2CQDA

Solution structure of the rna recognition motif in rna-binding region containing protein 1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
116
Chain Sequence
b'GSSGSSGMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding region containing protein 1
publication title Solution Structure of the RNA recognition motif in RNA-binding region containing protein 1
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 14
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqdA01
3VAHA 4RU2A 3VAFA 1U1NA 2DK2A 3US5A 1OO0B 4CH1A 2KHCA 1VQOS 2M88A 4Z2XA 3TP2A 1U1QA 2A3JA 2M52A 1OIAA 2X1FA 2B0GA 2DNOA 2HGNA 2LA6A 1YJWS 2YKAA 3OW2R 4ERDA 2HVZA 5JVHQ 1VQPS 4C7QA 2MZ1A 4Y00A 1VBZA 2CQ3A 3BO2A 2MKKA 1ZZNA 1KD1T 2XS5A 3CCLS 4EGLA 5D77A 1WF0A 1VQ8S 3CCVS 2E44A 2QA4S 1X4HA 1UFWA 5GAHU 1Q86T 1IQTA 1L3KA 3G71S 2E5IA 1VC0A 2DIVA 2AYBA 4IO9Q 2DO4A 2DISA 1N54B 3HI9A 4ED5A 2OTJS 2XNRA 2DNHA 3TO8A 1YHQS 2CPEA 2DNNA 2KXHA 4IOAQ 5DETA 2KM8B 2DHGA 2XB2D 3VAIA 1VQ9S 3PIOQ 1DZ5A 2MJNA 3P6YC 1NJIT 1A7GE 4QPTA 2KN4A 1HA1A 1SJQA 1FO1A 2DO0A 1KOHA 1WI8A 1QM9A 3N9UC 4TU8A 2DGSA 3EGNA 4A8XA 4TU9A 2U1AA 1ZH5A 2JX2A 4WIIA 3G6ES 4PKDB 4PR6A 3J7YU 4WKRA 5LSLA 4QQBA 2M8HA 4TLQA 1SJ4P 1CVJA 1D9AA 1WG1A 1RK8A 5FJ4A 3G96A 1N8RT 2N3LA 4W90B 3RW6A 2MQOA 2OTLS 4QU6A 2MQMA 4YOEA 4V19X 2CQIA 2LKZA 1H6KX 2J76E 1YJ9S 3CPWR 2AYGA 2RRAA 3U1MA 2YTCA 1KOOA 5DDPC 1WHVA 3UCGA 2CQCA 3CXCR 4Y0FA 2MQQA 3UD3P 1VQKS 4P6QA 2EK1A 4FXWA 3VF0B 2FC8A 2X1BA 2MQPA 3MUVP 1G2EA 1D8ZA 2WBRA 2CQ4A 1H2TZ 1Q7YT 3EX7B 2VOOA 5EN1A 3FEXB 1X4DA 3CC4S 3CCRS 4UQTA 1DBDA 3G8SA 3NS5A 2D9PA 1QVGR 2QEXS 2EVZA 3P3DA 2NLWA 2MZJA 2I38A 2M0GB 1SJFA 2CPHA 3ULHA 2LEBA 1X5TA 1WF2A 1VQNS 2LMIA 5ITHA 3LPYA 2RUGA 3NNCA 5HO4A 3CF5Q 2DHXA 1O0PA 2M70A 4ZKAA 3MD3A 2DNGA 1SXLA 4WF9Q 3R27A 3EGZA 2MPUA 1FJCA 1XN9A 5GADU 3H2VE 5CXTA 2BZ2A 2MZTA 1YTYA 2DNKA 2CPDA 3MUMP 2G0CA 3MUTP 4WFAQ 3CCSS 1N52B 3P5TL 2VODA 2KXNB 2FPHX 2XSFA 2MSTA 1X4BA 2M9KA 1N88A 1YIJS 3UCUP 1FT8A 4LJMA 4UY8T 2XS2A 2OJ3A 3IRWP 1VQLS 2HZCA 3BEGB 3CCUS 1VC6A 1WEZA 2DB1A 2KM8C 1FJ7A 1JJHA 5LXRA 2L41A 2DNZA 2KH9A 2BOPA 2G1DA 2MB0B 4YUDA 4LIRA 3Q2SC 1UP1A 1S79A 2DHSA 2DH8A 2E5JA 3J7ZT 1Q82T 2CPIA 1K9MT 4IUFA 2AD9A 2DIUA 3NNAA 2JVRA 2CQPA 2JVOA 2MGZB 1QVFR 3NNHA 3MDFA 2G4BA 2PEHA 3MURP 3DXBA 2ERRA 2UP1A 2XNQA 4CIOA 3CD6S 2CQBA 4OZ0A 5H1SV 3TYTA 1YWXA 1VC5A 1P27B 3VAMA 3CTRA 3HHNB 2CQGA 1YITS 2RRBA 2MZQA 2DNLA 4QU7A 2DNMA 2X1GA 2LEAA 2EK6A 2RS8A 2HGMA 3R1LA 2FY1A 2CQ0A 1X5PA 1M1KT 3CMES 2HGLA 5DDQC 3NS6A 3B4DA 2GO9A 3V4MA 3G9CA 2CQ1A 2KG1A 5DM6Q 1DRZA 1X4FA 2DGQA 5D78A 2J0SD 3FEYB 2DGXA 1YJNS 2JWNA 3SDEA 1X0FA 1FHTA 2CQ2A 2D3OR 2J8AA 5GAEU 2DH9A 1U1RA 1K8AT 3CULA 2KU7A 1WHWA 4OZ1A 2LECA 2J0QD 4LMZA 2CPFA 2LXIA 1X5OA 2FC9A 2RU3A 1OWXA 5IM0A 1FNXH 1R8HA 2L9WA 2U2FA 4F02A 3DLLQ 2RQ4A 1P1TA 2KXFA 1F9FA 3UWTA 1WTBA 1M5VC 1WHYA 3MD1A 1B7FA 1H2UX 2MKIA 2MHNA 3CCES 3CCMS 5CA5A 5LJ3Y 2CPZA 2E5HA 2MKSA 2LA4A 2NZ4A 2M7SA 1VQ5S 3BO3A 2YH1A 2DNRA 2CQHA 4F25A 1A9NB 1WEYA 2KT5A 3S8SA 1OPIA 5DM7Q 1FJEB 3NMRA 4WFNQ 3CMAS 4C4WA 1NO8A 1M5PC 1JMTA 3UE2A 2KVIA 2MY8A 2RNEA 2MJUA 2MSSA 3THTA 1U1KA 1ZZFA 2MKHA 4CQ1A 3UD4P 3VAGA 2CQDA 1BY9A 4CH0S 5IQQA 2N7CA 1WG5A 2DGVA 1JJ2R 2DGUA 2MKJA 1U6BA 4FXVA 2I2YA 2DITA 1FXLA 2V94A 2SXLA 2DH7A 4M5DB 2RT3A 2DNQA 2L08A 3IWNC 1WG4A 2M2BA 2LCWA 3SXLA 2RVJA 4IOCQ 2M8DB 3BS9A 3LQVA 1U1PA 2DGOA 2KYXA 2DGTA 1K73T 3S6EA 4WCEQ 3S01A 2CPJA 1DHMA 2N3OA 3SDEB 1H2VZ 3CUNA 1X4AA 2LXUA 2YH0A 3CCQS 2AYEA 4U67Q 2ADCA 1U6FA 3ZZYA 1NU4A 2CPYA 3RW7A 2HYIB 3CC2S 3VAKA 5GAGU 1SJRA 3D2WA 2VONA 3I55S 2F9JA 1U1LA 2DHAA 5CYJA 2ZJRQ 3CCJS 3I56S 5IM0B 2MMYA 3VAJA 1U1OA 2OIHA 2YWKA 5IFMA 5LSOA 1VQ4S 1U2FA 2F9DA 2KFYA 3B4MA 2F3JA 5GMKa 5BJRA 3U1LA 1X4GA 4BS2A 4YB1P 1W2BR 3G8TA 2K8GA 1HL6A 4WFBQ 1URNA 1SJ3P 2LQ5A 1JJ4A 2JRSA 4TU7A 3H2UB 1VQMS 1RKJA 3SMZA 3S7RA 4F26A 2MYFA 2RS2A 2Q79A 1WHXA 5LXYA 3MXHP 5GVQA 1R8PA 4C0OC 1Q81T 3CC7S 1PO6A 2E5GA 2MY7A 3R1HA 2OSQA 1UAWA 4J5OA 2D9OA 3K0JA 1HD0A 3BO4A 5DDOC 4PRFA 2RQCA 2VOPA 3MOJB 5MLCV 2XS7A 1AUDA 5HL7Q 3THPA 1WELA 1WEXA 2MXYA 1KC8T 3L3CA 2KI2A 2MZRA 2ZJPQ 5DDRC 3VALA 2M4MA 1VBXA 2O3DA 2X1AA 2LYVA 1WF1A 3P49B 1WI6A 1M90T 2KRRA 3JB9k 1HD1A 2DNPA 2PE8A 1X4CA 2MQLA 3UCZP 2DNYA 4W92B 2DGWA 2KG0A 2MKCA 2MZSA 1PGZA 1UW4A 5LJ5Y 2ADBA 1M5KC 3ZZZA 1X4EA 2MQNA 1S72S 2OSRA 2MGZA 3Q2TC 2AYMA 2CPXA 1VBYA 2FHOB 5JVGQ 1U1MA 1WWHA 2ZJQQ 2QFJA 2N82B 2GHPA 3PIPQ 3MI7X 1X5SA 1KQSR 1YI2S 2CJKA 3G4SS 1VQ6S 1M5OC 2KRBA 2K3KA 1VQ7S
chains in the Genus database with same CATH superfamily
