2CPSA

Solution nmr structures of the major coat protein of filamentous bacteriophage m13 solubilized in sodium dodecyl sulphate micelles, 25 lowest energy structures
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFNSLQASATEYIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the M13 major coat protein in detergent micelles: a basis for a model of phage assembly involving specific residues.
pubmed doi rcsb
source organism Enterobacteria phage m13
molecule tags Viral protein
molecule keywords M13 MAJOR COAT PROTEIN
total genus 9
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 1998-04-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2cpsA00
1HGVA 1IFJA 2C0XA 2CPSA 1HGZA 1IFDA 2C0WA 2MJZA 2CPBA 1HH0A 1FDMA 1IFIA 1NH4A
chains in the Genus database with same CATH superfamily
1RE3C 2WSCJ 1SQXE 3TGUE 2QEXP 3V2RA 1RE4C 3TNUA 3W67A 5AVWB 1NWQA 3H1IG 3JCUE 1BDCA 3SFDC 1A02F 1PPJD 2W8ZA 4JBZA 1LTGC 3V4QA 1N86A 2G3AA 5KKZC 2POHA 2M3BA 1GDTA 5CBNA 5CCGD 2BEZF 1JY2N 2Q6QA 1L0NE 5AVSB 4YPCA 1OMIA 1QL1A 3JC22 3L74E 3L71E 3BASA 2HLOA 3CI9A 2PP6A 1NAYA 1PP9G 2M5AA 3AE4C 3CWBD 3MGNA 1JCDA 2OQQA 3CMAP 1OFCX 1PGPA 4PD4I 1S9KE 2I1JA 3SWFA 1GTWA 2K9YA 1EXIA 1K05A 3TSIA 1KB9I 2P67A 5CCGC 1GL2A 2AXTE 2JJLA 2M3EA 1N73B 2KSEA 1S9KD 2C0XA 3GHGA 1KB9D 2L5GB 3HRNA 3MD0A 3D6YA 1ZP0C 2FXPA 3LIDA 1QVGO 3H1LE 2NPSB 1YTZI 4PD4D 1FDIA 4N6JA 1IFMA 1LT9A 3O6QB 3A0BE 1SQBJ 2VRSA 4GOFA 2O1JA 1SQQE 2PRRA 5H2FE 1OIPA 1KFNA 3S9OA 4M3LA 1MUUA 2V7QJ 1LTSC 3T97B 3U1AA 5KLIB 1LT9C 2QM7A 1NTZD 1X79B 3M91A 2N9YB 2E76C 1L0LD 1P84H 1PPJG 3H1HD 3L74J 1PV3A 1IO4A 5KAIE 1VQ4P 1IK9A 2SPZA 4ZMDA 1E79H 3GW6A 2UWJE 1ZR2A 4AYCA 2KLVA 1N73A 1S5LE 1P84I 1RH5B 3CC2P 1VL2A 2Y0EA 2NZ2A 2FY8A 3L73J 2ZT9C 1M7LA 4JYBA 1NTMJ 1MZ9A 1K73Q 4PD4H 4GT1A 1W5CE 5TISE 5APVA 1JUNA 4K35A 1KD1Q 4WWIA 3AE3C 1SQXJ 3TGUJ 1EZVI 3KPEA 1FZCB 1VQMP 1GW3A 1VQNP 2IX7C 1LT9B 2AXTH 1XTCC 1YYCA 3RL0D 1SS1A 5APQA 2QM8A 2FYZA 1JM0A 2E75C 1FAVA 1RQVA 3AE9C 4PD4E 1L0ND 1IFJA 1Q90D 2KI7B 2QJPB 2WVRA 1NKNA 3KXDA 5APWA 2KIKA 3WUTA 5KLVG 1L2PA 1HH0A 1KYOI 1PL5A 3R2PA 4U7JA 3RK2B 4B86A 5CCGA 5KTBA 2CK3H 3SSUA 3FXDA 4WVZA 5B66E 1YIJP 1YITP 4I7ZC 3RL0C 1AVOA 1KYOE 2YMKA 3P8MC 2P10A 3I55P 2YIUC 2HPCB 1GMJA 1NH4A 3GMAA 4U3FD 1IFPA 4W7ZA 3MTUE 2IBZI 1AA0A 3AE2C 1ZR4A 1S1CX 2NPSD 1SQVG 3L75J 3TF5A 3L37A 5KJ7C 1L0LK 2WZ7A 3U1CA 2PGDA 5CJ0A 3AEAC 1S5LH 2AEMA 1PP9J 5TJHA 3H1JJ 1U7JA 1RF0C 1DD3A 2IFNA 2Q7CA 4RJTA 1H88A 3G9RA 2XV5A 2P2UA 1RE3A 4JYCA 1SQQD 2QVAA 2GA1A 3CWBE 5GTHH 4DOJA 4ZKPA 1S2EA 2D2CB 2IYOA 2IPPA 2ZXEB 3L72G 3FXEA 4GODA 2N1TA 4IL6H 5AW4B 5AW9B 3Q5SA 3OJAB 1N73C 1ZOYC 3A3YB 3WU2H 3S1KA 2YMYA 1VPCA 1KORA 1D7MA 2IYPA 4D6TD 1URQB 1LWUB 1YQ4C 2C0WA 1CI6A 2HFED 4AUWA 1FZGA 1E5WA 3GLMA 3LW5H 2OTJP 4WBAA 2R5DA 1MV8A 3H1ID 2R3CA 3AEFC 2OGUA 2IBZE 5B5EE 4D6TJ 2O01N 3WU2E 3L74D 1IC2A 1SQQK 4NPFX 1L0LG 1OVUA 3H1HG 2K37A 1NAFA 1K04A 4HJGH 4BRYB 3CX5D 1KILA 1RY3A 1YI2P 1J1EC 4GOEA 2NRGA 4Z1MH 1DEEG 2WMMA 2ZVNB 5BVZA 3CCVP 2XNXA 4KJMA 4C7NB 2L91A 3HE4B 2P58A 5GTHE 1Q7YQ 2KNCA 5CCHC 1PP9D 3L73E 2G8YA 3A0HE 1OW8A 4GIFA 2ZFCA 2KUBA 3H1LG 3VMZA 1SVFA 1M90Q 3NFQA 3BRVB 1DX7A 3TDKA 1ZV8A 1HGZA 2GUSA 2KP8A 3MUDA 1QL2A 2B89A 3HE5A 1NVOA 4LLHA 4EDFA 5BU5A 1M8OB 2I1KA 1BGYJ 2A06E 3L36A 1VQ7P 3BCCJ 2QIWA 3HUSA 1T2KD 4BWNA 3CWBJ 1MFZA 4Y28J 3V2NA 3EFGA 3A5TA 1R5LA 2FYNC 3L4FA 4Y99C 3RBZA 1GL2D 1M1JC 1N7SA 1OW6A 1LTJA 2R44A 3PLNA 3W68A 1FZEA 4OVNF 2A06G 1RF1A 4LC1A 2WT7A 1KV4A 2N9BA 3L71J 2OYIA 1IZNB 3RBXA 1J1EB 5AVYB 1YJNP 1ZXGA 3SWKA 3AEEC 3VTPC 1FZFA 2GM4A 4OH8B 2C9LY 2Z5HA 2RH0A 1RF0A 2BEQD 1X0TA 1N8RQ 4U3FJ 1VQKP 5B66H 3M9BA 2OYHA 3D71A 3VP8A 1PPJE 1EZVE 1KQLA 1FOSF 1NKZB 1KILB 1KYOH 2A45I 2B87A 1UIXA 2E74C 2YXRB 1NTMD 3L70E 4H44C 5KKZB 1KC8Q 1K9MQ 1QVFO 3ABVC 2KK7A 2Y0DA 3H1KJ 