2CPSA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in sodium dodecyl sulphate micelles, 25 lowest energy structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
molecule keywords M13 MAJOR COAT PROTEIN
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpsA00
1IFIA 1HH0A 2CPBA 2CPSA 1FDMA 2C0XA 1NH4A 2MJZA 1HGZA 1IFDA 2C0WA 1HGVA 1IFJA
chains in the Genus database with same CATH superfamily
1GK4A 1SQBJ 4ZMDA 3Q2YA 1FZCC 1SFCC 2R32A 3CX5H 1PP9G 1EQ7A 2KNCA 2OARA 2WQYC 3T97B 1N73B 1K04A 2N9YB 2WPVB 1BCCG 1S3JA 2E76D 1S9KE 1VQKP 1S1CX 3H1JD 3USSA 1S5LH 1W2BO 2E74C 4HYTB 1XTCC 1Q81Q 3D70A 2A06E 2JDIH 3A2AA 3TYYA 2FYNB 4JYCA 4U3FJ 3GLMA 1EC5A 2WSFH 4R4MA 5AW2B 2HFED 2KLUA 2RMZA 2AXCA 3FWNA 4W7ZA 3I5CA 1DH3A 1JCDA 2KP8A 1EDLA 1RF0A 1M7LA 1YTZI 2ZAEB 4OVNF 1YHQP 2G3AA 2O3JA 1SLQA 2ZVOB 4PD4E 2AXTE 1IFMA 4ZKUA 1JOCA 2KS1B 4Y99C 1N2DC 2FYUG 2Y0EA 3KQGA 3P8MC 3RK2B 4B86A 3H1IE 2RH0A 3IF4A 1IFDA 1GDTA 1PGPA 5AW7B 2BCCJ 1R5SA 2Q9IA 3CCEP 2O01N 1KQGB 1KB9I 1NTKE 3H32B 4K3AA 4RESB 4WWIA 1LTJA 5AVSB 5CCGD 1HWTC 3BVHA 1SQBD 1FJPA 1AJYA 1OVUA 2WSCJ 3AE6C 3GHGB 2KK7A 5APSA 5AVXB 4EOTA 3FGAD 4JPZB 5CBOA 3V2NA 1U7JA 2BEQD 1KILE 3V2RA 4NPFX 3Q5SA 3GF3A 1SQQD 2ZT9D 3H1JJ 1G1JA 1SQQJ 5E79E 2HPCA 4DOJA 4O9BA 3Q3DA 2RKLA 1M1JC 5KKZC 2Q1KA 2NPSD 2OYIB 3HD7D 3BASA 3CCVP 3H1JG 1SQVE 3C9IA 4L75A 4ZKPA 1T8ZA 4OWFA 4D6TE 1AQTA 1J1DC 1QLED 3TF5A 3M91A 1RE3C 1JNMA 2LXCB 5KLVE 2B88A 2W90A 1EZVG 3H1LD 2CPSA 1GL2A 2FYUE 4GODA 5CJ0A 3SFEC 1FS0E 3GMAA 1AVOA 4XA4A 1X22A 1NU1D 1M1JA 1NU1J 1ZXGA 3L75D 3RK3E 5CCHD 2WVRA 2G8YA 3LW5H 3F89A 3H1ID 4WY4B 1OW7A 4BXLA 3VOPA 1KYOI 4C7RA 3QH9A 4DT0A 3E1RA 3HE5B 3CCJP 3CLQA 1WMKA 2A45I 1PPJE 1RE3A 2XNXA 4NPDA 5GTHE 2MJZA 3AE2C 2M8RA 2W6AA 3M9QA 2E5TA 3OAKA 1GK6A 2N9BA 1OZHA 1RY3A 2AEMA 1SVFA 2QJYC 3M0DA 3GW6A 5AVTB 3V5BA 4AQRD 1VQ4P 1VF5D 3L70D 4WVZA 4L73A 1BSNA 3L70J 3O6QB 4LGDE 3V6IA 1UIIA 2M5AA 3PHLA 5AVZB 4GIFA 3HUSC 3CC7P 1RF1B 1LNQA 2A06D 2AEFA 1X0TA 2K3RA 2HODA 3P7KA 1FAVA 1NO4A 3P8CD 5KLVG 1HJBA 2IBZE 1YYCA 3B5NA 3L71J 3H32A 1A02J 3OJAB 2ZT9C 3C8VA 2IBZG 2XU6A 1N7SA 5KAIE 3U59A 2A06G 4PJ0H 4XFJA 1SQPJ 1ZP0C 3BCCJ 5APYA 3F5HA 5H2FH 3RL0D 1L0LD 2HPCB 1L0LJ 3H25A 3TGUJ 1EZVE 3A0BE 3I55P 2KI7B 3V2QA 2N1TD 2WPQA 3NXSA 1LT9A 1BDCA 2LR2A 3GF7A 1LTBC 4H13C 3L74E 1T2KD 2JKVA 3CCRP 1NU1K 1VF5B 2XNDH 2E76C 2M3EA 3L37A 3BATA 3L73J 3L74G 3L73D 2JO1A 4GT1A 1JY3O 2MKVA 1SFCD 2WMMA 1PP9E 1T3UA 2M3BA 3JCUE 4Z1MH 5M1BA 1W5CE 2H88C 2P7JA 1KC8Q 1FZGA 2M0BA 1BCCE 5AVUB 4PD4I 5AW9B 1YITP 2P1JA 3V2PA 2P2UA 4YPCA 1DEEG 2BCCD 1VQMP 4L76A 1LT9C 1DX7A 2WITA 3MHVA 1TU3F 1J1EC 1L0NK 3MIWA 4H44D 4WY4A 3HD7A 3MUDC 5AW6B 3HE4B 1NTMD 1OIPA 1KB9H 2FYNC 2FYUD 2IZ1A 2PP6A 3N7NA 2FXPA 3OA7A 5TISE 3TGUD 5AVQB 2Z5IA 3ITKA 4W80A 1AQ5A 3PH0A 4HH2A 2KOGA 2QVAA 2KUBA 1NYHA 2R5BA 4H13D 4I2LC 3SWYA 1JY2P 5TJHA 2E42A 3A0HE 4H44B 1NTKG 4NPEA 5EFWB 4U3FD 1Y9BA 2WSCH 2FFDC 2J59M 5KJ7C 3II6A 1SQPG 1L0NE 1OWAA 2FY8A 5DJUB 3MD0A 1LTSC 3VMXA 1D7MA 1ZR2A 1R8EA 5KLIC 2OYHA 1JMMA 3L72G 2R3CA 1VF5C 3CX5D 1XTGB 3HD7C 3MUDA 4N3YB 1NU1E 4EYYQ 1KV4A 2JWDA 3UIAA 1N7SB 4UB8H 1GW3A 4DZOA 5GTHH 1CZQA 5KLVD 1Y8AA 2FXOA 1RF1C 3L72D 3TK1A 1BE3G 3BRTB 1USEA 1VPCA 5AVVB 2B9BA 1FDIA 2W83C 2ZYAA 2H43A 1H89A 1KYOE 2I8DA 2OTLP 3B71A 2IFNA 3FXEA 3H1HD 1JY2N 3AEGC 3VP9A 3L75E 2Q5UA 3L75J 2NPSB 3PRJA 3RK3D 4BWNA 2HG5D 1YIJP 1GU4A 1FDMA 2A45G 4ZNCA 3L75G 1L4AD 1OFCX 1LTTC 2O1KA 2XKMA 5K5GB 1NVOA 4GDOA 3H1HG 2QEXP 5CCHC 4DCKA 4H44C 1H0TB 2QSIA 3M9HA 2H89C 1N8RQ 2OYIA 1MUUA 2IBZI 4I1LA 1N7SD 4WB4A 5APWA 1WT6A 1W2EA 2O01J 2O01H 3RK2C 3CC4P 2N1TB 1JMBA 1VDFA 2W6BA 3AE7C 1VQLP 3HD7B 1GL2D 2JEEA 3AE8C 3G4SP 2KZJA 3L72J 1UIXA 1Y47A 3SSUA 2P67A 1BE3E 3GHGC 3G9RA 4GOFA 1P84D 1FZEA 1PV3A 2I1JA 1EZVI 