5B09A 4Z2XA 4I2PB 4URGA 1HI0P 3H20A 5ETSA 1QE1A 2RB7A 3DYAB 4JI8F 1TAQA 4DCJB 1HNZF 2UXBF 2H5EA 1TL3B 2V8PA 5KFDA 2HPUA 4LIWA 4BHQA 2ZKUA 4C97A 2YVSA 2D1CA 3M8SA 4EBCA 3HSDA 2BJDA 2BQ3A 1QM9A 5A6PA 1RHUB 2FHKA 5B0GA 4WZQA 1NLKL 2GNKA 4DR7F 1IM6A 4ZVHA 5LSLA 4GVLA 1VLYA 1WDTA 4TLQA 5K14B 4RNMA 1N8RT 3IM8A 1IJFB 2MQMA 1EARA 1U02A 4MMOA 4N76A 1NSPA 2QX0A 1T05B 5IT0A 3VVTA 1QTNB 3ILJA 3VF0B 5IV4A 3MUVP 3KK1A 2ZH2A 3K17A 2V6AA 2DBBA 1C0TB 4J9NA 2AQ4A 1YJRA 4WIQA 1DBDA 1QVGR 1RAIB 3CD7A 2NLWA 4MT1A 3EVWA 2XZTB 1VQNS 2VG6B 3F73A 2LMIA 3HMJG 2ZOMA 3P4UB 5D8HB 3OTOJ 1HWIA 1EQ0A 2FLLA 1SXLA 2UXDJ 1B99A 1WORA 4LQ9A 4E2FB 3O5TB 4F4WA 3MUTP 3AAWB 4TN2A 1WJ9A 5EGYA 4R0JA 4ZMMA 1I51B 3UCUP 2D3ZA 3W63A 1D3WA 2ZH5A 3CDEA 2HZVA 1VC6A 3GSIA 4ZIVA 3DGPA 2JC1A 2BJEA 2QN6B 1B7YB 4P52A 4LF6F 4Q8EA 1JKHB 2ZE2A 4IFYB 2F4VJ 4FS1A 1S79A 2YNHA 3EWGA 3BSAA 1RCXB 4JI1F 3NCPA 2JVOA 4NCBA 3RAMA 4HTIA 3TYTA 5KAKA 3MMBB 5IS2A 3DDKA 2RU9A 1SCJB 1T11A 4WE1B 2W9BB 3OL8A 1K47A 3NS6A 3B4DA 4P9SA 4ZVRB 2CDQA 3DLEB 4B3RF 2W7OA 2DGXA 3DHXA 2CQ2A 3IBCB 4DQQA 2RMLA 4KT0C 3M8PB 3IAS9 5IOLA 1RT4A 3FDSA 1UVJA 3TWZA 2UXCF 4IOBA 1FRIA 3LP2A 4P71A 4DQSA 4ED7A 3HHLD 5J1EA 3DFEA 2GIQA 4X65J 4P7TA 4QIVA 3MM6A 3W62A 3WDOA 3K8WA 3E8OA 2B51A 1X31C 3DM2A 3S8SA 2AGQA 1N32F 5CYQA 5A8RA 2LDIA 4KPCA 2HWHA 2PFFB 4DPYA 2MY8A 3BQ1A 4BWMA 4JB8B 3OFFA 2RKIB 3J81j 4G1QA 4YMEA 1KEKA 1WOPA 4CH0S 5IQQA 2HBQB 4XDDA 3B6BA 3SCKE 2E7WA 4OI3A 2ZH7A 1TKZA 4FYYB 3NCRA 2F8MA 1U1PA 1GEHA 1G6BA 1HNXJ 1KSPA 1TQLA 4J9VA 2GQQA 3O1LA 1KBRA 3L7UA 4JUZA 5F8LA 4IQMA 4PWUA 4RNOA 5E5NA 3X1LB 2OIHA 4ES3A 4ZA1A 1NK6A 4Q5VA 2DR9A 4IG3A 4DUZJ 4DSIA 1HL6A 3QMQA 3PJXA 1I3OB 3JQJA 4HHJA 4PABA 3MCOA 2R7VA 2MY7A 4GRSA 4CLKA 4PXEA 1RTIB 4ZPDA 1I5OB 1VBKA 4X62F 1AUDA 4L75A 2AJ1A 2MZRA 3BDEA 5DDRC 3FNNA 2VU5A 1RGVA 3OFGA 3OV7A 2GMLA 2P9GA 3GTYX 5LJ5Y 3OLBA 1X4EA 3IAM9 3LGNA 4MKBA 1FKPA 4RU9A 2N82B 1FXRA 2H54B 3KDOA 2DRAA 2DRDA 5JJBA 4KGMA 3VAHA 1TL5A 3D3BJ 2MLYA 5J2PA 1S1VB 2C2EA 1CJVA 2QL5B 2M88A 4YS2A 2DNOA 1Y0HA 4WU2A 4B3OB 2EBGA 3IG1B 1FFGB 1P1LA 2ZBIA 5F41A 5ETRA 3ZZRA 1VC0A 4CWBA 3DLGA 2MKYA 3HVTA 3MR7A 3H0PA 2OTJS 4OJ1A 1EETB 3VGSA 3VAIA 3PIOQ 5U47A 2AMCB 1A7GE 3C19A 2KN4A 1HNIA 2V4JA 3BKTA 1B70B 3G6ES 1Z1ZA 4ED3A 1T3OA 2R7QA 2HZAA 1WG1A 4IH7A 3G96A 2KYZA 1U0HB 3PY8A 1IQZA 2LKZA 2EWHA 1YQHA 1BQNA 2B9WA 2XO6A 4USUA 2B9EA 2NQPA 1X8DA 3C16A 1D8ZA 1BE4A 2HK2A 1HMVB 1Q7YT 3HVAA 2QJ3A 1Y11A 4IH6A 5AT1B 3G8SA 2A6OA 2B7CB 2MZJA 4DL4A 5CZVA 1Y3KA 4QBUA 2LEBA 1WF2A 3HP6A 4GC7A 3AD9C 3HM9A 2W4PA 1TVRB 3GJSB 3NY0A 3MD3A 2ZC3A 2HNYB 3BR9A 1FE0A 4I6WA 4WFAQ 3RG6A 2Y0BB 1RT2B 2CVIA 4FKXA 1R43A 1KONA 4IDKA 3C6UA 2GV1A 2HHQA 1VRUA 3M8RA 3EZ5A 2E7XA 2CJYB 4OHWA 4Z7CA 5M2UA 5IXUA 2IVMA 4YUDA 3D7SB 1ELOA 2R7SA 3Q2SC 2DH8A 4ILMA 4QZVB 3K5LA 2JEFA 2XI3A 3D28A 2IRYA 4P74A 4DBQA 3MURP 1B0VA 2XC9A 3OR1A 3U7JA 1V5IB 4PYAA 3AA8A 3RZAA 2YNGB 4WFXA 2CQ0A 3LF0A 3QWUA 1VOMA 5F8HA 4PUOB 1QLNA 3V4MA 1Y3JA 1JWWA 4YR3A 1RU1A 1X0FA 4LRDA 1FVQA 2DH9A 3PW5A 2C3UA 1CJUB 3HJVA 2OMLA 5KFGA 2L9WA 3LAKA 2VDIA 3MD1A 2Z56B 1GAOA 3N5FA 3O44A 3OTOF 3IFEA 2LP4A 2CQHA 3NS7B 4OI4A 2W9CB 1FJEB 2UXDF 4Y2KA 4WFNQ 1MROB 3MF5A 3MPWA 3N6MA 4I1TA 4TY8A 4JI3J 2KVIA 2P9CA 4DL5A 4C48A 2DGVA 1M1GA 1AT1B 1FXLA 2V94A 4FS2A 4LSNB 2HHPA 1REGX 4DWIA 1OJ4A 2RIJA 1E6YA 3R3TA 4ES1A 4X4PA 5CABA 3IXQA 1ZETA 3DOMB 2F4VF 3DRPA 4WCEQ 3S01A 1RBOB 2CZ9A 3D68A 4Q2MA 1NU4A 1R8CA 2CRLA 1MN9A 3D2WA 3KLEB 2F9JA 3SFUA 1BQMB 1QUVA 4UW2A 3W60A 5IFMA 5LSOA 3AQPA 2EFPA 4XAKA 4M5JA 1FX4A 1K0VA 3JS9A 3TI0A 2KZMA 1RWWB 1NHVA 2XMKA 1Z4UA 4EU0A 1TELA 1Q81T 4ECWA 4JI6J 1Q0NA 2J7UA 2NXNA 4CCHA 2VG5B 3KLIB 3H90A 2KTQA 1OMSA 1HWKA 3T9NA 5L9NA 2ZBCA 2KI2A 1VBXA 3GYNA 5E3QA 5AE2A 4O4GB 2DNYA 1R89A 1PGZA 3WX4A 3EICA 3NAIA 4P75A 4X65F 3POTB 2ZD1B 1DQAA 2FHOB 1VFJA 4RNNA 5JVGQ 1RBAA 3PFOA 3TQEA 2V9WA 4WXOA 2LFVA 4ECUA 3G4SS 4OZ2A 2C3MA 2Y9HA 4CYUA 4I6YA 4Y2MA 1NPPA 1S1WA 1YJWS 1MWZA 1R0BG 1XNQJ 2JJ4D 2E1MC 1C0UB 2OD4A 1SIZA 3DHWC 1X0PA 1HNXF 3O6QA 1NDPA 3BGRA 5IQ6A 3ZZPA 1SKWA 4UZCA 2XGPA 5KFPA 3ILOA 2DD8S 3DRSB 1CG2A 2JH3A 4ED5A 1S57A 4ZLPA 4MIAA 5DETA 4N77A 4EBDA 2CG8A 3P6YC 3MM5B 1NJIT 2ROGA 5E33A 4QYZK 4ECYA 1JLFB 4DUZF 4O3QA 1FDAA 2DGSA 1HHSA 3RBEA 3IWXA 4C2MA 2OH2A 4ELUA 5KG7A 1YJTA 1T0TV 2BKOA 4CO2A 5ETNA 5L46A 3HT0A 5FJ4A 4LT6A 2N3LA 2VC0A 1I6JA 4DG1B 4QU6A 4YEAA 1LFWA 1JXEA 2CQIA 2AYGA 4OLOA 2CADA 2ATCB 2GS8A 4LF8J 3UCGA 3CXCR 2IC3A 2VFSA 3MMCA 1FNMA 3LOUA 2WRMA 2ROPA 2NS1B 2GJFA 4IRCA 2RDJA 1TP7A 1LQ9A 4LF1A 3OJSA 1RWKB 2I38A 4CLPA 4TNOA 2CPHA 1VRTA 2I0XA 3M2UA 4LBIA 5J1PA 4OX9J 2ZEJA 4C0BA 6AT1B 4ZITA 3PW0A 2BW2A 1IWAA 4BC7A 2M70A 3PYEA 4LF4J 4UUXA 2LQ8A 5KFCA 3CJTA 5AE1A 3N28A 4ETZA 2ZUGA 5EX0A 1J5OB 5H9EJ 1OYDA 3B82A 1Q53A 5T7LA 2PT0A 1YIJS 3ET6A 2HQGA 2K7JA 1OQ6A 1SH3A 1RLDA 3F0NA 4RW8B 3HFKA 3TVYA 2F63A 1FJ7A 4X84A 4PCQA 2YQ1A 4AL7A 2FUG9 1CJKA 4L76A 3RUBL 5KT6A 3JYTA 1T95A 1J2VA 3VV2B 4IUFA 2DIUA 1HYSB 1D9FA 1RB0A 2RUSA 2RF2B 5D0EA 2POKA 2BXJA 2IAJA 5H1SV 2QA4G 3FSIA 1SQFA 2LEAA 4X4RA 