2CPSA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in sodium dodecyl sulphate micelles, 25 lowest energy structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords M13 MAJOR COAT PROTEIN
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpsA00
1HGZA 2C0XA 1HH0A 1IFDA 2C0WA 1NH4A 1HGVA 1IFIA 2CPBA 1IFJA 2CPSA 2MJZA 1FDMA
chains in the Genus database with same CATH superfamily
1L0NG 5CBOA 2FYZA 4K3AA 2FYUD 3L74G 1IFNA 2FXPA 4R4LA 4H44D 3LW5J 2A45H 1LWUC 1HTLC 1YTZI 2QM8A 5AW6B 1URQA 2A06D 3JC22 3P8CE 3L73E 3Q5PA 2C0WA 1OW8A 2Y0DA 1EDIA 1KQGB 1OWAA 1PPJD 2OYIC 3M0DA 1JUNA 1YIJP 4EYYQ 2FFDC 4N78D 4PD4H 4NPDA 1SS1A 1KILB 1YJWP 3AEFC 3RL0B 1NTZK 2MJZA 3L70D 2J5UA 2G3AA 2QJKB 1NU1J 3CX5E 2XZRA 2ZYDA 3OAKA 5CCGA 2PP6A 1KC8Q 4YTPC 2E75D 1Q86Q 1SQXK 5KKZC 5DJUB 2DW3A 3HD7B 2OTKE 2QG4A 1S9KD 3CC7P 1L4AD 2QJPC 3IFMA 3KXDA 1N7SC 2XDJA 4OGQB 1M8OB 2Y0CA 1S3JA 3U1CA 3MD0A 1FZCB 4D6TG 3CXHI 5AVZB 4ZKUA 4ZKPA 2ZYAA 1SQVG 1IZNB 2ZYGA 3IN6A 1PGOA 1EZVE 1RF1B 1NTZE 1YI2P 2CPSA 3FGAD 2IZ1A 4HH2A 1EXJA 1ZMEC 2JR8A 2ZAEB 4PD4E 1MZ9A 3RK2C 1N7LA 1GL2A 3EFGA 1KYOD 1OW6A 1URQB 1RF0A 2KB7P 1KILE 5TISH 1IFDA 4BWNA 4U3FE 1OXZA 4XFJA 1FZGA 4XE5B 3H1HG 1DEEG 2HFED 2LXCB 4WVZA 4GKGA 1JY3P 3D6YA 5APWA 3H1LJ 1KB9I 2WPVB 1L0NE 3VP9A 1J1DB 5AVSB 5KLVG 3CXHH 3R4YA 1IFPA 3TNUA 1RQUA 5AW3B 1NH4A 3P8CD 3L73D 2JKVA 2K88A 1X0TA 3U1AA 1W2EA 1PFIA 3PH0A 1KILC 5APVA 4U7JA 1SQBJ 3L71E 3KDPB 3RL0C 1HJBA 1PP9E 1IO4A 5AW2B 1FOSE 1S72P 2QJKC 1PGQA 5GTIH 3KPEA 4HB1A 1HWTC 1R8EA 5CCHD 3CX5D 1W5CE 3L75G 1Y8AA 1KB9H 1T2KC 2FBWC 1BE3G 1L0LE 5H2FH 1A02J 3C8VA 3CI9A 3HD7C 1LTSC 1QVFO 1H88A 3S4RA 1MUUA 2JO1A 2FYUG 1GL2B 2IX7C 4OGQC 2FXMA 3CXHE 2A06G 3FXEA 2R3CA 4UB8E 1LNQA 4MN4C 4L73A 1RF1C 1PPJG 2CPBA 4H13B 1NVOA 4IL6H 2E43A 1T8ZA 4WY4A 1BSHA 5CJ0A 2H43A 2ZVNB 2D2CD 2WMMA 3H1KJ 1NTZD 2N9BA 1VQMP 5KJ7D 3L72J 2LR2A 2M0BA 1SQQJ 3MUDC 1URQC 3L70G 3TNUB 4PV1D 2QVAA 1SQPG 4PD4D 2L91A 2K1AA 5GTIE 3M0DC 3Q1MA 1VQ5P 4BRYA 1SQXD 1JNMA 2JEEA 2WWWA 4I7ZB 4U3FD 3H1JE 2XKMA 2V7QJ 1KB9E 1FOSF 5H2FE 1J1DC 2FKWB 1VQPP 4L75A 3RL0g 4DT0A 1GU4A 3HTKB 5CCGC 3BCCD 1X9VA 4ZMDA 2E42A 4OWFA 2IBZI 3FWLA 2YO3A 1NU1K 3TGUE 1L0NJ 4IOIH 1JMMA 3L74J 2K9JA 1FJKA 3CCEP 2OYOA 1GD2E 4BXLA 1ZR4A 3CMAP 3L71D 3EFFK 4N3YB 2WSFJ 2BCCG 1AQTA 2Q5UA 2HPCA 2LKMA 3KZIH 2ZFCA 4RO0A 2BEZF 1JY2N 4OVNF 2W6AA 3AE2C 4WY4B 3FX0A 1S5LH 4N6JA 1GL2C 4Y28J 3CL3D 2SPZA 2YKQA 3M91A 2Q6QA 3AEDC 1LTAC 2HLOA 1GW4A 2E5YA 2POHA 2O01J 1NU1E 2P58A 1L0LJ 2Z5IA 4H13C 5BU8B 4L74A 2NPSB 5APTA 1OMIA 4C7RA 2N1TD 1QL1A 2YMYA 2G8YA 5AW9B 1JEKA 2FXOA 2FYNB 4D6TJ 4DZOA 2HYNA 1LTJA 3P32A 3I56P 1NTME 1K04A 1SQVJ 2JWDA 1GK6A 1GW3A 3I5CA 1JOCA 3KZIE 2P1JA 4I7ZC 3A5TA 1YJ9P 2WITA 3G3ZA 2WSSH 1VQ6P 1DX7A 1VQNP 2R5BA 1JTHB 4WBAA 2K9JB 3AE4C 1LP1B 1MKMA 3H1JD 1NAYA 1S5LE 1L2PA 1BSNA 2E74D 2IYOA 3B5NC 4IL6X 1VQ7P 1IK7A 1BCCD 2MKVA 5AW4B 2HPCB 3NTNA 3VP8A 1RH5B 5CMZA 1W2BO 1P84I 2M3BA 3AE6C 1SQBK 1VF5B 3H1HJ 2KLVA 2IBZE 2KS1A 3F89A 1EDLA 1QL2A 3CC2P 3S1KA 4H0LB 3S9OA 5KLVJ 3D6ZA 4W7ZA 1FZEA 3H1LE 1T3JA 2ZT9D 3HUSA 1NTKG 4NPEA 3CCUP 1UIXA 1SQXG 5KAFH 4WY4C 1MFZA 2WT7B 3CWBD 4I6MC 3B4SA 3Q5SA 1QX8A 2YNYA 1OW7A 3TDKA 3H32B 2Q3EA 1P84H 1SQBE 2O01N 4EOTA 1RE4A 1FZAA 3BCCG 3M0AA 1K73Q 3H1ID 1S1CX 3WUUA 3VMXA 3L75J 1SQQK 4JBZA 1KQSO 1NU1D 2NPSC 2NZ2A 2V7QH 4XA4A 3B5ND 1QVGO 4C7NB 2YIUB 2FYUJ 1CI6A 3B8EB 3NXSA 1CSBA 2IPPA 4Y99B 1SFCA 1S5LX 3MP7B 3KHUA 2KS1B 2E5TA 3SWFA 1FBMA 2KZJA 3Q5RA 4L76A 2HODA 1UIIA 1BDCA 1KD1Q 1HJ0A 5KAFE 1NOHA 1SP4A 1KZUB 1OZHA 1M1KQ 2CK3H 3USSA 3T97A 3TF5A 4JQ0D 2E76B 3H1KE 3GMAA 3L72E 1SQPJ 3ABVC 1NTMJ 2WSFH 3LIEA 1P84E 1SQQE 3HUSB 1L0NK 2PRRA 2B87B 3B71A 1VF5C 5APQA 4C46A 2QM7A 1JO5A 3BRTB 4RJTA 3MGNA 1GK4A 2PFXA 2PAJA 1DH3A 2K9YA 3CCQP 