2CPXA

Solution structure of rna binding domain in hypothetical protein flj11016
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
115
structure length
115
Chain Sequence
b'GSSGSSGEEIRKIPMFSSYNPGEPNKVLYLKNLSPRVTERDLVSLFARFQEKKGPPIQFRMMTGRMRGQAFITFPNKEIAWQALHLVNGYKLYGKILVIEFGKNKKQRSSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Hypothetical protein FLJ11016
publication title solution structure of RNA binding domain in Hypothetical protein FLJ11016
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 10
structure length 115
sequence length 115
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cpxA01
3CCSS 1VC0A 1YJ9S 5HO4A 2KVIA 2E5IA 2ADCA 1WG1A 2KG1A 2D9PA 2DH8A 2CPZA 3VF0B 3ULHA 2DGWA 2CQGA 3HI9A 5GVQA 3BO3A 3CCVS 1X5TA 1FJCA 4W90B 2CJKA 3G8TA 1VBXA 2E5JA 2JX2A 2LEAA 1FNXH 2JVOA 3US5A 2RS8A 2MJUA 3CC7S 4ED5A 2MB0B 2XNQA 3EGNA 2CPEA 2O3DA 2MKIA 2N3OA 1Q82T 3VALA 1F9FA 2MZSA 2U2FA 3VAGA 4OZ0A 1WF1A 2DH9A 1N52B 2E5GA 2D9OA 3P6YC 1QM9A 2DO0A 4WFNQ 4PRFA 2MQQA 3NNHA 5GAGU 3CC2S 3MD1A 2YKAA 4QU7A 1DRZA 2DITA 3SXLA 4IO9Q 4W92B 5IQQA 2OSQA 2A3JA 2WBRA 1U6FA 2CPHA 3LQVA 4Y0FA 3CCJS 2FPHX 2ZJQQ 3TO8A 1RKJA 1X4BA 2L41A 1U2FA 2SXLA 1VBZA 3FEYB 4CH0S 2RVJA 2EK1A 2KG0A 3UCGA 3OW2R 1CVJA 3CC4S 4IUFA 3NNCA 2RRBA 1FJ7A 2DGXA 5GAEU 1WEZA 2DGTA 1VQOS 2HZCA 1YITS 2DGVA 4CH1A 3CCMS 2MZRA 1ZH5A 1OWXA 2CQ2A 5MLCV 3CXCR 2DH7A 1WTBA 1X4DA 2DGSA 2XB2D 4YOEA 2CQBA 2MQPA 2DIVA 2L9WA 3CMAS 1KC8T 2RU3A 1VC6A 1JJHA 3ZZZA 1P27B 4J5OA 5CXTA 2DGOA 2MQMA 5CA5A 1HL6A 4TU7A 4A8XA 2CQ4A 1VQ9S 2DHAA 1U1LA 2YTCA 2K3KA 1L3KA 1YHQS 2RRAA 1WEYA 2MKHA 3U1MA 2KT5A 3THPA 4TU8A 2VODA 1HD1A 3BS9A 3UD4P 3R27A 3MDFA 1QVGR 4TLQA 3CCES 1O0PA 4FXWA 3VAKA 1D9AA 2J76E 2X1AA 1U1RA 3CD6S 2JVRA 2KN4A 1VQ4S 2CPXA 2M8DB 5CYJA 2ERRA 2N7CA 2DNHA 2MYFA 5FJ4A 4WCEQ 2DNQA 1VC5A 1VQNS 5DDRC 3H2UB 2E44A 2EVZA 3DXBA 4ZKAA 1WG4A 2M4MA 1PGZA 2DHSA 2FHOB 2DIUA 3SDEB 3MXHP 2HGNA 4WIIA 2LEBA 2KXNB 1SJ3P 1WHVA 2DO4A 1VBYA 2DISA 2MJNA 1R8HA 2MZTA 2KM8B 1Q7YT 3VAJA 1FHTA 2LCWA 2MY7A 2YWKA 4QU6A 2MXYA 1Q86T 3G8SA 3EX7B 4V19X 1QVFR 1X4EA 3I56S 1M1KT 1FT8A 1KOOA 2F9DA 1KD1T 5ITHA 2MQNA 1VQ8S 2KXFA 1OO0B 1AUDA 2KU7A 1U1PA 2FC8A 1HA1A 2DNZA 2I2YA 2JRSA 1FXLA 2V94A 4ERDA 4U67Q 4YB1P 1WF2A 3MUMP 3S6EA 1N54B 3UWTA 1NU4A 1OPIA 1SXLA 1YWXA 3TYTA 1WI6A 1M5KC 3THTA 1X5OA 2OIHA 1JJ2R 2M9KA 2CQ1A 4IOCQ 1K8AT 3PIPQ 2DHGA 1UP1A 3B4MA 1HD0A 1D8ZA 2DGUA 2DB1A 1YTYA 2MHNA 2HGMA 2FC9A 4LIRA 5LJ3Y 3IRWP 3NNAA 3Q2TC 2DNGA 1M5PC 3S01A 2B0GA 3G71S 1YJWS 2DNKA 2RNEA 3CTRA 3HHNB 2NZ4A 2MY8A 1XN9A 1WG5A 2MZQA 2KXHA 2GHPA 4CQ1A 4WF9Q 3J7YU 3S7RA 2MZJA 3TP2A 3SDEA 2M2BA 3MI7X 5DDQC 3VAMA 5LJ5Y 3VAIA 5GAHU 1YI2S 1WI8A 1YIJS 1X4FA 1H2TZ 1WWHA 2JWNA 1YJNS 1X4HA 5LXYA 2N3LA 3UD3P 2CPJA 2QEXS 2N82B 4F26A 1S79A 1SJRA 2MZ1A 1A7GE 2CQCA 5IFMA 2DNRA 2X1BA 5D77A 2YH1A 2VONA 4FXVA 1SJQA 1DHMA 3CCRS 1M90T 1JMTA 2RQ4A 2EK6A 5IM0B 2LXUA 1UFWA 4CIOA 2LQ5A 4WFAQ 4WKRA 2MGZB 1VQPS 4PKDB 1SJFA 2MMYA 2G4BA 2UP1A 2CQPA 3CCQS 2OTJS 2MSSA 4BS2A 2DNPA 1U1OA 4F25A 2J0QD 4M5DB 1BY9A 2F3JA 5D78A 3RW7A 2MQOA 3RW6A 1H2UX 3CPWR 2M7SA 2BZ2A 1R8PA 2XSFA 2CPYA 2M52A 4C0OC 2ADBA 1M5VC 3NS5A 1WELA 1N88A 1VQLS 3ZZYA 4C4WA 2DNYA 3R1LA 2KI2A 3I55S 4YUDA 2MQLA 5LSLA 5H1SV 1A9NB 2BOPA 2CQ3A 2J0SD 1U1QA 2LA6A 3BO4A 1S72S 3IWNC 1RK8A 2XS7A 1VQKS 2MKKA 3K0JA 2RUGA 1U1KA 2AD9A 2AYEA 2MSTA 2KM8C 2CPFA 1PO6A 2MKCA 2NLWA 2G0CA 1M5OC 1NJIT 2KFYA 5DETA 2HGLA 2LXIA 2XNRA 3U1LA 3PIOQ 1K73T 1U6BA 2LA4A 1U1NA 3BO2A 3FEXB 2OTLS 1WHXA 1G2EA 1FO1A 1NO8A 3CUNA 4P6QA 2KRRA 3MUTP 2G1DA 2LECA 5LSOA 3B4DA 2U1AA 2YH0A 3MD3A 1X4AA 3NMRA 3S8SA 5LXRA 1VQMS 5IM0A 2QFJA 3CCLS 2J8AA 4EGLA 2PE8A 1KOHA 3CF5Q 2XS5A 1UW4A 5GADU 2M8HA 1UAWA 2KYXA 1X5PA 2MGZA 1K9MT 2CQHA 2XS2A 1X5SA 4TU9A 1X4GA 2OSRA 5JVHQ 2LKZA 1H6KX 2DNLA 2AYMA 3G96A 3UCZP 1W2BR 2M0GB 2CQDA 1DZ5A 2FY1A 5DDPC 2MKSA 2VOOA 1VQ5S 2QA4S 2CPIA 3G9CA 3D2WA 1Q81T 2Q79A 2HYIB 3UCUP 1P1TA 3G6ES 4IOAQ 3UE2A 1JJ4A 4Z2XA 4QQBA 1X4CA 4C7QA 3CULA 2D3OR 5JVGQ 1OIAA 2K8GA 3P5TL 3Q2SC 3V4MA 2OJ3A 5EN1A 1VQ6S 2X1FA 1WHYA 2ZJPQ 2RT3A 2MPUA 4RU2A 3CCUS 2ZJRQ 3P49B 1WEXA 4UQTA 2MKJA 4Y00A 5DDOC 2F9JA 5BJRA 1N8RT 2KH9A 3EGZA 2GO9A 3LPYA 4LJMA 1U1MA 3SMZA 2CQ0A 2AYGA 2AYBA 1WHWA 2RS2A 5GMKa 3CMES 2VOPA 1WF0A 3J7ZT 1DBDA 2DNMA 4OZ1A 4LMZA 3G4SS 2CQIA 1B7FA 2M70A 2I38A 3BEGB 2PEHA 1ZZNA 1FJEB 1URNA 3VAFA 5DM7Q 4F02A 2DK2A 1VQ7S 2LMIA 1IQTA 2X1GA 3MURP 3NS6A 2LYVA 1H2VZ 3R1HA 2HVZA 3MOJB 2DNNA 3P3DA 2DHXA 1ZZFA 3VAHA 5HL7Q 2KRBA 1KQSR 2L08A 2M88A 4WFBQ 1SJ4P 3MUVP 5DM6Q 4QPTA 4UY8T 3N9UC 3DLLQ 2KHCA 4PR6A 2CPDA 2DNOA 2RQCA 3L3CA 2E5HA 3H2VE 3JB9k 2DGQA 1X0FA
chains in the Genus database with same CATH superfamily
