 1FJPA 1RE3A 1FZGA 4C7RA 1FU1A 1H8AA 4IFMA 4W7ZA 3HD7D 3V2NA 3P8CD 1GL2C 2JJLA 1T2KD 2NPSB 2W27A 1M1JC 1SQQK 5APWA 3BRVB 3RK2B 3A5TA 4KHXA 5APSA 1S9KE 2WTYA 5AVUB 3WMM0 5AW0B 1FZEA 4I2LC 1IFNA 1NTMK 3H32A 1H89A 1FZAA 2VRSA 2L5GB 1LTJA 3EFGA 4XA4A 5AVXB 3MD0A 1FAVA 2QM7A 2FYUK 1N73B 2LKMA 2WITA 1KILC 1FZCB 1RF1B 3VP8A 3B5NC 1GU5A 2GUVA 3VN0A 3EQ2A 3GHGC 1SFCC 3BRTB 5APXA 1GW3A 5AVTB 2MJZA 2O01H 1GL2D 2R5DA 3L36A 1N7LA 4AQRD 5AW3B 1JY3N 3N4XA 5CCGA 2OYHA 2N9BA 1QL1A 4C7NB 2IPPA 3P32A 5AVQB 3M0DA 2R32A 1N7SB 2PAJA 3B5ND 3BASA 3VYIA 5KJ7A 3RK3B 1LWUB 2XZRA 3HUSB 1LTTC 1JUNA 1RE3C 1IK9A 1N2DC 4Y99C 4AYCA 3CLQA 1J1EC 3OJAB 1SLQA 3V5BA 1ZR4A 3BATA 4JYBA 2FXMA 4B86A 2P7JA 5AW5B 1G1IA 1L4AB 1A02J 1G2CA 2XDJA 2IX7C 2Z5HA 4IFFA 2ZFCA 1LTAC 3V2QA 3KPEA 3T97A 3UIAA 4N78E 3RL0B 1VPCA 1KQLA 1Z56A 1JOCA 2OYIC 2N1TB 1HTLC 2HODB 1E5WA 3SWYA 2P2UA 2HFED 4N3YB 3OA7A 2R3CA 4I1LA 3LIDA 1MFZA 4W80A 4LC1A 3HD7B 1CI6A 1LT9C 3II6A 1N73A 5APTA 1T2KC 2YO2A 5CCGC 2OYHC 1SQBK 3NTNA 1JY2P 5AW2B 5APUA 3VMZA 4HH2A 1HH0A 1IFJA 3M0DC 1SP4A 2OARA 2FFDB 1YYCA 1RF0C 5AW4B 2IFNA 4ZKPA 1SQVK 4RESB 3A2AA 3IFMA 2Q7CA 1W2EA 1T3UA 1S9KD 4C7NA 1JCDA 5AW8B 1IFIA 2FYZA 2KYVA 2HYNA 3HRNA 2GUSA 2W6AA 1XTCC 1NHLA 1GL2B 2CPBA 3CL3D 1GTWA 2GM4A 4I6MC 5CCGD 1AFOA 3TYYA 1M1JB 1ZLLA 2HPCB 3HE5B 2Z5IA 1SVFA 1JCCA 4DZOA 1NTKK 4O9BA 3HE4B 3V4QA 5AVZB 3LIEA 2P1JA 2KOGA 1URQA 1RE4C 1JTHB 1QL2A 5KJ7D 1T8ZA 1G1JA 5AVSB 1KILB 2C9LY 3HTKB 3B5NB 4XE5B 3U1AA 1NAFA 1SFCB 3CI9A 5APVA 1J1DC 3R2PA 5AVRB 3C9IA 2C0XA 1HGVA 5AW1B 1DEBA 2QM8A 5APYA 5BVZA 2N1TA 1JY3O 4OH8B 1IJDB 1J2JB 2I1KA 1GK4A 4EOTA 3L35A 3V2RA 1EQ7A 4JF7A 2NPSD 5AVWB 1X79B 1WT6A 1JO5A 1X9VA 3RK2D 1IFMA 1YTZI 2FKWB 3KYQA 2HLOA 2KLVA 2J58A 1NOHA 5CCHA 2XNXA 1NO4A 4WB4A 1OWAA 2A45H 3TNUB 2FFDA 4Y99B 4N78D 1J1EB 2XKMA 3VP9A 1HBWA 3MGNA 3M06A 4WY4A 1OXZA 1GD2E 2O1JA 1LGHB 3U1CA 3B8EB 2WSFH 2WWWA 1GZLA 3M9QA 1LTJC 1URQC 2NPSA 1L0NK 1KFMA 5BU5A 2H43A 5KTBA 2OYIB 2WT7B 1GK6A 3P8MC 3TSIA 2WZ7A 3L37A 1N7SD 2Q5UA 1FJKA 1FZCA 1RF1A 1LT9B 3RK3D 5BU8B 1KILA 3A7OA 5CJ4A 2OYHB 1SFCA 1LTIC 1JY2N 3MTUE 4N6JA 3M0AA 1URQD 2P67A 2WPQA 1JY2O 1MV8A 2H7HA 2YKQA 1FDMA 1DH3A 2Q3IA 2XU6A 1HWTC 5KJ7C 4DOJA 2A45G 1KFNA 1HVVA 1NTZK 5CCHC 2WPRA 3KQGA 2Q9IA 2YKPA 1JMMA 3PP5A 1N7SA 1M7LA 1KZUB 3IR9A 3RL0D 4IFDK 2N1TD 2WPSA 1LWUA 1N86A 3HUSA 4WY4C 1IFDA 3SWFA 3VTPC 1G2CB 2I1JA 3N7NA 1ZR2A 2YO3A 4EIJA 2IFMA 2H8PD 1CSBA 2NPSC 4GT1A 1VDFA 3RK2C 1X8YA 5CCHD 3GHGB 1A02F 1L4AA 1T3JA 4HYTB 5CHXA 3M91A 3G3ZA 1GW4A 1J1DB 3L4FA 5CJ0A 1L0LK 2J59M 1ZN5A 1CZQA 2KB7P 3V4WA 3P8CE 1GU4A 2YMYA 4WY4D 1H88A 1N73C 1CW5A 2POHA 1FZCC 1RF1C 4WBAA 1CI6B 2HODA 2BASA 3M9BA 2OYIA 1RY3A 2WT7A 3E1IA 4JYCA 1DX7A 3MIWA 2JEEA 5AVYB 3I5CA 5AW9B 3M9HA 3NFQA 2WSCH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFD A;  1FDM A;  2CPB A;  2CPS A;  1HGZ A;  1HGV A;  1NH4 A;  1IFI A;  2C0W A;  1HH0 A;  2MJZ A;  1IFJ A;  2C0X A; 