4H0LC 4JYCA 3CCVP 2M5AA 1YQ3C 2O01H 2I8DA 3AEEC 1X8YA 1BGYD 1NTKE 3GF3A 1A02F 1S4XA 4I1LA 3N7NA 5CHXA 1CI6B 1PL5A 3A2AA 2IFNA 2OYHA 1L0LK 1U7MA 1Q90D 3L74E 3CC4P 2RH0A 1IFJA 1SFCB 4UB8H 2BCCJ 1LJ2A 2AEJA 1BCCG 3F5HA 2IYPA 2XNXA 1NO4A 5BVZA 4QMAA 2ZXXA 3T97B 1N7SD 2YIUC 1LTBC 3VMAA 1EC5A 3VYIA 1SQVK 1ZR2A 1OVUA 2K37A 3M9QA 1Q82Q 4Y99C 1Y9BA 1R5SA 2H88C 3V6IA 2I1KA 2BEQD 1JB0J 3GF7A 3K5BA 2LXBA 2W90A 1FS0E 4EIJA 4JPZB 1NYHA 3RK2D 2WVRA 3CWBG 2Z4EA 2WPSA 2KOGA 5AW1B 1T3UA 2OARA 4PJ0E 2E76C 1RE3A 2M5AB 3AEAC 4LLHA 5B5EH 3BRVB 1USEA 3O8ZA 1RHZB 2KNCA 1D7MA 3HUSC 1FZCC 1NAFA 2JWAA 2W27A 4TLFA 1DIPA 1YJNP 3H1KD 5M1BA 2W6BA 4D6TE 3H1IG 1P84D 5KLVK 1SQVE 1EZVD 2VRSA 2OYHB 2J58A 1JY2O 1U57A 1L4AA 1IJDB 1N73A 3VMYA 4EI2A 1AVYA 3VN0A 1VQKP 2QRXA 3V2RA 3E1RA 3IF4A 2OTLP 3IR9A 1KILD 2KK7A 3RL0D 3H1HE 1ZP0C 1FC2C 1J2JB 1G1IA 1OVVA 1JCDA 4H44B 2YXRB 1ZRTE 1IFIA 1KN7A 1H0TA 1GTWA 1SFCC 2O3JA 4YXWH 2OYIA 5KLVE 3NMDA 2XU6A 3R2PA 1L0ND 3V5BA 1T6AA 2W83C 1T2KD 5B5EE 3V2QA 2L5GB 1NTKJ 3C1LA 3HD7D 2FYUK 2WSCJ 1AVOA 1SQXJ 1AQ5A 3GLMA 1JCCA 2KSEA 4OGQD 4W7YA 2H89C 1YITP 2WSEH 1HGZA 1VQ4P 2KNCB 1OVRA 2M3EA 1PP9D 3BCCJ 3TSIA 2PGDA 2E75B 2GUSA 1IFMA 2R5DA 1N2DC 2KI7B 4GT1A 1KYOI 3SFEC 2RN0A 5AVYB 1BGYG 1VQ9P 5KLIB 3L75E 1SQPK 1NTMK 1KFNA 1YHQP 1URQD 1BE3E 1L4AB 1L0LD 1RF0C 3WUVA 1E5WA 2FYUE 2KYVA 4YPCA 2C9LY 1VQOP 1PV3A 2Y9YA 2C0XA 5CCHA 4BRYB 4KHXA 5CBNA 3W68A 5AVQB 2A06E 3CXHD 1EDJA 1K05A 3OJAB 1LTIC 3L73G 3M9BA 3N4XA 1PPJE 4LGDE 1G2CA 3G6EP 1G1JA 2H7HA 3M06A 3W67A 2QA4P 2OYHC 5CCGD 1H0TB 1OFCX 3QH9A 3D70A 1VPCA 2B89A 1KYOH 3OW2O 2B9BA 2R44A 3L70E 3A0HH 1TU3F 1RQVA 1JY2P 1SQPE 5APYA 3MHVA 3CCJP 1EQ7A 3P8MC 1FU1A 1ZXGA 3TK1A 1ZOYC 3D71A 4H44C 5KJ7A 2WQYC 3H1HD 3I55P 2Q1KA 1FDIA 1KB9D 2GUVA 1FDOA 1ZN5A 3GHGA 1M7LA 2A45G 1GL2D 3AEBC 4M3LA 1NHLA 1KMIZ 5AW7B 3EWKA 4RESB 3H25A 1CW5A 1EZVG 1NTZG 3TGUD 2P2UA 2V4HA 2P10A 1BCCJ 1QGKB 4NPFX 4H13D 4GDOA 3IAOA 2E75C 1KYOE 2BCCE 2Y9ZA 1AJYA 3SFDC 2GM4A 3A0HE 4YXDC 4DCKA 2NRGA 1N8RQ 2ZJSE 5KLIC 1N86A 1HH0A 4U3FG 3BVHA 5EFWB 5K5GB 1HGVA 3RGUA 1LT9A 3CD6P 1L4AC 3GG2A 2Q9IA 5C39A 1HBWA 3CCMP 4KJMA 3G71P 2HR3A 5E79H 1LGHB 1LTJB 3AEGC 3VMZA 3BASA 2ZVOB 1AV1A 1M57D 2OTJP 2WTYA 1EDKA 2XNDH 3HE5A 1BE3J 1M90Q 2Q3IA 3CWBJ 2D2CB 3MUDA 4HYTB 1U7JA 2JJLA 1LT1A 1VQ8P 3AE7C 4PV1B 3WUTA 2WPRA 2KUBA 1PGPA 1FJPA 2FYNC 3L71G 3GHGB 5AVUB 1PP9G 3CLQA 4ASVA 1MFTA 3H1IJ 2RKLA 2WSCH 1EXIA 2Q7CA 1SQPD 1NTMD 3PTZA 3FXDA 4GODA 2H8PD 1WMKA 2N1TA 3OA7A 1KORA 1CZQA 1OX3A 2WSEJ 1NTKK 2AXCA 1L0LG 4K35A 3L70J 4O9BA 4LC1A 3V4WA 3M9HA 1KFMA 4WY4D 1GDTA 5E79E 5AVRB 3O6QA 1WT6A 1JY3N 3V2NA 3BATA 1XTCC 1LT9B 3JSVC 1NKZB 3L4FA 2IBZD 5AVTB 2P67A 3PJSK 1FZBA 1ZV8A 5GTHH 1HVVA 2W8ZA 4WWIA 3MZWB 1YQ4C 5AVVB 3CCRP 2KZIA 4UB6H 3WU2H 1QEXA 5L8RJ 1PGJA 5CCHC 1HF9A 4DOJA 2NPSD 3H1LD 3AE8C 3HE5B 2O1KA 1DD4A 2HG5D 1M1JA 3V4QA 1Q2NA 2BCCD 3G9RA 3H6PA 1SQXE 4PJ0H 2QIWA 3U59A 1Y47A 1DEBA 1E79H 2JP3A 3H1JG 4IFDK 2IDBA 1SLQA 5KTBA 3MIWA 3CPWO 1LTJC 3L35A 1SQBD 1GZLA 3II6A 3RK3B 1RY3A 3BCCE 1GU5A 1J1EB 3A3YB 2B88A 2HODB 4AYCA 1FE6A 1K9MQ 1BGYJ 2N1TB 2D2CC 5KJ7C 3LIDA 2Y0EA 4PV1C 4B86A 1VF5D 3TGUG 1PZQA 1IK9A 2YXQB 5GTHE 2FY8A 1XTGB 3SWKA 1VQLP 4GOFA 1ZW0A 2BASA 3GHGC 3O6QB 4WB4A 4RKUJ 4UB6E 3WU2E 3VTPC 1Q7YQ 2W6JH 4H0LD 3L73J 2R3SA 3B5NA 2UWJE 3HTKA 2E74B 5AVXB 5TISE 4KT0J 1SVFA 5AW8B 1HUCA 2KIKA 1IC2A 1M1JB 3L72D 4EDFA 2AXTH 1SQQD 1X79B 4GIFA 1LT9C 1NU1G 3RK3E 2C9NY 3L36A 4AQRD 1BDDA 2IFMA 3AE5C 2KP8A 3V2PA 5TJHA 1NGMB 1RE4C 1YBKA 3ZDMA 3TYYA 2ZT9B 1DD3A 1X22A 1LTGC 2JDIH 1WRGA 5BU5A 3L37A 4CPGA 2YKPA 3PHLA 3SWYA 2QE7H 2YMKA 2OGUA 2ZXEB 3LW5H 3MTUE 2QJYB 2XV5A 2OQQA 3E1IA 5APXA 1LWUA 1NTMG 4GOEA 5AVWB 1VDFA 2KLUA 1NTKD 3SSUA 1KTMA 1NTZJ 2QSIA 3A0BH 4TT3H 3A7OA 4HJGH 1FDMA 4JYBA 