4K4WA 3CJRA 2CYYA 4O3OA 3Q8RB 2J0SD 2H1YA 3OSPA 2JWNA 3CCWA 3PX6A 1QE1B 2IRUA 4ZP8A 1WHWA 4NLTA 2LECA 4DPTA 5FLXU 4LRBA 1FNXH 4FKYA 2I1RA 2Q43A 5KFLA 3GP9A 3QBCA 2UUWA 2G0IA 1PAEX 3BN4A 3SQOP 3G82B 3C2PA 2W4CA 3BZQA 5KFIA 3OTEA 5ETTA 4W98A 1UCNA 1NO8A 1O51A 2RNEA 2PD1A 3I6PA 1MMNA 1ZZFA 4OZLA 2WW4A 1WG5A 3WHIA 5I42A 3TAMA 3MM9B 2FJXA 1YRUA 4M5DB 1CS4B 2HKEA 4IQXA 2AEFA 5DQGA 2V8GA 3M1VA 3BBBA 3RR7A 1K73T 1LXNA 1S97A 1RHKB 2CPJA 3BQ0A 1KVIA 2Q66A 1L3TA 2IMWP 4A8OA 2F40A 1S0OA 2BE2A 4F4ZA 4ZDNA 2AT1B 3ENVA 2R2SA 5KG6A 4LSLA 2WVBA 1JJ4A 3H7HB 1KLNA 3H2UB 3TANA 2MYFA 2OPSB 1R7IA 2I8EA 4OMFG 4IRDA 1YDLA 2GIRA 2CDRB 2D9OA 3CJQA 4HACA 5KT3A 3BB5A 1DAXA 3PFEA 1IKYA 2M4MA 4DX5A 1GNKA 4EWTA 2PE8A 4OZNA 1TTHB 2Y1LB 3O8WA 2KG0A 3DLHA 1UW4A 4HYKA 2ZE2B 1PILA 2ADBA 3MMAA 4CLLA 2OSRA 2O66A 3MZIA 4WP3A 2YNHB 2A2CA 1TL1B 1U1MA 2QFJA 1TAUA 4DI6A 1CBKA 1R0AA 1X5SA 3DRRB 2PDAA 3GV7B 1VR6A 4WFZA 2BQUA 1VIXA 3VAFA 1BQXA 4R0EA 5E3RA 4KHPJ 3J7YI 1HHQA 4XIUA 3OL7A 1GTEA 3T9ZA 2FTRA 3V6DA 1FFSB 2VH7A 5A2QY 3CCVS 1YRTA 5I3QA 2Z57B 4IO9Q 1RT4B 5F0UA 4N41A 4K4YA 2KM8B 5J1EB 1IXKA 3MEGB 3BGLA 3HDSA 2UUBJ 1N6QA 1S59A 1MSWD 4K50A 1NKEA 3CDBA 4OYPA 5A8RB 1B4SA 1RK8A 4JI6F 4JV0A 4QOTA 1KVJA 4DCOB 3JQKA 4RL1A 2IM2A 4B3SJ 3GONA 1XK8A 5HQMA 5F8MA 4LR9A 1TKZB 3UD5A 2H5IB 5D6GA 3OTDA 2X1BA 2ZWOA 1EQMA 3A3NB 2ASYA 2JLGA 1T03A 2VC1A 4YDXA 3KFWX 3NS5A 1IKVA 4DSKA 4G1PA 4U7UD 4RW7A 1LK5A 5KG0A 4K59A 3JXOA 4IG3B 3H2VE 1YTYA 3ITHB 3PR4A 3TR5A 2CWXA 2R8IA 4KPYA 4YB7A 2FPHX 3FBBA 3QT8A 1XNQF 3DRYA 3HCXA 1YZ6A 1SL2A 3HZEA 1UVNA 4KKOB 5HQ8A 4KB7A 1JJHA 3I87A 1NPKA 1UEVA 3KLFB 4DFKA 1RAFB 1KS2A 2MDAA 3UNYA 5KFUA 1FEHA 4F0KA 3M2VA 4DV7J 3GILA 5ETVA 3NNHA 2PEHA 3TVKA 2BV3A 4TLRA 4QR2A 3CD6S 3QGPA 1EKSA 3A8IA 2YBVA 3AHPA 3CTRA 3CDUA 4ID8A 2RRBA 3GFZA 3G86A 2BMBA 4NWBA 5HMXA 2HGLA 1PAUB 1B0PA 3CD5A 5J2PB 2HS4A 4DSFA 2CQ1A 4LF8F 1RDRA 3ELHA 1S6UA 1EJ7L 4KGZB 2HRYA 2Z8QA 3OPKA 3SDEA 3M6WA 5KFZA 1U1RA 1K8AT 1WDDA 2ABYA 2V68A 2J0QD 1YJVA 3KXDA 4B9SA 5AXNA 4MK7A 1OPZA 3DLGB 2G13A 1WHYA 1V9OA 4OX9F 3GWCA 3M9MB 4LF4F 2XYHB 3RBDA 2F5GA 2W4DA 1HNIB 1CULB 1HQ2A 4OYBA 1M5PC 2V4JB 1QUPA 4HH1A 3FJ2A 1WC6A 4JI4J 4X4OA 4B08A 2R3VA 5AE3A 5CAAA 2MKJA 1QSSA 3ZO7A 2W01A 3OXGA 2OEJA 1NSQA 3NGUA 1XMOJ 1TKTB 4NLXA 4PG7A 2J8SA 1BUXA 1LFPA 3FCHA 2EC0A 1TKDA 2KYXA 3OD2A 4ZJOA 5D3GA 1OSCA 3C16B 4J9MA 1H2VZ 3GB0A 2YH0A 4CO3A 1GTHA 3I0SB 3D0IE 5CYJA 3CCJS 4Y2CA 4B3TJ 4IKAA 4ECXA 4ECZA 5GMKa 2MLXA 4KHRA 1KLMA 2KB2A 4PQUB 2AJQA 3OJUA 1R3NA 2WSEC 2X7IA 1NK7A 3UI3A 4OQJA 2AGOA 2VQFJ 3S7RA 2RS2A 1NKCA 2JOQA 4C0OC 3VTIA 2E5GA 2KDOA 2YNIA 4LFBJ 3MCMA 2XMJA 3ZC4A 4EO6A 1WELA 1HW8A 4IDKB 1HPZA 3C6UB 3JSRA 4O23A 2O3DA 4D3HA 4R8UA 1SV5A 1RBLA 5KFXA 2RH3A 1RT7A 4MIBA 1S0VA 1TUVA 4CDIA 2CPXA 3EDQB 3V5RA 5LMUJ 4KRWA 5ADZA 2EFNA 4C8YA 1Q79A 4C0HA 2WCXA 2HS3A 2AZ1A 2X3GA 4AD6A 1WUUA 1I1GA 2OELA 3R8YA 1TL7A 5AXMA 3QIPA 3D1OA 2KHDA 2Y1JA 1OIAA 2J6SA 2YKAA 1FTCA 2XM3A 1NEEA 3FUYA 2NYIA 4ECSA 2YPYA 3OXLA 4PPDA 1Q86T 2FHJA 2R42A 1LW2A 2PMWA 2YNFB 2HWTA 2DHHA 2VPWB 1LXJA 3M05A 3U27A 1FRLA 3VR1A 2APOA 1RTJA 3MAAA 3PJ9A 1NHKL 2CJQA 5DQIA 3PKYA 3KHHA 3LGHA 4QQBA 4Q45A 2OI2A 2M8HA 1SKSA 1FD8A 3DLBA 2FGCA 1PYSB 3IBWA 2V8HA 4YOEA 2YX1A 1NCLA 1Q16B 4BCAA 1FA0A 1Q8LA 4DZDA 4ZVUB 4PWWA 3D9BA 1TMMA 3EJMA 2MQPA 4DSJA 3LW5C 3NP5A 3TRGA 2HFNA 3DRPB 4OJHA 5FDLB 2QEXS 2R7XA 3G6XA 2M0GB 3RGIA 4L6V3 2QMUB 3ULHA 3CIZA 4NRTA 5HN0A 2AHOB 4C98A 5ITHA 3UW1A 5H9EK 2PFDA 2R8JA 1Q8BA 3TJAA 3EXCX 1HR0J 1BD6A 4H4MA 2VKZG 3MR5A 2G0CA 2WVEA 2BM0A 4OHYA 2VODA 1S1TA 2W7PA 5LT5A 1X4BA 1FT8A 4RPFA 1NMEB 2QSFA 1L3UA 1RA7A 4R5PA 1S12A 1WEZA 4JV2A 1FDNA 4IYQA 2NR0A 2HK3A 2UUBF 2FGOA 3BREA 4WP8A 4B9UA 2FZKB 3BBFA 2XLIA 4C8ZA 1QDUB 1RQ0A 2Z30B 3VAMA 3CCTA 1IUJA 4ZN3A 4FF4A 1X5PA 3RYLA 4CYUB 1WKKA 1FK9B 2CFXA 4KFBB 2PIIA 4FDFA 4B3SF 3FEYB 2QLXA 1IR0A 2W9AA 1S1WB 3LUYA 4NOHA 3E3XA 4KV8A 2XZWA 5HAOA 4YR0A 1OWXA 4KE5A 1KVKA 3QAEA 1H74A 2ALZA 2RQ4A 1NAQA 1ZM4A 1F9FA 1B7FA 3FRYA 4O44A 2E5HA 2VL1A 1UFKA 3UVJA 4DFPA 1ACMB 4NMLA 2BW7A 2DXEA 1KFSA 3HFZB 5F8NA 4DHVA 3CO9A 1OY9A 1U1KA 3P96A 1VYAA 3A3PB 2LU2A 5A0YA 1H0HB 1BY9A 2AJFE 3OTCA 2W24A 4O4RA 2SXLA 2XLJA 3BSCA 4U7UK 4C11A 3HSJA 4Q0BA 2NPFA 3J81Y 3SXLA 4KR0B 3BS9A 1MN7A 3QLHA 4J9RA 4ZVQB 3W64A 2IC3B 1XERA 3ETOA 1G3OA 1WC0A 4DV7F 4ZHRA 3ONQA 4P2FA 5BYQA 2VONA 1KR4A 1XWLA 1U2FA 1VQ4S 1NHUA 1VRTB 3FRZA 5KFRA 5C2CA 4YB1P 1UKUA 2O5DA 4FYDA 3LWMA 1JLEA 2YPZA 2NZCA 1X60A 4K2JA 3MXHP 3KK3A 3I32A 4M5KA 3R1HA 2I5JA 3IR5B 5BYSA 5T7LB 2BE7D 4M5NA 4E98A 2J5AA 1F9HA 1JLQB 3KJFB 1T7PA 3HO1A 3P49B 3NBPB 3CDAA 3M7VA 1FVSA 4B9TA 2ZZTA 4USKA 2V9KA 1S72S 4RBVA 2MGZA 3JYTB 4USJC 3RRGA 2EG2A 2FD2A 4HH0A 2ROEA 4DQIA 3M9OB 4C8LA 5KFNA 3Q8UA 1GXLA 2W2MP 4NLOA 1KQSR 4OLPA 1UL3A 1M5OC 2IAJB 5J2NA 4JI4F 3D6FB 4F4YA 