#chains in the Genus database with same CATH topology
 3HD7 A;  2M3B A;  1LTS C;  4ASV A;  2W6B A;  5H2F E;  3CWB D;  1PFI A;  1MZ9 A;  3VOP A;  1FOS E;  4JBZ A;  1IC2 A;  3PH0 A;  3E7K A;  4GOE A;  2XV5 A;  1WRG A;  1FZB A;  3RK3 C;  1LWU C;  5KLV K;  2JDI H;  3AE1 C;  3VMX A;  2FXO A;  3H32 B;  2A45 I;  2O01 N;  1HGZ A;  1M1J A;  2ZT9 B;  2YNY A;  1KV4 A;  2E5Y A;  1ZV8 A;  1JTH A;  2FYN C;  3H1J E;  4YPC A;  3RL0 C;  5M1B A;  3GHG A;  2E42 A;  3MUD A;  1KYO D;  2Y9Y A;  3PJS K;  3HD7 C;  3NMD A;  1SQQ D;  1DD4 A;  3CC2 P;  1Q82 Q;  1M8O B;  4M3L A;  2G3A A;  2K88 A;  1LNQ A;  2FBW C;  1VF5 B;  3F89 A;  3WU2 H;  1SQB G;  2O1K A;  1EZV G;  2FY8 A;  5AW7 B;  3TNU A;  1VQO P;  4GOF A;  1H8A A;  4IFM A;  3HD7 D;  3IN6 A;  3P8C D;  1M1J C;  1SQQ K;  5APW A;  3I55 P;  5APS A;  4WWI A;  1BCC J;  3WMM 0;  3GW6 A;  4U3F G;  2VRS A;  2FXP A;  4PD4 E;  2LKM A;  2WIT A;  2GUV A;  3GHG C;  3BRT B;  1DEE G;  2R5D A;  3MUD C;  2WSS H;  1OVU A;  3L75 E;  4Y28 J;  3W68 A;  1OMI A;  3TGU G;  3L70 G;  1PP9 G;  5AW3 B;  5CCG A;  2KUB A;  3P32 A;  2ZJS E;  2JKV A;  2PAJ A;  3L73 G;  4KJM A;  5KJ7 A;  3RK3 B;  1LWU B;  2XZR A;  1LTT C;  1JUN A;  2J5U A;  4Y99 C;  1J1E C;  3R4Y A;  2P58 A;  2JWD A;  3OJA B;  1Y9B A;  1SQB D;  3BAT A;  1EZV D;  1A02 J;  2XDJ A;  1EZV I;  2WSF J;  4YTP C;  1BGY G;  4N78 E;  4BRY A;  2MKV A;  3RL0 B;  4YXW H;  2OYI C;  3H1K G;  5B66 H;  3G6E P;  1VQ9 P;  4N3Y B;  1YIJ P;  4I1L A;  1YJW P;  2QJP C;  3O6Q B;  3HD7 B;  1VQM P;  1MKM A;  3CX5 D;  2E5T A;  3H1H J;  5CCG C;  1USD A;  1SQB K;  4U3F J;  3GLM A;  4PV1 D;  1M56 D;  5CBN A;  3CX5 I;  3CPW O;  1SP4 A;  1YYC A;  1VQ8 P;  1RF0 C;  2IFN A;  3TGU D;  1EXJ A;  3L70 D;  1PP9 D;  4ZKP A;  1YBK A;  1W2E A;  1OW8 A;  2K37 A;  1QVF O;  3TF5 A;  3TGU J;  2KI7 B;  2PGD A;  1IFI A;  2GUS A;  2W6A A;  1NHL A;  1R5S A;  2CPB A;  3H1L J;  4I6M C;  5CCG D;  1AFO A;  3TYY A;  1M1J B;  2LXB A;  2B9B A;  1JCC A;  4U7J A;  3L73 J;  1URQ A;  1RE4 C;  1JTH B;  4RO0 A;  5KJ7 D;  1T8Z A;  4D6T E;  1S1C X;  3U1A A;  5APV A;  4H0L C;  1GMJ A;  3C9I A;  1BGY D;  1SQP E;  5AW1 B;  3S9O A;  3H1K D;  4OH8 B;  1BGY J;  3RL0 g;  2I1K A;  1GK4 A;  4XFJ A;  3CC4 P;  