1G2CA 1N2DC 5M1BA 1M56D 3Q5RA 1NYHA 4I2LC 1KB9H 3OA7A 4OGQD 3V2QA 1KQSO 1NTMK 2R5BA 2FFDC 3IF4A 3WUVA 2QJYC 1L4AD 1EDLA 2W27A 3PJSK 2YNYA 5APSA 1Y47A 1L0LE 3H1HE 1LTAC 4H44D 1NU1K 3CC7P 2D2CC 1SQPJ 1FS0E 3M0DC 1BCCJ 1FC2C 1LT1A 2BCCJ 2KZIA 3O6QA 2KLUA 4WY4C 2FXMA 2XZRA 3I56P 1FJKA 2HYNA 4H0LB 2NPSC 3HTKB 2FYUG 1BE3E 1MFTA 1SQBD 2O01J 1VF5B 1SQVJ 2ZVOB 3GHGB 2JDIH 3MUDC 1PP9E 2B87B 1GZLA 1KFMA 2O1KA 3L73D 1URQC 2QJKB 1NJIQ 4IFMA 3L74G 3FGAD 2E5TA 2W6JH 2YO2A 1FU1A 3PP5A 4EYYQ 1JTHA 1FZBA 4WY4D 3VMAA 2M8RA 2PFXA 4TLFA 2K9JA 3HD7A 2JP3A 3CC4P 1GK6A 1EZVD 1BE3G 1NGMB 1N7SD 2E74B 3KYQA 3D6ZA 3OAKA 2P7JA 1IK7A 3GG2A 5AW6B 3II6A 3NTNA 1SLQA 2QRXA 3C9IA 1RHZB 2IFMA 4H13C 3HD7D 1SQXK 5AW8B 1N7LA 2E75B 1IFDA 2WSSH 1LP1A 1LGHB 2WSFH 3IAOA 4O9BA 3A0HH 1H0TB 2Y9ZA 1DH3A 2N1TD 3NXSA 2M0BA 2H7HA 1SQPD 1NU1D 4H0LC 3F5HA 2J5UA 1IFNA 1NTKE 2WPSA 4H13D 2A06D 1NHLA 5CJ4A 1K8AQ 3AE8C 2AEJA 1FZAA 1KILE 4RO0A 5L8RJ 5KJ7A 5AW5B 2QA4P 1FZCA 2WPVB 1WRGA 2BASA 2K9JB 3CCLP 5APYA 1SFCA 4L74A 3VOPA 3BVHA 4N3YB 1VQ5P 1M1JB 1X9VA 1FOSE 1KTMA 3B5NA 1LJ2A 1IJDB 2E5YA 1YBKA 2FYNB 3JSVC 4HKZH 2ZYDA 4I6MC 4Y99B 3ZDMA 1NU1E 3PRJA 2Q3IA 1TU3F 4EI2A 4ASVA 2C9NY 4U3FE 1L4AA 1SQBK 3B5ND 1L0NK 3B71A 3E7KA 4C46A 4PV1C 5KLIC 3AE7C 3B5NB 2CPBA 1M1KQ 1FE6A 3HUSC 3L71D 4KHXA 3L72E 5KJ7D 4ZNCA 1BSNA 1T2KC 3PTZA 1ZLLA 1RE4A 1LNQA 1WT6A 5KAIH 3RK3E 5AW0B 1UIIA 1GL2C 2FFDB 5TISH 1KQGB 3A7OA 4N78D 4PV1D 2KB7P 3CCUP 4HH2A 2LXBA 3BCCD 1G1JA 3VYIA 3WMM0 1T3JA 1H8AA 1USEA 5KLVK 1NTKG 1BGYE 2K1AA 1FDMA 2ZYGA 2ITAA 2LXCB 3H32A 3IN6A 5H2FH 3L73G 2Z4EA 2HODA 4IFFA 1WMKA 1OVVA 2H43A 2ZT9B 2OYHB 3RK3D 1NTKK 2OYOA 2DW3A 3C1LA 1J1DC 2Y9YA 2LKMA 3H6PA 1SQVD 3MP7B 1PGQA 3L70G 1NTZK 2OARA 2E76D 2M5AB 5KAFH 5CHXA 1YJWP 1EDJA 1SFCD 3I5CA 3HD7B 4OGQC 2B9BA 5AVTB 2WTYA 3CLQA 2OYIB 1W2BO 2JR8A 2E43A 3BATA 4BXLA 4R4LA 1OXZA 1BCCD 1LTJB 2BCCD 2FKWB 2QJKC 3TGUD 3CCEP 1JY3O 3Q5PA 1SQPE 1Q86Q 3VMXA 4YXWH 3P8CD 1HJ0A 3A0BH 2JKVA 3G4SP 2A45G 3TNUB 3L72D 1HGVA 1SFCC 1L0NG 5AW2B 3TK1A 2YO3A 4DJGA 1HJBA 3H1IJ 4DT0A 2XDJA 3H32B 1ZN5A 1VF5C 3GHGC 3HE5B 5APTA 3FX0A 2FYUE 1EQ7A 1OX3A 1NTZG 1T6AA 1ZW0A 2WSFJ 3BCCG 2KSJA 2IBZD 2Z5IA 2PAJA 1FDOA 4IL6E 4A7PA 1SQPK 2YKPA 2KNCB 4PJ0E 4HB1A 1NTME 2HR3A 3LIEA 1LTIC 3RK3C 1JY2P 2MJZA 2OTKE 3K5BA 3M06A 4OWFA 5AVUB 5AVVB 4L76A 1U7MA 4DCKA 2K3RA 4H44B 3CPWO 2WPQA 1R8EA 3H1KE 3KZIE 2ZYAA 4RKUJ 3AEBC 1L4AB 2QSIA 1Y8AA 1M57D 3P7KA 4JQ0D 3M0DA 4I1LA 2KS1A 1OVRA 2Q5UA 5KAFE 3HD7C 4OGQB 4PJ0H 3H1KD 2WSEH 1OW7A 2QJYB 2XKMA 3EQ2A 2E75D 4EIJA 2JWAA 3CXHH 1BGYD 1EZVG 1XTGB 2I8DA 3CCSP 2YKOA 2HG5D 3Q3DA 2KYVA 3EWKA 1SFCB 1Z56A 1YHQP 3AE5C 1CI6B 2FFDA 2E76B 2JEEA 5KLVE 4WB4A 1OWAA 1URQA 2H8PD 3E1IA 5APXA 1P84E 1HVVA 1SQBE 2AXCA 1J2JB 1N7SB 2E74D 1X8YA 5EFWB 1DIPA 1JEKA 1LWUC 1SQQJ 3KDPB 2V4HA 2NPSA 2XNDH 1AV1A 2WSCH 3H1LJ 4RESB 1FZCC 1VQLP 2JWDA 3JCUH 3QWOC 3H1JD 2LR2A 3D70A 1P84D 1AFOA 4WY4B 2YXQB 1JB0J 4YXDC 1GL2B 1S72P 1KN7A 1KMIZ 1L4AC 1NTKD 4N78E 1T3UA 2R3SA 3V5BA 3CD6P 1CSBA 3VP9A 3IFMA 3LW5J 3KHUA 1PIXA 3KZIH 3TYYA 1EC5A 1RF1C 1MKMA 2QG4A 4XA4A 1JY3P 2H89C 5C39A 1M1JA 3EFFK 5B5EH 3B5NC 2O3JA 2K88A 1LTBC 3KQGA 1VQ8P 3CCJP 1SQXG 3E1RA 3TGUG 3QH9A 3L70D 2ZAEB 2ZXXA 4L75A 1BCCG 2BCCG 4UB8H 2OTLP 1G1IA 3CXHE 1U57A 3N7NA 4LGDE 1IFIA 2FXOA 3FWNA 1SQVE 5AW1B 5BU8B 2Q9IA 3PH0A 5APUA 2YIUB 4NPEA 1JMBA 2CPSA 4XE5B 3CXHI 1KQFB 3SFEC 5CBOA 1GU5A 1FJPA 1AVYA 3R4YA 3V2PA 1SQQG 1L0LJ 3H1HJ 2WSEJ 1ZRTE 3MZWB 1HF9A 2WPRA 2RMZA 3HTKA 4W80A 3BRTB 4WY4A 3WUUA 1J1DB 3GF7A 4ZKUA 1N7SC 1NTKJ 2IBZG 1EXJA 4R4MA 3VMYA 3H1JE 1S5LX 2R32A 1RQUA 3CL3D 2FBWC 1KILC 3O8ZA 4H13B 3RK3B 1VQOP 2ZT9D 1GW4A 3MHVA 2GUVA 3L75D 2N1TB 4UB6E 5AVXB 3L70J 3CMEP 5E79H 1VDFA 2KOGA 2FYUK 3U59A 4W7YA 4IFDK 5DJTB 2O01H 4GDOA 3Q1MA 4IL6X 2KS1B 2IZ0A 2ZJSE 3L75E 1AJYA 4JF7A 4MN4C 4PV1B 