3HCXA 2QGFB 2E5IA 5EUHA 1RCXB 1N56A 4OJ3A 1JLQA 4PWDB 3EWGA 3OPKA 3C15A 1IBMJ 3ZO7A 2BE7D 5GAEI 1Q53A 4ED5A 2G2ZA 2XNQA 1Q82T 4LF6J 1F9FA 4BCAA 1Q16B 1TK8A 4OZ0A 1WF1A 1L3TA 4LF4F 2MKYA 3V5RA 1K0VA 5SZTA 4ZP7A 5IQQA 1RABB 1EKSA 3ZNJ1 2D74B 1VRTB 1VHIA 2E1PA 2RH3A 4KHPF 3WC0A 2SXLA 5IT4A 1OJ4A 1JLQB 4DOZA 4EZ6A 5GAEU 4NYZA 4K4VA 5KFAA 3C15B 1JXVA 1RDRA 2F63A 4PQAA 3FNNA 3HDSA 2X7IA 4FNIA 1IR2A 4LT6A 3OTCA 1DJ0A 1VLYA 4YQWA 2DJWA 4OHWA 2MQMA 2B9XA 1WEYA 2VUGA 4DLEA 1HQUB 3GLJA 3D5MA 1IR0A 2WSCC 2VBWA 2KN4A 1APSA 2W2MP 2CPXA 5KFMA 2WRMA 4DN9A 3GU0A 4F4KA 5FJ4A 2DNQA 2BANA 4P2XA 1VQNS 3KFWX 1VS3A 1NJZA 1S76D 3GFYA 5KT3A 3BZQA 4J9QA 2LEBA 4ZLLA 1SJ3P 1YZ6A 2YNFB 2MJNA 4JI4F 3M6WA 2FIUA 4CDIA 5MAOA 4FZVA 2V0NA 4ENOA 2DEIA 3I31A 1OQ6A 1ACMB 3AXKA 3V6KA 7AT1B 1HNXF 4HH0A 5A76A 3DM2A 1N0UA 3THTA 3QLHB 2HPUA 5KFFA 3TZZA 5D4PA 3H4BA 4HKQA 3I82A 3AT1B 1PC5A 2QA1A 1NJWA 2HG4A 5LJ3Y 3NNAA 3MCSA 1P9YA 4ELVA 1FVSA 2AW0A 2MY8A 4NA3A 1PYTA 2I8EA 1GH8A 3ENVA 4WF9Q 3DN9A 5KG4A 5ETMA 1BUXA 1KLMA 3LUYA 3T41A 2R7WA 3SYZA 1RT4B 2OD4A 2DRAA 5LXYA 4Q2LA 1U4BA 2N82B 3TUIC 4LRFA 1M1GA 3G6VA 5D77A 2VONA 2PFFB 1SJQA 5CH7B 1IJEB 3DM2B 3M4XA 3NGDA 3TEHB 3ZTRA 1NPKA 3BGFA 3DOKB 1SPBP 4CIOA 2RQMA 4B3OB 4OYMA 1Z2ZA 4RX6A 2VQFJ 1JWWA 4DUTA 2UVUA 2BVZA 3M2VA 1JLFB 3RW7A 4NPOA 1H2UX 4D3HA 2XSFA 2M52A 4U95A 4I2PA 4DV0J 3RRGA 4F4YA 1VQLS 3CDUA 4YUDA 1PC4A 2HBYB 4MYTA 4JI8F 3V81B 2BKNA 1FCAA 2BMBA 4OJHA 4ZA1A 3J7YI 2JHEA 3T5KA 4LF7F 1S12A 3IAM9 3FQKA 2BRKA 3MAAA 4O4RA 2VA3A 5LMUJ 4LF9F 4RW7A 4X4QA 2HHWA 1VQMS 2E1CA 3N6NA 4KE5A 1Q7LB 4USIA 2ZFHA 4N8OA 4CNYA 2NYIA 1VK3A 1X9SA 4EBEA 1GEHA 2ALYB 2XS2A 1X4GA 2E5LJ 3C66A 4U7UD 1WC0A 4PUOA 4OI1A 2K06A 1SL0A 3G9CA 3D2WA 1GMWD 2NXEA 4P73A 4J9PA 3BQ2A 1JLBB 1IBMF 2IBOA 1N5QA 4CWBA 1OIAA 4RUCA 1FDAA 3V4MA 1CQMA 1LW2A 4LF6F 3Q8VA 5D3GB 3MAAB 3K5NA 3WQPA 5JJBA 5KT4A 4RW7B 1CSJA 5GMKa 3CMES 4Q0BA 2HWHA 4K2JA 2HFNA 3G4SS 2IAJA 1HMVB 2MTLA 2RRNA 4X84A 2RF2B 4NE9C 3M7VA 2JLGA 1HQ2A 1H38A 3QWUA 4JP8A 3MMAA 2BM0A 4UY8T 5DS7A 2DNOA 1BD6A 1CEZA 3AJ2A 2RE1A 1YJ9S 2C2DA 2IYIA 3FZBA 3PR4A 2BYCA 5DQIA 3VF0B 3ULHA 1AXQA 3TQEA 2JSXA 1FJCA 3VV2B 2JEJA 2NREA 4UW2A 2BM1A 3D1HA 2AV5A 4NRUA 3QFWA 2MJUA 3CC7S 4AQYJ 2CPEA 3WDOA 1WKLA 2YX1A 3W7BA 2DRBA 1XMOF 2EFNA 1N5YB 1H98A 2QTWA 4H4MA 3DGPA 4JI6J 3DRSA 2ZJQQ 4C8ZA 1RKJA 3JTOA 1K0TA 4K4YA 2CWKA 3V6JA 2HS4A 1GX6A 2FJWA 3KLFA 5B7WA 4LR8A 3KLHA 2HHXA 3F44A 1QUPA 3CXCR 2CWXA 4YEAA 1PYOB 1HBMA 3W60A 4YDDB 3EZ5A 1AFIA 4FF1A 2VB6A 2BBEA 2NXUA 4OMFG 4J9UE 1YRUA 1P6TA 2POKA 2ZBRA 3UO0A 1L3KA 1YHQS 1QDUB 1T95A 5KT5A 2GQCA 5HANA 3CB4A 3Q83A 2Z4PA 1U1RA 2VF3A 3D6HB 2VA2A 4KRWA 4KSEB 3MPUB 2FJXA 3J81j 2NPIA 2XMTA 2JEGA 1JLAA 4URGA 3KLHB 4PZVA 2MZTA 2WOMA 3IGNA 3O1LA 5KOXA 4V19X 1YK9A 5KFPA 4X62J 1QTNB 3NS7B 4K5SA 2VQFF 4YB5A 4CRJA 1EB0A 1DLOB 3MECA 1YWXA 2BA9A 3MM7B 4C3MA 4DV0F 2UUCJ 3UVJA 2R7QA 1YZ7A 3M2UA 4J9OA 4Y6IA 4ANDA 2CQ1A 4M5MA 4Y65A 4O3QA 4DL5A 2N4CA 3RB0A 1YBTA 1CULA 1EQMA 2A2DA 1E6YA 2P8IA 3I6PA 3RBDA 4B9VA 2Y8YA 3SDEA 1MU2B 5DDQC 2F8HA 4WIQA 4LR7A 2IMWP 1X4HA 4DPOA 1T3NA 2Z56B 3M2RA 2MDAA 4U96A 4X64J 2YNGB 4FP9A 2E5LF 3JSYA 3MM8A 3THVA 5IV3A 3UVJB 1PIEA 1M90T 4JI3J 3M2UB 1O5JA 4JI1J 1I6JA 2GS8A 2VHGA 1LWXA 1FESA 2AZ3A 2C2ZB 2B5JA 4A8WA 2QZ8A 1UEUA 3JQMA 4IQXA 1QAIA 1TUWA 1CLFA 2KT3A 2YQ1A 1M5VC 1T94A 3DU6A 4DF8A 2NSCA 3D9BA 4K0KJ 1JNZB 4DL6A 1UVLA 3F41A 3W9HA 3W61A 3MMCA 4PXCA 3MM8B 3BKTA 1RE1B 1NEEA 1Q8BA 4P6QA 1MN9A 4ES2A 2VD3A 1X4AA 2EKYA 2UUAF 2B5JB 3S1TA 3LP0A 1EKRA 3W5YA 1RYSA 3HKZD 2QFIA 1TR0A 1QAXA 1W2BR 2CQDA 3D68A 3KJVB 4DN0A 1S4EA 3DYAA 4P52A 4R5PA 4X4SA 1YJRA 2P9CA 3JTNA 2ATLA 4J9KA 4CLTA 4K4SA 2VH7A 3BSAA 4AQYF 2LU2A 3K5PA 2E7XA 3BSCA 2LLZA 4UZCA 4A8SA 4X4TA 1BWEA 2RU9A 2W2PP 4DFKA 1HNVB 2ZZMA 3LP0B 1QAYA 3GWCA 4JI6F 4DS5A 2W9CA 4PQUA 4OYIA 3DYAB 3EXYA 3NAIA 2NQPA 2C3MA 5GMEA 2GX8A 4B08A 4CTAB 4CCHA 4PXBA 3T1HJ 4OZNA 3ADAC 1X9MA 3QT8A 3CIMA 1REGX 3CT9A 2FDNA 1S5ZA 1PAUB 3ENWA 3BO3A 1KLNA 1R0AA 1GQEA 3L4BC 4CT9A 3OFFA 5EHHA 3KNAA 5FDLB 3PTWA 3EE3A 4PWUA 3SZ2A 2BQ3A 4DG1B 1Q5VA 3TR5A 4ETZA 3M32A 4QU7A 1VCTA 2QSFA 3I5BA 4X62F 5J1PA 3UPFA 2L3MA 3H0PA 4PWWA 3DLEA 2HZAA 2KG0A 3MEKA 1R0AB 1SQFA 2UUCF 4I69A 2MQPA 4HHUA 4CO5A 3W65A 2OAUA 4EWTA 1T3OA 1R3NA 3GZ7A 3MPDA 2XEXA 3HHLD 2RRAA 5D4LA 1R31A 4ZHRA 1RA6A 4F0MA 4J9NA 4Y2MA 4YP3A 3DLEB 2MYFA 2DVIA 4J9RA 4WCEQ 2IMOA 4RLEA 2R8JA 2XGPA 4OYWA 4X64F 4IG3B 1ZOTA 2HGNA 2KXNB 2RKIA 4ELUA 1NUEA 4JI3F 2EC2A 4QU6A 4JI1F 4F36A 5L1KA 5F0UA 3CGIA 1CC8A 1AUDA 3MTKA 5BR8J 4ZPVR 3VGUA 3P45B 3O5TB 4ZIVA 3OQ2A 1WKJA 4B02A 3M8YA 2CNKB 3GIRA 1KSPA 3S6EA 2KFNA 3TYTA 4NXNF 1TK5A 3PJXA 2LQ9A 5E3PA 3RTVA 2A0FB 3K59A 4ANEA 3B4MA 3UN2A 4XK8C 4RNHA 1FK9A 3D28A 2GMJA 5GMDA 2R8KA 4XDDA 2F4VJ 3LP1B 4NYOA 4Q5VA 2W9AA 5HROB 1RAJA 3C6UA 4CQ1A 5CD4H 1RISA 1SIWB 2EG1A 4WK3A 1YI2S 5KT6A 3CJ8A 2RDDA 2B6AA 5C25A 2FHJA 4IO1A 2CJYB 4NZ7A 5EWEA 3MMBA 4JV0A 3TJAA 3DNCA 5IM0B 3AOBA 1VI7A 2XMVA 1FK9B 3IC1A 1NK4A 2EPIA 2DHHA 4K4XA 2G4BA 3MM9A 2QYCA 2LFVA 1BXNA 4L73A 4LIWA 3PO4A 2J0QD 5D78A 3RRKA 2MQOA 2W01A 1XMBA 2PEBA 1RWPB 3AY0A 3I4HX 5L1LA 2BEFA 3Q8QB 1BMQB 3I55S 1RCOB 3M8SA 3W2VA 3GYNA 3Q8SB 4M5GA 5C25B 2MSTA 3SFGA 2NLWA 4CLLA 1LXJA 1JXEA 4ZCKA 3GTYX 3MMBB 4MK9A 5EGYA 2GZOA 2Y1JA 3ISZA 1B0VA 1RTZA 5HQLA 4RW8B 3FUYA 2IM1A 4MAKA 4XO0A 2Y0BB 1BLUA 1NH7A 3RGIA 3UD5A 4TU9A 2C3OA 1ZM2A 4JI5J 3LF0A 1YDLA 4DV4F 2V2KA 1SVDA 5KFIA 4J9MA 2ZNZA 3TJ8A 2CPIA 1SBRA 3EDQB 3W2VB 3CJTA 4CNZA 