1SQX E;  3H1K J;  2NPS D;  3RK2 D;  1X9V A;  1IFM A;  2KLV A;  2LR2 A;  1HF9 A;  2E74 C;  5CCH A;  2XNX A;  3CCU P;  1OWA A;  3TNU B;  4UB8 E;  4Z1M H;  3A0B H;  2FFD A;  4Y99 B;  3FGA D;  1J1E B;  3VP9 A;  1K04 A;  1OXZ A;  2O1J A;  3U1C A;  3AE6 C;  2A06 E;  2WSF H;  5KAI H;  1LTJ C;  1URQ C;  2Q6Q A;  3MZW B;  2E74 D;  4DT0 A;  2OYI B;  2V4H A;  3AE4 C;  1QEX A;  4L73 A;  2WZ7 A;  3L37 A;  1EDL A;  1Q2N A;  1FJK A;  2QJP B;  2KXP B;  1FZC A;  1RF1 A;  4MN4 C;  1KIL A;  2CK3 H;  3FWL A;  1URQ D;  2P67 A;  1NTK J;  3H1I G;  2K9J A;  2YKQ A;  4OGQ D;  1DH3 A;  2XU6 A;  1HWT C;  1NU1 G;  1HVV A;  5CCH C;  2Q9I A;  1N7S A;  3IR9 A;  2YMK A;  4IFD K;  2O3J A;  2WPS A;  1N86 A;  2ZYA A;  1KB9 H;  3SWF A;  2IBZ I;  1NGM B;  1ZR2 A;  2IFM A;  2H8P D;  1YQ4 C;  2M0B A;  4H44 C;  2KNC A;  1NAY A;  2IBZ E;  4HB1 A;  5CCH D;  1A02 F;  4HYT B;  4TLF A;  3JCU H;  1ZME C;  3L74 J;  4H0L B;  1OIP A;  2KB7 P;  1GU4 A;  2YMY A;  1H88 A;  1N73 C;  1FZC C;  1RF1 C;  4WBA A;  3M9B A;  2HOD A;  5K5G B;  1RY3 A;  1USE A;  3E1I A;  1DX7 A;  5GTI E;  4GOD A;  3USS A;  2JEE A;  1OW6 A;  1PPJ G;  2OYO A;  2W8Z A;  2FYU G;  1LT9 A;  2M5A A;  2ZXE B;  2E74 B;  1L0N J;  1QX8 A;  3QH9 A;  3H1I D;  3BCC E;  1N7S C;  1KIL D;  1LTB C;  1NH4 A;  1FZF A;  1NU1 D;  3NXS A;  1LJ2 A;  2KP8 A;  3L71 J;  3V6I A;  2R5B A;  1HUC A;  1JEK A;  1LTJ B;  1URQ B;  1LTG C;  1KIL E;  3D6Y A;  3HE5 A;  2OTL P;  3G9R A;  3GMA A;  3S4R A;  3CC7 P;  1IO4 A;  1NTZ J;  1PGQ A;  1NVO A;  5GTH H;  3HTK A;  2PP6 A;  2JO1 A;  2N1T C;  5KAF E;  1NU1 K;  2K1A A;  4EDF A;  2Y9Z A;  2V7Q J;  1SQV E;  4ZKU A;  2B87 A;  3L72 J;  5APQ A;  1PPJ D;  2GA1 A;  1PV3 A;  4C46 A;  3B71 A;  5AW6 B;  3H1J G;  2FYU D;  4UB6 H;  3Q3D A;  1L0L J;  3A3Y B;  2C0W A;  1KOR A;  2IZ1 A;  1YTZ T;  2CPS A;  1ZRT D;  2Z4E A;  1EDI A;  4C7R A;  1FU1 A;  4W7Z A;  2KS1 A;  4H44 B;  3A5T A;  5AVU B;  2OTK E;  3PLN A;  1FZE A;  3EFG A;  4XA4 A;  3WU2 E;  1FAV A;  2FYU K;  4ZMD A;  1N73 B;  3MP7 B;  2KZI A;  1FZC B;  1RF1 B;  1GU5 A;  4WVZ A;  2WMM A;  5APX A;  1GW3 A;  5AVT B;  2WPV B;  1LP1 A;  5KLV J;  1DIP A;  1N7L A;  2K9J B;  2IDB A;  4NPD A;  1M1K Q;  2M3E A;  3N4X A;  2OYH A;  3SFD C;  4C7N B;  4IOI H;  5AVQ B;  2BEQ D;  3AEB C;  5DJT B;  1N7S B;  3CWB J;  3BAS A;  1JB0 J;  3OW2 O;  1EC5 A;  1H0T A;  1VQ7 P;  2PFX A;  2BCC E;  2KIK A;  3L75 G;  1IK9 A;  1N2D C;  3CLQ A;  3H1J D;  1SLQ A;  3V5B A;  4B86 A;  2P7J A;  1G1I A;  1IFP A;  2K3R A;  3H25 A;  2IX7 C;  2ZFC A;  3Q5R A;  3V2Q A;  3T97 A;  2RH0 A;  1YI2 P;  