4L73A 2H88C 3AEDC 1NTMG 1T8ZA 2Q1KA 1DEBA 3CWBG 4XFJA 1QX8A 3CXHD 5E79E 4UB8E 3M9QA 3AEGC 1EDIA 1L0NJ 1Q2NA 3BCCE 4ASWA 3T97A 3RL0g 4YTPC 3H1LD 3CCQP 2WT7B 1A02J 4AQRD 1ZRTD 3RK2C 4K3AA 4D6TG 3N4XA 1JCCA 1LTTC 1NOHA 3AE6C 2JO1A 5DJUB 3A2AA 3M9HA 1SQPG 2A45H 2W90A 1NU1G 1BDDA 2Y0CA 2FYUD 2W6BA 3H1JG 1SQBG 3HUSB 3L35A 3SWYA 3AECC 2KXPB 3NMDA 2B88A 3P8CE 4KT0J 4C7RA 3FWLA 3RK2D 1VQ9P 2Q3EA 1FBMA 3L72J 2OYIC 1BSHA 4UB6H 1Q82Q 2WWWA 3VN0A 2W6AA 3CCRP 5GTIE 1LTJC 1GK4A 2IDBA 3V6IA 1NU1J 1RF1B 2P1JA 3H25A 5CMZA 1BE3D 1CZQA 3P32A 1JMMA 1SQXD 4GKGA 1PZQA 1URQD 3B8EB 3F89A 1QGKB 2W83C 3H1KG 4C7NA 1VQPP 1Q81Q 1ZMEC 5AVQB 1BGYG 4BRYA 2RN0A 3IR9A 1QLED 2KZJA 3M0AA 5AVRB 1CW5A 1H0TA 2D2CD 2WITA 2HODB 3PHLA 4IOIH 1KZUB 2IZ1A 1PGJA 3G3ZA 3H1IE 2MKVA 1W2EA 3AE1C 5KLVD 1NTZE 1S3JA 4EOTA 1USDA 3B4SA 4CPGA 1OZHA 5CCHA 5AW7B 3G6EP 3Q2YA 1QEXA 3CX5E 1KB9E 3S4RA 3OW2O 3RGUA 1NTZJ 1DD4A 3L75G 3USSA 1PGOA 3HE4A 4U3FG 5KLVJ 3G71P 1YTZT 2J58A 1GU4A 1PFIA 3V4WA 2QJPC 1VF5D 2AEFA 1JTHB 5CCHD 4H0LD 2WQYC 3ITKA 1SQVK 2QE7H 1KYOD 1YJ9P 1R5SA 1YQ3C 2E42A 4JPZB 3CX5H 5K5GB 1S4XA 1HWTC 1JY3N 3CCMP 4I7ZB 1AQTA 3GF3A 1BE3J 5GTIH 4HYTB 1JNMA 4NPDA 3MIWA 1H89A 1NO4A 1EDKA 1AQ5A 1JO5A 1X22A 4QMAA 3RL0B 1GD2E 4DZOA 2YKQA 1HUCA 1JY2O 2RKLA 1JOCA 1LWUA 1SP4A 1HTLC 2OYHC 1Y9BA 4TT3H 1VQ6P 2J59M 2N1TC 2XU6A 3L71G 2HPCA 2BCCE 4D6TE 2V7QH 1KILD 2FYUJ 3CX5I 3C8VA 5AW3B 3UIAA 1G2CB 1BCCE 1LP1B 1HBWA 5AVZB
chains in the Genus database with same CATH topology
1RE3C 3V2RA 1RE4C 3TNUA 5AVWB 1NWQA 1A02F 3V4QA 1LTGC 1N86A 2POHA 2M3BA 1GDTA 5CCGD 1JY2N 5AVSB 1QL1A 3BASA 2HLOA 3MGNA 2PP6A 3CI9A 1JCDA 1S9KE 1GTWA 2I1JA 3SWFA 3TSIA 2P67A 5CCGC 1GL2A 2JJLA 1N73B 1S9KD 2C0XA 3GHGA 2L5GB 3HRNA 3MD0A 3LIDA 2NPSB 1YTZI 4N6JA 1IFMA 1LT9A 2VRSA 2O1JA 1KFNA 4M3LA 1MUUA 1LTSC 3U1AA 1LT9C 2QM7A 1X79B 3M91A 1IO4A 1IK9A 1N73A 1ZR2A 4AYCA 2KLVA 1M7LA 4JYBA 1MZ9A 4GT1A 5APVA 1JUNA 3KPEA 1FZCB 1GW3A 2IX7C 1LT9B 1XTCC 1YYCA 3RL0D 5APQA 2QM8A 2FYZA 1FAVA 1IFJA 5APWA 1NKNA 1HH0A 3RK2B 3R2PA 4B86A 5CCGA 5KTBA 3RL0C 3P8MC 2HPCB 1NH4A 4W7ZA 3MTUE 1ZR4A 2NPSD 3L37A 5KJ7C 1L0LK 2WZ7A 3U1CA 5CJ0A 1H88A 1RF0C 2Q7CA 2IFNA 2XV5A 2P2UA 1RE3A 4JYCA 4DOJA 4ZKPA 2IPPA 2ZXEB 2N1TA 5AW9B 5AW4B 3OJAB 1N73C 3A3YB 2YMYA 1VPCA 1URQB 1LWUB 4AUWA 2C0WA 1CI6A 2HFED 1FZGA 1E5WA 3LW5H 4WBAA 2R5DA 1MV8A 2R3CA 1IC2A 1SQQK 1NAFA 1KILA 1RY3A 1J1EC 5BVZA 2XNXA 4C7NB 3HE4B 5CCHC 4GIFA 2ZFCA 3VMZA 1SVFA 3NFQA 3BRVB 1DX7A 1ZV8A 1HGZA 2GUSA 2KP8A 3MUDA 1QL2A 3HE5A 4LLHA 5BU5A 2I1KA 3L36A 1T2KD 3HUSA 1MFZA 3V2NA 3A5TA 3EFGA 3L4FA 4Y99C 1GL2D 1M1JC 1N7SA 1LTJA 1FZEA 1RF1A 4LC1A 2WT7A 2N9BA 2OYIA 1J1EB 5AVYB 3VTPC 1FZFA 4OH8B 2C9LY 2Z5HA 1RF0A 2OYHA 3M9BA 3VP8A 1KQLA 1FOSF 1NKZB 1KILB 3RK3C 2A45I 1G2CA 1N2DC 4I2LC 3V2QA 3OA7A 1NTMK 2R5BA 2FFDC 1L4AD 2W27A 2YNYA 5APSA 1LTAC 1NU1K 3M0DC 4WY4C 2FXMA 2XZRA 1FJKA 2HYNA 2NPSC 3HTKB 3GHGB 1GZLA 1KFMA 2O1KA 1URQC 4IFMA 2YO2A 1FU1A 3PP5A 1JTHA 1FZBA 4WY4D 2M8RA 3HD7A 1GK6A 1N7SD 3KYQA 3OAKA 2P7JA 5AW6B 3II6A 3NTNA 1SLQA 3C9IA 2IFMA 3HD7D 1SQXK 5AW8B 1N7LA 1IFDA 1LGHB 2WSFH 4O9BA 1DH3A 2H7HA 2N1TD 3NXSA 1IFNA 2WPSA 1NHLA 5CJ4A 1FZCA 1FZAA 5KJ7A 5AW5B 1WRGA 2BASA 5APYA 1SFCA 3VOPA 3BVHA 4N3YB 1M1JB 1X9VA 1FOSE 3B5NA 1IJDB 4Y99B 4I6MC 2Q3IA 2C9NY 1L4AA 1SQBK 3B5ND 1L0NK 4C46A 3B5NB 2CPBA 3HUSC 4KHXA 5KJ7D 1T2KC 1ZLLA 1RE4A 1WT6A 5AW0B 1GL2C 2FFDB 3A7OA 4N78D 2KB7P 4HH2A 3WMM0 1G1JA 3VYIA 1H8AA 1T3JA 5KLVK 1FDMA 3H32A 2Z4EA 2HODA 4IFFA 2H43A 2OYHB 3RK3D 1NTKK 1J1DC 2Q9IA 2LKMA 3H6PA 1NTZK 2OARA 5CHXA 1SFCD 3I5CA 3HD7B 5AVTB 2WTYA 2OYIB 3CLQA 2E43A 3BATA 1OXZA 1LTJB 2FKWB 1JY3O 3VMXA 3P8CD 2A45G 3TNUB 5AW2B 1HGVA 1SFCC 3TK1A 1HJBA 2YO3A 2XDJA 3H32B 1ZN5A 3GHGC 3HE5B 5APTA 1EQ7A 2KSJA 2Z5IA 2PAJA 1SQPK 2YKPA 3LIEA 1LTIC 1JY2P 2MJZA 3M06A 5AVUB 5AVVB 2GM4A 