3WMM0 2NPSA 2FFDA 3L74D 3RK3C 1BCCE 3KQGA 1J1EC 4R4MA 5AW5B 4W80A 3JCUH 3B5NB 3CCSP 2N1TC 2AXTE 4U3FJ 2E76D 1KQLA 2IBZG 3ITKA 5B66H 1NWQA 2IZ0A 2M8RA 4ZNCA 3PLNA 1M56D 3Q3DA 4ASWA 1PIXA 4IL6E 5KAIH 4JF7A 1K8AQ 1JTHA 3H1LG 2YO2A 2K3RA 1USDA 1LTTC 1LP1A 4I2LC 4OH8B 1N7SA 2RMZA 1Z56A 2E74C 3CWBE 1N73B 2YKOA 1FZFA 3Q2YA 3A0BE 3L71J 3RBZA 3PRJA 3E7KA 1NKNA 1PP9J 3HE4A 2QEXP 4DJGA 1SQBG 1M1JC 1ZLLA 3NFQA 1S2EA 3CCLP 2P7JA 1LWUB 3H1IE 2KSJA 2WPQA 1OIPA 4D6TD 1SFCD 1JM0A 3JCUE 4IFFA 2ITAA 1SQVD 4N78E 2OYIB 3FWNA 3RK3D 5B66E 2ZT9C 2Z5HA 4Z1MH 3PP5A 1GMJA 2FFDB 2AEFA 2WT7A 4IFMA 3KYQA 2O1JA 1YTZT 5KAIE 5AW0B 2QJYC 3H32A 3GW6A 3VOPA 4AUWA 3CX5I 3AECC 5CJ4A 1NJIQ 3RBXA 5DJTB 1R5LA 1S9KE 5KKZB 1ZRTD 3EQ2A 1VL2A 2N9YB 1H8AA 3QWOC 3AE1C 1H89A 5KLVD 1KILA 3H1KG 2GA1A 4C7NA 2J59M 3L72G 4A7PA 2QJPB 1SQQG 3HRNA 3P7KA 1N7SB 4HKZH 1JMBA 2KXPB 3UIAA 1AA0A 1MV8A 1RE3C 2A45I 3H1JJ 1Q81Q 1KV4A 3CMEP 2R32A 1EZVI 3HE4B 5APUA 2WZ7A 3AE9C 3HD7A 3C9IA 1YYCA 3CX5H 1KQFB 3RK2B 4PD4I 1G2CB 3AE3C 3G4SP 1QLED 1JY3O 1BGYE 1FZCA 2I1JA 2B87A 1N73C 2AEMA 3L75D 5APSA 3TGUJ 1BE3D 1AFOA 1RF1A 1FAVA
chains in the Genus database with same CATH topology
2Z5IA 1IJDB 2FYZA 3H6PA 1N73A 1IFNA 3VMYA 3U59A 5BU8B 2NPSB 2A45H 1DEBA 3VN0A 1LWUC 1HTLC 5APTA 1YTZI 2QM8A 3V2RA 4IFDK 5AW6B 4C7RA 2N1TD 1QL1A 1URQA 1KILD 3IR9A 1SLQA 3P8CE 5KTBA 3MIWA 2YMYA 3RL0D 1LTJC 2C0WA 5AW9B 3L35A 1OWAA 1GZLA 2OYIC 3II6A 1J2JB 3RK3B 3M0DA 1JUNA 1G1IA 1RY3A 1GU5A 1JCDA 1J1EB 3A3YB 1IFIA 2FFDC 2HODB 4AYCA 4N78D 4DZOA 2HYNA 1LTJA 3P32A 1GTWA 2N1TB 1GK6A 1GW3A 1KILB 1SFCC 3I5CA 1JOCA 2OYIA 5KJ7C 2P1JA 3RL0B 3LIDA 3NMDA 2XU6A 3R2PA 3V5BA 3A5TA 1NTZK 2WITA 1T2KD 2MJZA 3V2QA 3G3ZA 1DX7A 2L5GB 4B86A 2R5BA 1JTHB 2XZRA 3HD7D 4WBAA 2FYUK 3OAKA 1IK9A 1AQ5A 1XTGB 5CCGA 2BASA 3GHGC 2PP6A 1JCCA 4WB4A 3B5NC 3VTPC 5AW4B 2HPCB 1SQXK 4W7YA 3NTNA 3VP8A 5CMZA 2WSEH 2M3BA 1SQBK 1HGZA 3HD7B 2KLVA 3B5NA 3HTKA 1S9KD 1L4AD 3IFMA 3TSIA 1QL2A 5AVXB 2GUSA 1IFMA 2R5DA 1N7SC 1SVFA 1N2DC 2XDJA 4GT1A 3U1CA 3MD0A 1FZCB 5AVZB 5AW8B 1HUCA 4ZKUA 5AVYB 4ZKPA 4W7ZA 1FZEA 1SQPK 1NTMK 1KFNA 1T3JA 1URQD 1IC2A 1RF1B 1L4AB 1M1JB 1X79B 2CPSA 4GIFA 1RF0C 1LT9C 3HUSA 4HH2A 1E5WA 2C9NY 3L36A 4AQRD 2KYVA 2IFMA 1MZ9A 3RK2C 2C9LY 2KP8A 4WY4C 1MFZA 2WT7B 4I6MC 3V2PA 1N7LA 1GL2A 3EFGA 2C0XA 5CCHA 1URQB 1RF0A 1RE4C 4KHXA 2KB7P 5AVQB 3TYYA 2YNYA 1IFDA 3OJAB 1LTGC 3H32B 1LTIC 1WRGA 5BU5A 1FZGA 1OXZA 3M9BA 3N4XA 3L37A 4EOTA 4LGDE 1G2CA 2YKPA 4XE5B 1G1JA 2HFED 2H7HA 1RE4A 3M06A 3SWYA 2OYHC 1FZAA 5CCGD 2ZXEB 3LW5H 3MTUE 3M0AA 4GKGA 2XV5A 1JY3P 3E1IA 5APXA 1VPCA 5APWA 1LWUA 3VMXA 5AVWB 1VDFA 1SQQK 3VP9A 1J1DB 5AVSB 2NPSC 1JY2P 4XA4A 5APYA 3B5ND 3A7OA 1EQ7A 1FDMA 4C7NB 3P8MC 3TNUA 1FU1A 1CI6A 4JYBA 5AW3B 3TK1A 3WMM0 2NPSA 2FFDA 3RK3C 1NH4A 3B8EB 3NXSA 1CSBA 3P8CD 2IPPA 3KQGA 4Y99B 1J1EC 1SFCA 5AW5B 5KJ7A 4W80A 3U1AA 1W2EA 3B5NB 2N1TC 1PFIA 1KILC 2GUVA 5APVA 3KDPB 3RL0C 1HJBA 3SWFA 1FBMA 1KQLA 1IO4A 1NWQA 5AW2B 2HODA 1FOSE 1ZN5A 3GHGA 2M8RA 1NOHA 1SP4A 1KZUB 1M7LA 3KPEA 3T97A 2A45G 1HWTC 1GL2D 5CCHD 4M3LA 1NHLA 5AW7B 4JF7A 4RESB 1JTHA 1CW5A 2YO2A 2WSFH 3LIEA 1T2KC 1LTTC 3HUSB 1L0NK 4I2LC 1A02J 4OH8B 3CI9A 3HD7C 1LTSC 2P2UA 5APQA 1H88A 4C46A 2QM7A 1N7SA 1JO5A 1MUUA 3BRTB 1GL2B 1Z56A 3MGNA 1GK4A 2PAJA 1DH3A 2IX7C 1N73B 2FXMA 2YKOA 1FZFA 2GM4A 4JYCA 2R3CA 1NKNA 3HE4A 1N86A 1HH0A 3BVHA 1HGVA 1RF1C 2CPBA 1LT9A 1L4AC 1M1JC 1ZLLA 2Q9IA 2E43A 3NFQA 1HBWA 2O01H 2P7JA 1LWUB 1T8ZA 2KSJA 2WPQA 4WY4A 5CJ0A 1X8YA 2H43A 1LGHB 1SFCD 2N9BA 5KJ7D 4IFFA 1LTJB 1A02F 4N78E 3VMZA 3BASA 4I1LA 1URQC 2OYIB 3TNUB 3N7NA 5CHXA 3RK3D 2Z5HA 1CI6B 2WTYA 3PP5A 3HE5A 3A2AA 2IFNA 2FFDB 2OYHA 1L0LK 2Q3IA 3M0DC 2WT7A 4IFMA 3MUDA 1IFJA 1SFCB 3KYQA 2JJLA 4HYTB 1JNMA 2JEEA 2O1JA 2WWWA 1YTZT 5AW0B 