4I64A 4ZK7M 4L74A 2G0JA 3TP2A 4PYDA 1XMOF 3OW2R 2ZDPA 2VBWA 1ZZNA 3CCLS 4OL8A 2CXEA 2WVCA 1UJ4A 5ETMA 1RWNB 4KH1B 3LO3A 2DNHA 3D6HB 4IOAQ 5KFFA 1DZ5A 4B3TF 2YWGA 3EE3A 5DG7A 3N9UC 4YFUA 1RTZA 4DV3J 3QPIA 4DL3A 1UJ6A 4UZBA 4PKDB 2BVZA 3J7YU 4J9OA 2VQFF 2Z0GA 2DRBA 1GMWD 2FLNA 2GZOA 3HXMA 4CM2A 4ED2A 4Y65A 4YQWA 3K7RA 1PJ7A 4ZS6A 4LFBF 4RNHA 1WOSA 4A46A 5I42B 4LF7J 3UD3P 1X9SA 3LH2S 1GMVA 3OHBA 6FDRA 1VJQA 1X9WA 3Q89A 1S6PA 3M1VB 5B0BA 1GX6A 4MYUA 4AE5A 3AB4B 2BKPA 2EVZA 1OY6A 4O0IA 5LMUF 3OTBA 1SJFA 2KT3A 2ZNYA 1LEOA 3KUGA 5DGBA 5EWGA 2GC8A 1H72C 1XMQF 3PM9A 3GG1A 3R27A 3HHEA 4DUYJ 1LW0A 2BZ2A 3H5YA 3O2IA 3MUMP 4RUAA 2IIHA 2W2OP 2H9ZA 3P45B 3SQGA 3MAQA 5CCLA 4CLSA 2COLA 3KG4A 3UDVA 5IZHA 3ZZTA 4ATNA 2BOPA 2VIHA 1IKYB 4NLSA 1N5SA 3I4HX 3RB6A 5D0GA 1RT1A 1UP1A 1PYOB 5BR8J 4N8NA 2VPZB 2B4OA 2ZH9A 3MMAB 3UO0A 1CJTB 2YKPA 2G4BA 4F4AA 4M5IA 4KJIA 1LWFB 2HMIB 1R0AB 1AB8A 5KFSA 3UPFA 1Q5YA 3M4XA 4NLVA 2HHHJ 4RW9B 3BR8A 4I4BA 2X1GA 1NSKL 4WTOB 2YKMA 5BYRA 3C15A 4WYWA 1PKUA 4UY85 4ZP9A 1ZTWA 3ILIA 2J6TA 1MWQA 9RUBA 5B08A 1TKXA 2O01C 3J7Z5 4QIGA 1HBMA 1Y00A 1F3VA 2BA9A 2KFNA 4X4UA 5C24B 4QJVA 2FYXA 1FD2A 5ETQA 3PR5B 2MKSA 2M7SA 3KTQA 3UDLA 1N48A 1RYRA 1N6QB 2HBRB 2KT5A 4HL9A 5DM7Q 1J27A 1HR0F 2HWIA 3HULA 4FXVA 1QAYA 2DITA 2BJ8A 4USWA 2YWEA 2GJ2A 3T5JA 2DNQA 1DY3A 2HHXA 2P5VA 3K5MA 2OKQA 2ZNZA 2D3UA 3HD1A 4NA1A 2FLOA 3K89A 3MPYA 2AYEA 2EG1A 4N7TA 3CJ2A 2UU9J 2CA9A 4TY9A 2UV8G 2FVPA 1IKVB 5IM0B 2MMYA 4G65A 1EAYC 3NGKA 2KFYA 1IKWB 2J9DE 4U7CA 3DKDA 1UTAA 3KK2B 4RW7B 1HWJA 3RB0A 1HI1A 2B9YA 2MHEA 1T9VA 4BWJA 1JLGA 1R8PA 3CC7S 1PO6A 4Z37A 3IWLA 4ELVA 1NDKA 1JB0C 2ZH6A 1ROFA 2VFVA 2OPQA 3GIIA 4F4KA 1WEXA 4I69A 4ITSA 3CSKA 4YB6A 1T9YA 1KWMA 2ZHAA 1VGYA 2HNDA 3M2VB 4GVBB 4NA2A 1NJWA 1S49A 3EDRB 2L48A 2XULA 4KC5A 4FBTA 3HSZA 1EX8A 3C46A 3IS9A 3TA0A 2GW8A 1FFWB 4A8FA 1FXDA 4RZRA 4KSEB 4ERDA 3EVOA 2MEWA 2CQ3A 3KJNB 2XS5A 1WF0A 5KTQA 1JXLA 3TUIC 1IQTA 2E5IA 3QJJA 1N54B 4LF9J 3GYGA 3B78A 2Y0SD 3EM1A 2XB2D 4J9UE 3ZTPA 5HSPA 2V2VA 2EXUA 1ZTTA 2ILYA 1KOHA 5L1LA 4ICLA 1AFIA 1U47A 1S0MA 4M1KA 3T5HA 1WKLA 1VK3A 2EC2A 2HHWA 4EFAC 2E9ZA 3CNQP 3FFIA 1FRMA 4L73A 3AJDA 2BYCA 5GADI 1WHVA 5HROA 2JZ5A 1V3RA 3A4TA 4P6QA 2AW0A 1TL4A 2WBRA 2G2YA 2CQ4A 2EBEA 5IC6B 4ED1A 5D3GB 3FEXB 1N33J 1FX2A 2YWWA 4UQTA 5KFYA 1RT5B 3ISNC 1J5EJ 4Y34A 4F0MA 4UT4A 4JV1A 2ATLA 2NXEA 4ZKAA 1Q95G 4IR9A 3BPSP 1KLMB 5K9FA 1S1UA 3CCSS 2ALYB 2C42A 1KTQA 2NSCA 4NZ6A 3IR7B 2P2CB 3CEDA 3PRVA 1RTHA 4KGXB 2V67A 4DSEA 2YNIB 4B3MJ 4JI7J 5D4OA 4M95A 4HKQA 4J37A 5LXRA 1TV6A 3HHLA 4QPXA 1JQGA 4PG5A 2IJNA 1HPZB 4R8UB 4YP3A 2VICA 1SV5B 4J9KA 2HLTA 1AZSA 1RT7B 1BC6A 5K8OA 4DCPB 2GVZA 4QR1A 4DV3F 5DRKA 2VFUA 4OYOA 1KQFB 3QAUA 4OZ0A 4IG0A 2CQGA 3MECA 1REVB 3GU0A 2EK6A 2RS8A 1TUWA 1LWCB 2YWHA 3MCNA 2L3MA 4O0NA 1DTTA 2CWKA 3OSNA 4LF7F 5DM6Q 4ZJLA 3BM7A 2XI2A 3RTVA 4BLGA 2KL8A 3J81U 1YJUA 5I3PA 1MW7A 4C6AA 3C14B 4N47A 3NL0A 3TX8A 1M5VC 5L1IA 2AX1A 2MKIA 3ZTQA 3NG8A 4OYMA 1VQ5S 2N4CA 3FK4A 4KTQA 2W2PP 1VHIA 2B4VA 3MAAB 4PAAA 4DUYF 4NYOA 1RAJA 3OUYA 2QC3A 2MJUA 2MSSA 2W8LA 3UD4P 1SI9A 3D5MA 3LP1A 5E41A 1YLXA 3KNAA 2XMUA 4RO0A 2HHSA 3C3LA 1FCAA 1DJ0A 1HI8A 3V2UC 2DGTA 1K1QA 1UPPA 2XTJP 1L5UA 1X4AA 3CCQS 4U67Q 5BR8F 2ADCA 3FZ2A 1OSDA 1MMLA 3KOAA 3NGSA 2E1RA 1BWVA 5HK4A 3KKFA 2K1RA 1UWBB 2QA2A 4C8NA 3V6JA 1C4CA 3RBXA 2E1PA 4I2PA 3H25A 3I4PA 4DV1J 2ASDA 3H5XA 4TU7A 1RKJA 2CAJA 1WHXA 1UVMA 3AQOA 3DNCA 3CJKB 2GHWA 3DYAA 4H4MB 2ZZNA 2PA3A 1YKWA 3CB4A 4FBUA 4DL0C 1Y5LB 3FSXA 3HK2A 1HD0A 3BO4A 3M8YA 2ZBPA 4CTAA 2RQCA 2ZOGA 3MPUB 3MOJB 3G6YA 2J0WA 5HL7Q 4D3GA 4GO7X 8RUCA 2LYVA 3K5PA 5ETKA 2V8VA 2C22A 4W92B 5B7WA 2FVQA 5E7OB 2J6UA 2WOMA 2DXFA 1HQUA 5GAHI 3BH6B 1IR1A 2HS0A 2R8GA 2KVQE 5GAGI 2JLFA 3N6LA 3W2VA 4ED6A 5K14A 3VVUA 3UDCA 1IR2A 1FE4A 2V2ZA 4ZN1A 2QZ8A 1JNZB 4LVNP 1U1NA 2AEMA 1T05A 1BXNA 4CH7A 2XMWA 3TAQA 3K2YA 2AF6A 1GH8A 3H4DA 2IFXA 1C0TA 3IBFB 4CLFA 3EPIA 3LTOA 2O1PA 3ETMA 1L3KA 4KV8B 1WC1A 2HLUA 4RUHA 2DISA 2MTLA 2VG6A 2KT2A 3SCIE 2WK4A 2UU9F 2YX7A 4IO1A 5KFOA 1FEEA 4IFVB 4JI2J 2E1AA 4ILLA 5KT5A 1WSRA 4HVZA 3SCJE 4H4KA 1SKRA 1FWLA 4O44B 5LMNJ 1EP4A 5J1NA 2V2KA 4J9SA 2NCKL 2HNZA 5H9FJ 4A8XA 3WQPA 3UVJB 2Z58B 4DSLA 2KZZA 3GV5B 3DDNA 4RW6B 4WK3A 1LWXA 4W90B 5MAOA 5J2MA 3BPDA 4DU8A 4CO1A 2BM1A 4K8RA 3TZZA 1U6ZA 2QLBB 4C11B 4Q0BB 1RE1B 3ZXWA 1CLFA 2KO1A 3QLHB 4AYBD 3CCRS 2NUUG 4B9NA 1DQ9A 4U9RA 2CKWA 1SH0A 3MMBA 4ZHRB 2BBEA 3T1AA 2QYGA 4WE1A 5HO4A 3TA2A 2DNGA 3WIVA 3MR2A 1PC5A 1D1UA 4F8RA 1XN9A 1ZS6A 4NEZA 4YR2A 1HBOB 4WFYA 2OGUA 1JLEB 5D4NA 3L9ZA 3TJ9A 3V4IB 3DLKA 5LM7E 5C42A 4ED8A 5SZTA 3M30A 1O8BA 1N88A 1N4LA 2VPYB 2I5JB 3H5SA 2HHUA 3OL6A 5HLFA 5CD4A 1CEZA 5FLXY 4DV2J 4LF9F 4DR3J 2AEJA 2VFTA 3QGGA 3D4JA 1VCTA 2R7OA 3N5BA 2MGZB 2J9CA 2MLZA 5L38A 3JSMA 4ZCKA 2QG9B 2E29A 3CJ0A 3I82A 