1Z56 A;  1KQL A;  2DW3 A;  3VMA A;  2N1T B;  2HOD B;  1KN7 A;  2ZVO B;  3SWY A;  2HFE D;  3OA7 A;  1W2B O;  1MFZ A;  2V7Q H;  3PRJ A;  3II6 A;  5APT A;  5KLI C;  2YO2 A;  2OYH C;  3NTN A;  1QLE D;  5CBO A;  5APU A;  1SQQ J;  1HH0 A;  3AEC C;  2W83 C;  1KD1 Q;  2OAR A;  4IL6 E;  1FC2 C;  2H89 C;  3A2A A;  5B66 E;  2Q7C A;  1PIX A;  1JCD A;  5AW8 B;  2FYZ A;  1GTW A;  4PD4 D;  1ZLL A;  1FS0 E;  2N9Y B;  3C8V A;  3HE5 B;  4PD4 I;  3D71 A;  3L75 D;  5AVZ B;  3CXH H;  3G71 P;  1R5L A;  1RH5 B;  1QL2 A;  2OTJ P;  1G1J A;  1S72 P;  3HTK B;  2W6J H;  3CI9 A;  1P84 H;  5TJH A;  1Q7Y Q;  1HGV A;  3CCL P;  4EYY Q;  4TT3 H;  1JY3 O;  1BCC E;  2ZYD A;  1IJD B;  1J2J B;  4EOT A;  2B88 A;  3L35 A;  4RKU J;  4JF7 A;  1WT6 A;  2WSC J;  1JO5 A;  3WUT A;  4D6T G;  1EDK A;  2FKW B;  2J58 A;  1NOH A;  4WB4 A;  2A45 H;  4OVN F;  4N78 D;  1SQP G;  2KS1 B;  3M06 A;  1SQB J;  4PV1 C;  1D7M A;  1SQX G;  1Y8A A;  3S1K A;  2FYN B;  2WWW A;  3AEA C;  1FE6 A;  2NPS A;  4CPG A;  1BE3 E;  1PL5 A;  1RQU A;  2H43 A;  3AEG C;  3A0B E;  3TSI A;  1LP1 B;  1KYO H;  3Q5S A;  5BU8 B;  1S4X A;  2WVR A;  5KLI B;  1JMB A;  3A7O A;  3AE9 C;  2OYH B;  1SFC A;  2A06 G;  2QVA A;  3M0A A;  1MV8 A;  1FDM A;  3IF4 A;  2Q3I A;  5KJ7 C;  4DOJ A;  1E79 H;  3L70 J;  1PP9 J;  3KQG A;  1K8A Q;  2RMZ A;  4D6T D;  2B89 A;  1PGJ A;  2E75 C;  2G8Y A;  2I1J A;  1NTM E;  3N7N A;  2YO3 A;  1SQP D;  2YXR B;  3T97 B;  2NPS C;  3RK2 C;  1X8Y A;  2QSI A;  3GHG B;  5CHX A;  3G4S P;  3G3Z A;  4K3A A;  1SQX D;  3L4F A;  3H1L E;  1KB9 I;  5CJ0 A;  2PRR A;  2J59 M;  1CZQ A;  2E75 D;  2YXQ B;  2AXT E;  2BAS A;  1KB9 E;  2WT7 A;  1KTM A;  4JYC A;  1N8R Q;  3I5C A;  3CME P;  2WSC H;  1SQP K;  2KSJ A;  2IBZ G;  2A06 D;  3AE3 C;  1U57 A;  3PHL A;  2HG5 D;  1SQX K;  4A7P A;  2ZAE B;  3D6Z A;  1SFC D;  3RGU A;  2M8R A;  2SPZ A;  4PV1 B;  2L91 A;  1GL2 A;  2QA4 P;  1U7J A;  1MFT A;  3TDK A;  4OGQ C;  4IL6 X;  5AVV B;  2ZXX A;  1FBM A;  4AUW A;  3U59 A;  3BCC G;  1JNM A;  1X0T A;  3ITK A;  4L74 A;  3AE7 C;  4JQ0 D;  1NKZ B;  3B5N A;  1BDD A;  1EDJ A;  3CX5 H;  1FDO A;  2I8D A;  1AQ5 A;  1OZH A;  1HJB A;  2KK7 A;  2JR8 A;  4QMA A;  1NYH A;  3O8Z A;  2FFD C;  2KSE A;  5TIS E;  1NKN A;  1GDT A;  2IBZ D;  2E75 B;  4GKG A;  3FWN A;  2ITA A;  1NTK E;  3TK1 A;  3OAK A;  1S5L E;  1VQ5 P;  1FZG A;  1FJP A;  1OVV A;  3V2N A;  3KXD A;  3KZI E;  1GL2 C;  1SQV G;  2JJL A;  1T2K D;  1YQ3 C;  2NPS B;  4BRY B;  3BRV B;  3RK2 B;  1S9K E;  2WTY A;  1IFN A;  3H32 A;  1H89 A;  4UB6 E;  3Q5P A;  3MD0 A;  3SSU A;  1KIL C;  3VP8 