2XKMA 3H32A 2XNXA 1NO4A 5BVZA 2WPRA 3VOPA 1FOSF 4AUWA 1FJPA 1J1DC 2FKWB 3GHGB 5AVUB 3CLQA 5CJ4A 1GU4A 3HTKB 5CCGC 1N7SD 2WSCH 1S9KE 1LTBC 3EQ2A 1X9VA 3VYIA 1SQVK 1H8AA 1ZR2A 2Q7CA 1H89A 2H8PD 3M9QA 4Y99C 2N1TA 2E42A 1KILA 4C7NA 3OA7A 2I1KA 1CZQA 2J59M 2YO3A 1NU1K 1NTKK 3HRNA 3P7KA 1N7SB 4O9BA 1JMMA 3UIAA 1FJKA 4LC1A 1MV8A 1RE3C 3V4WA 1GD2E 2A45I 3M9HA 4EIJA 1KFMA 3RK2D 4WY4D 1GDTA 5AVRB 1ZR4A 2Z4EA 2WPSA 1WT6A 4N3YB 1JY3N 2KOGA 5AW1B 3V2NA 1T3UA 3BATA 2R32A 2Q5UA 3HE4B 2HPCA 2OARA 2LKMA 5APUA 1RE3A 1XTCC 2ZFCA 1LT9B 4LLHA 1NKZB 2WZ7A 3BRVB 3L4FA 3O8ZA 3HD7A 1JY2N 2W6AA 5AVTB 3C9IA 1YYCA 3HUSC 2P67A 1FZCC 1FZBA 1ZV8A 3RK2B 1NAFA 4WY4B 1G2CB 2W27A 1HVVA 4N6JA 2W6BA 5AVVB 5KLVK 1JY3O 1GL2C 5CCHC 3CL3D 4DOJA 2YKQA 1FZCA 2I1JA 2NPSD 3M91A 1N73C 5APSA 1LTAC 3HE5B 2VRSA 1AFOA 2HLOA 1GW4A 2O1KA 2J58A 2POHA 1JY2O 1RF1A 2OYHB 1FAVA 2HG5D 1L4AA 1M1JA 3V4QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGZ A;  2C0X A;  1HH0 A;  1IFD A;  2C0W A;  1NH4 A;  1HGV A;  1IFI A;  2CPB A;  1IFJ A;  2CPS A;  2MJZ A;  1FDM A; 
#chains in the Genus database with same CATH topology
 1L0N G;  5CBO A;  2FYZ A;  4K3A A;  2FYU D;  3L74 G;  1IFN A;  2FXP A;  4R4L A;  4H44 D;  3LW5 J;  2A45 H;  1LWU C;  1HTL C;  1YTZ I;  2QM8 A;  5AW6 B;  1URQ A;  2A06 D;  3JC2 2;  3P8C E;  3L73 E;  3Q5P A;  2C0W A;  1OW8 A;  2Y0D A;  1EDI A;  1KQG B;  1OWA A;  1PPJ D;  2OYI C;  3M0D A;  1JUN A;  1YIJ P;  4EYY Q;  2FFD C;  4N78 D;  4PD4 H;  4NPD A;  1SS1 A;  1KIL B;  1YJW P;  3AEF C;  3RL0 B;  1NTZ K;  2MJZ A;  3L70 D;  2J5U A;  2G3A A;  2QJK B;  1NU1 J;  3CX5 E;  2XZR A;  2ZYD A;  3OAK A;  5CCG A;  2PP6 A;  1KC8 Q;  4YTP C;  2E75 D;  1Q86 Q;  1SQX K;  5KKZ C;  5DJU B;  2DW3 A;  3HD7 B;  2OTK E;  2QG4 A;  1S9K D;  3CC7 P;  1L4A D;  2QJP C;  3IFM A;  3KXD A;  1N7S C;  2XDJ A;  4OGQ B;  1M8O B;  2Y0C A;  1S3J A;  3U1C A;  3MD0 A;  1FZC B;  4D6T G;  3CXH I;  5AVZ B;  4ZKU A;  4ZKP A;  2ZYA A;  1SQV G;  1IZN B;  2ZYG A;  3IN6 A;  1PGO A;  1EZV E;  1RF1 B;  1NTZ E;  1YI2 P;  2CPS A;  3FGA D;  2IZ1 A;  4HH2 A;  1EXJ A;  1ZME C;  2JR8 A;  2ZAE B;  4PD4 E;  1MZ9 A;  3RK2 C;  1N7L A;  1GL2 A;  3EFG A;  1KYO D;  1OW6 A;  1URQ B;  1RF0 A;  2KB7 P;  1KIL E;  5TIS H;  1IFD A;  4BWN A;  4U3F E;  1OXZ A;  4XFJ A;  1FZG A;  4XE5 B;  3H1H G;  1DEE G;  2HFE D;  2LXC B;  4WVZ A;  4GKG A;  1JY3 P;  3D6Y A;  5APW A;  3H1L J;  1KB9 I;  2WPV B;  1L0N E;  3VP9 A;  1J1D B;  5AVS B;  5KLV G;  3CXH H;  3R4Y A;  1IFP A;  3TNU A;  1RQU A;  5AW3 B;  1NH4 A;  3P8C D;  3L73 D;  2JKV A;  2K88 A;  1X0T A;  3U1A A;  1W2E A;  1PFI A;  3PH0 A;  1KIL C;  5APV A;  4U7J A;  1SQB J;  3L71 E;  3KDP B;  3RL0 C;  1HJB A;  1PP9 E;  1IO4 A;  5AW2 B;  1FOS E;  1S72 P;  2QJK C;  1PGQ A;  5GTI H;  3KPE A;  4HB1 A;  1HWT C;  1R8E A;  5CCH D;  3CX5 D;  1W5C E;  3L75 G;  1Y8A A;  1KB9 H;  1T2K C;  2FBW C;  1BE3 G;  1L0L E;  5H2F H;  1A02 J;  3C8V A;  3CI9 A;  3HD7 C;  1LTS C;  1QVF O;  1H88 A;  3S4R A;  1MUU A;  2JO1 A;  2FYU G;  1GL2 B;  2IX7 C;  4OGQ C;  2FXM A;  3CXH E;  2A06 G;  3FXE A;  2R3C A;  4UB8 E;  1LNQ A;  4MN4 C;  4L73 A;  1RF1 C;  1PPJ G;  2CPB A;  4H13 B;  1NVO A;  4IL6 H;  2E43 A;  1T8Z A;  4WY4 A;  1BSH A;  5CJ0 A;  2H43 A;  2ZVN B;  2D2C D;  2WMM A;  3H1K J;  1NTZ D;  2N9B A;  1VQM P;  5KJ7 D;  3L72 J;  2LR2 A;  2M0B A;  1SQQ J;  3MUD C;  1URQ C;  3L70 G;  3TNU B;  4PV1 D;  2QVA A;  1SQP G;  4PD4 D;  2L91 A;  2K1A A;  5GTI E;  3M0D C;  3Q1M A;  1VQ5 P;  4BRY A;  1SQX D;  1JNM A;  2JEE A;  2WWW A;  4I7Z B;  4U3F D;  3H1J E;  2XKM A;  2V7Q J;  1KB9 E;  1FOS F;  5H2F E;  1J1D C;  2FKW B;  1VQP P;  4L75 A;  3RL0 g;  4DT0 A;  1GU4 A;  3HTK B;  5CCG C;  3BCC D;  1X9V A;  4ZMD A;  2E42 A;  4OWF A;  2IBZ I;  3FWL A;  