2H48B 3T19A 5KFQA 1RHMB 2OEKA 1T02A 2B56A 3OFEA 2XMTA 4ZPWR 2D7SA 1C1BA 1GK8A 1GT8A 4M5MA 4QIFA 3VGVA 3GIKA 5IC4B 4OZ1A 2ACMA 7FDRA 1PC4A 3TEHB 1X5OA 3N79A 1N33F 2VPXB 1T9UA 1XBWA 4ZJQA 4E8UA 4HHHA 2HHVA 1J5EF 3R5BA 4H4KC 4CLWA 1H2UX 3J7A1 5D15A 2BANA 1Z2ZA 1F1BB 1A9NB 1Y10A 1XMBA 4AL5A 3QATA 1T3NA 1JMTA 4C9DA 2IYIA 5CCMA 4PXCA 4UOGA 1FDDA 3THTA 2O67A 1MG7A 3HZGA 4HLBA 1WD6A 1NJZA 3H42A 3WIUA 1JJ2R 2RE1A 3FQLA 3AD7C 1O6XA 2E7VA 1DTQB 4B3MF 2LEPA 4JI7F 2QE5A 2PC6A 1PSDA 2M8DB 3OL9A 5L9XA 3OFHA 3H4BA 3W2WB 2N3OA 2IBKA 4ZP7A 1U25A 4MKVA 3ZZYA 4DV5J 3SCLE 2R2UA 3CC2S 1P9YA 2EFOA 5HMWA 1F0XA 2UUCJ 1UVLA 3U1LA 4BS2A 4HDGA 4CZCA 5KFVA 2V63A 2DEJA 4DZ6A 5HI7A 3DMJA 1LW0B 4P10A 2CVEA 1F3FA 1Q8IA 1R31A 1WSVA 1ZM3A 4QIWD 4J5OA 1HHTP 2GAGC 3SQGB 4I7FB 4EI2A 1N36J 2HRTA 1PIEA 3VALA 4UF4A 3BH7B 1WI6A 2NXCA 2QL9B 3HF5A 1IWGA 1L3SA 1ZA2B 1ICEB 2F65A 1UZDA 1DURA 1FDBA 3M6UA 1E6VB 1KP6A 5CHCB 2Z2YB 2CJKA 2UVRA 2HIYA 1U0HA 3DI6B 2DCLA 5KG1A 2P6TA 2LQ9A 4UUWA 4OI1A 3QRPA 3GFHA 4CH1A 2C3YA 1U1QA 1RAOA 3PV8A 2XMMA 4Y00A 1VBZA 4FF3A 4DX7A 1VS3A 2JEIA 2QSWA 1RHQB 4I0WA 4MJKA 1X4HA 2ZVSA 3PEHA 4UOCA 3QGHA 3T1YJ 1EB0A 2DO4A 5DJBA 4ZVOB 3CJ4A 4U8VA 3NRBA 1TVRA 2F8EX 1HBMB 1VQYA 2B3TB 2DO0A 2XCPA 4FXDA 3PVXA 2JX2A 5M2PA 3PX0A 4AXIA 4PR6A 4DV1F 4XDCA 1A0OB 1RT2A 1IBCB 1U0SA 3G2XA 3M8QA 2BR0A 4DEZA 1CVJA 4QWCA 4XPCA 4C3LA 5IV3A 2A6MA 2MQOA 3MM7A 3T6JA 4H4OB 1D9DA 2CZ4A 3BKFA 1UMJA 3UN2A 1IJEB 3W9JA 1VQKS 3AOAA 2BOAA 5IWAJ 1G2EA 2BQRA 1A6LA 2HVEA 4U8YA 1S48A 3CC4S 2OPPA 5HBMA 4TYAA 3M2RB 4EYHB 3SZ2A 1M0SA 4X4QA 1DLOA 3OR2B 3PHTA 1U49A 3CF5Q 5K8MA 5KFTA 1SJ1A 5GADU 4YDDB 1WC3A 4NLWA 2HFZA 3FMBA 3T5LA 4NCGA 4TXSA 1YZ7A 2MSTA 2QA1A 3KLVA 3OVBA 1SVDA 4RNFA 2XS2A 1CJUA 5AXLA 2P6SA 3CWJA 4M63A 3CCUS 5C2GA 4DR6J 2OPQB 4RWXA 2L41A 3SV4A 1U8WA 3QIDA 1QTMA 3ZTOA 1WNEA 4A48A 1QAJA 3KMSA 4JI2F 1YK9A 3MR3A 3BGUA 2JVRA 3QO9B 5LMNF 1SKUB 2M5YA 3DXBA 2HNDB 2ERRA 4MTPA 2EKYA 1G1XA 1NK0A 1VC5A 3VWSA 4CLTA 3C66A 3GJTB 3GIRA 4X66J 4OZ5A 4QU7A 2OHDA 2DNMA 3TUJC 4LSNA 1RZMA 2UUAJ 5THWA 3CMES 2VBYA 5DDQC 3KJVB 3G9CA 3DOMA 5EUHA 3ENWA 3T41A 2A2DA 2GQ2A 3JTNA 1U48A 3NWRA 2J8AA 3CJ3A 2YQ0A 2PGCA 2KU7A 5KFMA 3DOLB 2UXCJ 2HQ3A 2BJ3A 4DN0A 4QW9A 4DR5J 3KLEA 1N5QA 4DQPA 4QYRA 2NPIA 3LP0A 3DLLQ 1P1TA 2BJ9A 1WTBA 3ZNUA 3AXKA 1BGXT 3G8QA 5LJ3Y 2CPZA 1VLOA 1XQIA 2YH1A 2DNRA 1SUQA 3W61A 2EPIA 2L9NA 4DL6A 1Q78A 7AT1B 1N32J 1WEYA 3PCOB 2W1BA 2RDDA 3UNGC 4ZPVR 3NGDA 5L39A 2VG7A 3DOKA 3IP0A 5LOQA 4MFBA 2I2YA 4P2SA 2WVFA 2WB4A 4RJVA 1YBUA 3EVMA 5FIIA 1T9XA 5DG8A 3I5BA 1Q4RA 4TKTA 4WXWA 2DGOA 5L1JA 4NI2A 4Q43A 4DV2F 3S6EA 2ZD1A 5F3TA 1ZPVA 4DR3F 4WWSA 1D09B 1JLAB 5A6WA 1MWYA 2C2ZB 2XBPA 2CPYA 1B3TA 3GR0A 2YKOA 3PYFA 2F3JA 2FZGB 3R7NB 2GVDB 4Q44A 1YGYA 1FERA 2BE9B 1XR5A 1FKOA 2LQ5A 1T94A 3EGWB 1UETA 1C0UA 4F2RA 2C2KB 4YY3J 1S1UB 3RR8A 3BF4A 1RYSA 2RHSB 2W25A 3IR6B 2AGPA 1TV6B 3MM5A 1F5BA 4KO0A 2MKCA 4UOHA 3R5JB 3A8EA 4ID5A 4CLYA 1JLFA 4DR2J 2IMOA 2MQNA 3JTPA 1RKIA 1RT3A 3CIMA 1YSJA 1AZSB 1Q5VA 3BGFA 3R6LB 2GHPA 2GVZB 3QRQA 1XR7A 4PEOA 4J90A 4NASA 5K8PA 5GMEA 4K5SA 2ZHOA 2K3KA 5T41A 2UZAA 1VQ7S 4OHXA 4IG0B 1SB6A 3VZHA 1S1XA 1WC4A 2YY3A 3EZOA 2DK2A 1RWMB 4HI1A 3MECB 2ACYA 4RBTA 2A3JA 2ZZMA 3BN7A 2UVVA 2BRKA 1HWLA 2UVUA 3R6GB 3T1HJ 4JI5J 1VDHA 3MM8A 4RKUC 3KNGA 4ED0A 5D77A 5HQLA 1UFWA 1LWEA 3W8GA 5GAHU 3OQ2A 2HAIA 2DIVA 5E3AA 4R25A 4EBEA 5F0WA 2CPEA 2HQFA 1ZAXA 3VQTA 4DF4A 1T9WA 3FBEA 1AXQA 2N7YA 3MEDA 1NB7A 4TU8A 3W66A 3M32A 2U1AA 5G0RB 1J5OA 1YRXA 2XYGB 2A0FB 1RU2A 3OUYB 1KNZA 1UA0A 3Q23A 3BSOA 2JEGA 4K2XA 2YQ3A 1N36F 4FF1A 3J80U 1KOOA 5DS7A 1SQGA 1S77D 2B7BB 3CDWA 2PSZA 2EEYA 1U2RA 5A8KA 3MGJA 4ENOA 1ZA1B 4DR4J 1F5CA 1FRJA 2GAHC 1HYSA 4Y6IA 4A4JA 3OT9A 1WACA 3ZNJ1 4X4SA 3MR6A 3ZFVA 2BJ1A 2FJAB 2RSQA 3K5OA 4RW4A 3GFYA 1FJGJ 2NUHA 1AFJA 3D0GE 1NDLA 3CW2C 1F5AA 1U45A 1NH7A 4QW8A 2K1RB 4DU7A 4WZMA 2GA7A 4NLGA 1NXIA 3MTJA 3HKWA 2AZ3A 4NXMJ 1PJ5A 2HFOA 2KXNB 1RADB 2EI5A 4P73A 4C8OA 1N0UA 4W4MA 2XSJA 4K4VA 1GXTA 3MPVA 4CTAB 1VI7A 4NLDA 3QSYB 2R7WA 3DU6A 3T1YF 1IKXA 3PYDA 3E2EA 2MB0B 2ZHBA 3G82A 4WBFA 2VDHA 5C25A 2W2QP 2UV8A 3MEEA 1V6HA 5HMZA 5AXKA 3KK1B 1FESA 1C4AA 2RRNA 2WOMB 4CRJA 3L09A 1HQUB 3HT3A 4WU3A 2WBMA 2W8KA 3PW4A 4RBUA 1YWXA 1U09A 4QYZJ 4O3PA 3W2VB 5LSRA 3MOZA 3MM9A 1RA6A 3DDIA 4M5DA 3R5AA 1CS4A 3KMQA 4G1IA 3UN3A 4F50A 2WAQD 5KFAA 2QFIA 3G87A 2DR5A 1UFLA 2HG4A 1H7WA 2K06A 3FCVA 2FJVA 5IWAF 1L3VA 4OYXA 4NRUA 1RAHB 1FI4A 1R8HA 1F60B 2U2FA 3C8YA 3DGPB 4UTGA 4JP8A 2KXFA 3M6XA 4KAIA 3F41A 2MHNA 2GX8A 3D1QA 4XO0A 1AA1B 4DV6J 2FY8A 3QSIA 4FVMA 1UZHA 2OPSA 4ZPAA 1EP4B 1AUSL 3NMRA 2HNZB 2DJWA 4JI3F 4G6VB 3W5ZA 3VAGA 5CH7B 1K0TA 4FN5A 1K44A 5J2MB 2K7KA 2AJ4A 4DR6F 4MIWA 1WG4A 2LCWA 2F7VA 4CO5A 5F3ZA 1NJYA 1TMJA 2C2OB 3LPEA 1TL1A 2C2RA 4ZPTR 1U6FA 5IT9U 3CO0P 3VHQA 3DRRA 