A;  3B5N C;  3VN0 A;  1W5C E;  1GL2 D;  3BCC D;  3L36 A;  4AQR D;  3SFE C;  4ASW A;  1OX3 A;  2N9B A;  2ZVN B;  3L74 E;  1QL1 A;  2IPP A;  2JWA A;  3B5N D;  3VYI A;  1T6A A;  3H1I J;  1S3J A;  1NU1 J;  4NPE A;  4OGQ B;  1ZR4 A;  1NJI Q;  1L0N E;  5AW5 B;  5EFW B;  1PGO A;  1WMK A;  1ZP0 C;  4IFF A;  1SQV D;  1S2E A;  1VPC A;  1YIT P;  1E5W A;  3L71 E;  3QWO C;  1IZN B;  2BCC G;  2P2U A;  1SQV J;  2IZ0 A;  3LID A;  4W80 A;  4LC1 A;  1TU3 F;  1LT9 C;  3CCQ P;  2P10 A;  1RHZ B;  1JY2 P;  5AW2 B;  4HJG H;  2AEF A;  1AQT A;  4HH2 A;  2FFD B;  1DD3 A;  2ZT9 D;  3I56 P;  1SQV K;  1UII A;  3IFM A;  1T3U A;  2FYU J;  3C1L A;  3HRN A;  2HYN A;  1KQG B;  1GL2 B;  4H13 C;  1K73 Q;  3CCS P;  1SVF A;  4DZO A;  2YIU C;  3LIE A;  3RBZ A;  2P1J A;  2KOG A;  5E79 H;  1L0L E;  3ABV C;  1BDC A;  4PJ0 H;  5AVS B;  1KIL B;  3B5N B;  1ZXG A;  1NAF A;  2HR3 A;  3EFF K;  4H13 D;  5AVR B;  1VQ4 P;  2H88 C;  1Q86 Q;  4KT0 J;  5BVZ A;  2LXC B;  2BCC D;  5AVW B;  1X79 B;  1AVY A;  2BCC J;  3GG2 A;  1KMI Z;  3CCR P;  3KYQ A;  2HLO A;  2IYO A;  1VQN P;  5KLV E;  1P84 E;  1BSH A;  1NO4 A;  2WSE J;  2XKM A;  3AE2 C;  1HBW A;  1BCC G;  2KNC B;  4WY4 A;  3Q2Y A;  3H1J J;  1LGH B;  5C39 A;  2QJK C;  5KAF H;  1K05 A;  3CWB E;  3B8E B;  4R4L A;  1GZL A;  3M9Q A;  4BWN A;  2OGU A;  1R8E A;  5B5E H;  1GK6 A;  3P8M C;  1YJN P;  2Q5U A;  1S5L X;  3A0H H;  1LT9 B;  3RK3 D;  3LW5 J;  2M5A B;  1LTI C;  1VQK P;  1JY2 N;  3MTU E;  4N6J A;  2WPQ A;  2H7H A;  1BE3 G;  3RK3 E;  1KYO I;  2YKP A;  3PP5 A;  1KYO E;  1M7L A;  3FX0 A;  1KZU B;  3RL0 D;  4H13 B;  1SQQ E;  2WQY C;  1AVO A;  3HUS A;  4WY4 C;  2Y0C A;  2W90 A;  1IFD A;  3VTP C;  2YIU B;  3KHU A;  4OWF A;  1CSB A;  3L75 J;  1VDF A;  1BCC D;  1IK7 A;  1L4A A;  1T3J A;  5H2F H;  3M91 A;  3H1H G;  1ZN5 A;  1QVG O;  3V4W A;  3P8C E;  4WY4 D;  3E1R A;  1CW5 A;  2B87 B;  2OYI A;  2RN0 A;  3Q1M A;  3MIW A;  2Y0D A;  5AVY B;  3CCM P;  1NTM G;  1OFC X;  2D2C C;  3FXD A;  3M9H A;  3NFQ A;  2O01 J;  1JY3 P;  1KQF B;  2YKO A;  1NWQ A;  4LLH A;  3H1L G;  2WSE H;  3MHV A;  1YHQ P;  4LGD E;  1BE3 D;  1RF0 A;  3AE5 C;  3BVH A;  4GIF A;  3P7K A;  3HUS C;  2C9N Y;  1BE3 J;  2D2C D;  2QJK B;  4W7Y A;  2KZJ A;  3KDP B;  1XTG B;  3K5B A;  2HPC A;  4NPF X;  1ZW0 A;  1L4A C;  1U7M A;  3HE4 A;  3H6P A;  4JPZ B;  1VQL P;  3V2P A;  1RE4 A;  3VMY A;  1PZQ A;  3LW5 H;  4IL6 H;  1QGK B;  1SQB E;  3AEE C;  3EWK A;  1EZV E;  5KAI E;  3H1H D;  5CMZ A;  1FOS F;  4U3F D;  1L2P A;  1L4A D;  1H0T B;  1MUU A;  2E43 A;  1NTM D;  3H1H E;  4U3F E;  1NTM J;  