3JCUH 3P32A 3U1CA 2AEJA 5CCGC 1MZ9A 1JUNA 2WPRA 4Y28J 1M1JB 4IFFA 1NTZG 1KMIZ 3A7OA 2QJPB 5AW1B 2E75B 3VN0A 1GL2B 3W68A 3U1AA 2Z4EA 1SQVG 1JY3P 3HE5A 2WTYA 4IL6X 5CMZA 1NTZD 1JTHB 2OYOA 2ZVNB 1ZMEC 3IN6A 3VMZA 2V4HA 3L35A 3MTUE 4RJTA 5BU5A 4C7NB 2H8PD 1S4XA 5AVWB 2NRGA 4BRYA 2FFDB 5CCGA 3O6QA 1SQXK 1FJKA 4D6TD 4PD4H 1VQ8P 2VRSA 3H1HE 3W67A 1KD1Q 1M8OB 2W8ZA 4AUWA 1CI6B 3AECC 1KILA 1LWUB 2HODB 2J5UA 3HTKA 1HBWA 1HF9A 3S4RA 3B5NB 4OGQC 4EDFA 2KYVA 1LT1A 1GZLA 3CWBE 2E76B 3CCSP 3L73G 1EDIA 3L74J 4YXWH 1ZV8A 1QVGO 1YI2P 3RBZA 1SQXG 1HUCA 3CWBG 4U7JA 2WT7A 4JQ0D 4I6MC 3H1KE 2YNYA 1PP9D 1FOSF 2R3SA 1QVFO 4GOEA 1OW6A 2KXPB 2IYPA 3G3ZA 4H0LC 5E79H 1DIPA 1IZNB 3H1KG 1SQPK 3WU2H 3FXDA 2YXQB 1ZRTD 1VL2A 1H0TA 1KQFB 2E5YA 4EIJA 1FE6A 1LT9B 3M0AA 1SQVK 1KILC 1NTKK 5APTA 1X9VA 1SS1A 4LC1A 4U3FE 2YKPA 4LLHA 2OQQA 5B66E 2B89A 2C0XA 2WSEJ 3R4YA 3A3YB 1FC2C 3N4XA 5KLVJ 3CCUP 3RK3B 2PAJA 4A7PA 1KILD 1FZFA 2KZIA 3CXHD 4I7ZB 1L0NG 1OVVA 1RH5B 4XE5B 1L4AA 2GUVA 2K9YA 4IFMA 1NTMJ 3H1HJ 4C46A 1Q90D 1U57A 2XZRA 2PFXA 1GD2E 2ZJSE 3JSVC 4PV1C 2FXMA 2V7QJ 2V7QH 3A5TA 1Q82Q 1AA0A 3AEDC 3HE4A 1YJ9P 3Q5PA 1GU5A 2J58A 1VQ6P 3H1LE 5CHXA 1HVVA 1NU1G 2D2CD 2WZ7A 3CI9A 1KB9D 1BE3J 3S9OA 4C7NA 2ZYDA 3LIDA 1FZBA 1L4AC 1AFOA 1K8AQ 1BSHA 2OTKE 2QJPC 1JY2O 4JBZA 1FBMA 2L5GB 1CI6A 1DEBA 1KILB 1LWUA 2JWAA 2QRXA 3EWKA 3H1JE 1IFNA 3HTKB 3WUUA 1KQSO 1EZVD 2QA4P 2E43A 3M0DC 2OYHB 2IX7C 3D6YA 1J2JB 1SQVJ 3ZDMA 1JY3N 1BGYD 3PJSK 4TT3H 5DJTB 1HGVA 1IFJA 1NOHA 1T6AA 2IZ0A 2BEZF 2L91A 3FWLA 4Y99B 1CSBA 3RGUA 1AVYA 4ASVA 3D71A 3H1IG 1PGQA 2QM7A 1OMIA 1NHLA 3B4SA 3H1IJ 5KLIB 1FZCA 1NTME 2QE7H 3B5NC 2H7HA 1ZW0A 1LWUC 3AE4C 4N78E 3QWOC 2Y9YA 3JC22 5APXA 1ZR4A 2NPSA 4OGQB 2YMKA 2BCCE 5AW5B 4H0LD 1MFZA 3B5ND 3AEFC 1NTZE 3RK2D 1A02F 5KKZB 1VQNP 3AEBC 1SQXE 4KHXA 2YMYA 1IK7A 1IJDB 3M9BA 3RBXA 3ABVC 2K1AA 1L4AB 2Z5HA 2ZYGA 1RF0C 3EQ2A 1Q7YQ 2JP3A 2YKOA 1J1DB 1S5LE 2D2CB 3RL0B 1KFNA 1NAFA 3PLNA 5APQA 1VQ7P 1NTKD 2B87A 3L74D 1PGJA 3I56P 3D6ZA 1IO4A 1JEKA 2N1TA 2NPSC 4TLFA 4U3FG 3NMDA 2NZ2A 1FZAA 1LTJC 1P84H 1OW8A 4M3LA 3IAOA 1L0LE 3VYIA 3TGUE 1Q2NA 2C9LY 1NTMG 5AW3B 1YTZT 1LTIC 2Q3EA 1KZUB 3LIEA 1G2CB 2AXTH 3CX5I 5AW4B 3TGUG 1L0NJ 1IC2A 1LJ2A 1LP1B 2Y0DA 3A0HH 1H88A 2LKMA 3H6PA 2FKWB 1N7LA 3LW5J 1R5LA 1USDA 2P10A 2Q7CA 3SFDC 1NKZB 1ZRTE 4WBAA 1NGMB 3L36A 1HTLC 4HB1A 1KN7A 2N1TC 3KZIH 1YQ3C 1GW4A 1S9KD 1JTHA 1OX3A 2KIKA 3AE1C 3GG2A 4UB8E 1S5LX 1URQB 1CW5A 2YO2A 4IL6H 1OXZA 1SFCB 2ZXEB 3NTNA 4BRYB 2FFDA 1NAYA 2C9NY 2P58A 4H0LB 1LGHB 3KHUA 3H1KJ 1GL2C 2WSEH 3L70G 3SWKA 1S72P 1HH0A 2CPBA 2GUSA 1KORA 2W27A 4OH8B 1QL2A 5L8RJ 2E75C 3BRVB 2QJKC 1SQXJ 2E74B 3G71P 2XV5A 1HJ0A 1MFTA 1EXIA 4L74A 2A45H 3CMAP 1YBKA 4JYBA 1J1EB 2WSFJ 3L4FA 1L2PA 3L71D 2WT7B 2QG4A 2YO3A 2C0WA 4QMAA 3AE3C 4YXDC 2KNCB 4WY4D 2JJLA 4UB6H 1E79H 2W6JH 1T3JA 3KYQA 3P8CE 3Q5RA 1KYOD 3HRNA 3HUSA 3H1LG 4KJMA 1QL1A 5AW0B 4JF7A 2WPSA 3FX0A 3L72E 3TSIA 1IFPA 1IK9A 3L73E 3MGNA 1URQC 1M56D 5CCHA 1T2KC 3AEAC 1S2EA 1N7SC 3CXHI 4MN4C 1MKMA 5B5EE 3PP5A 2OYIC 1G2CA 1NTZJ 2FYUK 1SQQG 1Q86Q 1LP1A 3SWFA 2IFMA 5GTIE 1KTMA 1PGOA 3EFGA 2YIUC 2D2CC 2IBZD 1HGZA 1PZQA 4HJGH 4W7YA 3RL0C 5CJ4A 4D6TJ 1LTJB 1NJIQ 3R2PA 1IFIA 3GHGA 3Q1MA 3CXHH 2LXBA 5KAIH 2ZFCA 4PJ0E 3L71G 2POHA 3G6EP 3BCCD 3RK3C 3V4QA 1RQUA 1URQA 3VTPC 5KLVK 5H2FE 1NTZK 1Z56A 1EDKA 2FYUJ 1P84E 1YQ4C 2Q6QA 2QM8A 2YXRB 4OGQD 2K9JA 3A0BH 3KDPB 5KAFE 2HR3A 2HLOA 2GM4A 1SQPE 2R5DA 5C39A 3WUTA 2Y9ZA 2HYNA 3CCLP 3MZWB 3VP8A 1QEXA 1SQVD 1JM0A 2Q3IA 3TNUB 2K37A 1SQPD 2PGDA 2Y0CA 3E7KA 5AW8B 3WUVA 1SP4A 3CL3D 4GKGA 1K73Q 4WY4C 2GA1A 3KZIE 1PL5A 1SQQE 2YKQA 1BCCD 1M90Q 1BCCJ 3CX5E 1K9MQ 3AE5C 3NFQA 1WRGA 1YJNP 1GTWA 1PP9J 1VQ9P 3KPEA 2FYZA 3EFFK 3IFMA 4IL6E 1NTMK 1SQBG 3WU2E 1FZCB 2QIWA 1YJWP 1L0ND 1ZOYC 