2PDAA 3WIVA 4A47A 4IRCA 5EN1A 3BDPA 2RT3A 1RHRB 1HPZB 3TA1A 5BJRA 4Z7YA 3SQGA 1N8RT 4F0HA 2GO9A 4FYYB 3QRPA 4URSA 4OV6A 2CVEA 1KQGB 1FJEB 5DG9A 2PGCA 1B99A 2HHQA 3I96A 1S1WA 3P3DA 2VKZG 4WFBQ 3PRDA 1EHWA 2AJ0A 3M6UA 3SCJE 3CCSS 5F8JA 1TKTA 1FKPB 2CFXA 1WG1A 3RAMA 2D9PA 1XR6A 1NKCA 3CCVS 2DCUB 1NAQA 3NKYA 1NMEB 3GIMA 4ZOSA 3BR8A 3DI6A 2Z8QA 4IG0B 1JJCB 1FEHA 2YQ0A 2RSQA 2I5JA 4DHVA 1Y3KA 5HN0A 3TZXA 3K5LA 3F73A 3LQVA 2J5AA 3EDRB 2UUTA 1TKTB 3RB4A 3AD8C 4OYXA 5BYRA 2FLNA 5F9LA 1C0UB 1U2FA 1N36J 4Q43A 4TY8A 4ECYA 3PCOB 4EMDA 4OV1A 4GC6A 3TRGA 4K2XA 5HVHA 1SKSA 3OTOF 3D3BJ 2R7OA 1RP5A 4WWSA 4F8RA 3RZAA 3H5UA 5LL6d 5I3UA 3DOLA 2VICA 5CA5A 1SQGA 4DEZA 3QATA 4WZQA 1VQSA 2YWGA 4OYPA 3DMJA 1R27B 4UUWA 3OL7A 3KLVA 3ZXWA 1RWWB 5CQGA 1U0HB 3Q22A 1D9AA 1CQNA 2JVRA 4ZVGA 3L7PA 4GRSA 4LUBA 4QWAA 1KWMA 2M8DB 1BQXA 1F2HA 2ERRA 1VR6A 3H5SA 4P7TA 2EEYA 1XTZA 5E3AA 2PI5A 4CLKA 4TY8B 3JTPA 5KT2A 3JSMA 5KG7A 1R8HA 5H9FJ 4DQRA 1FT8A 3ZZPA 2IDEA 3AJ1A 2O1PA 4O4GA 5FD1A 3BGLA 7FDRA 3GV7B 2XZDB 3DMJB 1RSCA 3QSIA 1EAYC 5AXLA 1JJ2R 5EDWA 1R6YA 4IOCQ 3HVTA 1W7WA 3I4PA 3G6XA 2JZ5A 3Q2TC 1Q8IA 3S01A 5M2RA 3JSMB 3MFHA 3AA9A 4ZVUB 5F8HA 2W9BA 4ES3A 2M2BA 1LQ9A 2IJRA 1YRTA 4OX7A 2UUBJ 3DU5A 1H2TZ 3BGUA 2JWNA 1Q78A 1WNEA 3UD3P 2CPJA 2HBRB 2QLBB 1MNEA 4HYKA 3SCLE 2GJFA 1Q0NA 1UWBA 2G1HA 1UVKA 4JI5F 4O23A 1FE0A 2Z2ZA 3CCRS 1C2PA 2RQ4A 3ISND 4YY3J 4LRCA 2FD2A 1B3TA 4WKRA 2FJEB 2MGZB 5H9FK 1UFKA 3PW7A 1URRA 3D4JA 2EXUA 3RW6A 1N32J 1GXUA 2M7SA 4N76A 2XO7A 2W9BB 2MQLA 1UPMB 2VG6B 2KB2A 4PG5A 3ZTSA 3M05A 4AE5A 5AE3A 2HLUA 4KH0B 2E29A 1NSPA 2H5IB 2Q43A 4B3TJ 4Z7CA 2O66A 1K73T 1U6BA 2C22A 3DLGA 1SUQB 2KRRA 2WVEA 1IUJA 3E3XA 2EC0A 1M0SA 4F3QA 2BJDA 4P75A 3QIPB 3HVRA 2FQQB 1U24A 3N5BA 1G6BA 3IO1A 4JI7J 2NXNA 1TFWA 4GVBA 1RADB 5ETVA 3I0RA 3TNVA 2Q79A 2ASDA 4OZLA 3IBCB 1SKRA 4HACB 1QAJA 3R8YA 2AP6A 1GMWA 2B8QA 4ZPAA 4WP9A 1WHYA 3X3UA 3KLEB 4CLPA 1TUVA 4QR2A 4DFJA 4DUYF 4YN3B 4QCLA 4ZMMA 2LDYA 4OZ1A 3D0GE 1Z1ZA 2PMZD 1RTDA 5F0WA 1N36F 1S48A 2V68A 1J5EJ 3I0RB 3MURP 1YGYA 1H2VZ 4PCQA 1S1XA 2NSBA 5KFWA 3N9UC 2E9ZA 4LF8F 3BKUA 2PC6A 4KFBB 1IBKJ 2DGQA 1VC0A 5HO4A 3OSPA 2R7XA 2ZKUA 3PHTA 2DGWA 2CQGA 4M1KA 2BACA 3PYDA 2WBMA 3G8TA 1NK0A 1JIHA 3CJ2A 1RTDB 3NY0A 1RT5A 5CYMB 2D9OA 4NLUA 2DO0A 1FRMA 3AQOA 1S1XB 3CJ3A 4MH8A 2DITA 3SXLA 2IRYA 4E2FB 2X3DA 2HVDA 1SKUB 4CO4A 5H9EJ 4RBTA 3J80Y 4U7CA 5D15A 3OW2R 2PMHA 2J7UA 3WZ0A 4M5LA 1G3OA 1MWQA 2HZCA 3I0SA 1X4DA 3AD9C 1IWGA 3G82B 4LFBJ 2RU3A 2XY5A 5G4DA 2FYXA 1P27B 4ECXA 5M2UA 3I5AA 2IDLA 1U1LA 2ZUAA 2AQ4A 3ILIA 1FTCA 1AYEA 3W5ZA 1Q1KA 2KKHA 1Q8LA 3H59A 4DV6J 3QT5A 1RAIB 1WOOA 2ZBIA 2ASJA 1DY3A 2UUBF 4X4UA 2HRYA 5D4OA 2DYAA 2EVZA 3F0NA 1NLKL 3PFEA 1HFEL 3MXHP 1WHVA 3CJSA 5CCLA 2YWKA 4XPEA 4C3KA 1M1KT 4YY3F 1KD1T 2XTJP 3K17A 3T19A 4NRTA 1YRXA 2DNZA 2AGQA 1P8GA 2J0XA 2RHQB 2V94A 3UN5A 2JNJA 1N32F 2VZ9A 3MUMP 1N54B 1DQ8A 2VFTA 3AB4B 1S1UA 3JAMY 4F3OA 2LXFA 1U25A 1S49A 2V5HG 2OUGA 3UNYA 4LBIA 4C97A 2YPZA 1QE1A 2JL9A 3HHNB 4B3TF 3HT0A 3N6MA 4CM0A 3LH2S 2V4JA 3VAMA 4L75A 5K5MA 1K44A 5LJ5Y 3T6JA 1RGVA 2R8IA 1L3VA 1IVZA 1YJNS 1HHSA 4FNHA 5C24A 2HFSA 4JI7F 3WBZA 5C5JA 2CZ9A 3OLAA 1S1UB 2GIQA 5BXIA 2GO8A 4IOBA 4O3NA 2YPYA 3A8KA 1YSJA 2HFOA 2Q66A 2R7SA 3BJYA 3M8WA 3AAWB 2MMYA 5KFDA 3FBFA 3D1OA 2XYGB 2Y9HA 3M8PA 4NA1A 4GKJJ 4OI2A 1H74A 2MEWA 3ICLA 3PG9A 4QWEA 4F50A 4EFAC 3KWMA 4DR7F 3IMQJ 3CDEA 4RUAA 5K8MA 1JLCB 1I94J 4ALZA 1VQKS 2BJ8A 1U48A 2FY8A 5C24B 3C2PA 1M5OC 1RT1A 4RWWA 1J5EF 4CLYA 3FEXB 3PRBA 1RAGB 1S6PB 3S8SA 4I7FB 1KOHA 1T05A 1IBKF 4I64A 1G1XA 2DKOB 1U8WA 1L3UA 2ZBCA 2BR0A 4EZ9A 1NSAA 1S0VA 4RR5A 4M95A 2A1BA 2I9SA 3Q8PB 1TP7A 4NCGA 3MFIA 4DV5J 4BHQA 1JJ4A 1X9WA 1D1UA 2AJ4A 4IH5A 4E8UA 1FRJA 2ZD1B 2CNOB 5DDOC 3DRPB 1C1CA 4WPAA 4EYIB 3CJKB 3SMZA 3FQLA 3TARA 2CQIA 2M70A 4X4RA 2IBKA 5J1NA 2NR0A 2YY3A 3M8QB 1OYEA 2UZAA 2F8EX 2BJ9A 1HWUA 3Q86A 3LALA 2K1RB 2NPFA 5HQMA 5AXNA 4NCGB 1EP4A 5GADI 2QO3A 1WKKA 5HL7Q 4KGXB 4C11A 1SJ4P 1J2VA 4LFBF 3IA0A 1HBNA 4IH7A 4RPFA 5T7LA 4ED0A 5D0RA 2FZKB 2CG8A 1C1CB 3HI9A 1U8SA 3NL0A 3KDNA 3LGHA 3A8IA 4KC5A 1UTAA 2ZH6A 3OJSA 1EZZB 1WC1A 2RIJA 4F4AA 4EEYA 3CD7A 2DXDA 5C7PA 2DH9A 1EETB 4QYRA 3HLUA 1KFDA 8RUCA 5KFKA 8ATCB 2DR9A 5GAGU 3MD1A 3H98A 2IM2A 4ECVA 5IZHA 1U6FA 1S1VB 2DBBA 4B9NA 2GGPA 1VIOA 1C1BB 2LDIA 2FZCB 2EK1A 4URQU 3I32A 3TW0A 3Q24A 1HBUB 2LEPA 1B64A 2WTFA 2ZVIA 3DOMA 1VQOS 4X4VA 3V4IA 4LFAF 3KLIA 1TL5A 4B9UA 5SUHA 3PX0A 1RAOA 3V2UC 3NG8A 4IR9A 4BC9A 3POTB 4Q7AA 4TU7A 4S0MA 4WP3A 3P5BP 4UT4A 3KJQB 3U1MA 2F40A 3D1QA 2VODA 1IKXA 4CLSA 4K4ZA 1QVGR 1RT3A 4DCPB 1VBKA 5DLFA 3O2IA 4IFVB 1B70B 5ETNA 3PJ9A 2VPXB 2KJWA 2EKNA 1WD6A 3J7AN 3IBWA 2HNZB 3PYFA 3V4IB 4NEZA 1U2CA 2PFDA 2DO4A 4O3OA 1FHTA 3KLIB 1VGYA 3AB2B 3KKFA 4CT8A 3DKDA 2F9DA 2XHCA 1NZAA 3ELHA 3JSBA 1JLEB 1R89A 2NCKL 3EVWA 3QT7A 4GKJF 1IKXB 4F0KA 1S9EA 1TMMA 3PVXA 2XULA 1NCLA 4WZMA 3ITHB 2Y8WA 3FRYA 3TUPA 2W7OA 2GW8A 2DHGA 2RUSA 1I94F 1NB7A 4LIRA 1GMUA 1TKZA 2Y0SD 1Y4ZB 1RWMB 2RNEA 3SQOP 1EX8A 2FLPA 3DLBA 1DARA 4ZPWR 3FCWA 1PJ7A 1NK7A 3MI7X 1JQGA 1GX5A 4C2MA 3VR1A 4UF4A 4X4PA 2IRUA 1S79A 