3FC9A 2HYIB 3IGNA 3I55S 2DHAA 2ZJRQ 3LP2B 3I56S 4ZVSB 1S6QA 2G9OA 1JLBA 5CZXA 5KG3A 1Y5NB 3OBIA 4X66F 2IJRA 2E5LJ 4KYZA 3MM6B 4M5GA 3QQCD 4U96A 3RRHA 2UUAF 3DM2B 1LK7A 4NA3A 4N8OA 5CYQB 3VGUA 2OSQA 3GMGA 4G1QB 3PNIA 1S0NA 3DLKB 5C42B 5D0RA 2VOPA 2XY5A 1S5ZA 3SEOA 3M30B 1W25A 2PMZD 5D4LA 3A1YG 5HLFB 4DR5F 1WF1A 4DX8H 3MEGA 2VF3A 4ZCIA 2J9DA 4JYAJ 5DZ6A 3GFXA 4URQU 4K4UA 1R6YA 4EK2A 5EDWA 4J7CA 1S99A 4NLQA 4LRFA 4K4SA 3W8PA 1PYTA 4WP9A 3HHDA 3THVA 1YI2S 2FLPA 4DPOA 4AUKA 1VQ6S 2G2OA 2KRBA 5KOWA 4MAKA 5KT7A 5ETLA 3JSMB 4RU2A 3AXMA 1S7HA 2BUNA 4USTA 4KY3A 2M52A 1HWUA 4F2SA 4AL6A 1U8SA 2F8HA 5AJ3J 1MMDA 2Y1RI 1NB2A 3TAPA 3D3CJ 1C1BB 3UQSA 1F2HA 4NLUA 2XG8A 4E0DA 4UOFA 2BRLA 2YWFA 3HI9A 3TO8A 2ZH4A 2IDEA 3FBFA 2NREA 4K0KJ 1T8EA 1QY7A 4L3NA 3FCWA 3ITHA 2BANB 4TU9A 3H2LA 2XHWA 2NSBA 1FKPB 1NK5A 4YY3F 3SBMA 2D3O1 4V19X 4KKOA 3KUEA 2VKRA 1H6KX 2J76E 2RRAA 3KLFA 1QJHA 1CJVB 2CQCA 4Y0FA 1TR0A 5JMNA 1O5JA 4FXWA 3R5CA 2XMAA 1H2TZ 4KIAA 4MK9A 3SV3A 2VOOA 4DR2F 3LANA 4CT9A 3BBCA 4ZCLA 1RAGB 3P3DA 2RHQB 1HIYA 3HVTB 3ENAA 3GJQB 3D6TB 2IDLA 4CI0B 2E1CA 3Q83A 1YVFA 3EGZA 5HVFA 2DNKA 2CPDA 3J7AN 4OV1A 4GO5X 5KOXA 4M8LA 3DMJB 4OYIA 2XSFA 3T1HF 4JI5F 2G2ZA 3TZXA 2XHCA 4USIA 2AIRB 3IRWP 1VQLS 4OZJA 1RT6A 2DB1A 1Y4ZB 4NYZA 2KM8C 3W5YA 3VCDA 2RDIA 4KBIA 1BQNB 1YBAA 4LIRA 2YKNA 1MU2A 4DLEA 4GKJJ 4X4NA 1RCOB 1CULA 3OLAA 1S7IA 1QVFR 3AT1B 3WZ0A 3NLCA 3Q8SB 3V6HA 1YITS 2A18A 5F8IA 2HGMA 1TKTA 4CT8A 4ZPBA 4U6PA 3W3SA 2GO9A 2JNJA 2LQJA 1SH2A 2OFHX 2AU0A 1SBRA 2D3OR 4DR4F 1LNQA 2QYCA 4B9MA 3I0SA 2RU3A 3NGRA 2QLJB 1VRUB 3DC2A 3ZTRA 3RAQA 2BACA 2ZOFA 4DPUA 3CMQA 4EUVA 4PQUA 1FJGF 4N56A 4CO0A 1UJ5A 1NRKA 4ALZA 3JAMY 2PO4A 5DZ7A 1N34J 5CYMA 4PWDA 4CQ1A 4NXMF 4P7VA 3QFWA 1ZAVA 3OR1B 3FMWA 3M8QB 2F4FA 3TA1A 1NDCA 2KKHA 4FF2A 3MM7B 4XTTA 4ECVA 4B9VA 4HDHA 4OX8A 4F3QA 2M2BA 3PTWA 1HBNA 1PJ6A 1Q1KA 2WONA 4J9PA 4F7VA 3AODA 2ZKTA 1N56A 4IRKA 2Q6BA 2VFRA 2HHTA 1KN6A 2OPPB 3MFHA 2B8PA 5HBMB 1IBMJ 5B0AA 1HARA 3F56A 3GSDA 2EFGA 1DLOB 2M3DA 2K8GA 1SJ3P 1JXVA 2EFQA 1VQMS 4AFFA 4HI2A 3DU5A 5GVQA 3EPGA 4TY8B 4NCGB 5T14A 2QLWA 3ENQA 1UAWA 1NKBA 1CC8A 5D0HA 5MLCV 2YNFA 4A8YA 2MXYA 1Q7LB 4HR2A 4QWBA 2KRRA 4BBYA 1KKHA 5E3CA 4ANEA 1E6YB 2NYHA 4A47A 2GCFA 2BABA 3N4WA 1M5KC 1N5TA 2C3PA 3D54A 1FRXA 4DV6F 2D69A 3ZTSA 1UA1A 1WWHA 3MI7X 1GMWA 4WPAA 4P72A 1XC9A 4ELTA 4DPWA 1EKRA 1HFEL 4DV0J 1IBLJ 4KHPF 4OIXA 4J9QA 2DPIA 7FD1A 2HVZA 3PW2A 3DCAA 2MKKA 4U95A 5FDLA 2QMWA 1CSJA 3HLUA 3HHKA 4OYAA 4RX6A 2W2NP 1CPZA 5DG9A 3FSYA 3ADAC 2BEFA 2OMOA 2MJNA 2R7TA 1CQMA 3LP0B 5I3UA 3GZ7A 4HT7A 4NPOA 4ZVGA 5KFEA 2B9XA 3R2CJ 1FO1A 1TUGB 2QGFB 3EGNA 1ZH5A 2E5LF 1SUQB 2HBYB 4MK8A 3PJWA 3C6TA 3SYZA 3RW6A 2ASLA 2VG7B 2RILA 3DOKB 3LWLA 1S9GA 3CPWR 2DPJA 3IRXA 4MFBB 2DR6A 3FZBA 3PEJA 2JFDA 1YBTA 1M5SA 2HSEB 4LVOP 4JYAF 1IN0A 2E9RX 5EN1A 4NI2B 4Y2AA 3BGRB 2IY5B 4JI0J 3PACA 4I56A 1VISA 3DN9A 2VBZA 1Z2LA 3R5GA 3BDPA 2RUGA 3JQMA 2DHXA 5K20B 3PO4A 1TFYA 1FK9A 4LFCJ 4DL2A 3Q0AA 2Q3PA 5CXTA 4KFBA 2C2MB 2DVIA 3L7OA 1FKOB 3QZ8A 5EWFA 2UVWA 4ETXA 5AJ3F 2M9KA 5HJYA 5DO2A 3L4BC 3BQ2A 1S9EA 1RWPB 5KG2A 1ZAWA 2KH9A 4J9LA 1C2PA 3KJQB 4OZ3A 2DHSA 3MMCB 3N01A 4KO0B 4NEYA 4ID5B 2BDPA 4K0KF 5SUHA 4DL7A 3EMTA 1RT3B 2XNQA 1B0TA 5C5JA 3HVRA 4USHA 3M2UB 2DNLA 2MZQA 4USVA 2OUGA 3GPAA 5E2QA 1S1XB 4LF5J 2DGQA 4TQRA 3CCZA 2ZUAA 2R2TA 1FHTA 1JLCA 2IM3A 3MM8B 2XEXA 3ET6B 4LMZA 2LXIA 4PG4A 3CGIA 3VZIA 2FC9A 4KGKA 1LWEB 3LAMA 3QJPA 1P8GA 2YKQA 3OHAA 2IRXA 2OO4A 3NCQA 2IM0A 2WHOA 1CJKB 2XWYA 2GMJA 3M9NB 3GYXB 6FD1A 1VMBA 1IBKJ 1RLCL 3MEDB 2HFVA 2DYAA 2R9LA 3M32B 3PRBA 1HQEA 3PXGa 4A8KA 3GV8B 4DMZA 2FJEB 2KJVA 1HBUA 3HD2A 1U6BA 3VQSA 2AV5A 4H54A 1JLQA 3NBPA 4KHMA 2RT3A 3IWNC 2L08A 4OYZA 3R9LA 4IOCQ 2CZVC 4FYWB 5A8KB 3GIMA 1X7VA 1SC4B 2H3EB 4GKJF 4X64J 2KFZA 1IVZA 3VAKA 1U1LA 3SIPB 3V81A 1U1OA 1TK8A 2VASA 4ZVEA 1BLUA 2R4FA 1PG5B 4RW4B 2LVWA 3HX9A 1QD1A 5BXIA 1CC7A 3T6BA 1W2BR 4NYPA 3RBZA 4WFBQ 3PX4A 4JBCA 2WTFA 1V5VA 3SMZA 2A10A 2Q79A 5LXYA 3HVWA 5HVHA 4LR8A 2OPRA 4RR5A 3FKBA 1NUEA 1RWXB 5KFBA 1CQNA 3K0JA 3Q8VA 3KG1A 1UPMB 4OV6A 3MEKA 4ES2A 3L3CA 2XSJB 2DY1A 5ETOA 3TAMB 3MFIA 4PPZA 1UVIA 2L9DA 5M2RA 5HMYA 4A8WA 2MQLA 4Y3CA 3SSQA 1IKXB 2MZSA 4LRAA 2FQQB 5C25B 3MEEB 3D1HA 2ILZA 4ZIWA 3PYGA 4GKKJ 1C1CA 4OX7A 1N34F 3PIPQ 2J7WA 2BE2B 3QRRA 4ER8A 1RHJB 1BMQB 2C28A 3OXFA 4X4VA 2RJZA 1VQOS 4LSLB 2K2PA 2LA6A 1W26A 3HJFA 2ZH1A 4BC9A 1IM4A 3HFVA 2GO8A 1RTDA 2QA4S 4HACB 1UWAA 4NLRA 3G71S 2LU1A 1KQKA 5ETPA 1PCAA 1G7CB 3KHGA 1YHQS 3Q8PB 2DNNA 3MTKA 1S76D 1VQ9S 2OEMA 3CD0A 4QPTA 1HA1A 1SJQA 1IBMF 2DXDA 2QLFB 4LREA 4ZVTB 4OYWA 1HNVA 1BWEA 1R8AA 2GMHA 1JX4A 1W2IA 2IVFB 1V3ZA 4HTJA 3I96A 1UVKA 2YTCA 3EUNA 1S10A 2FC8A 3TX0A 4KGVB 1HLWA 2JHEA 4PQAA 5KFKA 2XGQA 3V6DB 3EX7B 4DFJA 3ILLA 1CJTA 2ZBQA 4ZLLA 2MQ8A 2KJWA 1U24A 1X9MA 