2YO3 A;  1NU1 K;  3TGU E;  1L0N J;  4IOI H;  1JMM A;  3L74 J;  2K9J A;  1FJK A;  3CCE P;  2OYO A;  1GD2 E;  4BXL A;  1ZR4 A;  3CMA P;  3L71 D;  3EFF K;  4N3Y B;  2WSF J;  2BCC G;  1AQT A;  2Q5U A;  2HPC A;  2LKM A;  3KZI H;  2ZFC A;  4RO0 A;  2BEZ F;  1JY2 N;  4OVN F;  2W6A A;  3AE2 C;  4WY4 B;  3FX0 A;  1S5L H;  4N6J A;  1GL2 C;  4Y28 J;  3CL3 D;  2SPZ A;  2YKQ A;  3M91 A;  2Q6Q A;  3AED C;  1LTA C;  2HLO A;  1GW4 A;  2E5Y A;  2POH A;  2O01 J;  1NU1 E;  2P58 A;  1L0L J;  2Z5I A;  4H13 C;  5BU8 B;  4L74 A;  2NPS B;  5APT A;  1OMI A;  4C7R A;  2N1T D;  1QL1 A;  2YMY A;  2G8Y A;  5AW9 B;  1JEK A;  2FXO A;  2FYN B;  4D6T J;  4DZO A;  2HYN A;  1LTJ A;  3P32 A;  3I56 P;  1NTM E;  1K04 A;  1SQV J;  2JWD A;  1GK6 A;  1GW3 A;  3I5C A;  1JOC A;  3KZI E;  2P1J A;  4I7Z C;  3A5T A;  1YJ9 P;  2WIT A;  3G3Z A;  2WSS H;  1VQ6 P;  1DX7 A;  1VQN P;  2R5B A;  1JTH B;  4WBA A;  2K9J B;  3AE4 C;  1LP1 B;  1MKM A;  3H1J D;  1NAY A;  1S5L E;  1L2P A;  1BSN A;  2E74 D;  2IYO A;  3B5N C;  4IL6 X;  1VQ7 P;  1IK7 A;  1BCC D;  2MKV A;  5AW4 B;  2HPC B;  3NTN A;  3VP8 A;  1RH5 B;  5CMZ A;  1W2B O;  1P84 I;  2M3B A;  3AE6 C;  1SQB K;  1VF5 B;  3H1H J;  2KLV A;  2IBZ E;  2KS1 A;  3F89 A;  1EDL A;  1QL2 A;  3CC2 P;  3S1K A;  4H0L B;  3S9O A;  5KLV J;  3D6Z A;  4W7Z A;  1FZE A;  3H1L E;  1T3J A;  2ZT9 D;  3HUS A;  1NTK G;  4NPE A;  3CCU P;  1UIX A;  1SQX G;  5KAF H;  4WY4 C;  1MFZ A;  2WT7 B;  3CWB D;  4I6M C;  3B4S A;  3Q5S A;  1QX8 A;  2YNY A;  1OW7 A;  3TDK A;  3H32 B;  2Q3E A;  1P84 H;  1SQB E;  2O01 N;  4EOT A;  1RE4 A;  1FZA A;  3BCC G;  3M0A A;  1K73 Q;  3H1I D;  1S1C X;  3WUU A;  3VMX A;  3L75 J;  1SQQ K;  4JBZ A;  1KQS O;  1NU1 D;  2NPS C;  2NZ2 A;  2V7Q H;  4XA4 A;  3B5N D;  1QVG O;  4C7N B;  2YIU B;  2FYU J;  1CI6 A;  3B8E B;  3NXS A;  1CSB A;  2IPP A;  4Y99 B;  1SFC A;  1S5L X;  3MP7 B;  3KHU A;  2KS1 B;  2E5T A;  3SWF A;  1FBM A;  2KZJ A;  3Q5R A;  4L76 A;  2HOD A;  1UII A;  1BDC A;  1KD1 Q;  1HJ0 A;  5KAF E;  1NOH A;  1SP4 A;  1KZU B;  1OZH A;  1M1K Q;  2CK3 H;  3USS A;  3T97 A;  3TF5 A;  4JQ0 D;  2E76 B;  3H1K E;  3GMA A;  3L72 E;  1SQP J;  3ABV C;  1NTM J;  2WSF H;  3LIE A;  1P84 E;  1SQQ E;  3HUS B;  1L0N K;  2PRR A;  2B87 B;  3B71 A;  1VF5 C;  5APQ A;  4C46 A;  2QM7 A;  1JO5 A;  3BRT B;  4RJT A;  3MGN A;  1GK4 A;  2PFX A;  2PAJ A;  1DH3 A;  2K9Y A;  3CCQ P;  4H0L C;  4JYC A;  3CCV P;  2M5A A;  1YQ3 C;  2O01 H;  2I8D A;  3AEE C;  1X8Y A;  1BGY D;  1NTK E;  3GF3 A;  1A02 F;  1S4X A;  4I1L A;  3N7N A;  5CHX A;  1CI6 B;  1PL5 A;  3A2A A;  2IFN A;  2OYH A;  1L0L K;  1U7M A;  1Q90 D;  3L74 E;  3CC4 P;  2RH0 A;  1IFJ A;  1SFC B;  4UB8 H;  2BCC J;  1LJ2 A;  2AEJ A;  1BCC G;  3F5H A;  2IYP A;  2XNX A;  1NO4 A;  5BVZ A;  4QMA A;  2ZXX A;  3T97 B;  1N7S D;  2YIU C;  1LTB C;  3VMA A;  1EC5 A;  3VYI A;  1SQV K;  1ZR2 A;  1OVU A;  2K37 A;  3M9Q A;  1Q82 Q;  4Y99 C;  1Y9B A;  1R5S A;  2H88 C;  3V6I A;  2I1K A;  2BEQ D;  1JB0 J;  3GF7 A;  3K5B A;  2LXB A;  2W90 A;  1FS0 E;  4EIJ A;  4JPZ B;  1NYH A;  3RK2 D;  2WVR A;  3CWB G;  2Z4E A;  2WPS A;  2KOG A;  5AW1 B;  1T3U A;  2OAR A;  4PJ0 E;  2E76 C;  1RE3 A;  2M5A B;  3AEA C;  4LLH A;  5B5E H;  3BRV B;  1USE A;  3O8Z A;  1RHZ B;  2KNC A;  1D7M A;  3HUS C;  1FZC C;  1NAF A;  2JWA A;  2W27 A;  4TLF A;  1DIP A;  1YJN P;  3H1K D;  5M1B A;  2W6B A;  4D6T E;  3H1I G;  1P84 D;  5KLV K;  1SQV E;  1EZV D;  2VRS A;  2OYH B;  2J58 A;  1JY2 O;  1U57 A;  1L4A A;  1IJD B;  1N73 A;  3VMY A;  4EI2 A;  1AVY A;  3VN0 A;  1VQK P;  2QRX A;  3V2R A;  3E1R A;  3IF4 A;  2OTL P;  3IR9 A;  1KIL D;  2KK7 A;  3RL0 D;  3H1H E;  1ZP0 C;  1FC2 C;  1J2J B;  1G1I A;  1OVV A;  1JCD A;  4H44 B;  2YXR B;  1ZRT E;  1IFI A;  1KN7 A;  1H0T A;  1GTW