4I6WA 1A7GE 2X1BA 3FEZA 3FSIA 1LWEA 5THWA 6FD1A 2GA7A 4DSLA 4AXJA 3ET6B 4DV5F 3W2WA 9ATCB 2OPRA 4ID5B 1I5OB 1UEVA 3L7OA 4FS2A 4KKOA 3TAMB 3IGVA 3OR2A 2H5JB 1FDBA 4R25A 1A9NB 4DV7F 2M3DA 4XIUA 2ZM6J 2EI5A 4DV1J 2VJVA 3BSNA 2Y1IA 3GFXA 4EO6A 3AHPA 5AJ3J 5E2QA 2KFYA 2HGLA 1TK0A 1LWEB 3TA0A 1FO1A 4RW6A 5A8KB 1XBWA 2XO6A 1RHJB 2W7AA 1YJTA 2OEKA 1C0TB 1CJKA 3HHDA 5LXRA 2CA9A 2PE8A 2RAQA 5RUBA 2XS5A 1OSDA 3GR1A 4KAIA 3KK3A 1W25A 2GHVC 2GQ2A 1C4AA 2XQCA 1S77D 2B4VA 2KZMA 2YVSA 1FWKA 3R5CA 4G1QA 4PXEA 2HRUA 4I2QA 2CG4A 4MJKA 5DGAA 1PSDA 1FFGB 1UA0A 3KLGA 4Y2KA 3GB0A 1TV6A 3N4WA 3FDSA 3OFGA 2D3OR 4Q8FA 2XWXA 1NPPA 1VQ6S 8AT1B 4O44B 1RT7A 3P49B 2D3ZA 3TI0A 4UQTA 2JC1A 5LMNF 2VG5B 4PAAA 1CJKB 2CQ0A 2KYZA 3JQJA 3T1YJ 4LMZA 3KK3B 3FFIA 3OD2A 5KFZA 3BEGB 3BBCA 1ZZNA 5B0BA 4A8YA 4ZITA 4ZVTB 4F02A 4G1QB 2LMIA 4DSJA 4Q2MA 2HMIB 1I3OB 4DR1J 2BX6A 2H1YA 5KFXA 3HJVA 4DLGA 2V67A 3IRXA 2XG8A 1TV6B 5F8NA 4MTPA 1CJVA 2RB7A 2BE9B 1M5HA 3NBPA 1BQMB 2ILZA 2LQJA 4AYBD 3NLCA 1VBXA 2W2NP 3US5A 3GIKA 1RAEB 2ROPA 3OHBA 3AQPA 3K2YA 1PJ6A 2U2FA 1F5CA 1YBAA 2CVIA 1N33J 2CUYA 5J2QB 1IXKA 1KTQA 5KTQA 3CCJS 1CJVB 3OR1B 4FF3A 1DTQA 1HLWA 2VG7B 3HX9A 3C46A 1N5SA 1T9XA 2IVYA 2DH7A 2BUNA 3MOZA 2JFDA 3FGVA 3EXCX 4F7VA 1S1TA 2FVCA 2QMXA 2HK3A 2VFRA 4ED2A 3NGKA 2UV8G 3TA2A 1RHMB 2CJBA 1ZTWA 5JUMA 4J37A 3KNGA 2BKPA 4LQ9A 4JI4J 1KFSA 2DCLA 3CCES 2VL1A 2PMWA 4ED4A 4C6AA 4DSKA 3K5MA 1DTQB 1VYAA 3O6QA 3EVMA 2VDIA 3G8QA 2AT1B 1FFWB 3H40A 5JMNA 4DQSA 4L74A 2DTJA 3FKBA 4NLPA 4WTYA 1VBYA 2E1RA 3NRBA 4FF4A 5AT1B 3KK1A 1QVFR 1N4LA 1S1TB 3AOCA 3CJ4A 2HURA 2R9LA 1UCNA 2IIHA 4ATNA 1Q8KA 4Y28C 4ICLB 3GONA 4ERDA 3R7SB 2HNDA 2X51A 1YX2A 1WI6A 3B54A 2ZC3A 2C3YA 4KGKA 1S0NA 2YNHA 2M9KA 5KOWA 5KG0A 4RU9A 2ZM6F 4JI0F 4DV1F 3PM9A 3EPGA 1YJWS 2ZDPA 1WSRA 3VWSA 3OXLA 3H5XA 3OL6A 5DZ6A 2WCXA 2VU5A 4DX5A 3ENQA 2BKOA 3K8VA 5DZ7A 1JLGA 4KTQA 4UQGA 2IJNA 1AFJA 3Q89A 1HWLA 2OD6A 5B0CA 3TOQA 4JI8J 2YNHB 2EK6A 3J7Z5 5F3TA 2B9YA 2QE5A 5KFOA 1VQPS 2W8LA 2FJDB 1I51B 2MSSA 2DNPA 1BC6A 1F9EB 3KJFB 5F8MA 5HBMB 2ADBA 3NS5A 1WELA 2FJBB 4EBCA 2R2SA 4KGMA 2BOPA 4A46A 2QIFA 3T1YF 3C16B 2XS7A 3K0JA 1U1KA 1Q79A 4WE1B 2G0CA 2J7KA 4USKA 5GAHI 1XNQF 1XR7A 2UVRA 5J2PB 5ETLA 2ACMA 3KG4A 2PD1A 3R5BA 3BO2A 4DR1F 1G7CB 4K4TA 5KFBA 1NKBA 2U1AA 2KO1A 1TL3A 2MLYA 1REVA 3PEHA 2M8HA 4OJGA 3M1VA 4C48A 1IM4A 4DR2F 2BOAA 2Z2MA 3MEGB 1VQ5S 4OLOA 3UDCA 1TL4A 2HQ3A 4IKAA 1SH0A 1UW9A 2BQRA 2HAIA 4B9MA 4CLZA 4DR4J 4NLVA 5ETSA 3Q8YA 3V6HA 2OJ3A 4K4WA 5AXKA 2NUUG 3HT3A 3HO1A 1NNDA 2VIHA 1PILA 2GMHA 4NLTA 4DQIA 3M30A 4PPZA 2KH9A 3OFHA 1WC4A 1N33F 2FVQA 2AYGA 1TL3B 1REVB 1KP6A 4UZBA 1KTVA 1FE4A 3M1VB 2ZITA 1NBEB 2HFZA 2KT2A 4J9VA 2E66A 1PAEX 3VAFA 5E0OA 4NI2A 3DLKA 4AL7A 4ZP6A 2J9DA 4F4XA 2W4DA 2KRBA 3N6LA 5DGBA 2B8PA 3PV8A 4EUVA 4PR6A 2CPDA 4H4OA 3FSYA 4C8NA 4IQMA 2QSWA 5K14A 4HL9A 1VDHA 5KFUA 3J80U 2KG1A 1SL2A 3M30B 1LFWA 1ZAXA 3SI8A 1KRPA 4JI2J 5CZVA 1XMOJ 4MKYA 1RBLA 2R4FA 4ZPTR 3W9IA 5HJYA 2ASLA 4DCJB 2JX2A 3PEJA 4ECRA 2RS8A 2OELA 1UVIA 3VALA 3D67A 4MT1A 2XGQA 2D1CA 3NNHA 2BJ7A 1U0SA 1FXDA 5ETQA 3DCAA 2BW7A 4RO0A 1E6VA 2CPHA 2BANB 1DAXA 1ZS6A 2FPHX 2KDOA 2A2CA 1OYDA 2P5VA 5KFEA 2AWZA 3HHKA 2UUWA 1SC6A 2ZH1A 3I5CA 3R7BB 3RYLA 4QIEA 2JEFA 4IRDA 3CCMS 2MZRA 3PDNA 2DGSA 2FZGB 1RTJA 2NUHA 1GTHA 4XTTA 5KFJA 1JJHA 3VGTA 1S6OA 5AE1A 2ZH2A 4I67A 1XR5A 4L76A 1VQ9S 2YTCA 2K3KA 3QT6A 4USMA 4NLOA 5IT9Y 3VVTA 4NL5A 1F2GA 3ZZTA 1O0PA 1QD1A 5J2NA 1LEOA 3JAMU 1RHKB 2ILYA 4RZRA 3G2XA 2R3VA 1WDTA 1WG4A 5BYQA 2DIUA 3PRVA 4WIIA 1KLMB 1LK7A 1QSYA 2V34A 4N8NA 2MY7A 2APOA 3UW1A 1RTJB 1X4EA 2DR8A 3KK2A 2V63A 3A1YG 2KXFA 2XSJA 5D4NA 2I2YA 1YJ7A 3X1LB 4PG7A 3MM6A 1MSWD 4ITSA 1N48A 4DWIA 3C6TA 2QYGA 2F7VA 1DQ9A 3M2VB 1VJWA 3RBEA 2MHNA 2HGMA 3CDBA 3A8JA 3RR8A 3OSNA 4I2PB 1S6UA 3VZIA 3PW0A 3M8ZA 2DNKA 3QJLA 3ISNC 4ZP9A 5LT5A 4XAKA 4DL4A 2KXHA 3J7YU 4DPWA 3S7RA 2MZJA 4ILMA 3MEDA 3KYLA 3KK2B 5DQHA 2CDQA 1WI8A 1F6TA 4CO2A 3AFGA 1WWHA 4O3RA 1HBOA 2Q1LA 3W63A 1CJTA 3HKWA 5IFMA 1RWUA 3DC2A 2VPYB 5B0FA 3C6TB 2WB1D 4LF2A 4KIAA 3LP2A 2LQ5A 1RUSA 4F04B 1SJFA 1RAFB 2UP1A 4CLFA 4DR4F 2I0XA 1TUGB 4AL6A 5KG6A 3CPWR 4PUOB 2EW9A 5CHCB 5E41A 1FRXA 3MAQA 2DNYA 4M5NA 2C1EB 2UUAJ 3GV8B 2Z30B 3BO4A 1HBOB 1UJ5A 2R42A 4J90A 1LW2B 4KGVB 3HF5A 3ZZ0A 1GAOA 4U8YA 4TYAA 3A3PB 4I6YA 1PJ5A 4CZCA 5EX3A 4Q0BB 2V2VA 4KPCA 3LP2B 2HHSA 2IAJB 4HVZA 4MIWA 2N7YA 4C8KA 3BQ1A 1X5SA 3IFEA 4M5DA 3UCZP 1IWAA 1JKHA 4KHMA 1MWZA 1KBRA 1UL3A 1TU0B 3MMAB 2HIQA 4O3PA 3M9OB 5J1EA 2ZOGA 4JI2F 1P1LA 2QL9B 1G4CA 4J91A 4M5KA 5CD4A 4HDGA 1FRKA 3FK4A 5AE2A 3EYZA 3OUYA 1TAQA 2CAJA 4L3NA 5L46A 2IA0A 2F9JA 4DBQA 1TELA 1VJQA 1FERA 4OZ5A 2PIIA 4YDXA 2RS2A 4L3KA 2GIFA 5KG5A 1ZETA 1CS4A 2W2OP 3MCNA 4HHJA 2CADA 3FC9A 3R1HA 4CLWA 3IM8A 3RR7A 2PSZA 2H5EA 4Y2AA 2VJUA 3CSKA 4H4MB 3A12A 3DGPB 3IG1A 3MUVP 4G3IA 3DRSB 3D54A 4ILLA 4FPRA 1R7IA 3L3CA 4X66J 1T9WA 3KLFB 1GXLA 4B9LA 1ZPVA 2YX4A 2AJQA 3KOAA 3ILJA 1HBMB 3JQKA 1IKWA 3OXGA 4CI0B 4U9RA 2HW3A 3KTQA 2RJZA 3M6VA 1RQ0A 1CS4B 1MMDA 5DG7A 2H51B 2MZSA 1AA1B 1NDLA 4CLUA 3P6YC 1IQZA 2MQQA 2CJ9A 4NLRA 4TLRA 1VFJA 4KO0A 