1AW0A 2HRUA 3QNWB 2VJVA 1LWFA 2HMIA 3NAHA 1RWOB 4RW9A 3LPYA 4A8MP 1FWPA 3KYLA 2FVRA 3NNCA 1S6QB 1JLBB 2MPUA 1UEKA 4PXDA 4DV0F 4WJBA 1IBLF 3A12A 2JEJA 2AKWB 3K58A 1N52B 1QAXA 3W9HA 4UY8T 1PBUA 2OJ3A 3D66A 3RB3A 1EIYB 1XNRJ 2CNOB 1NNDA 3KLGA 3ICLA 5C24A 5KFWA 3G6VA 4G3IA 1TK5A 3J7ZT 1RWUA 2E5JA 5GAEI 1Q82T 2FIUA 2HFSA 3FBCA 4ZVFA 1T03B 3E01A 2WW8A 3Q24A 4LF2A 2RAQA 1ZPWX 2GIFA 2QV6A 3A8KA 2GGPA 3GJRB 3JAMU 2FZCB 2OAUA 1KFDA 3MHYA 2CNNB 1BHNA 3R1LA 3U1NA 1GQEA 2X3DA 4PZVA 4F36A 1H73A 8ATCB 3I0RA 2CG4A 2B5JA 1RAAB 1LV5A 1RWVB 1NM2A 1HNWJ 1I94J 2Q6CA 3H8YA 2JLEA 5CQGA 1UEUA 2V2QA 5IM0A 1RP5A 4JI0F 1IKWA 3KWMA 3KK2A 2IA0A 1XIQA 1GMUA 4GMKA 1F9EB 1M5HA 3CMAS 4LFCF 3UE2A 3WC0A 4BDPA 2PMHA 3L7PA 2E66A 5EHHA 5A76A 2CUYA 1RAEB 4V19J 3FQKA 1N5YA 5F9LA 4ZVPB 3T5KA 2HBZB 4F04B 3SDEB 1WC5A 2LXUA 4GVBA 3NEKA 1GXUA 1FRKA 3MCSA 3ZZUA 5L8RC 2GHVC 4OI0A 2HQDA 3W1YC 2XY6A 4MKYA 2GFFA 3G8TA 4B9LA 4I6AA 4F26A 3P5BP 4LF5F 1SQEA 3TARA 4P2XA 3A3OB 3VGTA 3BV8A 3THPA 4DV4J 1RT6B 4Q7AA 1OQ3A 2DNPA 1X4CA 4I2QA 3M8WA 3M8ZA 2CNLB 3LALA 3FVYA 1VHFA 5KT4A 3ZZZA 4AQYJ 2DTJA 3QWPA 2B6AA 2YKNB 1MU2B 4LFAJ 5B0EA 1EZZB 8AT1B 4ZP6A 1IBKF 4EZ9A 1F6TA 4A8SA 2G1HA 3RJMB 3TUPA 4DF8A 2DEIA 2OP5A 2FVSA 2F1FA 4NE9C 1OO0B 2ZITA 3B8HA 1GX5A 3KLHA 3Q22A 4ZPCA 3QT6A 2HGNA 2E9TA 2QRRA 1MLAA 2X51A 4CLUA 4C7QA 2MZ1A 1KD1T 4NMXA 2HQIA 2LXFA 2ZM6J 1VQ8S 3H40A 4NLYA 1RT5A 4L72B 2AYBA 4X64F 4JV5J 4NZ7A 1TZ0A 1YX2A 4QR0A 4FYXB 4EMDA 4DLGA 2JDJA 1DFDA 5B0DA 3Q8YA 3FEZA 5A8WA 1WI8A 1JNRB 4M5HA 3TUZC 1KHVA 1WKJA 2I9SA 2VBXA 1Y9OA 2WB1D 2AWZA 4DPXA 3FGVA 4OX6A 5KFHA 1NK4A 4X2BA 1D9AA 5CYMB 4PWDB 1TL7B 2H65B 3QIPB 4USMA 1NBEB 1W7WA 5J2QA 1SC1B 2MQQA 4MKAA 2ZDOA 1HBNB 2J7KA 2CJAA 2WONB 3W7BA 5HP1A 4DN9A 3BJYA 4GKKF 1AROP 1B64A 1LW2B 3LGMA 1AYEA 1XMQJ 1REVA 3IA0A 4B02A 2C2DA 1RUSA 2IA6A 5JXSA 1LWCA 2VA2A 2ZWPA 3MWBA 4WF9Q 4C8KA 5F8GA 1RTJB 1OYEA 2VUGA 1FWKA 1P9QC 4LBHA 2Z2MA 2VB6A 1SIWB 4ILRA 3ZZ0A 2HVIA 1N0VC 1ZYQA 4OJ3A 2AX0A 3N6NA 1NZAA 3TEGA 4XPEA 1K1SA 2HZCA 3QJLA 4ANCA 3QFHA 3C14A 3O3LA 1RJJA 4FVCA 2QO3A 3DRXA 4X4TA 3DXSX 4LSZB 3NWGA 4YB5A 2CPIA 2ZVIA 3JSBA 1U2CA 2CQPA 3H59A 3AFGA 2I6WA 2IVYA 4IR1A 1H38A 2RD5C 3QZ7A 2IPOB 3U02A 2JL9A 2HHHF 1TU0B 1M1KT 1YJ7A 2DR7A 4O3NA 2ASJA 2KG1A 1X4FA 1YJNS 3D6MB 1TL3A 2VHGA 1KTVA 2VD3A 1S1TB 3CULA 4Y28C 3HHLC 1ITPA 1KDNA 3TQ1A 4R5PB 4DX6A 3UWTA 1XTZA 1UWBA 5D4PA 2Z4PA 2NZ4A 1NK9A 2V4RA 5I3UB 4F25A 3R2DJ 4K4TA 3CJKA 3W65A 2PI5A 3GIJA 3NXZA 1ZBTA 5E3PA 3GE9A 3PW7A 2BX6A 2CQDA 4FZVA 1D0EA 2DGUA 2DCUB 4FYVB 3DLJA 1H7XA 3C6TB 4DDFA 3N0VA 1XNRF 3R97A 1S4FA 2BJ7A 1S9GB 4CLZA 4ZLJA 1MNEA 3IRXB 1GFWB 1R8BA 3AH6A 3PG9A 3KDNA 4K5RA 4NL5A 2R8HA 1DHMA 3PZPA 2AP6A 3CUNA 4OI6A 2GJIA 3NOGA 2FHMA 2PN6A 2P8IA 4B17A 3L95X 3VAJA 2FJBB 2F9DA 1SC6A 1APSA 1VJWA 2B4PA 2HVDA 1X4GA 2J9EA 3SI8A 3PHEA 5JUMA 3R7SB 4IH5A 2V5HG 4CNZA 1P6TA 2OLWA 2PEBA 4F3MA 4PRFA 3SSRA 5A0YB 3JSYA 2XYPB 1HNWF 1I94F 4JOUA 1JKHA 4IFYA 1S9EB 4IFVA 2W7AA 1HD1A 3UCZP 4QIEA 2CJBA 4P2MA 4DXLA 4PXBA 3PKMA 2QMXA 2NXUA 3IGVA 2AYMA 3OVAA 2CNKB 3HPOA 2A1BA 3UR3C 5KFJA 2R8KA 3EGVA 3GCWP 4RW6A 3IM9A 2FJDB 5K8NA 5I4MA 2XO7A 1WTFA 2W9BA 4DR1J 1KQGB 5HATA 3US5A 2KHCA 3DLEA 3Q86A 1R6VA 4L3KA 2C3OA 2HVHA 2X1FA 2B0GA 2QL7B 4FNIA 4MH8A 3J80Y 3K57A 1VQPS 2B8QA 3KK3B 3M8PA 3A13A 4EGLA 3B54A 3IN5A 4LQ3A 5EWEA 4M5LA 2VJUA 1JLCB 2YXLA 1LOUA 4A8QA 2IM1A 4OHZA 1RABB 2LDYA 3AA9A 2KXHA 2V50A 4WTYA 3T3FA 3GG0A 1PBAA 1QSLA 1XEZA 4LRCA 1HBOA 4YN3B 1H3DA 4WIIA 1SL1A 5KT2A 1G4CA 2PI4A 2RKIA 3V4IA 3MAHA 4S0MA 1RSCA 1VQSA 1HQEB 3UN5A 3E51A 3NOCA 2OTLS 1T9TA 4YHHJ 4NLPA 5J2NB 1HBUB 1RHRB 3U1MA 5K5MA 4DV4F 4DFMA 5A2QU 3AOBA 2Y8YA 2EK1A 5HVGA 4MYTA 2EW9A 3QGIA 1X4DA 4AQYF 4CO4A 2FHJD 4LFAF 5L1KA 5B0CA 4Q8FA 2PA8D 3K59A 2Z2ZA 3V81B 3MPDA 1S4EA 1O0PA 2WSFC 2QT7A 4K4XA 2MZTA 2V4QA 3X3UA 1OS5A 3Q8QB 3P5TL 4ED4A 1RTIA 2OPRB 3QT7A 2ZBRA 1H98A 3BEGB 1NPRA 4FPIA 2ZM6F 2Y8WA 3WX8A 3H5UA 1NJXA 1DQ8A 2DNZA 2JC0A 3MMJA 4JV5F 1F2GA 4M94A 5KG4A 3RB4A 3NNAA 1S6PB 3D0HE 2ZH8A 1V3SA 3MDFA 3DGVA 2UP1A 1JK9B 1C1CB 2CQBA 2H4YB 3GLJA 2VZ9A 1RACB 3AJ2A 1S1VA 5DLGA 2FVCA 3IC1A 4RWWA 3SSSA 3R5DA 1DTQA 1RI7A 4WYLA 4N5SA 1U4BA 2FY1A 2DY9A 4B3OA 3IG1A 1FTRA 2P9EA 4C8MA 5FD1A 4CP5A 3W2WA 5D78A 3WC2A 1SL0A 5GAEU 4Y2IA 3BKUA 4NX9A 2JFKA 3R7BB 2CPFA 2GQCA 2IHR1 3W9IA 1RTDB 1EETA 3AB2B 3WBZA 5GMDA 1EHWA 4F02A 2VQEJ 3BYPA 5IT9Y 2FB0A 4ECQA 4TVAB 1FKAF 3CCES 3CCMS 3RU0A 2H51B 1RT1B 3BO3A 4ECTA 3UDEA 3I5CA 4RUBA 1OPIA 4C4WA 5DLFA 1WOOA 4OHVA 1OY8A 2LLZA 5HJXA 4NXNJ 1HNVB 4I7FA 3KG0A 4TQSA 4DUTA 2DH7A 1KRPA 2YKMB 3UR0A 2OD6A 5E0OA 2HW3A 2K3IA 3C15B 4ZLNA 1RISA 4KQZA 3LQVA 2EKNA 1HMVA 4JI8J 2VA3A 1HNZJ 2UXBJ 3GCXP 1Y7PA 3AJ1A 1E6VA 2R7RA 4TYBA 4DS4A 2R7UA 3RW7A 1TKXB 4AXJA 3I9ZA 2CJXB 4EYIB 3DI6A 2YWKA 4WK1A 1FRHA 2XLKA 2HNYA 1DARA 1XJWB 