1NKNA 1FU1A 2QJKB 1AV1A 3CD6P 4EI2A 2CK3H 3HUSB 4PD4D 4HKZH 1JB0J 5KJ7A 4ASWA 1BDDA 1KB9E 2DW3A 5B66H 2IDBA 2K88A 5AVRB 3CCQP 1QX8A 2OYHC 4D6TG 1EXJA 2O1JA 3PTZA 5AVYB 2FBWC 3BCCE 1X8YA 1NTKJ 3H1KD 2KB7P 4RO0A 4AYCA 3RL0g 2M5AB 1GMJA 1RE4A 3T97A 1N73A 1M1KQ 4H13B 1NH4A 1BGYG 1DD4A 1RF1A 4RKUJ 4UB6E 3AE9C 3WMM0 3CWBJ 3E1IA 3OW2O 2B87B 2KSJA 5CBNA 5TISH 3CMEP 1DD3A 2JR8A 2WWWA 1SQXD 3H1LJ 1KQLA 1QGKB 4KT0J 1JO5A 1X79B 2IPPA 5KJ7D 2WSSH 1L0LK 3L70E 5KTBA 2RN0A 2BCCG 2SPZA 2QJYB 1SQBE 1U7MA 3IR9A 1LTAC 4YTPC 3M06A 2E75D 5BU8B 4PV1D 4N78D 2I1KA 1RHZB 1RE4C 2IYOA 2K9JB 2KS1A 1VQ5P 5B5EH 1URQD 1NWQA 1N73C 3VMAA 1KYOH 1N86A 2YIUB 5GTIH 3TNUA 4IFDK 4K35A 1ZN5A 2ZT9B 3V4WA 3C1LA 3KXDA 5APVA 3CCMP 4N6JA 1SQQK 1KFMA 2BASA 3CXHE 2E74D 1FDOA 5APUA 1BGYE 1BGYJ 2R44A 3K5BA 3L71E 4DJGA 1LTGC 1SFCA 1H8AA 3B8EB 1L0LG 3CWBD 1PIXA 1SQBK 2ZXXA 1RQVA 2XDJA 1VQPP 4I7ZC 3CC2P 3BCCG 2KSEA 5KAFH 2KLVA 3CPWO 2UWJE 3TDKA 2ITAA 2OGUA 3O8ZA 3VMYA 2OTJP 1PPJG 4IOIH 1K05A 3MP7B 2PRRA 4R4LA 1E5WA 1G1IA 1M57D 1ZLLA 4CPGA 1VQOP 1JCCA 1PFIA 1MV8A 4PV1B 1OVRA 3S1KA 1FOSE 1BE3D 3AEEC 5BVZA 1EDJA 1P84I 1PPJD
chains in the Genus database with same CATH topology
1GK4A 1FZCC 1SFCC 2R32A 1EQ7A 2OARA 1N73B 1S9KE 4HYTB 1XTCC 3TYYA 3A2AA 4JYCA 5AW2B 2WSFH 2HFED 1DH3A 4W7ZA 3I5CA 1JCDA 2KP8A 1RF0A 1M7LA 1YTZI 1SLQA 1IFMA 4ZKUA 1JOCA 4Y99C 1N2DC 3P8MC 3KQGA 3RK2B 4B86A 1GDTA 1IFDA 5AW7B 2Q9IA 4RESB 5AVSB 3H32B 5CCGD 1LTJA 1HWTC 1FJPA 3BVHA 3GHGB 5APSA 4EOTA 5AVXB 3V2NA 3V2RA 2HPCA 1G1JA 4DOJA 4O9BA 1M1JC 2NPSD 2OYIB 3HD7D 3BASA 3C9IA 4ZKPA 1T8ZA 1J1DC 3M91A 1RE3C 1JNMA 2CPSA 1GL2A 5CJ0A 4XA4A 1M1JA 5CCHD 3LW5H 4C7RA 4WY4B 3VOPA 3HE5B 3CLQA 2A45I 1RE3A 2XNXA 2MJZA 2M8RA 2W6AA 3M9QA 3OAKA 1GK6A 2N9BA 1RY3A 3M0DA 3V5BA 1SVFA 4AQRD 5AVTB 4LGDE 5AVZB 4GIFA 3HUSC 1RF1B 3P7KA 1HJBA 2HODA 1FAVA 1NO4A 3P8CD 1YYCA 3B5NA 3H32A 1A02J 3OJAB 2XU6A 1N7SA 3U59A 5APYA 3RL0D 2HPCB 3V2QA 3NXSA 2N1TD 2WPQA 1LT9A 1LTBC 1T2KD 1NU1K 3L37A 1H89A 3BATA 4GT1A 1JY3O 1SFCD 1T3UA 2M3BA 2P7JA 1FZGA 5AVUB 5AW9B 2P1JA 3V2PA 2P2UA 1LT9C 1DX7A 2WITA 1J1EC 1L0NK 3MIWA 4WY4A 3HD7A 5AW6B 3HE4B 2PP6A 3N7NA 3OA7A 5AVQB 2Z5IA 4W80A 1AQ5A 4HH2A 2KOGA 2R5BA 3SWYA 4I2LC 1JY2P 2E42A 2FFDC 2WSCH 2J59M 5KJ7C 3II6A 3VMXA 1OWAA 1ZR2A 3MD0A 1LTSC 2OYHA 1JMMA 2R3CA 3HD7C 1XTGB 3MUDA 4N3YB 3UIAA 1N7SB 1GW3A 4DZOA 1CZQA 1RF1C 3TK1A 3BRTB 1VPCA 5AVVB 2H43A 2IFNA 3VP9A 1JY2N 3RK3D 2Q5UA 1FDMA 2NPSB 1GU4A 2HG5D 2A45G 1L4AD 1LTTC 2O1KA 2XKMA 5CCHC 3M9HA 2OYIA 1MUUA 4I1LA 1N7SD 4WB4A 5APWA 1WT6A 1W2EA 3RK2C 2O01H 2N1TB 2W6BA 1VDFA 3HD7B 1GL2D 2JEEA 2P67A 3GHGC 2I1JA 1FZEA 3P32A 3U1CA 1JUNA 5CCGC 1MZ9A 2WPRA 1M1JB 4IFFA 3A7OA 5AW1B 3VN0A 3U1AA 2Z4EA 1JY3P 3HE5A 2WTYA 5CMZA 1JTHB 3VMZA 5BU5A 3L35A 3MTUE 4C7NB 2H8PD 5AVWB 2FFDB 5CCGA 1SQXK 1FJKA 2VRSA 4AUWA 1CI6B 3HTKA 1KILA 1LWUB 2HODB 1HBWA 3B5NB 2KYVA 1GZLA 1ZV8A 1HUCA 2WT7A 4I6MC 2YNYA 1FOSF 3G3ZA 1SQPK 4EIJA 1LT9B 3M0AA 1SQVK 1KILC 1NTKK 5APTA 1X9VA 4LC1A 2YKPA 4LLHA 2C0XA 3A3YB 3N4XA 3RK3B 2PAJA 1KILD 1FZFA 4XE5B 1L4AA 2GUVA 4IFMA 4C46A 2XZRA 1GD2E 2FXMA 3A5TA 3HE4A 1GU5A 2J58A 5CHXA 1HVVA 2WZ7A 3CI9A 4C7NA 3LIDA 1FZBA 1L4AC 1AFOA 1JY2O 1FBMA 2L5GB 1CI6A 1DEBA 1KILB 1LWUA 3HTKB 1IFNA 2E43A 3M0DC 2OYHB 2IX7C 1J2JB 1JY3N 1HGVA 1IFJA 1NOHA 2H7HA 4Y99B 1CSBA 2QM7A 1NHLA 1FZCA 3B5NC 1LWUC 4N78E 1ZR4A 5APXA 2NPSA 5AW5B 1MFZA 3B5ND 1A02F 3RK2D 4KHXA 2YMYA 1IJDB 3M9BA 2Z5HA 1L4AB 3EQ2A 1RF0C 2YKOA 1J1DB 3RL0B 1KFNA 1NAFA 5APQA 1IO4A 2N1TA 2NPSC 3NMDA 1FZAA 1LTJC 4M3LA 2C9LY 3VYIA 5AW3B 1YTZT 1LTIC 3LIEA 1KZUB 1G2CB 5AW4B 1IC2A 1H88A 2LKMA 3H6PA 2FKWB 1N7LA 2Q7CA 1NKZB 4WBAA 3L36A 1HTLC 2N1TC 1GW4A 1S9KD 1JTHA 1URQB 1CW5A 2YO2A 1OXZA 1SFCB 2ZXEB 3NTNA 2FFDA 2C9NY 1LGHB 1GL2C 2WSEH 1HH0A 2CPBA 