1Q5YA 3KUEA 4NYPA 4K59A 1IKVA 2JOQA 2A3JA 1WOSA 1PBUA 2OPSA 4RNMA 1MW7A 1VMBA 4CO3A 3T3FA 2PA3A 1VBZA 3FEYB 1JLAB 4WFZA 4NX9A 5J2MA 2QX0A 4NLWA 1FJ7A 3GJQB 1S10A 2WOMB 1UJ4A 1IKWB 1D8YA 4LBPA 1BHNA 1WTBA 3HZEA 2CJQA 5HLFA 1X8DA 3WHIA 1YKWA 2OPPA 2QLFB 3LWMA 4HEA9 5CXTA 3AODA 3MECB 3LGNA 3RUBL 5BYSA 4KO0B 3PX6A 1TFYA 4R0JA 3FBCA 3LW5C 4QIGA 2J76E 2FVPA 3R6LB 4O3SA 1WSVA 3RBXA 2Y1RI 4ZVOB 2WVBA 1CULB 3CVKA 2DNHA 1YBUA 1E6YB 1RTIA 5DDRC 5LSRA 3PW2A 4NXNJ 3SDEB 4OZJA 3NCPA 4KT0C 1HQEA 1WC3A 2QA4G 3VAJA 2G13A 1UVMA 5HLFB 2MXYA 2HSEB 1V6HA 1LFPA 3M2RB 2YWFA 1ZPWX 3DHXA 4FN5A 2HKEA 2MQNA 4KH1B 4QR1A 1HWKA 4QIFA 5A6PA 1YJUA 5C42A 1HKAA 3UQSA 1TTHB 3P4UB 1NU4A 3VQSA 4NZ0A 5IT0A 3W64A 1SV5A 1V3ZA 1X5OA 3CEDA 4R8UA 1NPRA 2K2PA 2OFGX 4N77A 1D8ZA 1DTTA 3I9V9 3QGIA 1WC5A 5L1JA 1RTIB 4WJBA 3LGMA 4DL0C 3CTRA 4RJVA 5CYQA 3ZC4A 5G0RA 2FGOA 1HQEB 2GJ2A 4K7QA 3IM9A 4UOCA 4ZVQB 4OX6A 1S99A 2GNKA 3MMCB 2HRTA 2N3LA 1SKWA 5F8IA 2BW2A 4M8LA 1Z4UA 2HZVA 2YWWA 4B3RJ 1KONA 1VOMA 2LXUA 5HP1A 1DTTB 3NGRA 2AX0A 4WFAQ 3MR6A 4P2FA 2CQPA 1BY9A 4OJ1A 2PI4A 5CYQB 4JOUA 3EMTA 3I9ZA 4R5PB 4LREA 5ADZA 1ZAVA 1HI8A 2W1BA 4KR0B 2V69A 1WTFA 3L09A 3E2EA 2AGOA 2BE2A 3CMQA 1RAHB 3O44A 3OJUA 2AD9A 4F4WA 3SSRA 2XM3A 2CPFA 3BYRA 4QJVA 4DV4J 3RG6A 4O0NA 4QYZK 4AFFA 5HP1B 1UVNA 1WHXA 5B0EA 4QWDA 4P72A 2YKNA 2J7WA 2G1DA 3VHQA 3B4DA 4DV2J 2W9CB 1UW4A 1LV5A 4PQUB 2ZH7A 1UAWA 4X66F 4H54A 1FJGJ 3SSQA 4B17A 1K9MT 1FDDA 2HIYA 2P9GA 2LKZA 5JVHQ 3UDVA 1NDPA 4CH7A 2WONA 2GVDA 5F9NA 4HI1A 2XMMA 1TKXA 3HHEA 1GFWB 1D9FA 2V4RA 2XMUA 2FHJD 1S6QA 1VRUA 4Z2XA 3HULA 1NSQA 3EICA 2B51A 3B82A 2ZJPQ 4YR3A 4PG6A 4QPXA 3LA0A 2ASYA 3DRYA 4BLGA 3PO5A 4LSNA 4MK7A 3J7ZT 4OI0A 2EFVA 5KFRA 3SCKE 4QZVB 2WVCA 2BXJA 5L1IA 2WONB 4KHRA 4ZCLA 2X1GA 3M32B 3BGOP 4N5SA 2P6TA 4AXIA 3VAHA 3IS9A 1ZYQA 1VRUB 3DLLQ 3PYGA 5ETTA 3NAHA 5ETRA 1O6XA 2OI2A 2CPZA 3K7RA 1RI7A 2GFFA 4LSNB 4B9SA 2HEKA 3D6FB 3R3TA 2OKQA 4HT7A 3M8RA 1B4SA 3QRQA 2ALZA 2VFSA 1D0EA 4ZHRB 3KMSA 4YMEA 2UXBJ 4JV5F 1FRLA 2GC8A 2ZOFA 4WTOB 1QLNA 3CJQA 3OTOJ 5D0HA 1EARA 3A3OB 4E98A 1HI1A 4B9TA 3TZYA 2HVIA 4BBYA 2QL5B 4CH0S 2RVJA 1KHWA 1RHUB 2RKIB 4IUFA 2UV8A 1WEZA 1U47A 2X3GA 4CH1A 3GJRB 4KPYA 1ZH5A 3OV7A 3R97A 5MLCV 4YOEA 2CQBA 2L9WA 1VC6A 5HMWA 4EBDA 1UZHA 3HVAA 4RNFA 4DR5F 3ZTQA 1R8AA 4OX9J 3PW5A 1EQ0A 3QGHA 3DFEA 4TU8A 4LVNP 2GCFA 1U6ZA 1O8BA 1VQ4S 1F5AA 3UDLA 3W62A 4P2SA 3OFEA 3ENAA 2HQDA 1VRTA 3H2UB 1NH8A 2E44A 3C6UB 4G1IA 1KKHA 2ZH3A 2GAGC 3QBCA 1LOUA 4LSZB 2KM8B 3VGVA 3W66A 3ZZUA 4DUZJ 2YKMA 4IFYA 4B3RF 3DDIA 1KOOA 2B6AB 2CIMA 2KU7A 2AKWB 3KUHA 4ZJLA 1HR0J 3CW2C 4U6PA 2AJ2A 3R9LA 1WUUA 4EU0A 3QSYB 1RA7A 1SXLA 2C2RA 3ZTPA 2QC3A 3MM9B 3HMJG 1HQUA 1UP1A 2DB1A 3DDKA 4FYVB 4USJC 2V8HA 2FC9A 4HR2A 2YXLA 1SC3B 4OHXA 4LF5J 2O67A 3PW4A 1RWKB 2W4CA 2YKMB 4IFYB 2YNFA 4QWBA 4DV2F 3H4DA 2EG2A 1LKZA 2BABA 3W1YC 2ZH9A 2JLEA 3T9ZA 2J0WA 3I87A 1BQNA 2CNNB 3H20A 2OPQA 1FJGF 5K9FA 1SJRA 3F56A 2ZUGA 2DNRA 3H7HB 2MQ8A 1RT6A 4M63A 2E7VA 1TL1A 1DHMA 2CJXB 3NGTA 1U09A 3C19A 3ZZRA 2B9EA 4AUKA 1NHVA 2ABYA 2XHWA 3QLHA 5D6GA 2R7RA 2NS1B 4M5HA 4PKDB 2GQQA 3PKYA 1XMQF 1RBAA 4F25A 2C42A 3FCVA 1T02A 2IRXA 5T41A 1WOPA 2IFXA 4QWCA 3PFOA 2W2QP 2PA8D 4C4WA 3R1LA 3NMAA 2OMLA 1UWAA 5HQ8A 4ED6A 3BREA 3RB3A 1BQNB 2J6UA 5IV4A 2V4QA 2VV5A 2XMAA 1MROA 2OPQB 4GO7X 1KQKA 1RT4A 1JK9B 1RT6B 1S7HA 3SQGB 1FKAF 5B0GA 1TL1B 5DETA 3CIZA 3QZ7A 1NO8A 3CUNA 5IXUA 3DLHA 4JB8B 3UN3A 4PYDA 1PG5B 3FZ2A 3FRZA 2QMUB 1XIQA 3DOKA 2FB0A 2KYXA 1HNZF 1GK8A 3BB5A 4B3OA 3GIIA 3G96A 1JLFA 1S1WB 1RLCL 2FLOA 4DUYJ 4P9SA 4NXMJ 1H0HB 1MROB 2AU0A 4WKYA 3V81A 3Q2SC 3P5TL 4OYOA 3ETMA 2X1FA 3LWLA 5IS2A 4TQSA 3K5OA 2C3PA 3TVYA 2UXBF 3W8GA 2VPZB 4LF8J 2CRLA 4EK2A 4DU8A 3DI6B 3MR2A 1A6LA 3BPDA 1URNA 2I5JB 3TZWA 1F0XA 3BN4A 1HW8A 1TL7A 4NZ6A 1S4FA 3RBZA 3A4TA 2KVQE 2DHXA 1HWJA 2DR5A 1L5UA 2HVHA 3GMGA 1RWVB 4K4UA 2V50A 1JLBA 2FY1A 3GP9A 4HHHA 2ZDOA 4OX9F 3NEKA 3CDAA 1I1GA 1RU1A 3OL9A 4PABA 5D3GA 4L6V3 4TY9A 3SIPB 3PR5B 3QGGA 2E5JA 5I3UB 1ZM4A 3DOLB 4NLGA 3QRRA 1WORA 2FHKA 5L8RC 2O3DA 1HMVA 2XBPA 1TL7B 2RF2A 3MR7A 4AT1B 3WX4A 3GYXB 5IT9U 4DUZF 1Y00A 3QYYA 2COLA 2AEMA 1FA0A 4C8MA 2B4PA 3TO8A 1HR0F 2Z57B 5L9XA 3N0VA 4WBFA 2CDRB 3HVWA 2RDIA 3P8BB 4MKAA 2CJAA 4ZLPA 4LRAA 2KHDA 2XB2D 4ER8A 4O4GB 5M2PA 1SQEA 1IBCB 4A8XA 2CQ4A 1QSLA 2QMWA 4WU3A 4LF5F 4NLSA 2N4DA 2MLXA 4OHYA 3NCQA 4F3MA 3HVTB 3MDFA 3MEEA 3Q8UA 2X1AA 1Q95G 4W4MA 2R8GA 5CYJA 1SB6A 2AJ1A 1N5YA 4KJIA 2V8VA 2DD8S 5JXSA 4DFMA 2UXCJ 3QIDA 4RNOA 3VVUA 2DT9A 4USVA 3GILA 4PEOA 1YLXA 3D0HE 3R2DJ 5ETPA 1HWIA 2J9EA 3N01A 3Q0AA 1UWBB 3HP6A 1Y11A 1P9QC 3R6GB 3UWTA 4USWA 3FJ2A 2RDJA 2D41A 4DSEA 3ILOA 3MEEB 2OIHA 3E01A 2QJ3A 2ZHAA 4OI6A 1RAAB 2DGUA 1QTMA 4ED7A 2OP5A 4Q8EA 1W2IA 1OY8A 2KZZA 2K7JA 1Y3JA 4IH6A 4DX7A 4QOTA 5F8GA 1UKUA 3GYGA 1X4FA 2EBGA 4NLDA 2AIRB 4ZK7M 3DLGB 4C8LA 1PCAA 5FLXY 1ZM9A 1DLOA 3E01B 4DR7J 2J6SA 3MM7A 2QLJB 1UA1A 4NXMF 5CZXA 2E1MC 3VTIA 4RWXA 1PBAA 4Y34A 3D0IE 2F3JA 3CD5A 4ZCIA 4GVBB 1FRHA 2IJFA 2R7UA 3MPYA 3U7JA 2HHVA 3CJ5A 1NZ8A 4UUXA 3ZZYA 4DQQA 1VRQC 4ECQA 3D66A 1ULRA 1OQ3A 3D6TB 5HK4A 1RK8A 