2WPQA 1L4AB 3P7KA 3M0DA 4I1LA 2Q5UA 3HD7C 2WSEH 2XKMA 3EQ2A 4EIJA 1XTGB 2YKOA 2HG5D 2KYVA 2FFDA 1SFCB 1Z56A 1CI6B 2JEEA 4WB4A 1OWAA 1URQA 2H8PD 3E1IA 5APXA 1HVVA 1J2JB 1N7SB 1X8YA 1LWUC 4RESB 3KDPB 1FZCC 2NPSA 1AFOA 2WSCH 4WY4B 1GL2B 1L4AC 4N78E 1T3UA 3V5BA 1CSBA 3VP9A 3IFMA 3TYYA 1RF1C 4XA4A 1JY3P 1M1JA 3B5NC 1LTBC 3KQGA 1G1IA 3N7NA 4LGDE 1IFIA 5BU8B 5AW1B 5APUA 4XE5B 2CPSA 1GU5A 1FJPA 3V2PA 2WPRA 4W80A 3HTKA 4WY4A 3BRTB 1J1DB 4ZKUA 1N7SC 3VMYA 2R32A 3O8ZA 3CL3D 1KILC 3RK3B 1GW4A 5AVXB 2GUVA 2N1TB 1VDFA 2KOGA 2FYUK 3U59A 4W7YA 4IFDK 2O01H 4JF7A 1T8ZA 1DEBA 3M9QA 3T97A 2WT7B 1A02J 4AQRD 3RK2C 3N4XA 1JCCA 1LTTC 1NOHA 3A2AA 3M9HA 2A45H 3HUSB 3SWYA 3L35A 2W6BA 3NMDA 3P8CE 4C7RA 3RK2D 1FBMA 2OYIC 2WWWA 3VN0A 2W6AA 1LTJC 1GK4A 1RF1B 2P1JA 5CMZA 3P32A 1CZQA 1JMMA 4GKGA 1URQD 3B8EB 4C7NA 5AVQB 3M0AA 3IR9A 5AVRB 1CW5A 2WITA 2HODB 1KZUB 3G3ZA 1W2EA 4EOTA 5CCHA 5AW7B 3HE4A 1YTZT 2J58A 1GU4A 1PFIA 3V4WA 1JTHB 5CCHD 1SQVK 2E42A 1HWTC 1JY3N 1H89A 1JNMA 4HYTB 1JO5A 3MIWA 1NO4A 1AQ5A 3RL0B 1GD2E 4DZOA 2YKQA 1HUCA 1JY2O 1JOCA 1LWUA 1SP4A 1HTLC 2OYHC 2J59M 2N1TC 2XU6A 2HPCA 1KILD 5AW3B 3UIAA 1G2CB 1HBWA 5AVZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGV A;  1IFJ A;  2C0X A;  2CPS A;  1HGZ A;  1IFD A;  2C0W A;  2MJZ A;  2CPB A;  1HH0 A;  1FDM A;  1IFI A;  1NH4 A; 
#chains in the Genus database with same CATH topology
 1RE3 C;  2WSC J;  1SQX E;  3TGU E;  2QEX P;  3V2R A;  1RE4 C;  3TNU A;  3W67 A;  5AVW B;  1NWQ A;  3H1I G;  3JCU E;  1BDC A;  3SFD C;  1A02 F;  1PPJ D;  2W8Z A;  4JBZ A;  1LTG C;  3V4Q A;  1N86 A;  2G3A A;  5KKZ C;  2POH A;  2M3B A;  1GDT A;  5CBN A;  5CCG D;  2BEZ F;  1JY2 N;  2Q6Q A;  1L0N E;  5AVS B;  4YPC A;  1OMI A;  1QL1 A;  3JC2 2;  3L74 E;  3L71 E;  3BAS A;  2HLO A;  3CI9 A;  2PP6 A;  1NAY A;  1PP9 G;  2M5A A;  3AE4 C;  3CWB D;  3MGN A;  1JCD A;  2OQQ A;  3CMA P;  1OFC X;  1PGP A;  4PD4 I;  1S9K E;  2I1J A;  3SWF A;  1GTW A;  2K9Y A;  1EXI A;  1K05 A;  3TSI A;  1KB9 I;  2P67 A;  5CCG C;  1GL2 A;  2AXT E;  2JJL A;  2M3E A;  1N73 B;  2KSE A;  1S9K D;  2C0X A;  3GHG A;  1KB9 D;  2L5G B;  3HRN A;  3MD0 A;  3D6Y A;  1ZP0 C;  2FXP A;  3LID A;  1QVG O;  3H1L E;  2NPS B;  1YTZ I;  4PD4 D;  1FDI A;  4N6J A;  1IFM A;  1LT9 A;  3O6Q B;  3A0B E;  1SQB J;  2VRS A;  4GOF A;  2O1J A;  1SQQ E;  2PRR A;  5H2F E;  1OIP A;  1KFN A;  3S9O A;  4M3L A;  1MUU A;  2V7Q J;  1LTS C;  3T97 B;  3U1A A;  5KLI B;  1LT9 C;  2QM7 A;  1NTZ D;  1X79 B;  3M91 A;  2N9Y B;  2E76 C;  1L0L D;  1P84 H;  1PPJ G;  3H1H D;  3L74 J;  1PV3 A;  1IO4 A;  5KAI E;  1VQ4 P;  1IK9 A;  2SPZ A;  4ZMD A;  1E79 H;  3GW6 A;  2UWJ E;  1ZR2 A;  4AYC A;  2KLV A;  1N73 A;  1S5L E;  1P84 I;  1RH5 B;  3CC2 P;  1VL2 A;  2Y0E A;  2NZ2 A;  2FY8 A;  3L73 J;  2ZT9 C;  1M7L A;  4JYB A;  1NTM J;  1MZ9 A;  1K73 Q;  4PD4 H;  4GT1 A;  1W5C E;  5TIS E;  5APV A;  1JUN A;  4K35 A;  1KD1 Q;  4WWI A;  3AE3 C;  1SQX J;  3TGU J;  1EZV I;  3KPE A;  1FZC B;  1VQM P;  1GW3 A;  1VQN P;  2IX7 C;  1LT9 B;  2AXT H;  1XTC C;  1YYC A;  3RL0 D;  1SS1 A;  5APQ A;  2QM8 A;  2FYZ A;  1JM0 A;  2E75 C;  1FAV A;  1RQV A;  3AE9 C;  4PD4 E;  1L0N D;  1IFJ A;  1Q90 D;  2KI7 B;  2QJP B;  2WVR A;  1NKN A;  3KXD A;  5APW A;  2KIK A;  3WUT A;  5KLV G;  1L2P A;  1HH0 A;  1KYO I;  1PL5 A;  3R2P A;  4U7J A;  3RK2 B;  4B86 A;  5CCG A;  5KTB A;  2CK3 H;  3SSU A;  3FXD A;  4WVZ A;  5B66 E;  1YIJ P;  1YIT P;  4I7Z C;  3RL0 C;  1AVO A;  1KYO E;  2YMK A;  3P8M C;  2P10 A;  3I55 P;  2YIU C;  2HPC B;  1GMJ A;  1NH4 A;  3GMA A;  4U3F D;  1IFP A;  4W7Z A;  3MTU E;  2IBZ I;  1AA0 A;  3AE2 C;  1ZR4 A;  1S1C X;  2NPS D;  1SQV G;  3L75 J;  3TF5 A;  3L37 A;  5KJ7 C;  1L0L K;  2WZ7 A;  3U1C A;  2PGD A;  5CJ0 A;  3AEA C;  1S5L H;  2AEM A;  1PP9 J;  5TJH A;  3H1J J;  1U7J A;  1RF0 C;  1DD3 