2GUSA 2W27A 4OH8B 1QL2A 3BRVB 2XV5A 2A45H 4JYBA 1J1EB 3L4FA 2WT7B 2YO3A 2C0WA 4WY4D 2JJLA 1T3JA 3KYQA 3P8CE 3HRNA 3HUSA 1QL1A 5AW0B 4JF7A 2WPSA 3TSIA 5CCHA 1IK9A 3MGNA 1URQC 1T2KC 1N7SC 2OYIC 3PP5A 1G2CA 2FYUK 3SWFA 2IFMA 3EFGA 1HGZA 3RL0C 5CJ4A 4W7YA 1LTJB 3R2PA 1IFIA 3GHGA 2ZFCA 2POHA 3RK3C 3V4QA 3VTPC 1URQA 5KLVK 1NTZK 1Z56A 2QM8A 1JO5A 3KDPB 2GM4A 2HLOA 2R5DA 2HYNA 3VP8A 2Q3IA 3TNUB 5AW8B 1SP4A 3CL3D 4GKGA 4WY4C 2YKQA 3NFQA 1WRGA 1GTWA 3KPEA 2FYZA 3IFMA 1NTMK 1FZCB 1NKNA 1FU1A 3HUSB 5KJ7A 5AVRB 2OYHC 2O1JA 5AVYB 1X8YA 2KB7P 4AYCA 1RE4A 3T97A 1N73A 1NH4A 1RF1A 3WMM0 3E1IA 2KSJA 2WWWA 1KQLA 1X79B 2IPPA 5KJ7D 5KTBA 1L0LK 3IR9A 1LTAC 3M06A 5BU8B 4N78D 2I1KA 1NWQA 1RE4C 1N73C 1URQD 1N86A 3TNUA 4IFDK 1ZN5A 3V4WA 5APVA 4N6JA 1SQQK 1KFMA 2BASA 5APUA 1LTGC 1SFCA 1H8AA 3B8EB 1SQBK 2XDJA 2KLVA 3O8ZA 3VMYA 1E5WA 1G1IA 1ZLLA 1PFIA 1JCCA 1MV8A 1FOSE 5BVZA 1GL2B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFI A;  1HH0 A;  2CPB A;  2CPS A;  1FDM A;  2C0X A;  1NH4 A;  2MJZ A;  1HGZ A;  1IFD A;  2C0W A;  1HGV A;  1IFJ A; 
#chains in the Genus database with same CATH topology
 1GK4 A;  1SQB J;  4ZMD A;  3Q2Y A;  1FZC C;  1SFC C;  2R32 A;  3CX5 H;  1PP9 G;  1EQ7 A;  2KNC A;  2OAR A;  2WQY C;  3T97 B;  1N73 B;  1K04 A;  2N9Y B;  2WPV B;  1BCC G;  1S3J A;  2E76 D;  1S9K E;  1VQK P;  1S1C X;  3H1J D;  3USS A;  1S5L H;  1W2B O;  2E74 C;  4HYT B;  1XTC C;  1Q81 Q;  3D70 A;  2A06 E;  2JDI H;  3A2A A;  3TYY A;  2FYN B;  4JYC A;  4U3F J;  3GLM A;  1EC5 A;  2WSF H;  4R4M A;  5AW2 B;  2HFE D;  2KLU A;  2RMZ A;  2AXC A;  3FWN A;  4W7Z A;  3I5C A;  1DH3 A;  1JCD A;  2KP8 A;  1EDL A;  1RF0 A;  1M7L A;  1YTZ I;  2ZAE B;  4OVN F;  1YHQ P;  2G3A A;  2O3J A;  1SLQ A;  2ZVO B;  4PD4 E;  2AXT E;  1IFM A;  4ZKU A;  1JOC A;  2KS1 B;  4Y99 C;  1N2D C;  2FYU G;  2Y0E A;  3KQG A;  3P8M C;  3RK2 B;  4B86 A;  3H1I E;  2RH0 A;  3IF4 A;  1IFD A;  1GDT A;  1PGP A;  5AW7 B;  2BCC J;  1R5S A;  2Q9I A;  3CCE P;  2O01 N;  1KQG B;  1KB9 I;  1NTK E;  3H32 B;  4K3A A;  4RES B;  4WWI A;  1LTJ A;  5AVS B;  5CCG D;  1HWT C;  3BVH A;  1SQB D;  1FJP A;  1AJY A;  1OVU A;  2WSC J;  3AE6 C;  3GHG B;  2KK7 A;  5APS A;  5AVX B;  4EOT A;  3FGA D;  4JPZ B;  5CBO A;  3V2N A;  1U7J A;  2BEQ D;  1KIL E;  3V2R A;  4NPF X;  3Q5S A;  3GF3 A;  1SQQ D;  2ZT9 D;  3H1J J;  1G1J A;  1SQQ J;  5E79 E;  2HPC A;  4DOJ A;  4O9B A;  3Q3D A;  2RKL A;  1M1J C;  5KKZ C;  2Q1K A;  2NPS D;  2OYI B;  3HD7 D;  3BAS A;  3CCV P;  3H1J G;  1SQV E;  3C9I A;  4L75 A;  4ZKP A;  1T8Z A;  4OWF A;  4D6T E;  1AQT A;  1J1D C;  1QLE D;  3TF5 A;  3M91 A;  1RE3 C;  1JNM A;  2LXC B;  5KLV E;  2B88 A;  2W90 A;  1EZV G;  3H1L D;  2CPS A;  1GL2 A;  2FYU E;  4GOD A;  5CJ0 A;  3SFE C;  1FS0 E;  3GMA A;  1AVO A;  4XA4 A;  1X22 A;  1NU1 D;  1M1J A;  1NU1 J;  1ZXG A;  3L75 D;  3RK3 E;  5CCH D;  2WVR A;  2G8Y A;  3LW5 H;  3F89 A;  3H1I D;  4WY4 B;  1OW7 A;  4BXL A;  3VOP A;  1KYO I;  4C7R A;  3QH9 A;  4DT0 A;  3E1R A;  3HE5 B;  3CCJ P;  3CLQ A;  1WMK A;  2A45 I;  1PPJ E;  1RE3 A;  2XNX A;  4NPD A;  5GTH E;  2MJZ A;  3AE2 C;  2M8R A;  2W6A A;  3M9Q A;  2E5T A;  3OAK A;  1GK6 A;  2N9B A;  1OZH A;  1RY3 A;  2AEM A;  1SVF A;  2QJY C;  3M0D A;  3GW6 A;  5AVT B;  3V5B A;  4AQR D;  1VQ4 P;  1VF5 D;  3L70 D;  4WVZ A;  4L73 A;  1BSN A;  3L70 J;  3O6Q B;  4LGD E;  3V6I A;  1UII A;  2M5A A;  3PHL A;  5AVZ B;  4GIF A;  3HUS C;  3CC7 P;  1RF1 B;  1LNQ A;  2A06 D;  2AEF A;  1X0T A;  2K3R A;  2HOD A;  3P7K A;  1FAV A;  1NO4 A;  3P8C D;  5KLV G;  1HJB A;  2IBZ E;  1YYC A;  3B5N A;  3L71 J;  3H32 A;  1A02 J;  3OJA B;  2ZT9 C;  3C8V A;  2IBZ G;  2XU6 A;  1N7S A;  5KAI E;  3U59 A;  2A06 G;  4PJ0 H;  4XFJ A;  1SQP J;  1ZP0 C;  3BCC J;  5APY A;  3F5H A;  