1MU2A 2XLJA 3SV4A 4H4KA 1S0OA 2O01C 3UR0A 4NCAA 1Y7PA 4TQRA 4OZ3A 2LXIA 1NJXA 2QV6A 5HSPA 2YNGA 4DPYA 4DV3J 1UPPA 2AF6A 2YH0A 4FBUA 4OFZA 4HI2A 2G0JA 2BV3A 2HHHJ 1JX4A 2ZWOA 3D6MB 5KAKA 3NCRA 2VOOA 4YB6A 1J5OA 1JB0C 1VISA 4W98A 1LXNA 1CJUA 4A8FA 1T9VA 1HNWJ 2EFPA 2EBEA 5LMUF 2FGCA 2AMCB 2K8GA 4DL3A 3KDOA 2AEJA 4RU2A 1WEXA 2C28A 4WYWA 2ZVSA 1LW0A 2HS3A 4ZS6A 1U1MA 2VOPA 1DBDA 3CNQP 3GPAA 1HIYA 1RT5B 5T14A 2O5DA 3D7SB 3OTBA 4DSFA 1J5OB 4J7CA 3KG0A 1CJUB 3NS6A 2D7SA 3KJVA 2DR7A 4NLQA 2RQCA 2B56A 3U02A 3JB9k 2ROGA 2XMWA 3OBIA 3BPSP 3I0SB 2JLFA 3GG1A 1LW0B 4LR9A 1WDDA 2VC0A 4MFBA 3RU0A 4N41A 3TVKA 4N47A 4WFXA 1SJ1A 2VFUA 1ELOA 3EUNA 1HNVA 3GJTB 5HAOA 2RHSB 2N3OA 3VZHA 1AB8A 1T0TV 3IN5A 4ZVPB 4WK1A 1RWOB 4HDHA 2UXCF 3L9ZA 3R5GA 3CCTA 4NA2A 2YKQA 4LFAJ 1NK5A 4Q44A 2A18A 3AOAA 1S57A 4CTAA 3TWZA 1D3WA 1NHKL 4Y3CA 4ZCMA 2H3EB 1D9DA 5CAAA 3SSSA 3CO0P 1ROFA 4MFBB 1MMLA 1NM2A 2CQ2A 2P2CB 3QNWB 1H7XA 2HNYA 2Z2YB 2ATCB 3ZTOA 1FVQA 2XY7A 2L48A 2DHAA 5FDLA 5D0EA 1HD1A 4DG1A 3R27A 4TLQA 4ECSA 4ED8A 3HK2A 5KFVA 2R8HA 3E8OA 1VC5A 1QE1B 2WB4A 3DXBA 3HSDA 2V4JB 2M4MA 2FHOB 1H7WA 3BH7B 2DISA 3NOCA 5DQGA 2JJ4D 5DO2A 2CZ4A 2Y1LB 3CCWA 2HNYB 2W24A 5ITHA 1OO0B 1RHQB 1FDNA 1OPIA 2B7BB 4ETXA 2XLKA 1SC4B 4JYAJ 1HNIA 4DI6A 1SL1A 4X4OA 5D8HB 3JXOA 4OQJA 3M8PB 2DNGA 1M5PC 3T6BA 5A2QY 4EYHB 2DY9A 4C9DA 1F9HA 2M5YA 5C2GA 4IG3A 4Q45A 3GV5B 3TP2A 3O8WA 1J27A 4DV3F 1FX4A 3MPVA 3N28A 1UETA 4BC7A 5E7OB 4MMOA 1RT1B 3BYPA 2HHHF 1K1SA 4X4NA 1H72C 3UI3A 1S97A 1HNIB 1JMTA 1V3SA 2Z58B 4DV7J 1N34J 1T05B 1HNWF 3CJ0A 3KHRA 4KV8A 3AH6A 2XCAA 2JH3A 4FDFA 4WP8A 3QMQA 3LP1A 2NYHA 2XYPB 5HROA 4FVMA 5H1SV 3MTJA 1U1QA 3IWNC 4YB7A 5HMZA 4Z37A 3J81Y 4LFCJ 5KFHA 4R0EA 3VQTA 3U1LA 5I3PA 4LBHA 1U1NA 3DHWC 4ILRA 3IR7B 3NXZA 2LVWA 2GAHC 2LECA 3MD3A 1Y0HA 5IM0A 2QFJA 4K0KF 4GKKJ 4KV8B 4RUHA 5GADU 1R0BG 1C4CA 4GC7A 1X5PA 2CQHA 5D0GA 5LMNJ 2M0GB 3K89A 1EP4B 2MKSA 5A6WA 3HD2A 3ZZOA 3FSXA 4C11B 4DPXA 1NK8A 3TAQA 1D09B 2HYIB 3OTEA 1YJVA 1FWLA 3UE2A 1HBNB 4NLXA 5T7LB 1IN0A 4YR2A 4V1Ak 1RXOB 1NRKA 1ZAWA 1VLOA 3KHGA 3OHAA 1SH2A 2KTQA 2HBQB 2H4YB 3MCOA 3KMQA 4TVAB 4LJMA 1XNRJ 2XWYA 4I0WA 5DG8A 3JYTA 2AYBA 2C2OB 2AX1A 3NWGA 2Y3YA 2DNMA 5LOQA 4A4JA 2I38A 4RW8A 3U1NA 4UOHA 5K8NA 3QWPA 1FWPA 1IQTA 2LYVA 3RAXA 3OT9A 3HHLA 3RAQA 5U47A 1ZZFA 4YS2A 1SI9A 2M88A 4TYBA 5A8RA 4DZ6A 4QPTA 2GGPB 4FKYA 2ZEJA 1DFDA 1MG7A 1X0FA 2QL7B 2KVIA 2GHWA 3DOMB 2G0IA 4WYLA 1N5TA 2Q6CA 3HJFA 5KG2A 2J9CA 1RZMA 1HPZA 3JYTB 1VQYA 1X5TA 1R0CB 4LRDA 3T1HF 1FNXH 2V9KA 3LPEA 4OYBA 5B0AA 1V5VA 4ZN1A 1N52B 3HHLB 4PRFA 4CYUA 1RT3B 4P7VA 4YFUA 2HHPA 2HK2A 2WSFC 2KFZA 1DRZA 4NWBA 2JC0A 5A8RB 2W25A 1NDCA 5HMXA 3OLBA 2ZKTA 2V8DA 1X4BA 3CDWA 4PPDA 3GR0A 3CC4S 3ZFVA 3C3LA 3GE9A 4UOFA 1FKPA 4P10A 2F5GA 1S0MA 1YITS 1NSKL 2DGVA 5DRKA 3FMWA 4DQPA 4JYAF 3EZOA 5K8PA 2DIVA 2DXFA 1KC8T 4IYQA 1NDKA 4J5OA 4X65J 2DGOA 2IYGA 4DPUA 4OIXA 2YKPA 4OL8A 3HFVA 1S9EB 3M9MB 4CYUB 3TANA 4IG0A 4QIVA 3BS9A 3UD4P 4FXWA 6FDRA 3VAKA 4U8VA 2Z0GA 2FLLA 1KVKA 3G86A 1TKZB 4BWMA 2N7CA 1X31C 3IR5B 2J8SA 3BH6B 4ZKAA 3BR9A 3PACA 4BWJA 1C0UA 3HPOA 4ECZA 1FD2A 3N79A 1KHVA 5KFSA 3FVYA 1N34F 3I56S 4QR0A 4JI0J 2IM3A 4ED3A 3TX8A 2UU9J 1WF2A 2BRLA 2XMKA 4B3SJ 5E3QA 1M5KC 2H9ZA 2ZH4A 1HD0A 3W2WB 1YTYA 1U0HA 2OPRB 3HD1A 4WU2A 1A0OB 4KKOB 5BR8F 3G71S 4LFCF 3OR2B 2DRDA 5IOLA 2D3UA 3U27A 2E1AA 5B08A 1WG5A 2MZQA 1NK6A 2GHPA 4A8OA 1VIXA 2I1RA 5K8OA 1YIJS 2CXEA 4GKKF 2IC3A 3VCDA 3KHLA 3DLJA 4HTJA 4XPCA 2V2ZA 2F4VF 4RW6B 4ZPBA 1SC1B 4P71A 1V3RA 3LOUA 4JV1A 1N6QA 1HARA 1RJJA 4XDCA 3RB6A 3LO3A 4DR3J 1K1QA 3CCQS 2A10A 5F8LA 2Q6BA 1XNQJ 3ONQA 4I2QB 1L3SA 1U02A 1BGXT 2BJ1A 2YNIA 5HVFA 1N88A 2IA6A 3KLGB 4G6VB 1XNRF 5ETKA 2RD5C 1S72S 2IC3B 2DY1A 3PJWA 2MKKA 1V9OA 3W5XA 2RUGA 4DCOB 1RT7B 3Q23A 2KM8C 2MKCA 4DR2J 2EFGA 1KEKA 1NJIT 1IM6A 3PIOQ 1BWVA 3P96A 2ACYA 3QZ8A 1N6QB 1G2EA 5EWGA 1RTHA 2WK4A 3FFIB 5K20B 5A8WA 1Y5IB 3DGVA 2EFOA 3N5FA 3CCLS 3CF5Q 3MPWA 2MGZA 2BJEA 5HVGA 1H6KX 5HMYA 2YNIB 3DRXA 1T9UA 2ZZNA 3IRXB 2OO4A 2JEIA 3IWLA 1Q81T 2K3IA 2W4PA 1M5SA 2WVFA 3UCUP 2ZH5A 4I4BA 5KFQA 3SBMA 2WVDA 2HQGA 1X4CA 2VG6A 3H8YA 1KVJA 4EI2A 1NK9A 3LAMA 3NBPB 2IPOB 5EX0A 3CCUS 2ZJRQ 1RTHB 2ZBPA 2L9NA 4YR0A 5A8WB 1U7LA 1SUQA 3MM5A 2PEHA 2XCPA 3QIPA 5B09A 5DM7Q 4NMLA 4L72B 2L9DA 1SIZA 1JNRB 1RYRA 2DR6A 2OFHX 3MMJA 3MZIA 2L08A 1T11A 5DM6Q 2FHMA 2KHCA 3OXFA 1S7IA 1KVIA 4HACA 1PKUA 2NZCA 3CJRA 4ES1A 4X65F 4TXSA 2LP4A 1OSCA 4QIWD 4UOGA 3B8HA 3KLEA 4W90B 2CJKA 1NJYA 2GJIA 2YWEA 5KFNA 3MM5B 3CD0A 3L7UA 5HATA 2IM0A 1U45A 3EGNA 2MKIA 1UFLA 1JXLA 2HWTA 4OZ2A 3LANA 4C8YA 2E5GA 4TKTA 3L95X 1KS2A 3A8EA 3CC2S 4FYWB 2YKAA 1VHFA 1WC6A 2HQCA 2WBRA 4QBUA 3HFZB 2UU9F 1XQIA 4KFBA 4DFPA 3UCGA 1CVJA 3QO9A 4P2MA 3KK1B 3R5AA 2DGTA 2UXDJ 5DLGA 3LAKA 4B3SF 5IC4B 3TVZA 3EVOA 4GMKA 4CO0A 3GJSB 4K50A 2YKOA 3BM7A 3CMAS 3EGVA 2B7CB 1FXRA 3EGWB 2HNDB 2VBZA 1OS5A 1HL6A 1TAUA 2FTRA 5B0DA 1MLAA 4D3GA 1EJ7L 5CYMA 2RQKA 3UNGC 2QT7A 2QG9B 2XZWA 2MLZA 3CD6S 2GMLA 3VGSA 1X0PA 1QJHA 4DL7A 3KG1A 1TMJA 3HSGA 5E5NA 4KB7A 1T8EA 3QO9B 4DXLA 1MMNA 3HSJA 1PGZA 1OY6A 1RB0A 4FKXA 3O3LA 1TQLA 