A;  2IFN A;  2Q7C A;  4RJT A;  1H88 A;  3G9R A;  2XV5 A;  2P2U A;  1RE3 A;  4JYC A;  1SQQ D;  2QVA A;  2GA1 A;  3CWB E;  5GTH H;  4DOJ A;  4ZKP A;  1S2E A;  2D2C B;  2IYO A;  2IPP A;  2ZXE B;  3L72 G;  3FXE A;  4GOD A;  2N1T A;  4IL6 H;  5AW4 B;  5AW9 B;  3Q5S A;  3OJA B;  1N73 C;  1ZOY C;  3A3Y B;  3WU2 H;  3S1K A;  2YMY A;  1VPC A;  1KOR A;  1D7M A;  2IYP A;  4D6T D;  1URQ B;  1LWU B;  1YQ4 C;  2C0W A;  1CI6 A;  2HFE D;  4AUW A;  1FZG A;  1E5W A;  3GLM A;  3LW5 H;  2OTJ P;  4WBA A;  2R5D A;  1MV8 A;  3H1I D;  2R3C A;  3AEF C;  2OGU A;  2IBZ E;  5B5E E;  4D6T J;  2O01 N;  3WU2 E;  3L74 D;  1IC2 A;  1SQQ K;  4NPF X;  1L0L G;  1OVU A;  3H1H G;  2K37 A;  1NAF A;  1K04 A;  4HJG H;  4BRY B;  3CX5 D;  1KIL A;  1RY3 A;  1YI2 P;  1J1E C;  4GOE A;  2NRG A;  4Z1M H;  1DEE G;  2WMM A;  2ZVN B;  5BVZ A;  3CCV P;  2XNX A;  4KJM A;  4C7N B;  2L91 A;  3HE4 B;  2P58 A;  5GTH E;  1Q7Y Q;  2KNC A;  5CCH C;  1PP9 D;  3L73 E;  2G8Y A;  3A0H E;  1OW8 A;  4GIF A;  2ZFC A;  2KUB A;  3H1L G;  3VMZ A;  1SVF A;  1M90 Q;  3NFQ A;  3BRV B;  1DX7 A;  3TDK A;  1ZV8 A;  1HGZ A;  2GUS A;  2KP8 A;  3MUD A;  1QL2 A;  2B89 A;  3HE5 A;  1NVO A;  4LLH A;  4EDF A;  5BU5 A;  1M8O B;  2I1K A;  1BGY J;  2A06 E;  3L36 A;  1VQ7 P;  3BCC J;  2QIW A;  3HUS A;  1T2K D;  4BWN A;  3CWB J;  1MFZ A;  4Y28 J;  3V2N A;  3EFG A;  3A5T A;  1R5L A;  2FYN C;  3L4F A;  4Y99 C;  3RBZ A;  1GL2 D;  1M1J C;  1N7S A;  1OW6 A;  1LTJ A;  2R44 A;  3PLN A;  3W68 A;  1FZE A;  4OVN F;  2A06 G;  1RF1 A;  4LC1 A;  2WT7 A;  1KV4 A;  2N9B A;  3L71 J;  2OYI A;  1IZN B;  3RBX A;  1J1E B;  5AVY B;  1YJN P;  1ZXG A;  3SWK A;  3AEE C;  3VTP C;  1FZF A;  2GM4 A;  4OH8 B;  2C9L Y;  2Z5H A;  2RH0 A;  1RF0 A;  2BEQ D;  1X0T A;  1N8R Q;  4U3F J;  1VQK P;  5B66 H;  3M9B A;  2OYH A;  3D71 A;  3VP8 A;  1PPJ E;  1EZV E;  1KQL A;  1FOS F;  1NKZ B;  1KIL B;  1KYO H;  2A45 I;  2B87 A;  1UIX A;  2E74 C;  2YXR B;  1NTM D;  3L70 E;  4H44 C;  5KKZ B;  1KC8 Q;  1K9M Q;  1QVF O;  3ABV C;  2KK7 A;  2Y0D A;  3H1K J;  1G2C A;  1N2D C;  5M1B A;  1M56 D;  3Q5R A;  1NYH A;  4I2L C;  1KB9 H;  3OA7 A;  4OGQ D;  3V2Q A;  1KQS O;  1NTM K;  2R5B A;  2FFD C;  3IF4 A;  3WUV A;  2QJY C;  1L4A D;  1EDL A;  2W27 A;  3PJS K;  2YNY A;  5APS A;  1Y47 A;  1L0L E;  3H1H E;  1LTA C;  4H44 D;  1NU1 K;  3CC7 P;  2D2C C;  1SQP J;  1FS0 E;  3M0D C;  1BCC J;  1FC2 C;  1LT1 A;  2BCC J;  2KZI A;  3O6Q A;  2KLU A;  4WY4 C;  2FXM A;  2XZR A;  3I56 P;  1FJK A;  2HYN A;  4H0L B;  2NPS C;  3HTK B;  2FYU G;  1BE3 E;  1MFT A;  1SQB D;  2O01 J;  1VF5 B;  1SQV J;  2ZVO B;  3GHG B;  2JDI H;  3MUD C;  1PP9 E;  2B87 B;  1GZL A;  1KFM A;  2O1K A;  3L73 D;  1URQ C;  2QJK B;  1NJI Q;  4IFM A;  3L74 G;  3FGA D;  2E5T A;  2W6J H;  2YO2 A;  1FU1 A;  3PP5 A;  4EYY Q;  1JTH A;  1FZB A;  4WY4 D;  3VMA A;  2M8R A;  2PFX A;  4TLF A;  2K9J A;  3HD7 A;  2JP3 A;  3CC4 P;  1GK6 A;  1EZV D;  1BE3 G;  1NGM B;  1N7S D;  2E74 B;  3KYQ A;  3D6Z A;  3OAK A;  2P7J A;  1IK7 A;  3GG2 A;  5AW6 B;  3II6 A;  3NTN A;  1SLQ A;  2QRX A;  3C9I A;  1RHZ B;  2IFM A;  4H13 C;  3HD7 D;  1SQX K;  5AW8 B;  1N7L A;  2E75 B;  1IFD A;  2WSS H;  1LP1 A;  1LGH B;  2WSF H;  3IAO A;  4O9B A;  3A0H H;  1H0T B;  2Y9Z A;  1DH3 A;  2N1T D;  3NXS A;  2M0B A;  2H7H A;  1SQP D;  1NU1 D;  4H0L C;  3F5H A;  2J5U A;  1IFN A;  1NTK E;  2WPS A;  4H13 D;  2A06 D;  1NHL A;  5CJ4 A;  1K8A Q;  3AE8 C;  2AEJ A;  1FZA A;  1KIL E;  4RO0 A;  5L8R J;  5KJ7 A;  5AW5 B;  2QA4 P;  1FZC A;  2WPV B;  1WRG A;  2BAS A;  2K9J B;  3CCL P;  5APY A;  1SFC A;  4L74 A;  3VOP A;  3BVH A;  4N3Y B;  1VQ5 P;  1M1J B;  1X9V A;  1FOS E;  1KTM A;  3B5N A;  1LJ2 A;  1IJD B;  2E5Y A;  1YBK A;  2FYN B;  3JSV C;  4HKZ H;  2ZYD A;  4I6M C;  4Y99 B;  3ZDM A;  1NU1 E;  3PRJ A;  2Q3I A;  1TU3 F;  4EI2 