A;  1SFC C;  2O3J A;  4YXW H;  2OYI A;  5KLV E;  3NMD A;  2XU6 A;  3R2P A;  1L0N D;  3V5B A;  1T6A A;  2W83 C;  1T2K D;  5B5E E;  3V2Q A;  2L5G B;  1NTK J;  3C1L A;  3HD7 D;  2FYU K;  2WSC J;  1AVO A;  1SQX J;  1AQ5 A;  3GLM A;  1JCC A;  2KSE A;  4OGQ D;  4W7Y A;  2H89 C;  1YIT P;  2WSE H;  1HGZ A;  1VQ4 P;  2KNC B;  1OVR A;  2M3E A;  1PP9 D;  3BCC J;  3TSI A;  2PGD A;  2E75 B;  2GUS A;  1IFM A;  2R5D A;  1N2D C;  2KI7 B;  4GT1 A;  1KYO I;  3SFE C;  2RN0 A;  5AVY B;  1BGY G;  1VQ9 P;  5KLI B;  3L75 E;  1SQP K;  1NTM K;  1KFN A;  1YHQ P;  1URQ D;  1BE3 E;  1L4A B;  1L0L D;  1RF0 C;  3WUV A;  1E5W A;  2FYU E;  2KYV A;  4YPC A;  2C9L Y;  1VQO P;  1PV3 A;  2Y9Y A;  2C0X A;  5CCH A;  4BRY B;  4KHX A;  5CBN A;  3W68 A;  5AVQ B;  2A06 E;  3CXH D;  1EDJ A;  1K05 A;  3OJA B;  1LTI C;  3L73 G;  3M9B A;  3N4X A;  1PPJ E;  4LGD E;  1G2C A;  3G6E P;  1G1J A;  2H7H A;  3M06 A;  3W67 A;  2QA4 P;  2OYH C;  5CCG D;  1H0T B;  1OFC X;  3QH9 A;  3D70 A;  1VPC A;  2B89 A;  1KYO H;  3OW2 O;  2B9B A;  2R44 A;  3L70 E;  3A0H H;  1TU3 F;  1RQV A;  1JY2 P;  1SQP E;  5APY A;  3MHV A;  3CCJ P;  1EQ7 A;  3P8M C;  1FU1 A;  1ZXG A;  3TK1 A;  1ZOY C;  3D71 A;  4H44 C;  5KJ7 A;  2WQY C;  3H1H D;  3I55 P;  2Q1K A;  1FDI A;  1KB9 D;  2GUV A;  1FDO A;  1ZN5 A;  3GHG A;  1M7L A;  2A45 G;  1GL2 D;  3AEB C;  4M3L A;  1NHL A;  1KMI Z;  5AW7 B;  3EWK A;  4RES B;  3H25 A;  1CW5 A;  1EZV G;  1NTZ G;  3TGU D;  2P2U A;  2V4H A;  2P10 A;  1BCC J;  1QGK B;  4NPF X;  4H13 D;  4GDO A;  3IAO A;  2E75 C;  1KYO E;  2BCC E;  2Y9Z A;  1AJY A;  3SFD C;  2GM4 A;  3A0H E;  4YXD C;  4DCK A;  2NRG A;  1N8R Q;  2ZJS E;  5KLI C;  1N86 A;  1HH0 A;  4U3F G;  3BVH A;  5EFW B;  5K5G B;  1HGV A;  3RGU A;  1LT9 A;  3CD6 P;  1L4A C;  3GG2 A;  2Q9I A;  5C39 A;  1HBW A;  3CCM P;  4KJM A;  3G71 P;  2HR3 A;  5E79 H;  1LGH B;  1LTJ B;  3AEG C;  3VMZ A;  3BAS A;  2ZVO B;  1AV1 A;  1M57 D;  2OTJ P;  2WTY A;  1EDK A;  2XND H;  3HE5 A;  1BE3 J;  1M90 Q;  2Q3I A;  3CWB J;  2D2C B;  3MUD A;  4HYT B;  1U7J A;  2JJL A;  1LT1 A;  1VQ8 P;  3AE7 C;  4PV1 B;  3WUT A;  2WPR A;  2KUB A;  1PGP A;  1FJP A;  2FYN C;  3L71 G;  3GHG B;  5AVU B;  1PP9 G;  3CLQ A;  4ASV A;  1MFT A;  3H1I J;  2RKL A;  2WSC H;  1EXI A;  2Q7C A;  1SQP D;  1NTM D;  3PTZ A;  3FXD A;  4GOD A;  2H8P D;  1WMK A;  2N1T A;  3OA7 A;  1KOR A;  1CZQ A;  1OX3 A;  2WSE J;  1NTK K;  2AXC A;  1L0L G;  4K35 A;  3L70 J;  4O9B A;  4LC1 A;  3V4W A;  3M9H A;  1KFM A;  4WY4 D;  1GDT A;  5E79 E;  5AVR B;  3O6Q A;  1WT6 A;  1JY3 N;  3V2N A;  3BAT A;  1XTC C;  1LT9 B;  3JSV C;  1NKZ B;  3L4F A;  2IBZ D;  5AVT B;  2P67 A;  3PJS K;  1FZB A;  1ZV8 A;  5GTH H;  1HVV A;  2W8Z A;  4WWI A;  3MZW B;  1YQ4 C;  5AVV B;  3CCR P;  2KZI A;  4UB6 H;  3WU2 H;  1QEX A;  5L8R J;  1PGJ A;  5CCH C;  1HF9 A;  4DOJ A;  2NPS D;  3H1L D;  3AE8 C;  3HE5 B;  2O1K A;  1DD4 A;  2HG5 D;  1M1J A;  3V4Q A;  1Q2N A;  2BCC D;  3G9R A;  3H6P A;  1SQX E;  4PJ0 H;  2QIW A;  3U59 A;  1Y47 A;  1DEB A;  1E79 H;  2JP3 A;  3H1J G;  4IFD K;  2IDB A;  1SLQ A;  5KTB A;  3MIW A;  3CPW O;  1LTJ C;  3L35 A;  1SQB D;  1GZL A;  3II6 A;  3RK3 B;  1RY3 A;  3BCC E;  1GU5 A;  1J1E B;  3A3Y B;  2B88 A;  2HOD B;  4AYC A;  1FE6 A;  1K9M Q;  1BGY J;  2N1T B;  2D2C C;  5KJ7 C;  3LID A;  2Y0E A;  4PV1 C;  4B86 A;  1VF5 D;  3TGU G;  1PZQ A;  1IK9 A;  2YXQ B;  5GTH E;  2FY8 A;  1XTG B;  3SWK A;  1VQL P;  4GOF A;  1ZW0 A;  2BAS A;  3GHG C;  3O6Q B;  4WB4 A;  4RKU J;  4UB6 E;  3WU2 E;  3VTP C;  1Q7Y Q;  2W6J H;  4H0L D;  3L73 J;  2R3S A;  3B5N A;  2UWJ E;  3HTK A;  2E74 B;  5AVX B;  5TIS E;  4KT0 J;  1SVF A;  5AW8 B;  1HUC A;  2KIK A;  1IC2 A;  1M1J B;  3L72 D;  4EDF A;  2AXT H;  1SQQ D;  1X79 B;  4GIF A;  1LT9 C;  1NU1 G;  3RK3 