4NLYA 4UTGA 4ZLJA 1YVFA 4DR3F 1JLGB 1VQ8S 1U1PA 2FC8A 3G82A 1HA1A 4TNOA 2JRSA 1T9YA 4NEYA 4PG8A 2ZHOA 1HHTP 2EFQA 4ZVSB 5EWFA 1FTRA 3ETOA 1RBOB 4KYZA 5FLXU 1T7PA 3QJPA 2QN6B 5L39A 1R8CA 4DX6A 4FBTA 1MWYA 3BF4A 5FIIA 2BQUA 1PYSB 4MIBA 3JSRA 1NXIA 5GAHU 3TUJC 2C2KB 4E0DA 4NMXA 3DXSX 3GIJA 1F3FA 2CNLB 1U49A 2XI2A 3R7NB 1LK5A 2MZ1A 2CQCA 4FXVA 4C0BA 4USHA 2RILA 2HS0A 2OGUA 2KJVA 4ZVFA 1UFWA 4FYDA 2R2UA 2DXEA 1FEEA 1GT8A 1T9TA 1NKEA 2MHEA 2OTJS 4BS2A 1U1OA 4RBUA 2R2RA 4OYAA 3H2LA 2BZ2A 1R8PA 3AJDA 1Y5NB 1ZA2B 3ZNUA 4C0OC 3GSDA 4CP5A 7FD1A 1Y9OA 2KI2A 1S59A 2GIRA 3HM9A 4MIAA 1XEZA 2CQ3A 1S9FA 2R7TA 2CKWA 1XJWB 4IRKA 3OVSA 1PO6A 3IXQA 3A13A 3NWRA 4Y2IA 4DSIA 5F41A 4USTA 1FRIA 2ZBQA 5H9EK 2LA4A 2QRRA 3TJ9A 3MUTP 3CE8A 4RKUC 4ZP8A 3AXMA 3DRRA 4K5RA 3NMRA 2FJVA 4NI2B 5KG3A 3DLKB 3QQCD 2AYMA 4ZJOA 3W9JA 2QA4S 2ZHBA 1R6VA 3G6ES 3G87A 4H4OB 4IOAQ 4I56A 1QY7A 4QQBA 3ILLA 5K14B 4OLPA 5E3RA 1JLCA 4DF4A 1LWCA 1EIYB 2B4OA 5KFLA 1YG0A 4PXDA 3DRRB 3W3SA 2PT0A 1WF0A 1S6PA 3IWXA 2OLWA 3FBEA 4I7FA 1UEKA 1OPZA 2F1FA 2IY5B 2XY6A 1IBLJ 2PN6A 3TAPA 3KUGA 1U26A 1E6VB 5IWAJ 2E9TA 3BKFA 2DNNA 3PZPA 2UXDF 1FX2A 1XWLA 1KQSR 1UMJA 2WW4A 4X2BA 2F4FA 3QFHA 1CPZA 1AROP 3AA8A 1LWCB 2V9WA 3FCHA 4FPIA 1Y5LB 4RNNA 2ADCA 3BQ0A 5L38A 4IR1A 2DH8A 1B0PA 2ZD1A 3PYEA 1FF2A 1IJFB 3AD7C 4TN2A 4A48A 3GQCA 4LSLA 4FF2A 3MR5A 3DRPA 4RBVA 3CJKA 4ZLNA 4NCBA 3QPIA 2V2QA 3C8YA 3WC2A 1Z2LA 2MB0B 4OYZA 2DPJA 3IP0A 3M8QA 2UVVA 1QM9A 4WFNQ 3V6DA 5HI7A 1X7VA 4I1TA 2K1RA 5J2NB 3A3NB 2F65A 4W92B 2UVWA 1TVRA 2B9WA 1UJ6A 4MKBA 4G65A 4Y0FA 1NHUA 2HHTA 1RWNB 1WJ9A 2K7KA 1U2RA 4A8MP 4P74A 3NNCA 4G1PA 4ECWA 4H4KC 1RKIA 4C8OA 1R8BA 4LSLB 1OWXA 2W8KA 9RUBA 2XSJB 2G2OA 2LU1A 2HBZB 3T5JA 3PHEA 3SCIE 3MM6B 2ZE2A 3J7A1 3CCZA 2OEJA 3V6DB 2MKHA 4RW4A 4M5IA 3THPA 3RRHA 1EETA 2D3O1 1TVRB 2F8MA 2YX7A 4CM2A 4LRBA 4J9LA 1W26A 2VDHA 2CYYA 1S1VA 5GAGI 3MR3A 2J6TA 1SCJB 1C1BA 3BBBA 2HWIA 5A2QU 3MEDB 2HQIA 2V8GA 4DZDA 1Q7YT 2P9EA 1BE4A 1NB2A 1HBUA 2DEJA 2XYHB 5F3ZA 3EX7B 1ZTTA 4HT5A 4DV6F 3GSIA 3MWBA 3WX8A 1CJTB 2HLTA 2ZE2B 3MCMA 2IHR1 4LF1A 3QAUA 4OHZA 1FXLA 1UZDA 4ANCA 4U67Q 4DMZA 3POTA 4RW4B 2CZVC 1T03A 2J9DE 1KR4A 1IKYA 3HXMA 2C3UA 2XC9A 3PIPQ 3GFHA 3FMBA 4ECTA 3KJNB 1M1HA 4MYUA 2B0GA 2FVSA 4KGZB 3UDEA 4IFVA 4ID8A 3NP5A 4AD6A 4DJBA 5E3CA 4FS1A 2HQFA 3GCXP 3M6XA 1N0VC 4RW9A 2WSEC 2AEFA 2HNZA 4C3LA 5E33A 1F60B 2VFVA 3HSZA 3VAIA 3QAEA 4ZVRB 1H3DA 3PY8A 2BDPA 4ED1A 4FXDA 1DQAA 2YH1A 2H4WB 3J81U 3GG0A 1T03B 3BDEA 1IKYB 6AT1B 1R43A 1JLEA 2XMJA 3MHYA 1F1BB 1HI0P 3GCWP 3H25A 3ITHA 1FNMA 1LWFA 1FNOA 4DX8H 2B4UA 4M5DB 3GFZA 2E7WA 1JKHB 4ZVEA 3R5DA 4F67A 1F3VA 5J1EB 4A8KA 3PXGa 4LVOP 3EJMA 4RW9B 1DURA 1AZSA 1H73A 5LSLA 4UY85 2J0SD 2ZZTA 3OUYB 3NGSA 1CC7A 3TEGA 3W8PA 4OI3A 4ZJQA 2E9RX 2XNRA 5I4MA 1IBLF 3KHHA 2Z2LA 1ICEB 3BGRA 5IQ6A 5IWAF 2OTLS 2H65B 2B3TB 2ZNYA 2VC1A 4HLBA 5LSOA 3CO9A 2OHDA 1LWFB 5LM7E 2J8AA 1XERA 3NGUA 2KL8A 3R2CJ 3ET6A 2EWHA 1OMSA 2OSRA 4U7UK 1DZ5A 3UFCX 4ID5A 1AZSB 3IG1B 4DR6J 3TAMA 1B0TA 2QLWA 3EPIA 3CULA 1S9GA 5JVGQ 4K8RA 3SFUA 3MGJA 2MPUA 2RMLA 3BGRB 4PYAA 4Y00A 2D69A 3LPYA 3IBFB 1RACB 4DS4A 3OTDA 1WHWA 3H5YA 4ZPCA 4USUA 5A8KA 4WXWA 4F2RA 4DDFA 1C0TA 3NOGA 4YHHJ 1AT1B 3OL8A 2OEMA 4ELTA 4IDKA 1VQ7S 4OI4A 5AXMA 1FFSB 2GVZA 1QUVA 2HVZA 3MOJB 1IKVB 4F2SA 5KFCA 2WHOA 3BBFA 2OPSB 5KFYA 2C2EA 3HZGA 3TUZC 1ZM3A 1S9GB 2P6SA 4WXOA 5J2MB 5KFTA 3WIUA 2YWHA 2B43A 4JV5J 1AUSL 4N7TA 4O44A 3K58A 3BN7A 5GVQA 4JBCA 3C14A 4AL5A 1X60A 2BJ3A 2OPPB 2VG5A 2LEAA 2DPIA 2JVOA 2HAFA 5KT7A 4IDKB 4B3MJ 2GVZB 2G9OA 4M94A 3VAGA 4C98A 3T9NA 2HMIA 2VKRA 2A6OA 3FBBA 1F5BA 4IO9Q 2OSQA 2R7VA 4MK8A 2FJAB 4ZVHA 2PO4A 4DR5J 4QYZJ 2AGPA 1CBKA 1Y10A 2L41A 3OVBA 1KN6A 1K47A 2RRBA 2DGXA 4ECUA 4GVLA 2VQEJ 1IR1A 3EZUA 3C14B 3QGPA 1HYSA 1B7YB 1BQMA 4O0IA 1TKDA 5C2CA 1YQHA 3T5LA 5C42B 3IR6B 3ZZZA 1HHQA 1SV5B 4F4ZA 3G6YA 4R8UB 4HH1A 2KT5A 4FVCA 4Y2CA 5DJBA 3TQ1A 4LQ3A 2VBYA 1N5VA 5J2QA 3R5JB 4ZPDA 3H42A 5CABA 2R2TA 5G0RB 1GTEA 3OR1A 2VG7A 2OH2A 2DHSA 4LF4J 3SEOA 3PX4A 2V8PA 1HYSB 2IVFB 3QJJA 2FUG9 4QW8A 2LCWA 1Q86T 1UVJA 3G8SA 4RL1A 3KXDA 5L9NA 2A6MA 1FKOA 3MF5A 2AJFE 3EM1A 2W7PA 1V5IB 1ZBTA 4KHPJ 2YQ3A 4C0HA 4YB1P 3K8WA 2WZ1A 4MKVA 2ZC4A 4FYXB 5ETOA 4JV2A 2NXCA 3T5HA 1XC9A 1K8AT 4NASA 5IC6B 2C2MB 4JUZA 4ZDNA 3E51A 4OX8A 2WW8A 5KFGA 3HHLC 3IRWP 3HFKA 3BSOA 2QA2A 3MAHA 4WFYA 3LTOA 2HFUA 2C2NA 2NXJA 2NZ4A 1XN9A 3H90A 2OMOA 1OY9A 2JFKA 2BE2B 4DL2A 1FKOB 1WACA 1XMQJ 5A0YA 3UR3C 5CCMA 3OVAA 3CWJA 2HHUA 2Q3PA 2QEXS 1FD8A 4F26A 4I6AA 2VBXA 3SV3A 2ZOMA 4ICLA 4GO5X 2YKNB 5KG1A 1RLDA 1KQFB 4KQZA 4DR6F 1RT2A 2QLXA 4DPTA 5HJXA 2XZTB 1SH3A 2G2YA 2ZWPA 2HVEA 3JS9A 2GVDB 2LQBA 1HNXJ 4BDPA 2CPYA 1TKXB 1XK8A 1HW9A 3IAS9 2VASA 1S6QB 5A0YB 1Q4RA 3K57A 2HFVA 2LA6A 1FI4A 4ZIWA 2VPWB 1HNZJ 4OHVA 2ZH8A 2GV1A 2AYEA 4YHHF 2ROEA 2AZ1A 2LQ8A 4EO8A 4DU7A 4I68A 2I6WA 1RT2B 1AW0A 1GNKA 1RWXB 2XLIA 1LNQA 4M5JA 4EGLA 3DDNA 2DNLA 4RUBA 2WAQD 5DDPC 2FVRA 5AJ3F 1GMVA 2V6AA 3IS9B 4KY3A 5I42A 1RU2A 1MN7A 4N56A 5HBMA 1P1TA 1TZ0A 1KDNA 2YBVA 4C7QA 4NOHA 3C16A 3PNIA 3M9NB 4B3MF 3T1AA 1QSSA 4WE1A 2MKJA 4PG4A 2AHOB 3EGZA 4PWDA 3BV8A 4V19J 5J2PA 1O51A 2IVMA 2JDJA 2H48B 4CO1A 1B7FA 3PKMA 4J9SA 3Q8RB 4LF7J 3B6BA 4A8QA 2DK2A 3RJMB 1VK8A 1ZA1B 3TX0A 4QW9A 4KBIA 5I42B 3D3CJ 2H54B 2VQEF 4LF9J 1KNZA 3MEGA 3B78A 4ZN3A 1ITPA 1GXTA 1CG2A 2XI3A 2E5HA 3H2VE 4HTIA 5I3QA