A;  4ASV A;  2C9N Y;  4U3F E;  1L4A A;  1SQB K;  3B5N D;  1L0N K;  3B71 A;  3E7K A;  4C46 A;  4PV1 C;  5KLI C;  3AE7 C;  3B5N B;  2CPB A;  1M1K Q;  1FE6 A;  3HUS C;  3L71 D;  4KHX A;  3L72 E;  5KJ7 D;  4ZNC A;  1BSN A;  1T2K C;  3PTZ A;  1ZLL A;  1RE4 A;  1LNQ A;  1WT6 A;  5KAI H;  3RK3 E;  5AW0 B;  1UII A;  1GL2 C;  2FFD B;  5TIS H;  1KQG B;  3A7O A;  4N78 D;  4PV1 D;  2KB7 P;  3CCU P;  4HH2 A;  2LXB A;  3BCC D;  1G1J A;  3VYI A;  3WMM 0;  1T3J A;  1H8A A;  1USE A;  5KLV K;  1NTK G;  1BGY E;  2K1A A;  1FDM A;  2ZYG A;  2ITA A;  2LXC B;  3H32 A;  3IN6 A;  5H2F H;  3L73 G;  2Z4E A;  2HOD A;  4IFF A;  1WMK A;  1OVV A;  2H43 A;  2ZT9 B;  2OYH B;  3RK3 D;  1NTK K;  2OYO A;  2DW3 A;  3C1L A;  1J1D C;  2Y9Y A;  2LKM A;  3H6P A;  1SQV D;  3MP7 B;  1PGQ A;  3L70 G;  1NTZ K;  2OAR A;  2E76 D;  2M5A B;  5KAF H;  5CHX A;  1YJW P;  1EDJ A;  1SFC D;  3I5C A;  3HD7 B;  4OGQ C;  2B9B A;  5AVT B;  2WTY A;  3CLQ A;  2OYI B;  1W2B O;  2JR8 A;  2E43 A;  3BAT A;  4BXL A;  4R4L A;  1OXZ A;  1BCC D;  1LTJ B;  2BCC D;  2FKW B;  2QJK C;  3TGU D;  3CCE P;  1JY3 O;  3Q5P A;  1SQP E;  1Q86 Q;  3VMX A;  4YXW H;  3P8C D;  1HJ0 A;  3A0B H;  2JKV A;  3G4S P;  2A45 G;  3TNU B;  3L72 D;  1HGV A;  1SFC C;  1L0N G;  5AW2 B;  3TK1 A;  2YO3 A;  4DJG A;  1HJB A;  3H1I J;  4DT0 A;  2XDJ A;  3H32 B;  1ZN5 A;  1VF5 C;  3GHG C;  3HE5 B;  5APT A;  3FX0 A;  2FYU E;  1EQ7 A;  1OX3 A;  1NTZ G;  1T6A A;  1ZW0 A;  2WSF J;  3BCC G;  2KSJ A;  2IBZ D;  2Z5I A;  2PAJ A;  1FDO A;  4IL6 E;  4A7P A;  1SQP K;  2YKP A;  2KNC B;  4PJ0 E;  4HB1 A;  1NTM E;  2HR3 A;  3LIE A;  1LTI C;  3RK3 C;  1JY2 P;  2MJZ A;  2OTK E;  3K5B A;  3M06 A;  4OWF A;  5AVU B;  5AVV B;  4L76 A;  1U7M A;  4DCK A;  2K3R A;  4H44 B;  3CPW O;  2WPQ A;  1R8E A;  3H1K E;  3KZI E;  2ZYA A;  4RKU J;  3AEB C;  1L4A B;  2QSI A;  1Y8A A;  1M57 D;  3P7K A;  4JQ0 D;  3M0D A;  4I1L A;  2KS1 A;  1OVR A;  2Q5U A;  5KAF E;  3HD7 C;  4OGQ B;  4PJ0 H;  3H1K D;  2WSE H;  1OW7 A;  2QJY B;  2XKM A;  3EQ2 A;  2E75 D;  4EIJ A;  2JWA A;  3CXH H;  1BGY D;  1EZV G;  1XTG B;  2I8D A;  3CCS P;  2YKO A;  2HG5 D;  3Q3D A;  2KYV A;  3EWK A;  1SFC B;  1Z56 A;  1YHQ P;  3AE5 C;  1CI6 B;  2FFD A;  2E76 B;  2JEE A;  5KLV E;  4WB4 A;  1OWA A;  1URQ A;  2H8P D;  3E1I A;  5APX A;  1P84 E;  1HVV A;  1SQB E;  2AXC A;  1J2J B;  1N7S B;  2E74 D;  1X8Y A;  5EFW B;  1DIP A;  1JEK A;  1LWU C;  1SQQ J;  3KDP B;  2V4H A;  2NPS A;  2XND H;  1AV1 A;  2WSC H;  3H1L J;  4RES B;  1FZC C;  1VQL P;  2JWD A;  3JCU H;  3QWO C;  3H1J D;  2LR2 A;  3D70 A;  1P84 D;  1AFO A;  4WY4 B;  2YXQ B;  1JB0 J;  4YXD C;  1GL2 B;  1S72 P;  1KN7 A;  1KMI Z;  1L4A C;  1NTK D;  4N78 E;  1T3U A;  2R3S A;  3V5B A;  3CD6 P;  1CSB A;  3VP9 A;  3IFM A;  3LW5 J;  3KHU A;  1PIX A;  3KZI H;  3TYY A;  1EC5 A;  1RF1 C;  1MKM A;  2QG4 A;  4XA4 A;  1JY3 P;  2H89 C;  5C39 A;  1M1J A;  3EFF K;  5B5E H;  3B5N C;  2O3J A;  2K88 A;  1LTB C;  3KQG A;  1VQ8 P;  3CCJ P;  1SQX G;  3E1R A;  3TGU G;  3QH9 A;  3L70 D;  2ZAE B;  2ZXX A;  4L75 A;  1BCC G;  2BCC G;  4UB8 H;  2OTL P;  1G1I A;  3CXH E;  1U57 A;  3N7N A;  4LGD E;  1IFI A;  2FXO A;  3FWN A;  1SQV E;  5AW1 B;  5BU8 B;  2Q9I A;  3PH0 A;  5APU A;  2YIU B;  4NPE A;  1JMB A;  2CPS A;  4XE5 B;  3CXH I;  1KQF B;  3SFE C;  5CBO A;  1GU5 A;  1FJP A;  1AVY A;  3R4Y A;  3V2P A;  1SQQ G;  1L0L J;  3H1H J;  2WSE J;  1ZRT E;  3MZW B;  1HF9 A;  2WPR A;  2RMZ A;  3HTK A;  4W80 A;  3BRT B;  4WY4 A;  3WUU A;  1J1D B;  3GF7 A;  4ZKU A;  1N7S C;  1NTK J;  2IBZ G;  1EXJ A;  4R4M A;  3VMY A;  3H1J E;  1S5L X;  2R32 A;  1RQU A;  3CL3 D;  2FBW C;  1KIL C;  3O8Z A;  4H13 B;  3RK3 B;  1VQO P;  2ZT9 D;  1GW4 A;  3MHV A;  2GUV A;  3L75 D;  2N1T B;  4UB6 E;  5AVX B;  3L70 J;  3CME P;  5E79 H;  1VDF A;  2KOG A;  2FYU K;  3U59 A;  