5H2F H;  3RL0 D;  1L0L D;  2HPC B;  1L0L J;  3H25 A;  3TGU J;  1EZV E;  3A0B E;  3I55 P;  2KI7 B;  3V2Q A;  2N1T D;  2WPQ A;  3NXS A;  1LT9 A;  1BDC A;  2LR2 A;  3GF7 A;  1LTB C;  4H13 C;  3L74 E;  1T2K D;  2JKV A;  3CCR P;  1NU1 K;  1VF5 B;  2XND H;  2E76 C;  2M3E A;  3L37 A;  3BAT A;  3L73 J;  3L74 G;  3L73 D;  2JO1 A;  4GT1 A;  1JY3 O;  2MKV A;  1SFC D;  2WMM A;  1PP9 E;  1T3U A;  2M3B A;  3JCU E;  4Z1M H;  5M1B A;  1W5C E;  2H88 C;  2P7J A;  1KC8 Q;  1FZG A;  2M0B A;  1BCC E;  5AVU B;  4PD4 I;  5AW9 B;  1YIT P;  2P1J A;  3V2P A;  2P2U A;  4YPC A;  1DEE G;  2BCC D;  1VQM P;  4L76 A;  1LT9 C;  1DX7 A;  2WIT A;  3MHV A;  1TU3 F;  1J1E C;  1L0N K;  3MIW A;  4H44 D;  4WY4 A;  3HD7 A;  3MUD C;  5AW6 B;  3HE4 B;  1NTM D;  1OIP A;  1KB9 H;  2FYN C;  2FYU D;  2IZ1 A;  2PP6 A;  3N7N A;  2FXP A;  3OA7 A;  5TIS E;  3TGU D;  5AVQ B;  2Z5I A;  3ITK A;  4W80 A;  1AQ5 A;  3PH0 A;  4HH2 A;  2KOG A;  2QVA A;  2KUB A;  1NYH A;  2R5B A;  4H13 D;  4I2L C;  3SWY A;  1JY2 P;  5TJH A;  2E42 A;  3A0H E;  4H44 B;  1NTK G;  4NPE A;  5EFW B;  4U3F D;  1Y9B A;  2WSC H;  2FFD C;  2J59 M;  5KJ7 C;  3II6 A;  1SQP G;  1L0N E;  1OWA A;  2FY8 A;  5DJU B;  3MD0 A;  1LTS C;  3VMX A;  1D7M A;  1ZR2 A;  1R8E A;  5KLI C;  2OYH A;  1JMM A;  3L72 G;  2R3C A;  1VF5 C;  3CX5 D;  1XTG B;  3HD7 C;  3MUD A;  4N3Y B;  1NU1 E;  4EYY Q;  1KV4 A;  2JWD A;  3UIA A;  1N7S B;  4UB8 H;  1GW3 A;  4DZO A;  5GTH H;  1CZQ A;  5KLV D;  1Y8A A;  2FXO A;  1RF1 C;  3L72 D;  3TK1 A;  1BE3 G;  3BRT B;  1USE A;  1VPC A;  5AVV B;  2B9B A;  1FDI A;  2W83 C;  2ZYA A;  2H43 A;  1H89 A;  1KYO E;  2I8D A;  2OTL P;  3B71 A;  2IFN A;  3FXE A;  3H1H D;  1JY2 N;  3AEG C;  3VP9 A;  3L75 E;  2Q5U A;  3L75 J;  2NPS B;  3PRJ A;  3RK3 D;  4BWN A;  2HG5 D;  1YIJ P;  1GU4 A;  1FDM A;  2A45 G;  4ZNC A;  3L75 G;  1L4A D;  1OFC X;  1LTT C;  2O1K A;  2XKM A;  5K5G B;  1NVO A;  4GDO A;  3H1H G;  2QEX P;  5CCH C;  4DCK A;  4H44 C;  1H0T B;  2QSI A;  3M9H A;  2H89 C;  1N8R Q;  2OYI A;  1MUU A;  2IBZ I;  4I1L A;  1N7S D;  4WB4 A;  5APW A;  1WT6 A;  1W2E A;  2O01 J;  2O01 H;  3RK2 C;  3CC4 P;  2N1T B;  1JMB A;  1VDF A;  2W6B A;  3AE7 C;  1VQL P;  3HD7 B;  1GL2 D;  2JEE A;  3AE8 C;  3G4S P;  2KZJ A;  3L72 J;  1UIX A;  1Y47 A;  3SSU A;  2P67 A;  1BE3 E;  3GHG C;  3G9R A;  4GOF A;  1P84 D;  1FZE A;  1PV3 A;  2I1J A;  1EZV I;  3JCU H;  3P32 A;  3U1C A;  2AEJ A;  5CCG C;  1MZ9 A;  1JUN A;  2WPR A;  4Y28 J;  1M1J B;  4IFF A;  1NTZ G;  1KMI Z;  3A7O A;  2QJP B;  5AW1 B;  2E75 B;  3VN0 A;  1GL2 B;  3W68 A;  3U1A A;  2Z4E A;  1SQV G;  1JY3 P;  3HE5 A;  2WTY A;  4IL6 X;  5CMZ A;  1NTZ D;  1JTH B;  2OYO A;  2ZVN B;  1ZME C;  3IN6 A;  3VMZ A;  2V4H A;  3L35 A;  3MTU E;  4RJT A;  5BU5 A;  4C7N B;  2H8P D;  1S4X A;  5AVW B;  2NRG A;  4BRY A;  2FFD B;  5CCG A;  3O6Q A;  1SQX K;  1FJK A;  4D6T D;  4PD4 H;  1VQ8 P;  2VRS A;  3H1H E;  3W67 A;  1KD1 Q;  1M8O B;  2W8Z A;  4AUW A;  1CI6 B;  3AEC C;  1KIL A;  1LWU B;  2HOD B;  2J5U A;  3HTK A;  1HBW A;  1HF9 A;  3S4R A;  3B5N B;  4OGQ C;  4EDF A;  2KYV A;  1LT1 A;  1GZL A;  3CWB E;  2E76 B;  3CCS P;  3L73 G;  1EDI A;  3L74 J;  4YXW H;  1ZV8 A;  1QVG O;  1YI2 P;  3RBZ A;  1SQX G;  1HUC A;  3CWB G;  4U7J A;  2WT7 A;  4JQ0 D;  4I6M C;  3H1K E;  2YNY A;  1PP9 D;  1FOS F;  2R3S A;  1QVF O;  4GOE A;  1OW6 A;  2KXP B;  2IYP A;  3G3Z A;  4H0L C;  5E79 H;  1DIP A;  1IZN B;  3H1K G;  1SQP K;  3WU2 H;  3FXD A;  2YXQ B;  1ZRT D;  1VL2 A;  1H0T A;  1KQF B;  2E5Y A;  4EIJ A;  1FE6 A;  1LT9 B;  3M0A A;  1SQV K;  1KIL C;  1NTK K;  5APT A;  1X9V A;  1SS1 A;  4LC1 A;  4U3F E;  2YKP A;  4LLH A;  2OQQ A;  5B66 E;  2B89 A;  2C0X A;  2WSE J;  3R4Y A;  3A3Y B;  1FC2 C;  3N4X A;  5KLV J;  3CCU P;  3RK3 B;  2PAJ A;  