chains in the Genus database with same CATH topology
1VC0A 5HO4A 2KVIA 3KLFB 2GHWA 3OSPA 1GXLA 4B9LA 2E5IA 5EUHA 2R7XA 1ZPVA 1N56A 4OJ3A 2YX4A 4WYLA 1N5TA 2Q6CA 3HJFA 2AJQA 2ZKUA 5KG2A 1JLQA 2J9CA 3KOAA 4PWDB 2DGWA 3OPKA 2CQGA 1HBMB 1HPZA 3JYTB 1VQYA 4M1KA 1X5TA 1IKWA 3OXGA 4CI0B 4U9RA 2HW3A 2BACA 2WBMA 3G8TA 3KTQA 1NK0A 2RJZA 1JIHA 3M6VA 5GAEI 3T1HF 1FNXH 3CJ2A 1RQ0A 1RTDB 1Q53A 2V9KA 4ED5A 5B0AA 2XNQA 1MMDA 5DG7A 1Q82T 1F9FA 1RT5A 4BCAA 2MZSA 1Q16B 1TK8A 4OZ0A 1WF1A 5CYMB 1N52B 2D9OA 4NLUA 3P6YC 2DO0A 1L3TA 4LF4F 1IQZA 3HHLB 2MQQA 4PRFA 1FRMA 1RT3B 2CJ9A 4NLRA 4P7VA 4TLRA 1VFJA 2HHPA 3AQOA 4YFUA 2WSFC 2KFZA 4KO0A 3V5RA 1S1XB 1K0VA 3CJ3A 5SZTA 4MH8A 2DITA 2JC0A 4NWBA 3SXLA 5A8RB 4ZP7A 1DRZA 4NYPA 2IRYA 2W25A 4K59A 5IQQA 5HMXA 3OLBA 1IKVA 2JOQA 2A3JA 2ZKTA 4CO4A 2OPSA 2V8DA 5H9EJ 4RNMA 1MW7A 1VMBA 1VRTB 2D74B 4CO3A 3T3FA 2PA3A 4RBTA 1X4BA 2RH3A 3J80Y 4U7CA 3CDWA 4PPDA 3WC0A 4KHPF 2SXLA 1VBZA 3FEYB 1JLAB 4WFZA 4NX9A 5IT4A 3OW2R 2PMHA 3GR0A 5J2MA 2J7UA 3CC4S 3WZ0A 1JLQB 4NLWA 1FJ7A 3ZFVA 1S10A 2WOMB 3C3LA 3GE9A 4DOZA 4EZ6A 5GAEU 4NYZA 1FKPA 1G3OA 1UJ4A 4K4VA 5KFAA 1IKWB 2HZCA 3I0SA 1YITS 1S0MA 2DGVA 1RDRA 5DRKA 3FMWA 1D8YA 4DQPA 4PQAA 4JYAF 3FNNA 1WTBA 3HDSA 1X4DA 3HZEA 2CJQA 4FNIA 4LT6A 5K8PA 5HLFA 3OTCA 2DIVA 1X8DA 1KC8T 2RU3A 4IYQA 1DJ0A 1VLYA 2XY5A 5G4DA 2OPPA 1P27B 4YQWA 4J5OA 4ECXA 3LWMA 4HEA9 2DJWA 4OHWA 5CXTA 2DGOA 2IYGA 2MQMA 3MECB 5M2UA 3I5AA 4OIXA 2B9XA 3LGNA 2YKPA 1U1LA 4OL8A 5BYSA 1S9EB 3M9MB 2AQ4A 1WEYA 2VUGA 3TANA 1FTCA 4IG0A 4KO0B 4QIVA 4DLEA 3PX6A 3BS9A 4R0JA 1TFYA 1HQUB 3UD4P 3D5MA 1Q1KA 2KKHA 1Q8LA 3H59A 1IR0A 3LW5C 4FXWA 4QIGA 6FDRA 3VAKA 2WSCC 2J76E 2FVPA 2Z0GA 2FLLA 2VBWA 4O3SA 2KN4A 1APSA 3G86A 2CPXA 5KFMA 1TKZB 2WRMA 2Y1RI 4BWMA 2ZBIA 3CVKA 4DN9A 2N7CA 2ASJA 2DNHA 2UUBF 4F4KA 5FJ4A 2DNQA 3IR5B 2BANA 1E6YB 4X4UA 1VQNS 1RTIA 5DDRC 2HRYA 5D4OA 3KFWX 5LSRA 1VS3A 1NJZA 2EVZA 4ZKAA 3BR9A 3PACA 3PW2A 1S76D 4BWJA 3PFEA 3GFYA 1C0UA 3HPOA 1HFEL 3BZQA 3SDEB 5KT3A 4J9QA 4ECZA 3MXHP 2LEBA 4OZJA 1FD2A 1WHVA 1SJ3P 3N79A 1KHVA 3NCPA 2YNFB 2MJNA 1HQEA 4KT0C 2QA4G 3VAJA 2G13A 5KFSA 1UVMA 4JI4F 3FVYA 5CCLA 2YWKA 3M6WA 5HLFB 2MXYA 4XPEA 4C3KA 1V6HA 1LFPA 2FIUA 1N34F 3I56S 5MAOA 4YY3F 4QR0A 1M1KT 4FZVA 3M2RB 2V0NA 2YWFA 1KD1T 1ZPWX 2IM3A 3DHXA 4FN5A 4ED3A 2MQNA 3T19A 3TX8A 4NRTA 4QR1A 1YRXA 2DNZA 1HWKA 2AGQA 1P8GA 3I31A 4QIFA 5A6PA 2J0XA 1OQ6A 1YJUA 5C42A 2V94A 3V6KA 3UQSA 1WF2A 2VZ9A 3MUMP 1N32F 1HNXF 1N54B 1NU4A 1DQ8A 3VQSA 2VFTA 4NZ0A 3AB4B 5IT0A 2BRLA 4HH0A 2XMKA 1SV5A 3DM2A 5E3QA 1S1UA 1N0UA 1V3ZA 1X5OA 3THTA 1M5KC 3CEDA 3QLHB 2H9ZA 4R8UA 2HPUA 2K2PA 5KFFA 2OFGX 3JAMY 4N77A 5D4PA 4F3OA 2ZH4A 2LXFA 1HD0A 1D8ZA 1DTTA 1S49A 1U25A 3W2WB 3I9V9 3I82A 3H4BA 1YTYA 4HKQA 1PC5A 3QGIA 2QA1A 1NJWA 2OPRB 5L1JA 1RTIB 2HG4A 2V5HG 4WU2A 5LJ3Y 3NNAA 4WJBA 3LGMA 3MCSA 4KKOB 4DL0C 5BR8F 3G71S 4ELVA 3CUNA 4C97A 4LFCF 3OR2B 3CTRA 5CYQA 2D3UA 1FVSA 1QE1A 3U27A 2E1AA 2JL9A 3HHNB 2AW0A 5G0RA 3ZC4A 5B08A 2MY8A 2FGOA 4NA3A 4B3TF 1HQEB 2GJ2A 1WG5A 2I8EA 2MZQA 3ENVA 2GHPA 3LH2S 3N6MA 4A8OA 1NK6A 4WF9Q 2V4JA 1VIXA 3DN9A 5KG4A 3VAMA 5K5MA 5LJ5Y 1KLMA 3LUYA 3T6JA 2R7WA 2I1RA 5K8OA 3SYZA 1RGVA 1RT4B 4UOCA 2R8IA 1YIJS 4OX6A 1L3VA 4GKKF 1S99A 2GNKA 2IC3A 2OD4A 3MMCB 1YJNS 2DRAA 3VCDA 5LXYA 2N3LA 4Q2LA 1U4BA 2N82B 1SKWA 3TUIC 1HHSA 3DLJA 3KHLA 4FNHA 4HTJA 5F8IA 3G6VA 4XPCA 2BW2A 5C24A 5D77A 2VONA 4JI7F 3WBZA 4M8LA 1Z4UA 1SJQA 2F4VF 2PFFB 5CH7B 4RW6B 4ZPBA 5C5JA 1IJEB 3DM2B 3OLAA 3M4XA 1S1UB 3NGDA 2GIQA 1V3RA 3LOUA 2GO8A 4IOBA 4JV1A 4O3NA 1KONA 1VOMA 2LXUA 5HP1A 1N6QA 1HARA 1RJJA 1DTTB 1YSJA 4XDCA 3RB6A 3BGFA 3DOKB 2HFOA 4CIOA 2Q66A 3LO3A 2AX0A 2RQMA 4WFAQ 3BJYA 2R7SA 4B3OB 1Z2ZA 4RX6A 3MR6A 1JWWA 1K1QA 2MMYA 3AAWB 2UVUA 5KFDA 2CQPA 3CCQS 2BVZA 2A10A 3M2VA 1JLFB 5F8LA 1BY9A 3D1OA 3RW7A 4OJ1A 2Q6BA 4NPOA 2PI4A 1H2UX 5CYQB 3M8PA 3ONQA 4NA1A 4I2QB 4D3HA 2XSFA 1L3SA 2M52A 4JOUA 4OI2A 4I2PA 1BGXT 3I9ZA 4R5PB 3ICLA 3RRGA 5ADZA 1ZAVA 2YNIA 4F4YA 4QWEA 1HI8A 1N88A 1VQLS 2IA6A 4KR0B 3KLGB 3CDUA 4F50A 4G6VB 4YUDA 4EFAC 1PC4A 1XNRF 3KWMA 1WTFA 3L09A 4MYTA 4DR7F 4JI8F 3CDEA 4RUAA 3E2EA 2RD5C 3V81B 2IC3B 5K8MA 1S72S 3PJWA 1JLCB 2AGOA 4ALZA 2BE2A 1VQKS 3O44A 2MKKA 1V9OA 3OJUA 2RUGA 2AD9A 1RT7B 1FCAA 3SSRA 4F4WA 3Q23A 4OJHA 2KM8C 1U48A 2CPFA 4ZA1A 5C24B 3J7YI 2MKCA 3C2PA 2JHEA 1M5OC 2EFGA 1KEKA 3T5KA 4QJVA 1NJIT 4LF7F 3IAM9 1RT1A 4RWWA 3FQKA 2Y1JA 3PIOQ 1J5EF 3P96A 2ACYA 2BRKA 3QZ8A 3FEXB 4AFFA 5HP1B 1N6QB 1WHXA 4O4RA 2VA3A 5B0EA 4QWDA 3PRBA 1UVNA 5EWGA 1G2EA 1RTHA 2YKNA 4LF9F 2J7WA 2G1DA 1S6PB 2WK4A 3B4DA 3FFIB 4RW7A 5A8WA 1Y5IB 2W9CB 2EFOA 3N5FA 3S8SA 4X4QA 1VQMS 2HHWA 2E1CA 3CCLS 3N6NA 4I7FB 1KOHA 1Q7LB 4KE5A 4USIA 3CF5Q 1T05A 1UW4A 2ZFHA 4N8OA 4CNYA 1LV5A 4PQUB 2NYIA 2ZH7A 1UAWA 1VK3A 3MPWA 4X66F 1IBKF 4I64A 1X9SA 4H54A 4EBEA 1G1XA 3SSQA 4B17A 2MGZA 1FDDA