E;  2C9N Y;  3L36 A;  4AQR D;  1BDD A;  2IFM A;  3AE5 C;  2KP8 A;  3V2P A;  5TJH A;  1NGM B;  1RE4 C;  1YBK A;  3ZDM A;  3TYY A;  2ZT9 B;  1DD3 A;  1X22 A;  1LTG C;  2JDI H;  1WRG A;  5BU5 A;  3L37 A;  4CPG A;  2YKP A;  3PHL A;  3SWY A;  2QE7 H;  2YMK A;  2OGU A;  2ZXE B;  3LW5 H;  3MTU E;  2QJY B;  2XV5 A;  2OQQ A;  3E1I A;  5APX A;  1LWU A;  1NTM G;  4GOE A;  5AVW B;  1VDF A;  2KLU A;  1NTK D;  3SSU A;  1KTM A;  1NTZ J;  2QSI A;  3A0B H;  4TT3 H;  3A7O A;  4HJG H;  1FDM A;  4JYB A;  3WMM 0;  2NPS A;  2FFD A;  3L74 D;  3RK3 C;  1BCC E;  3KQG A;  1J1E C;  4R4M A;  5AW5 B;  4W80 A;  3JCU H;  3B5N B;  3CCS P;  2N1T C;  2AXT E;  4U3F J;  2E76 D;  1KQL A;  2IBZ G;  3ITK A;  5B66 H;  1NWQ A;  2IZ0 A;  2M8R A;  4ZNC A;  3PLN A;  1M56 D;  3Q3D A;  4ASW A;  1PIX A;  4IL6 E;  5KAI H;  4JF7 A;  1K8A Q;  1JTH A;  3H1L G;  2YO2 A;  2K3R A;  1USD A;  1LTT C;  1LP1 A;  4I2L C;  4OH8 B;  1N7S A;  2RMZ A;  1Z56 A;  2E74 C;  3CWB E;  1N73 B;  2YKO A;  1FZF A;  3Q2Y A;  3A0B E;  3L71 J;  3RBZ A;  3PRJ A;  3E7K A;  1NKN A;  1PP9 J;  3HE4 A;  2QEX P;  4DJG A;  1SQB G;  1M1J C;  1ZLL A;  3NFQ A;  1S2E A;  3CCL P;  2P7J A;  1LWU B;  3H1I E;  2KSJ A;  2WPQ A;  1OIP A;  4D6T D;  1SFC D;  1JM0 A;  3JCU E;  4IFF A;  2ITA A;  1SQV D;  4N78 E;  2OYI B;  3FWN A;  3RK3 D;  5B66 E;  2ZT9 C;  2Z5H A;  4Z1M H;  3PP5 A;  1GMJ A;  2FFD B;  2AEF A;  2WT7 A;  4IFM A;  3KYQ A;  2O1J A;  1YTZ T;  5KAI E;  5AW0 B;  2QJY C;  3H32 A;  3GW6 A;  3VOP A;  4AUW A;  3CX5 I;  3AEC C;  5CJ4 A;  1NJI Q;  3RBX A;  5DJT B;  1R5L A;  1S9K E;  5KKZ B;  1ZRT D;  3EQ2 A;  1VL2 A;  2N9Y B;  1H8A A;  3QWO C;  3AE1 C;  1H89 A;  5KLV D;  1KIL A;  3H1K G;  2GA1 A;  4C7N A;  2J59 M;  3L72 G;  4A7P A;  2QJP B;  1SQQ G;  3HRN A;  3P7K A;  1N7S B;  4HKZ H;  1JMB A;  2KXP B;  3UIA A;  1AA0 A;  1MV8 A;  1RE3 C;  2A45 I;  3H1J J;  1Q81 Q;  1KV4 A;  3CME P;  2R32 A;  1EZV I;  3HE4 B;  5APU A;  2WZ7 A;  3AE9 C;  3HD7 A;  3C9I A;  1YYC A;  3CX5 H;  1KQF B;  3RK2 B;  4PD4 I;  1G2C B;  3AE3 C;  3G4S P;  1QLE D;  1JY3 O;  1BGY E;  1FZC A;  2I1J A;  2B87 A;  1N73 C;  2AEM A;  3L75 D;  5APS A;  3TGU J;  1BE3 D;  1AFO A;  1RF1 A;  1FAV A; 
#chains in the Genus database with same CATH homology
 2Z5I A;  1IJD B;  2FYZ A;  3H6P A;  1N73 A;  1IFN A;  3VMY A;  3U59 A;  5BU8 B;  2NPS B;  2A45 H;  1DEB A;  3VN0 A;  1LWU C;  1HTL C;  5APT A;  1YTZ I;  2QM8 A;  3V2R A;  4IFD K;  5AW6 B;  4C7R A;  2N1T D;  1QL1 A;  1URQ A;  1KIL D;  3IR9 A;  1SLQ A;  3P8C E;  5KTB A;  3MIW A;  2YMY A;  3RL0 D;  1LTJ C;  2C0W A;  5AW9 B;  3L35 A;  1OWA A;  1GZL A;  2OYI C;  3II6 A;  1J2J B;  3RK3 B;  3M0D A;  1JUN A;  1G1I A;  1RY3 A;  1GU5 A;  1JCD A;  1J1E B;  3A3Y B;  1IFI A;  2FFD C;  2HOD B;  4AYC A;  4N78 D;  4DZO A;  2HYN A;  1LTJ A;  3P32 A;  1GTW A;  2N1T B;  1GK6 A;  1GW3 A;  1KIL B;  1SFC C;  3I5C A;  1JOC A;  2OYI A;  5KJ7 C;  2P1J A;  3RL0 B;  3LID A;  3NMD A;  2XU6 A;  3R2P A;  3V5B A;  3A5T A;  1NTZ K;  2WIT A;  1T2K D;  2MJZ A;  3V2Q A;  3G3Z A;  1DX7 A;  2L5G B;  4B86 A;  2R5B A;  1JTH B;  2XZR A;  3HD7 D;  4WBA A;  2FYU K;  3OAK A;  1IK9 A;  1AQ5 A;  1XTG B;  5CCG A;  2BAS A;  3GHG C;  2PP6 A;  1JCC A;  4WB4 A;  3B5N C;  3VTP C;  5AW4 B;  2HPC B;  1SQX K;  4W7Y A;  3NTN A;  3VP8 A;  5CMZ A;  2WSE H;  2M3B A;  1SQB K;  1HGZ A;  3HD7 B;  2KLV A;  3B5N A;  3HTK A;  1S9K D;  1L4A D;  3IFM A;  3TSI A;  1QL2 A;  5AVX B;  2GUS A;  1IFM A;  2R5D A;  1N7S C;  1SVF A;  1N2D C;  2XDJ A;  4GT1 A;  3U1C A;  3MD0 A;  1FZC B;  5AVZ B;  5AW8 B;  1HUC A;  4ZKU A;  5AVY B;  4ZKP A;  4W7Z A;  1FZE A;  1SQP K;  1NTM K;  1KFN A;  1T3J A;  1URQ D;  1IC2 A;  1RF1 B;  1L4A B;  1M1J B;  1X79 B;  2CPS A;  4GIF A;  1RF0 C;  1LT9 C;  3HUS A;  