4PD4 H;  3CX5 E;  4WY4 B;  2ZYG A;  1Y47 A;  1VL2 A;  3WUV A;  3H1L D;  1RE3 A;  4D6T J;  4GDO A;  3TGU E;  2W27 A;  3L70 E;  1PP9 E;  1KB9 D;  3L73 D;  3PTZ A;  1SQP J;  4KHX A;  4DCK A;  5AW0 B;  4I2L C;  1NTM K;  2IYP A;  1FZA A;  2QJY C;  2L5G B;  1LTJ A;  5AVX B;  4I7Z C;  2QM7 A;  1SQX J;  3GF3 A;  3L73 E;  1NTK G;  3EQ2 A;  1SFC C;  2MJZ A;  2RKL A;  1FDI A;  2O01 H;  2D2C B;  4BXL A;  1JY3 N;  2AEJ A;  3JCU E;  2QG4 A;  3M0D A;  3B4S A;  3IAO A;  2R32 A;  1BGY E;  4L76 A;  1LT1 A;  3H1K E;  1SS1 A;  3HUS B;  4H0L D;  2E76 C;  1RE3 C;  2BEZ F;  4AYC A;  2QRX A;  4R4M A;  4JYB A;  3L74 G;  2FXM A;  2AEM A;  2K9Y A;  1L4A B;  3GF7 A;  1G2C A;  2Z5H A;  1Q90 D;  1LTA C;  2XND H;  3KPE A;  3UIA A;  4EI2 A;  1KQS O;  2NRG A;  1JOC A;  1HTL C;  2E76 D;  2R3C A;  5KKZ C;  1CI6 A;  1N73 A;  1L0N G;  1T2K C;  1Q81 Q;  1NTK D;  3VMZ A;  1IFJ A;  3M0D C;  5GTH E;  5AW4 B;  4L75 A;  4RES B;  3L71 G;  1S9K D;  4C7N A;  1AJY A;  2KYV A;  2Y0E A;  1XTC C;  3CL3 D;  2GM4 A;  1EXI A;  2AXT H;  2HPC B;  1X22 A;  1NTZ G;  2Z5I A;  1HJ0 A;  1NTK K;  4O9B A;  3HE4 B;  3V4Q A;  2QJY B;  4I7Z B;  2R3S A;  3L74 D;  2C9L Y;  4XE5 B;  3SWK A;  3FXE A;  1SFC B;  1J1D C;  3R2P A;  3L72 G;  4UB8 H;  2C0X A;  2Q1K A;  2R44 A;  1DEB A;  2QM8 A;  5APY A;  3BCC J;  2N1T A;  1KC8 Q;  4K35 A;  4YXD C;  5E79 E;  1L0L G;  3JC2 2;  4PJ0 E;  3V2R A;  1EQ7 A;  4ZNC A;  3RBX A;  4H44 D;  3D70 A;  4HKZ H;  1L0N D;  2NZ2 A;  1YTZ I;  1UIX A;  3CCE P;  2E76 B;  3WUU A;  5DJU B;  2UWJ E;  1PGP A;  3MGN A;  3L71 D;  1GD2 E;  3CD6 P;  3CCJ P;  5L8R J;  2OQQ A;  1YJ9 P;  3H1I E;  2ZT9 C;  5KLV G;  1L0N K;  1KFM A;  5BU5 A;  5KTB A;  1NTZ D;  1NU1 E;  2WT7 B;  2AXC A;  1N7S D;  1BSN A;  5KKZ B;  2QE7 H;  5TIS H;  1JM0 A;  5CJ4 A;  1NTZ E;  1ZOY C;  1K9M Q;  3CWB G;  3F5H A;  1VQP P;  3L72 D;  1OVR A;  1VQ6 P;  1S5L H;  1JY2 O;  3JSV C;  1M57 D;  2QEX P;  3KZI H;  4RJT A;  5B5E E;  2A45 G;  1KFN A;  1NTZ K;  2WPR A;  3AEF C;  1L0L D;  1JMM A;  1AA0 A;  3L72 E;  3A0H E;  1M90 Q;  2QIW A;  2KLU A;  1VF5 C;  2N1T D;  1LWU A;  5GTI H;  1PPJ E;  1G2C B;  4EIJ A;  2FYU E;  4GT1 A;  1RQV A;  3AED C;  3AE8 C;  3CXH D;  4DJG A;  1ZRT E;  1GW4 A;  1J1D B;  2Q3E A;  1VF5 D;  3W67 A;  1OW7 A;  1L0L K;  2JP3 A;  3CXH I;  3CMA P;  1SQQ G;  2POH A;  3CCV P;  1CI6 B;  3ZDM A;  5KLV D;  1P84 D;  3CXH E;  1AV1 A;  1P84 I;  3O6Q A;  5AW9 B; 
#chains in the Genus database with same CATH homology