4W7Y A;  4IFD K;  5DJT B;  2O01 H;  4GDO A;  3Q1M A;  4IL6 X;  2KS1 B;  2IZ0 A;  2ZJS E;  3L75 E;  1AJY A;  4JF7 A;  4MN4 C;  4PV1 B;  4L73 A;  2H88 C;  3AED C;  1NTM G;  1T8Z A;  2Q1K A;  1DEB A;  3CWB G;  4XFJ A;  1QX8 A;  3CXH D;  5E79 E;  4UB8 E;  3M9Q A;  3AEG C;  1EDI A;  1L0N J;  1Q2N A;  3BCC E;  4ASW A;  3T97 A;  3RL0 g;  4YTP C;  3H1L D;  3CCQ P;  2WT7 B;  1A02 J;  4AQR D;  1ZRT D;  3RK2 C;  4K3A A;  4D6T G;  3N4X A;  1JCC A;  1LTT C;  1NOH A;  3AE6 C;  2JO1 A;  5DJU B;  3A2A A;  3M9H A;  1SQP G;  2A45 H;  2W90 A;  1NU1 G;  1BDD A;  2Y0C A;  2FYU D;  2W6B A;  3H1J G;  1SQB G;  3HUS B;  3L35 A;  3SWY A;  3AEC C;  2KXP B;  3NMD A;  2B88 A;  3P8C E;  4KT0 J;  4C7R A;  3FWL A;  3RK2 D;  1VQ9 P;  2Q3E A;  1FBM A;  3L72 J;  2OYI C;  1BSH A;  4UB6 H;  1Q82 Q;  2WWW A;  3VN0 A;  2W6A A;  3CCR P;  5GTI E;  1LTJ C;  1GK4 A;  2IDB A;  3V6I A;  1NU1 J;  1RF1 B;  2P1J A;  3H25 A;  5CMZ A;  1BE3 D;  1CZQ A;  3P32 A;  1JMM A;  1SQX D;  4GKG A;  1PZQ A;  1URQ D;  3B8E B;  3F89 A;  1QGK B;  2W83 C;  3H1K G;  4C7N A;  1VQP P;  1Q81 Q;  1ZME C;  5AVQ B;  1BGY G;  4BRY A;  2RN0 A;  3IR9 A;  1QLE D;  2KZJ A;  3M0A A;  5AVR B;  1CW5 A;  1H0T A;  2D2C D;  2WIT A;  2HOD B;  3PHL A;  4IOI H;  1KZU B;  2IZ1 A;  1PGJ A;  3G3Z A;  3H1I E;  2MKV A;  1W2E A;  3AE1 C;  5KLV D;  1NTZ E;  1S3J A;  4EOT A;  1USD A;  3B4S A;  4CPG A;  1OZH A;  5CCH A;  5AW7 B;  3G6E P;  3Q2Y A;  1QEX A;  3CX5 E;  1KB9 E;  3S4R A;  3OW2 O;  3RGU A;  1NTZ J;  1DD4 A;  3L75 G;  3USS A;  1PGO A;  3HE4 A;  4U3F G;  5KLV J;  3G71 P;  1YTZ T;  2J58 A;  1GU4 A;  1PFI A;  3V4W A;  2QJP C;  1VF5 D;  2AEF A;  1JTH B;  5CCH D;  4H0L D;  2WQY C;  3ITK A;  1SQV K;  2QE7 H;  1KYO D;  1YJ9 P;  1R5S A;  1YQ3 C;  2E42 A;  4JPZ B;  3CX5 H;  5K5G B;  1S4X A;  1HWT C;  1JY3 N;  3CCM P;  4I7Z B;  1AQT A;  3GF3 A;  1BE3 J;  5GTI H;  4HYT B;  1JNM A;  4NPD A;  3MIW A;  1H89 A;  1NO4 A;  1EDK A;  1AQ5 A;  1JO5 A;  1X22 A;  4QMA A;  3RL0 B;  1GD2 E;  4DZO A;  2YKQ A;  1HUC A;  1JY2 O;  2RKL A;  1JOC A;  1LWU A;  1SP4 A;  1HTL C;  2OYH C;  1Y9B A;  4TT3 H;  1VQ6 P;  2J59 M;  2N1T C;  2XU6 A;  3L71 G;  2HPC A;  2BCC E;  4D6T E;  2V7Q H;  1KIL D;  2FYU J;  3CX5 I;  3C8V A;  5AW3 B;  3UIA A;  1G2C B;  1BCC E;  1LP1 B;  1HBW A;  5AVZ B; 
#chains in the Genus database with same CATH homology
 1RE3 C;  3V2R A;  1RE4 C;  3TNU A;  5AVW B;  1NWQ A;  1A02 F;  3V4Q A;  1LTG C;  1N86 A;  2POH A;  2M3B A;  1GDT A;  5CCG D;  1JY2 N;  5AVS B;  1QL1 A;  3BAS A;  2HLO A;  3MGN A;  2PP6 A;  3CI9 A;  1JCD A;  1S9K E;  1GTW A;  2I1J A;  3SWF A;  3TSI A;  2P67 A;  5CCG C;  1GL2 A;  2JJL A;  1N73 B;  1S9K D;  2C0X A;  3GHG A;  2L5G B;  3HRN A;  3MD0 A;  3LID A;  2NPS B;  1YTZ I;  4N6J A;  1IFM A;  1LT9 A;  2VRS A;  2O1J A;  1KFN A;  4M3L A;  1MUU A;  1LTS C;  3U1A A;  1LT9 C;  2QM7 A;  1X79 B;  3M91 A;  1IO4 A;  1IK9 A;  1N73 A;  1ZR2 A;  4AYC A;  2KLV A;  1M7L A;  4JYB A;  1MZ9 A;  4GT1 A;  5APV A;  1JUN A;  3KPE A;  1FZC B;  1GW3 A;  2IX7 C;  1LT9 B;  1XTC C;  1YYC A;  3RL0 D;  5APQ A;  2QM8 A;  2FYZ A;  1FAV A;  1IFJ A;  5APW A;  1NKN A;  1HH0 A;  3RK2 B;  3R2P A;  4B86 A;  5CCG A;  5KTB A;  3RL0 C;  3P8M C;  2HPC B;  1NH4 A;  4W7Z A;  3MTU E;  1ZR4 A;  2NPS D;  3L37 A;  5KJ7 C;  1L0L K;  2WZ7 A;  3U1C A;  5CJ0 A;  1H88 A;  1RF0 C;  2Q7C A;  2IFN A;  2XV5 A;  2P2U A;  1RE3 A;  4JYC A;  4DOJ A;  4ZKP A;  2IPP A;  2ZXE B;  2N1T A;  5AW9 B;  5AW4 B;  3OJA B;  1N73 C;  3A3Y B;  2YMY A;  1VPC A;  1URQ B;  1LWU B;  4AUW A;  2C0W A;  1CI6 A;  2HFE D;  1FZG A;  1E5W A;  3LW5 H;  4WBA A;  2R5D A;  1MV8 A;  2R3C A;  1IC2 A;  1SQQ K;  1NAF A;  1KIL A;  1RY3 A;  1J1E C;  5BVZ A;  2XNX A;  4C7N B;  3HE4 B;  5CCH C;  4GIF A;  2ZFC A;  3VMZ A;  1SVF A;  3NFQ A;  3BRV B;  1DX7 A;  1ZV8 