4HH2 A;  1E5W A;  2C9N Y;  3L36 A;  4AQR D;  2KYV A;  2IFM A;  1MZ9 A;  3RK2 C;  2C9L Y;  2KP8 A;  4WY4 C;  1MFZ A;  2WT7 B;  4I6M C;  3V2P A;  1N7L A;  1GL2 A;  3EFG A;  2C0X A;  5CCH A;  1URQ B;  1RF0 A;  1RE4 C;  4KHX A;  2KB7 P;  5AVQ B;  3TYY A;  2YNY A;  1IFD A;  3OJA B;  1LTG C;  3H32 B;  1LTI C;  1WRG A;  5BU5 A;  1FZG A;  1OXZ A;  3M9B A;  3N4X A;  3L37 A;  4EOT A;  4LGD E;  1G2C A;  2YKP A;  4XE5 B;  1G1J A;  2HFE D;  2H7H A;  1RE4 A;  3M06 A;  3SWY A;  2OYH C;  1FZA A;  5CCG D;  2ZXE B;  3LW5 H;  3MTU E;  3M0A A;  4GKG A;  2XV5 A;  1JY3 P;  3E1I A;  5APX A;  1VPC A;  5APW A;  1LWU A;  3VMX A;  5AVW B;  1VDF A;  1SQQ K;  3VP9 A;  1J1D B;  5AVS B;  2NPS C;  1JY2 P;  4XA4 A;  5APY A;  3B5N D;  3A7O A;  1EQ7 A;  1FDM A;  4C7N B;  3P8M C;  3TNU A;  1FU1 A;  1CI6 A;  4JYB A;  5AW3 B;  3TK1 A;  3WMM 0;  2NPS A;  2FFD A;  3RK3 C;  1NH4 A;  3B8E B;  3NXS A;  1CSB A;  3P8C D;  2IPP A;  3KQG A;  4Y99 B;  1J1E C;  1SFC A;  5AW5 B;  5KJ7 A;  4W80 A;  3U1A A;  1W2E A;  3B5N B;  2N1T C;  1PFI A;  1KIL C;  2GUV A;  5APV A;  3KDP B;  3RL0 C;  1HJB A;  3SWF A;  1FBM A;  1KQL A;  1IO4 A;  1NWQ A;  5AW2 B;  2HOD A;  1FOS E;  1ZN5 A;  3GHG A;  2M8R A;  1NOH A;  1SP4 A;  1KZU B;  1M7L A;  3KPE A;  3T97 A;  2A45 G;  1HWT C;  1GL2 D;  5CCH D;  4M3L A;  1NHL A;  5AW7 B;  4JF7 A;  4RES B;  1JTH A;  1CW5 A;  2YO2 A;  2WSF H;  3LIE A;  1T2K C;  1LTT C;  3HUS B;  1L0N K;  4I2L C;  1A02 J;  4OH8 B;  3CI9 A;  3HD7 C;  1LTS C;  2P2U A;  5APQ A;  1H88 A;  4C46 A;  2QM7 A;  1N7S A;  1JO5 A;  1MUU A;  3BRT B;  1GL2 B;  1Z56 A;  3MGN A;  1GK4 A;  2PAJ A;  1DH3 A;  2IX7 C;  1N73 B;  2FXM A;  2YKO A;  1FZF A;  2GM4 A;  4JYC A;  2R3C A;  1NKN A;  3HE4 A;  1N86 A;  1HH0 A;  3BVH A;  1HGV A;  1RF1 C;  2CPB A;  1LT9 A;  1L4A C;  1M1J C;  1ZLL A;  2Q9I A;  2E43 A;  3NFQ A;  1HBW A;  2O01 H;  2P7J A;  1LWU B;  1T8Z A;  2KSJ A;  2WPQ A;  4WY4 A;  5CJ0 A;  1X8Y A;  2H43 A;  1LGH B;  1SFC D;  2N9B A;  5KJ7 D;  4IFF A;  1LTJ B;  1A02 F;  4N78 E;  3VMZ A;  3BAS A;  4I1L A;  1URQ C;  2OYI B;  3TNU B;  3N7N A;  5CHX A;  3RK3 D;  2Z5H A;  1CI6 B;  2WTY A;  3PP5 A;  3HE5 A;  3A2A A;  2IFN A;  2FFD B;  2OYH A;  1L0L K;  2Q3I A;  3M0D C;  2WT7 A;  4IFM A;  3MUD A;  1IFJ A;  1SFC B;  3KYQ A;  2JJL A;  4HYT B;  1JNM A;  2JEE A;  2O1J A;  2WWW A;  1YTZ T;  5AW0 B;  2XKM A;  3H32 A;  2XNX A;  1NO4 A;  5BVZ A;  2WPR A;  3VOP A;  1FOS F;  4AUW A;  1FJP A;  1J1D C;  2FKW B;  3GHG B;  5AVU B;  3CLQ A;  5CJ4 A;  1GU4 A;  3HTK B;  5CCG C;  1N7S D;  2WSC H;  1S9K E;  1LTB C;  3EQ2 A;  1X9V A;  3VYI A;  1SQV K;  1H8A A;  1ZR2 A;  2Q7C A;  1H89 A;  2H8P D;  3M9Q A;  4Y99 C;  2N1T A;  2E42 A;  1KIL A;  4C7N A;  3OA7 A;  2I1K A;  1CZQ A;  2J59 M;  2YO3 A;  1NU1 K;  1NTK K;  3HRN A;  3P7K A;  1N7S B;  4O9B A;  1JMM A;  3UIA A;  1FJK A;  4LC1 A;  1MV8 A;  1RE3 C;  3V4W A;  1GD2 E;  2A45 I;  3M9H A;  4EIJ A;  1KFM A;  3RK2 D;  4WY4 D;  1GDT A;  5AVR B;  1ZR4 A;  2Z4E A;  2WPS A;  1WT6 A;  4N3Y B;  1JY3 N;  2KOG A;  5AW1 B;  3V2N A;  1T3U A;  3BAT A;  2R32 A;  2Q5U A;  3HE4 B;  2HPC A;  2OAR A;  2LKM A;  5APU A;  1RE3 A;  1XTC C;  2ZFC A;  1LT9 B;  4LLH A;  1NKZ B;  2WZ7 A;  3BRV B;  3L4F A;  3O8Z A;  3HD7 A;  1JY2 N;  2W6A A;  5AVT B;  3C9I A;  1YYC A;  3HUS C;  2P67 A;  1FZC C;  1FZB A;  1ZV8 A;  3RK2 B;  1NAF A;  4WY4 B;  1G2C B;  2W27 A;  1HVV A;  4N6J A;  2W6B A;  5AVV B;  5KLV K;  1JY3 O;  1GL2 C;  5CCH C;  3CL3 D;  4DOJ A;  2YKQ A;  1FZC A;  2I1J A;  2NPS D;  3M91 A;  1N73 C;  5APS A;  1LTA C;  3HE5 B;  2VRS A;  1AFO A;  2HLO A;  1GW4 A;  2O1K A;  2J58 A;  2POH A;  1JY2 O;  1RF1 A;  2OYH B;  1FAV A;  2HG5 D;  1L4A A;  1M1J A;  3V4Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...