4A7P A;  1KIL D;  1FZF A;  2KZI A;  3CXH D;  4I7Z B;  1L0N G;  1OVV A;  1RH5 B;  4XE5 B;  1L4A A;  2GUV A;  2K9Y A;  4IFM A;  1NTM J;  3H1H J;  4C46 A;  1Q90 D;  1U57 A;  2XZR A;  2PFX A;  1GD2 E;  2ZJS E;  3JSV C;  4PV1 C;  2FXM A;  2V7Q J;  2V7Q H;  3A5T A;  1Q82 Q;  1AA0 A;  3AED C;  3HE4 A;  1YJ9 P;  3Q5P A;  1GU5 A;  2J58 A;  1VQ6 P;  3H1L E;  5CHX A;  1HVV A;  1NU1 G;  2D2C D;  2WZ7 A;  3CI9 A;  1KB9 D;  1BE3 J;  3S9O A;  4C7N A;  2ZYD A;  3LID A;  1FZB A;  1L4A C;  1AFO A;  1K8A Q;  1BSH A;  2OTK E;  2QJP C;  1JY2 O;  4JBZ A;  1FBM A;  2L5G B;  1CI6 A;  1DEB A;  1KIL B;  1LWU A;  2JWA A;  2QRX A;  3EWK A;  3H1J E;  1IFN A;  3HTK B;  3WUU A;  1KQS O;  1EZV D;  2QA4 P;  2E43 A;  3M0D C;  2OYH B;  2IX7 C;  3D6Y A;  1J2J B;  1SQV J;  3ZDM A;  1JY3 N;  1BGY D;  3PJS K;  4TT3 H;  5DJT B;  1HGV A;  1IFJ A;  1NOH A;  1T6A A;  2IZ0 A;  2BEZ F;  2L91 A;  3FWL A;  4Y99 B;  1CSB A;  3RGU A;  1AVY A;  4ASV A;  3D71 A;  3H1I G;  1PGQ A;  2QM7 A;  1OMI A;  1NHL A;  3B4S A;  3H1I J;  5KLI B;  1FZC A;  1NTM E;  2QE7 H;  3B5N C;  2H7H A;  1ZW0 A;  1LWU C;  3AE4 C;  4N78 E;  3QWO C;  2Y9Y A;  3JC2 2;  5APX A;  1ZR4 A;  2NPS A;  4OGQ B;  2YMK A;  2BCC E;  5AW5 B;  4H0L D;  1MFZ A;  3B5N D;  3AEF C;  1NTZ E;  3RK2 D;  1A02 F;  5KKZ B;  1VQN P;  3AEB C;  1SQX E;  4KHX A;  2YMY A;  1IK7 A;  1IJD B;  3M9B A;  3RBX A;  3ABV C;  2K1A A;  1L4A B;  2Z5H A;  2ZYG A;  1RF0 C;  3EQ2 A;  1Q7Y Q;  2JP3 A;  2YKO A;  1J1D B;  1S5L E;  2D2C B;  3RL0 B;  1KFN A;  1NAF A;  3PLN A;  5APQ A;  1VQ7 P;  1NTK D;  2B87 A;  3L74 D;  1PGJ A;  3I56 P;  3D6Z A;  1IO4 A;  1JEK A;  2N1T A;  2NPS C;  4TLF A;  4U3F G;  3NMD A;  2NZ2 A;  1FZA A;  1LTJ C;  1P84 H;  1OW8 A;  4M3L A;  3IAO A;  1L0L E;  3VYI A;  3TGU E;  1Q2N A;  2C9L Y;  1NTM G;  5AW3 B;  1YTZ T;  1LTI C;  2Q3E A;  1KZU B;  3LIE A;  1G2C B;  2AXT H;  3CX5 I;  5AW4 B;  3TGU G;  1L0N J;  1IC2 A;  1LJ2 A;  1LP1 B;  2Y0D A;  3A0H H;  1H88 A;  2LKM A;  3H6P A;  2FKW B;  1N7L A;  3LW5 J;  1R5L A;  1USD A;  2P10 A;  2Q7C A;  3SFD C;  1NKZ B;  1ZRT E;  4WBA A;  1NGM B;  3L36 A;  1HTL C;  4HB1 A;  1KN7 A;  2N1T C;  3KZI H;  1YQ3 C;  1GW4 A;  1S9K D;  1JTH A;  1OX3 A;  2KIK A;  3AE1 C;  3GG2 A;  4UB8 E;  1S5L X;  1URQ B;  1CW5 A;  2YO2 A;  4IL6 H;  1OXZ A;  1SFC B;  2ZXE B;  3NTN A;  4BRY B;  2FFD A;  1NAY A;  2C9N Y;  2P58 A;  4H0L B;  1LGH B;  3KHU A;  3H1K J;  1GL2 C;  2WSE H;  3L70 G;  3SWK A;  1S72 P;  1HH0 A;  2CPB A;  2GUS A;  1KOR A;  2W27 A;  4OH8 B;  1QL2 A;  5L8R J;  2E75 C;  3BRV B;  2QJK C;  1SQX J;  2E74 B;  3G71 P;  2XV5 A;  1HJ0 A;  1MFT A;  1EXI A;  4L74 A;  2A45 H;  3CMA P;  1YBK A;  4JYB A;  1J1E B;  2WSF J;  3L4F A;  1L2P A;  3L71 D;  2WT7 B;  2QG4 A;  2YO3 A;  2C0W A;  4QMA A;  3AE3 C;  4YXD C;  2KNC B;  4WY4 D;  2JJL A;  4UB6 H;  1E79 H;  2W6J H;  1T3J A;  3KYQ A;  3P8C E;  3Q5R A;  1KYO D;  3HRN A;  3HUS A;  3H1L G;  4KJM A;  1QL1 A;  5AW0 B;  4JF7 A;  2WPS A;  3FX0 A;  3L72 E;  3TSI A;  1IFP A;  1IK9 A;  3L73 E;  3MGN A;  1URQ C;  1M56 D;  5CCH A;  1T2K C;  3AEA C;  1S2E A;  1N7S C;  3CXH I;  4MN4 C;  1MKM A;  5B5E E;  3PP5 A;  2OYI C;  1G2C A;  1NTZ J;  2FYU K;  1SQQ G;  1Q86 Q;  1LP1 A;  3SWF A;  2IFM A;  5GTI E;  1KTM A;  1PGO A;  3EFG A;  2YIU C;  2D2C C;  2IBZ D;  1HGZ A;  1PZQ A;  4HJG H;  4W7Y A;  3RL0 C;  5CJ4 A;  4D6T J;  1LTJ B;  1NJI Q;  3R2P A;  1IFI A;  3GHG A;  3Q1M A;  3CXH H;  2LXB A;  5KAI H;  2ZFC A;  4PJ0 E;  3L71 G;  2POH A;  3G6E P;  3BCC D;  3RK3 C;  3V4Q A;  1RQU A;  1URQ A;  3VTP C;  5KLV K;  5H2F E;  1NTZ K;  1Z56 A;  1EDK A;  2FYU J;  1P84 E;  1YQ4 C;  2Q6Q A;  2QM8 A;  2YXR B;  4OGQ D;  2K9J A;  3A0B H;  3KDP B;  5KAF E;  2HR3 A;  2HLO A;  2GM4 A;  1SQP E;  2R5D A;  5C39 A;  