A;  1HGZ A;  2GUS A;  2KP8 A;  3MUD A;  1QL2 A;  3HE5 A;  4LLH A;  5BU5 A;  2I1K A;  3L36 A;  1T2K D;  3HUS A;  1MFZ A;  3V2N A;  3A5T A;  3EFG A;  3L4F A;  4Y99 C;  1GL2 D;  1M1J C;  1N7S A;  1LTJ A;  1FZE A;  1RF1 A;  4LC1 A;  2WT7 A;  2N9B A;  2OYI A;  1J1E B;  5AVY B;  3VTP C;  1FZF A;  4OH8 B;  2C9L Y;  2Z5H A;  1RF0 A;  2OYH A;  3M9B A;  3VP8 A;  1KQL A;  1FOS F;  1NKZ B;  1KIL B;  3RK3 C;  2A45 I;  1G2C A;  1N2D C;  4I2L C;  3V2Q A;  3OA7 A;  1NTM K;  2R5B A;  2FFD C;  1L4A D;  2W27 A;  2YNY A;  5APS A;  1LTA C;  1NU1 K;  3M0D C;  4WY4 C;  2FXM A;  2XZR A;  1FJK A;  2HYN A;  2NPS C;  3HTK B;  3GHG B;  1GZL A;  1KFM A;  2O1K A;  1URQ C;  4IFM A;  2YO2 A;  1FU1 A;  3PP5 A;  1JTH A;  1FZB A;  4WY4 D;  2M8R A;  3HD7 A;  1GK6 A;  1N7S D;  3KYQ A;  3OAK A;  2P7J A;  5AW6 B;  3II6 A;  3NTN A;  1SLQ A;  3C9I A;  2IFM A;  3HD7 D;  1SQX K;  5AW8 B;  1N7L A;  1IFD A;  1LGH B;  2WSF H;  4O9B A;  1DH3 A;  2H7H A;  2N1T D;  3NXS A;  1IFN A;  2WPS A;  1NHL A;  5CJ4 A;  1FZC A;  1FZA A;  5KJ7 A;  5AW5 B;  1WRG A;  2BAS A;  5APY A;  1SFC A;  3VOP A;  3BVH A;  4N3Y B;  1M1J B;  1X9V A;  1FOS E;  3B5N A;  1IJD B;  4Y99 B;  4I6M C;  2Q3I A;  2C9N Y;  1L4A A;  1SQB K;  3B5N D;  1L0N K;  4C46 A;  3B5N B;  2CPB A;  3HUS C;  4KHX A;  5KJ7 D;  1T2K C;  1ZLL A;  1RE4 A;  1WT6 A;  5AW0 B;  1GL2 C;  2FFD B;  3A7O A;  4N78 D;  2KB7 P;  4HH2 A;  3WMM 0;  1G1J A;  3VYI A;  1H8A A;  1T3J A;  5KLV K;  1FDM A;  3H32 A;  2Z4E A;  2HOD A;  4IFF A;  2H43 A;  2OYH B;  3RK3 D;  1NTK K;  1J1D C;  2Q9I A;  2LKM A;  3H6P A;  1NTZ K;  2OAR A;  5CHX A;  1SFC D;  3I5C A;  3HD7 B;  5AVT B;  2WTY A;  2OYI B;  3CLQ A;  2E43 A;  3BAT A;  1OXZ A;  1LTJ B;  2FKW B;  1JY3 O;  3VMX A;  3P8C D;  2A45 G;  3TNU B;  5AW2 B;  1HGV A;  1SFC C;  3TK1 A;  1HJB A;  2YO3 A;  2XDJ A;  3H32 B;  1ZN5 A;  3GHG C;  3HE5 B;  5APT A;  1EQ7 A;  2KSJ A;  2Z5I A;  2PAJ A;  1SQP K;  2YKP A;  3LIE A;  1LTI C;  1JY2 P;  2MJZ A;  3M06 A;  5AVU B;  5AVV B;  2GM4 A;  2WPQ A;  1L4A B;  3P7K A;  3M0D A;  4I1L A;  2Q5U A;  3HD7 C;  2WSE H;  2XKM A;  3EQ2 A;  4EIJ A;  1XTG B;  2YKO A;  2HG5 D;  2KYV A;  2FFD A;  1SFC B;  1Z56 A;  1CI6 B;  2JEE A;  4WB4 A;  1OWA A;  1URQ A;  2H8P D;  3E1I A;  5APX A;  1HVV A;  1J2J B;  1N7S B;  1X8Y A;  1LWU C;  4RES B;  3KDP B;  1FZC C;  2NPS A;  1AFO A;  2WSC H;  4WY4 B;  1GL2 B;  1L4A C;  4N78 E;  1T3U A;  3V5B A;  1CSB A;  3VP9 A;  3IFM A;  3TYY A;  1RF1 C;  4XA4 A;  1JY3 P;  1M1J A;  3B5N C;  1LTB C;  3KQG A;  1G1I A;  3N7N A;  4LGD E;  1IFI A;  5BU8 B;  5AW1 B;  5APU A;  4XE5 B;  2CPS A;  1GU5 A;  1FJP A;  3V2P A;  2WPR A;  4W80 A;  3HTK A;  4WY4 A;  3BRT B;  1J1D B;  4ZKU A;  1N7S C;  3VMY A;  2R32 A;  3O8Z A;  3CL3 D;  1KIL C;  3RK3 B;  1GW4 A;  5AVX B;  2GUV A;  2N1T B;  1VDF A;  2KOG A;  2FYU K;  3U59 A;  4W7Y A;  4IFD K;  2O01 H;  4JF7 A;  1T8Z A;  1DEB A;  3M9Q A;  3T97 A;  2WT7 B;  1A02 J;  4AQR D;  3RK2 C;  3N4X A;  1JCC A;  1LTT C;  1NOH A;  3A2A A;  3M9H A;  2A45 H;  3HUS B;  3SWY A;  3L35 A;  2W6B A;  3NMD A;  3P8C E;  4C7R A;  3RK2 D;  1FBM A;  2OYI C;  2WWW A;  3VN0 A;  2W6A A;  1LTJ C;  1GK4 A;  1RF1 B;  2P1J A;  5CMZ A;  3P32 A;  1CZQ A;  1JMM A;  4GKG A;  1URQ D;  3B8E B;  4C7N A;  5AVQ B;  3M0A A;  3IR9 A;  5AVR B;  1CW5 A;  2WIT A;  2HOD B;  1KZU B;  3G3Z A;  1W2E A;  4EOT A;  5CCH A;  5AW7 B;  3HE4 A;  1YTZ T;  2J58 A;  1GU4 A;  1PFI A;  3V4W A;  1JTH B;  5CCH D;  1SQV K;  2E42 A;  1HWT C;  1JY3 N;  1H89 A;  1JNM A;  4HYT B;  1JO5 A;  3MIW A;  1NO4 A;  1AQ5 A;  3RL0 B;  1GD2 E;  4DZO A;  2YKQ A;  1HUC A;  1JY2 O;  1JOC A;  1LWU A;  1SP4 A;  1HTL C;  2OYH C;  2J59 M;  2N1T C;  2XU6 A;  2HPC A;  1KIL D;  5AW3 B;  3UIA A;  1G2C B;  1HBW A;  5AVZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...