 3HD7 A;  1JY3 P;  2M3B A;  1SQP K;  1LT9 A;  2KSJ A;  1LTS C;  2W6B A;  2ZXE B;  2YKO A;  1PFI A;  1MZ9 A;  4LLH A;  1NWQ A;  3VOP A;  2WSE H;  1FOS E;  2HG5 D;  1IC2 A;  1SQX K;  1N7S C;  4LGD E;  1RF0 A;  1KIL D;  2XV5 A;  1LTB C;  1NH4 A;  1FZF A;  3BVH A;  1WRG A;  1FZB A;  3RK3 C;  1SFC D;  4GIF A;  3P7K A;  1LWU C;  3HUS C;  5KLV K;  2C9N Y;  3NXS A;  2M8R A;  2KP8 A;  4W7Y A;  3KDP B;  1XTG B;  3VMX A;  2R5B A;  1GL2 A;  3H32 B;  2A45 I;  1HGZ A;  1HUC A;  1LTJ B;  1URQ B;  1LTG C;  1M1J A;  2HPC A;  3HE5 A;  2YNY A;  5AVV B;  1FBM A;  1L4A C;  3HE4 A;  3H6P A;  4AUW A;  1ZV8 A;  1IO4 A;  3U59 A;  1JNM A;  1JTH A;  3V2P A;  1RE4 A;  1NKZ B;  3VMY A;  3LW5 H;  3RL0 C;  3HTK A;  2PP6 A;  3B5N A;  2N1T C;  3GHG A;  1NU1 K;  2E42 A;  3MUD A;  1AQ5 A;  5CMZ A;  1FOS F;  1HJB A;  3HD7 C;  3NMD A;  4ZKU A;  1L4A D;  5APQ A;  3O8Z A;  1MUU A;  4C46 A;  2E43 A;  5AW6 B;  2FFD C;  4M3L A;  1NKN A;  1GDT A;  2O1K A;  3A3Y B;  2C0W A;  4GKG A;  4WY4 B;  1YTZ T;  2CPS A;  5AW7 B;  3TK1 A;  2Z4E A;  3TNU A;  3OAK A;  1FJP A;  1RE3 A;  1FZG A;  4C7R A;  1FU1 A;  1H8A A;  4IFM A;  4W7Z A;  3HD7 D;  3V2N A;  3P8C D;  1GL2 C;  2JJL A;  1T2K D;  2NPS B;  2W27 A;  1M1J C;  1SQQ K;  5APW A;  3BRV B;  3RK2 B;  3A5T A;  4KHX A;  5APS A;  1S9K E;  2WTY A;  5AVU B;  3WMM 0;  5AW0 B;  1FZE A;  4I2L C;  1IFN A;  1NTM K;  3H32 A;  1H89 A;  1FZA A;  2VRS A;  2L5G B;  1LTJ A;  3EFG A;  4XA4 A;  5AVX B;  3MD0 A;  1FAV A;  2QM7 A;  2FYU K;  1N73 B;  2LKM A;  2WIT A;  1KIL C;  1FZC B;  1RF1 B;  3VP8 A;  3B5N C;  1GU5 A;  2GUV A;  3VN0 A;  3EQ2 A;  3GHG C;  1SFC C;  3BRT B;  5APX A;  1GW3 A;  5AVT B;  2MJZ A;  2O01 H;  1GL2 D;  2R5D A;  3L36 A;  1N7L A;  4AQR D;  5AW3 B;  1JY3 N;  3N4X A;  5CCG A;  2OYH A;  2N9B A;  1QL1 A;  4C7N B;  2IPP A;  3P32 A;  5AVQ B;  3M0D A;  2R32 A;  1N7S B;  2PAJ A;  3B5N D;  3BAS A;  3VYI A;  5KJ7 A;  3RK3 B;  1LWU B;  2XZR A;  3HUS B;  1LTT C;  1JUN A;  1RE3 C;  1IK9 A;  1N2D C;  4Y99 C;  4AYC A;  3CLQ A;  1J1E C;  3OJA B;  1SLQ A;  3V5B A;  1ZR4 A;  3BAT A;  4JYB A;  2FXM A;  4B86 A;  2P7J A;  5AW5 B;  1G1I A;  1L4A B;  1A02 J;  1G2C A;  2XDJ A;  2IX7 C;  2Z5H A;  4IFF A;  2ZFC A;  1LTA C;  3V2Q A;  3KPE A;  3T97 A;  3UIA A;  4N78 E;  3RL0 B;  1VPC A;  1KQL A;  1Z56 A;  1JOC A;  2OYI C;  2N1T B;  1HTL C;  2HOD B;  1E5W A;  3SWY A;  2P2U A;  2HFE D;  4N3Y B;  3OA7 A;  2R3C A;  4I1L A;  3LID A;  1MFZ A;  4W80 A;  4LC1 A;  3HD7 B;  1CI6 A;  1LT9 C;  3II6 A;  1N73 A;  5APT A;  1T2K C;  2YO2 A;  5CCG C;  2OYH C;  1SQB K;  3NTN A;  1JY2 P;  5AW2 B;  5APU A;  3VMZ A;  4HH2 A;  1HH0 A;  1IFJ A;  3M0D C;  1SP4 A;  2OAR A;  