3WUT A;  2Y9Z A;  2HYN A;  3CCL P;  3MZW B;  3VP8 A;  1QEX A;  1SQV D;  1JM0 A;  2Q3I A;  3TNU B;  2K37 A;  1SQP D;  2PGD A;  2Y0C A;  3E7K A;  5AW8 B;  3WUV A;  1SP4 A;  3CL3 D;  4GKG A;  1K73 Q;  4WY4 C;  2GA1 A;  3KZI E;  1PL5 A;  1SQQ E;  2YKQ A;  1BCC D;  1M90 Q;  1BCC J;  3CX5 E;  1K9M Q;  3AE5 C;  3NFQ A;  1WRG A;  1YJN P;  1GTW A;  1PP9 J;  1VQ9 P;  3KPE A;  2FYZ A;  3EFF K;  3IFM A;  4IL6 E;  1NTM K;  1SQB G;  3WU2 E;  1FZC B;  2QIW A;  1YJW P;  1L0N D;  1ZOY C;  1NKN A;  1FU1 A;  2QJK B;  1AV1 A;  3CD6 P;  4EI2 A;  2CK3 H;  3HUS B;  4PD4 D;  4HKZ H;  1JB0 J;  5KJ7 A;  4ASW A;  1BDD A;  1KB9 E;  2DW3 A;  5B66 H;  2IDB A;  2K88 A;  5AVR B;  3CCQ P;  1QX8 A;  2OYH C;  4D6T G;  1EXJ A;  2O1J A;  3PTZ A;  5AVY B;  2FBW C;  3BCC E;  1X8Y A;  1NTK J;  3H1K D;  2KB7 P;  4RO0 A;  4AYC A;  3RL0 g;  2M5A B;  1GMJ A;  1RE4 A;  3T97 A;  1N73 A;  1M1K Q;  4H13 B;  1NH4 A;  1BGY G;  1DD4 A;  1RF1 A;  4RKU J;  4UB6 E;  3AE9 C;  3WMM 0;  3CWB J;  3E1I A;  3OW2 O;  2B87 B;  2KSJ A;  5CBN A;  5TIS H;  3CME P;  1DD3 A;  2JR8 A;  2WWW A;  1SQX D;  3H1L J;  1KQL A;  1QGK B;  4KT0 J;  1JO5 A;  1X79 B;  2IPP A;  5KJ7 D;  2WSS H;  1L0L K;  3L70 E;  5KTB A;  2RN0 A;  2BCC G;  2SPZ A;  2QJY B;  1SQB E;  1U7M A;  3IR9 A;  1LTA C;  4YTP C;  3M06 A;  2E75 D;  5BU8 B;  4PV1 D;  4N78 D;  2I1K A;  1RHZ B;  1RE4 C;  2IYO A;  2K9J B;  2KS1 A;  1VQ5 P;  5B5E H;  1URQ D;  1NWQ A;  1N73 C;  3VMA A;  1KYO H;  1N86 A;  2YIU B;  5GTI H;  3TNU A;  4IFD K;  4K35 A;  1ZN5 A;  2ZT9 B;  3V4W A;  3C1L A;  3KXD A;  5APV A;  3CCM P;  4N6J A;  1SQQ K;  1KFM A;  2BAS A;  3CXH E;  2E74 D;  1FDO A;  5APU A;  1BGY E;  1BGY J;  2R44 A;  3K5B A;  3L71 E;  4DJG A;  1LTG C;  1SFC A;  1H8A A;  3B8E B;  1L0L G;  3CWB D;  1PIX A;  1SQB K;  2ZXX A;  1RQV A;  2XDJ A;  1VQP P;  4I7Z C;  3CC2 P;  3BCC G;  2KSE A;  5KAF H;  2KLV A;  3CPW O;  2UWJ E;  3TDK A;  2ITA A;  2OGU A;  3O8Z A;  3VMY A;  2OTJ P;  1PPJ G;  4IOI H;  1K05 A;  3MP7 B;  2PRR A;  4R4L A;  1E5W A;  1G1I A;  1M57 D;  1ZLL A;  4CPG A;  1VQO P;  1JCC A;  1PFI A;  1MV8 A;  4PV1 B;  1OVR A;  3S1K A;  1FOS E;  1BE3 D;  3AEE C;  5BVZ A;  1EDJ A;  1P84 I;  1PPJ D; 
#chains in the Genus database with same CATH homology
 1GK4 A;  1FZC C;  1SFC C;  2R32 A;  1EQ7 A;  2OAR A;  1N73 B;  1S9K E;  4HYT B;  1XTC C;  3TYY A;  3A2A A;  4JYC A;  5AW2 B;  2WSF H;  2HFE D;  1DH3 A;  4W7Z A;  3I5C A;  1JCD A;  2KP8 A;  1RF0 A;  1M7L A;  1YTZ I;  1SLQ A;  1IFM A;  4ZKU A;  1JOC A;  4Y99 C;  1N2D C;  3P8M C;  3KQG A;  3RK2 B;  4B86 A;  1GDT A;  1IFD A;  5AW7 B;  2Q9I A;  4RES B;  5AVS B;  3H32 B;  5CCG D;  1LTJ A;  1HWT C;  1FJP A;  3BVH A;  3GHG B;  5APS A;  4EOT A;  5AVX B;  3V2N A;  3V2R A;  2HPC A;  1G1J A;  4DOJ A;  4O9B A;  1M1J C;  2NPS D;  2OYI B;  3HD7 D;  3BAS A;  3C9I A;  4ZKP A;  1T8Z A;  1J1D C;  3M91 A;  1RE3 C;  1JNM A;  2CPS A;  1GL2 A;  5CJ0 A;  4XA4 A;  1M1J A;  5CCH D;  3LW5 H;  4C7R A;  4WY4 B;  3VOP A;  3HE5 B;  3CLQ A;  2A45 I;  1RE3 A;  2XNX A;  2MJZ A;  2M8R A;  2W6A A;  3M9Q A;  3OAK A;  1GK6 A;  2N9B A;  1RY3 A;  3M0D A;  3V5B A;  1SVF A;  4AQR D;  5AVT B;  4LGD E;  5AVZ B;  4GIF A;  3HUS C;  1RF1 B;  3P7K A;  1HJB A;  2HOD A;  1FAV A;  1NO4 A;  3P8C D;  1YYC A;  3B5N A;  3H32 A;  1A02 J;  3OJA B;  2XU6 A;  1N7S A;  3U59 A;  5APY A;  3RL0 D;  2HPC B;  3V2Q A;  3NXS A;  2N1T D;  2WPQ A;  1LT9 A;  1LTB C;  1T2K D;  1NU1 K;  3L37 A;  1H89 A;  3BAT A;  4GT1 A;  1JY3 O;  1SFC D;  1T3U A;  2M3B A;  2P7J A;  1FZG A;  5AVU B;  5AW9 B;  2P1J A;  3V2P A;  2P2U A;  1LT9 C;  1DX7 A;  2WIT A;  1J1E C;  1L0N K;  3MIW A;  4WY4 A;  3HD7 A;  5AW6 B;  3HE4 B;  2PP6 A;  3N7N A;  3OA7 A;  5AVQ B;  2Z5I A;  4W80 A;  1AQ5 A;  4HH2 A;  2KOG A;  2R5B A;  3SWY A;  4I2L C;  1JY2 P;  2E42 A;  2FFD C;  2WSC H;  2J59 M;  5KJ7 C;  3II6 A;  3VMX A;  1OWA A;  1ZR2 A;  3MD0 A;  1LTS C;  2OYH A;  1JMM A;  2R3C A;  3HD7 C;  1XTG B;  3MUD A;  4N3Y B;  3UIA A;  1N7S B;  1GW3 A;  4DZO A;  1CZQ A;  1RF1 C;  3TK1 A;  3BRT B;  1VPC A;  5AVV B;  2H43 A;  2IFN A;  3VP9 A;  1JY2 N;  3RK3 D;  2Q5U A;  1FDM A;  2NPS B;  1GU4 A;  2HG5 D;  2A45 G;  1L4A D;  1LTT C;  2O1K A;  2XKM A;  5CCH C;  3M9H A;  2OYI A;  1MUU A;  4I1L A;  1N7S D;  4WB4 A;  5APW A;  1WT6 A;  1W2E A;  3RK2 C;  2O01 H;  2N1T B;  2W6B A;  1VDF A;  3HD7 B;  1GL2 D;  2JEE A;  2P67 A;  3GHG C;  2I1J A;  1FZE A;  3P32 A;  3U1C A;  1JUN A;  5CCG C;  1MZ9 A;  2WPR A;  1M1J B;  4IFF A;  3A7O A;  5AW1 B;  3VN0 A;  3U1A A;  2Z4E A;  1JY3 P;  3HE5 A;  2WTY A;  5CMZ A;  1JTH B;  3VMZ A;  5BU5 A;  3L35 A;  3MTU E;  4C7N B;  2H8P D;  5AVW B;  2FFD B;  5CCG A;  1SQX K;  1FJK A;  2VRS A;  4AUW A;  1CI6 B;  3HTK A;  1KIL A;  1LWU B;  2HOD B;  1HBW A;  3B5N B;  2KYV A;  1GZL A;  1ZV8 A;  1HUC A;  2WT7 A;  4I6M C;  2YNY A;  1FOS F;  3G3Z A;  1SQP K;  4EIJ A;  1LT9 B;  3M0A A;  1SQV K;  1KIL C;  1NTK K;  5APT A;  1X9V A;  4LC1 A;  2YKP A;  4LLH A;  2C0X A;  3A3Y B;  3N4X A;  3RK3 B;  2PAJ A;  1KIL D;  1FZF A;  4XE5 B;  1L4A A;  2GUV A;  4IFM A;  4C46 A;  2XZR A;  1GD2 E;  2FXM A;  3A5T A;  3HE4 A;  1GU5 A;  2J58 A;  5CHX A;  1HVV A;  2WZ7 A;  3CI9 A;  4C7N A;  3LID A;  1FZB A;  1L4A C;  1AFO A;  1JY2 O;  1FBM A;  2L5G B;  1CI6 A;  1DEB A;  1KIL B;  1LWU A;  3HTK B;  1IFN A;  2E43 A;  3M0D C;  2OYH B;  2IX7 C;  1J2J B;  1JY3 N;  1HGV A;  1IFJ A;  1NOH A;  2H7H A;  4Y99 B;  1CSB A;  2QM7 A;  1NHL A;  1FZC A;  3B5N C;  1LWU C;  4N78 E;  1ZR4 A;  5APX A;  2NPS A;  5AW5 B;  1MFZ A;  3B5N D;  1A02 F;  3RK2 D;  4KHX A;  2YMY A;  1IJD B;  3M9B A;  2Z5H A;  1L4A B;  3EQ2 A;  1RF0 C;  2YKO A;  1J1D B;  3RL0 B;  1KFN A;  1NAF A;  5APQ A;  1IO4 A;  2N1T A;  2NPS C;  3NMD A;  1FZA A;  1LTJ C;  4M3L A;  2C9L Y;  3VYI A;  5AW3 B;  1YTZ T;  1LTI C;  3LIE A;  1KZU B;  1G2C B;  5AW4 B;  1IC2 A;  1H88 A;  2LKM A;  3H6P A;  2FKW B;  1N7L A;  2Q7C A;  1NKZ B;  4WBA A;  3L36 A;  1HTL C;  2N1T C;  1GW4 A;  1S9K D;  1JTH A;  1URQ B;  1CW5 A;  2YO2 A;  1OXZ A;  1SFC B;  2ZXE B;  3NTN A;  2FFD A;  2C9N Y;  1LGH B;  1GL2 C;  2WSE H;  1HH0 A;  2CPB A;  2GUS A;  2W27 A;  4OH8 B;  1QL2 A;  3BRV B;  2XV5 A;  2A45 H;  4JYB A;  1J1E B;  3L4F A;  2WT7 B;  2YO3 A;  2C0W A;  4WY4 D;  2JJL A;  1T3J A;  3KYQ A;  3P8C E;  3HRN A;  3HUS A;  1QL1 A;  5AW0 B;  4JF7 A;  2WPS A;  3TSI A;  5CCH A;  1IK9 A;  3MGN A;  1URQ C;  1T2K C;  1N7S C;  2OYI C;  3PP5 A;  1G2C A;  2FYU K;  3SWF A;  2IFM A;  3EFG A;  1HGZ A;  3RL0 C;  5CJ4 A;  4W7Y A;  1LTJ B;  3R2P A;  1IFI A;  3GHG A;  2ZFC A;  2POH A;  3RK3 C;  3V4Q A;  3VTP C;  1URQ A;  5KLV K;  1NTZ K;  1Z56 A;  2QM8 A;  1JO5 A;  3KDP B;  2GM4 A;  2HLO A;  2R5D A;  2HYN A;  3VP8 A;  2Q3I A;  3TNU B;  5AW8 B;  1SP4 A;  3CL3 D;  4GKG A;  4WY4 C;  2YKQ A;  3NFQ A;  1WRG A;  1GTW A;  3KPE A;  2FYZ A;  3IFM A;  1NTM K;  1FZC B;  1NKN A;  1FU1 A;  3HUS B;  5KJ7 A;  5AVR B;  2OYH C;  2O1J A;  5AVY B;  1X8Y A;  2KB7 P;  4AYC A;  1RE4 A;  3T97 A;  1N73 A;  1NH4 A;  1RF1 A;  3WMM 0;  3E1I A;  2KSJ A;  2WWW A;  1KQL A;  1X79 B;  2IPP A;  5KJ7 D;  5KTB A;  1L0L K;  3IR9 A;  1LTA C;  3M06 A;  5BU8 B;  4N78 D;  2I1K A;  1NWQ A;  1RE4 C;  1N73 C;  1URQ D;  1N86 A;  3TNU A;  4IFD K;  1ZN5 A;  3V4W A;  5APV A;  4N6J A;  1SQQ K;  1KFM A;  2BAS A;  5APU A;  1LTG C;  1SFC A;  1H8A A;  3B8E B;  1SQB K;  2XDJ A;  2KLV A;  3O8Z A;  3VMY A;  1E5W A;  1G1I A;  1ZLL A;  1PFI A;  1JCC A;  1MV8 A;  1FOS E;  5BVZ A;  1GL2 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...