2FFD B;  1YYC A;  1RF0 C;  5AW4 B;  2IFN A;  4ZKP A;  1SQV K;  4RES B;  3A2A A;  3IFM A;  2Q7C A;  1W2E A;  1T3U A;  1S9K D;  4C7N A;  1JCD A;  5AW8 B;  1IFI A;  2FYZ A;  2KYV A;  2HYN A;  3HRN A;  2GUS A;  2W6A A;  1XTC C;  1NHL A;  1GL2 B;  2CPB A;  3CL3 D;  1GTW A;  2GM4 A;  4I6M C;  5CCG D;  1AFO A;  3TYY A;  1M1J B;  1ZLL A;  2HPC B;  3HE5 B;  2Z5I A;  1SVF A;  1JCC A;  4DZO A;  1NTK K;  4O9B A;  3HE4 B;  3V4Q A;  5AVZ B;  3LIE A;  2P1J A;  2KOG A;  1URQ A;  1RE4 C;  1JTH B;  1QL2 A;  5KJ7 D;  1T8Z A;  1G1J A;  5AVS B;  1KIL B;  2C9L Y;  3HTK B;  3B5N B;  4XE5 B;  3U1A A;  1NAF A;  1SFC B;  3CI9 A;  5APV A;  1J1D C;  3R2P A;  5AVR B;  3C9I A;  2C0X A;  1HGV A;  5AW1 B;  1DEB A;  2QM8 A;  5APY A;  5BVZ A;  2N1T A;  1JY3 O;  4OH8 B;  1IJD B;  1J2J B;  2I1K A;  1GK4 A;  4EOT A;  3L35 A;  3V2R A;  1EQ7 A;  4JF7 A;  2NPS D;  5AVW B;  1X79 B;  1WT6 A;  1JO5 A;  1X9V A;  3RK2 D;  1IFM A;  1YTZ I;  2FKW B;  3KYQ A;  2HLO A;  2KLV A;  2J58 A;  1NOH A;  5CCH A;  2XNX A;  1NO4 A;  4WB4 A;  1OWA A;  2A45 H;  3TNU B;  2FFD A;  4Y99 B;  4N78 D;  1J1E B;  2XKM A;  3VP9 A;  1HBW A;  3MGN A;  3M06 A;  4WY4 A;  1OXZ A;  1GD2 E;  2O1J A;  1LGH B;  3U1C A;  3B8E B;  2WSF H;  2WWW A;  1GZL A;  3M9Q A;  1LTJ C;  1URQ C;  2NPS A;  1L0N K;  1KFM A;  5BU5 A;  2H43 A;  5KTB A;  2OYI B;  2WT7 B;  1GK6 A;  3P8M C;  3TSI A;  2WZ7 A;  3L37 A;  1N7S D;  2Q5U A;  1FJK A;  1FZC A;  1RF1 A;  1LT9 B;  3RK3 D;  5BU8 B;  1KIL A;  3A7O A;  5CJ4 A;  2OYH B;  1SFC A;  1LTI C;  1JY2 N;  3MTU E;  4N6J A;  3M0A A;  1URQ D;  2P67 A;  2WPQ A;  1JY2 O;  1MV8 A;  2H7H A;  2YKQ A;  1FDM A;  1DH3 A;  2Q3I A;  2XU6 A;  1HWT C;  5KJ7 C;  4DOJ A;  2A45 G;  1KFN A;  1HVV A;  1NTZ K;  5CCH C;  2WPR A;  3KQG A;  2Q9I A;  2YKP A;  1JMM A;  3PP5 A;  1N7S A;  1M7L A;  1KZU B;  3IR9 A;  3RL0 D;  4IFD K;  2N1T D;  2WPS A;  1LWU A;  1N86 A;  3HUS A;  4WY4 C;  1IFD A;  3SWF A;  3VTP C;  1G2C B;  2I1J A;  3N7N A;  1ZR2 A;  2YO3 A;  4EIJ A;  2IFM A;  2H8P D;  1CSB A;  2NPS C;  4GT1 A;  1VDF A;  3RK2 C;  1X8Y A;  5CCH D;  3GHG B;  1A02 F;  1L4A A;  1T3J A;  4HYT B;  5CHX A;  3M91 A;  3G3Z A;  1GW4 A;  1J1D B;  3L4F A;  5CJ0 A;  1L0L K;  2J59 M;  1ZN5 A;  1CZQ A;  2KB7 P;  3V4W A;  3P8C E;  1GU4 A;  2YMY A;  4WY4 D;  1H88 A;  1N73 C;  1CW5 A;  2POH A;  1FZC C;  1RF1 C;  4WBA A;  1CI6 B;  2HOD A;  2BAS A;  3M9B A;  2OYI A;  1RY3 A;  2WT7 A;  3E1I A;  4JYC A;  1DX7 A;  3MIW A;  2JEE A;  5AVY B;  3I5C A;  5AW9 B;  3M9H A;  3NFQ A;  2WSC H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...