4DQRA 4DR7J 1JJCB 2JRSA 4NZ0A 2ZC4A 4DJBA 3I31A 3M6VA 3IMQJ 2Z2LA 3SFGA 2N4DA 2H5JB 4F67A 4CNYA 1TFWA 2XS7A 3HSGA 2WVDA 2X1AA 1NK8A 5KG5A 2RQMA 3KLGB 2V34A 3KHRA 3JB9k 3NMAA 2HFUA 4Q2LA 4I67A 1VK8A 4UQGA 3F44A 3Q2TC 2CJ9A 9ATCB 3AD8C 1NSAA 2D74B 3QYYA 2ZJQQ 3TJ8A 1QSYA 3E01B 3BYRA 2YNGA 2GGPB 4H4OA 4PUOA 2H4WB 3CJSA 1NH8A 3GR1A 2BKNA 1Y5IB 2FJWA 2Y3YA 2V0NA 5JVHQ 4ANDA 5F8JA 3I0RB 1JLGB 3BO2A 4LR7A 2B5JB 1FF2A 5EX3A 2E44A 3NKYA 1ZOTA 5DQHA 3NGTA 5CD4H 3M2RA 2XCAA 4LF6J 2XNRA 4LBPA 3OR2A 4I68A 2JSXA 4O3SA 2DHGA 4PG6A 1LKZA 4GC6A 4JI1J 2W9CA 1MROA 4PG8A 3KHLA 3JTOA 1KHWA 4WKRA 3CE8A 4F3OA 5HANA 1SJ4P 3HKZD 4FNHA 3K5NA 1YJ9S 1U26A 3IS9B 1D8YA 4DOZA 3KUHA 3AY0A 5DDPC 4B3RJ 2IYGA 1N5VA 1N5YB 3GQCA 3PDNA 2EFVA 4F0HA 3TZYA 3QO9A 4RLEA 1R0CB 4URSA 4ZOSA 2C2NA 1BQMA 2D9PA 2IBOA 3CJ8A 3BSNA 1X5TA 1R27B 4EZ6A 3TW0A 3I9V9 3K8VA 1RXOB 4DR1F 2ZH3A 1S9FA 1FJCA 3KJVA 4HHUA 4ICLB 4K4ZA 4QCLA 2HIQA 4ECRA 2AJ2A 2VG5A 1HKAA 5C7PA 3KLIA 3EXYA 2XQCA 3DOLA 4LJMA 4C3KA 4DS5A 4QWEA 3FFIB 4FP9A 1VIOA 3V6KA 2R2RA 3OVSA 4RUCA 4O4GA 2Y1IA 2G1DA 5HROB 1Q8KA 2OFGX 2NXJA 3D67A 3POTA 4OJGA 3ZZOA 3RAXA 1K9MT 4I2QB 4EEYA 4J91A 3CT9A 2AD9A 5DGAA 2V8DA 1U7LA 4OFZA 2V69A 2B6AB 1ZM9A 4CIOA 3I5AA 1P27B 3HHNB 5RUBA 2XY7A 2HAFA 4YHHF 2DT9A 1DRZA 1UW9A 3KLHB 2LQBA 3AOCA 4AT1B 4K7QA 1JLAA 1ULRA 4X62J 2HEKA 1RTHB 3DRSA 4FPRA 1VRQC 3W5XA 1ZM2A 1FNOA 2RQKA 3HHLB 2DR8A 2GVDA 5CA5A 5F9NA 2LA4A 4C3MA 3IO1A 3PO5A 4CM0A 2AJ0A 5A8WB 5LL6d 3P8BB 1SC3B 4QWAA 1SPBP 3S1TA 3QT5A 2WSCC 2CIMA 2MKHA 4EO8A 4DG1A 2D41A 2N7CA 3PRDA 2QTWA 4WKYA 3RRKA 5B0FA 4ZCMA 4Z7YA 3EYZA 3BGOP 1NZ8A 4F4XA 2UUTA 2RVJA 1URRA 1DTTB 4KH0B 2FDNA 5J2QB 2YX4A 5G4DA 2B4UA 2VV5A 5IT4A 3TVZA 3H98A 3TZWA 2QIFA 5HP1B 5H9FK 4DV5F 5GAGU 1SJRA 3ISZA 2IJFA 4HT5A 4XK8C 3B4MA 3TNVA 2UUCF 5BJRA 3UFCX 1QAIA 3CVKA 2DKOB 1URNA 1TK0A 2B43A 2XWXA 4OI2A 1M1HA 2HQCA 4NCAA 3CJ5A 2J0XA 4RW8A 4QWDA 2HURA 5DDOC 2Q1LA 3TOQA 3EZUA 1S6OA 3LP1B 3LA0A 4LUBA 1YG0A 1KC8T 4V1Ak 2ZJPQ 3A8JA 1M90T 2VQEF 2ZFHA 2DGWA 4HEA9 2XZDB 2WZ1A 4O3RA 1HW9A 5G0RA 2RF2A 1VBYA 2XMVA 1XR6A 2C1EB 3ISND 4NXNF 1JIHA
chains in the Genus database with same CATH topology
4UUWA 5AXMA 5B09A 4OI1A 2C28A 3QIPA 3D1OA 3GFHA 3OXFA 4X4VA 4CH1A 2C3YA 2KHDA 2RJZA 1VQOS 4Z2XA 4LSLB 2Y1JA 1U1QA 1OIAA 2K2PA 2J6SA 4I2PB 4URGA 2LA6A 1HI0P 2YKAA 3HJFA 3H20A 3PV8A 2ZH1A 2XMMA 1QE1A 2RB7A 3DYAB 1FTCA 4Y00A 1VBZA 4BC9A 4FF3A 1VS3A 2JEIA 2QSWA 4JI8F 1IM4A 1TAQA 4I0WA 1NEEA 4MJKA 1HNZF 2UXBF 2GO8A 2NYIA 2H5EA 4ECSA 1RTDA 1TL3B 3OXLA 2QA4S 5KFDA 1X4HA 2ZVSA 3PEHA 4PPDA 4NLRA 1Q86T 2FHJA 3G71S 2LU1A 4UOCA 3QGHA 1KQKA 1LW2A 2HPUA 2DO4A 2YNFB 5DJBA 2HWTA 4LIWA 3CJ4A 1G7CB 3KHGA 1YHQS 4BHQA 3Q8PB 2DNNA 3MTKA 3NRBA 2ZKUA 4C97A 2VPWB 1LXJA 1TVRA 2D1CA 2YVSA 2F8EX 3M05A 1HBMB 3U27A 1VQ9S 1VQYA 2B3TB 3M8SA 4EBCA 1FRLA 3CD0A 4QPTA 1HA1A 1SJQA 1IBMF 2BJDA 3VR1A 2BQ3A 2DO0A 2XCPA 2APOA 1RTJA 1QM9A 4FXDA 5A6PA 3PVXA 2FHKA 5B0GA 2CJQA 5DQIA 4WZQA 2JX2A 5M2PA 3PX0A 4AXIA 4PR6A 4DV1F 3PKYA 2GNKA 4XDCA 4DR7F 3KHHA 1HNVA 1BWEA 1RT2A 1R8AA 4ZVHA 2GMHA 1JX4A 5LSLA 3M8QA 1VLYA 4QQBA 4Q45A 2BR0A 4DEZA 2M8HA 1W2IA 4TLQA 1SKSA 1FD8A 2IVFB 1CVJA 3DLBA 2FGCA 4QWCA 1V3ZA 4HTJA 5K14B 4RNMA 3IBWA 4XPCA 1N8RT 4C3LA 2V8HA 2MQOA 4YOEA 1IJFB 2MQMA 3I96A 3MM7A 2YX1A 1UVKA 1Q16B 3T6JA 4MMOA 4N76A 4H4OB 1D9DA 2YTCA 1FA0A 4BCAA 1Q8LA 2CZ4A 3EUNA 1T05B 5IT0A 1UMJA 1IJEB 1VQKS 1S10A 3VF0B 2FC8A 2MQPA 3MUVP 4DSJA 1G2EA 3LW5C 2BQRA 3KK1A 1A6LA 2ZH2A 3NP5A 1S48A 2JHEA 4PQAA 5KFKA 2XGQA 3V6DB 2DBBA 3TRGA 1C0TB 2HFNA 3EX7B 4J9NA 2AQ4A 3DRPB 4DFJA 3CC4S 1YJRA 4OJHA 1DBDA 5FDLB 2OPPA 2KJWA 1QVGR 1U24A 1X9MA 2QEXS 3CD7A 1AW0A 2R7XA 5HBMA 2NLWA 2HRUA 3G6XA 2M0GB 1LWFA 4TYAA 3M2RB 4L6V3 3ULHA 3NAHA 4EYHB 2HMIA 3CIZA 4NRTA 5HN0A 3SZ2A 4C98A 1M0SA 2VG6B 3F73A 1VQNS 4X4QA 2LMIA 4RW9A 5ITHA 3HMJG 2ZOMA 1DLOA 3OR2B 3UW1A 3LPYA 4A8MP 5D8HB 1U49A 2FVRA 3KYLA 3NNCA 1S6QB 2R8JA 1HWIA 1Q8BA 3CF5Q 1JLBB 2FLLA 5K8MA 5KFTA 1SJ1A 1SXLA 2MPUA 5GADU 3EXCX 4YDDB 4PXDA 4NLWA 1BD6A 2HFZA 4H4MA 4DV0F 4LQ9A 4WJBA 2VKZG 3FMBA 3T5LA 4NCGA 3MR5A 2G0CA 3O5TB 1IBLF 4TXSA 4F4WA 3MUTP 3AAWB 2BM0A 2JEJA 4TN2A 3K58A 4OHYA 1N52B 2VODA 1QAXA 1S1TA 5EGYA 2MSTA 4R0JA 2QA1A 3KLVA 2W7PA 5LT5A 1X4BA 3OVBA 4ZMMA 3UCUP 4RNFA 1FT8A 4UY8T 2XS2A 2OJ3A 5AXLA 2P6SA 2D3ZA 3RB3A 2QSFA 3CWJA 1RA7A 1L3UA 4M63A 3CCUS 1NNDA 1D3WA 3KLGA 3CDEA 2ZH5A 4R5PA 3ICLA 1WEZA 1VC6A 2OPQB 3DGPA 4RWXA 2L41A 3SV4A 2JC1A 2BJEA 4JV2A 1FDNA 3QIDA 4IYQA 2NR0A 5C24A 1QTMA 4Q8EA 4LF6F 1JKHB 2ZE2A 4IFYB 5KFWA 3G6VA 4G3IA 1WNEA 4FS1A 4A48A 1TK5A 1S79A 3J7ZT 1RWUA 2E5JA 2YNHA 5GAEI 3KMSA 1QAJA 4JI2F 1Q82T 2FIUA 3MR3A 3BGUA 2UUBF 2FGOA 3BREA 2JVRA 3BSAA 4ZVFA 3QO9B 5LMNF 4JI1F 3NCPA 2JVOA 3E01A 1T03B 4B9UA 4NCBA 2WW8A 3Q24A 3RAMA 2XLIA 4HTIA 4C8ZA 2M5YA 3DXBA 2HNDB 1ZPWX 2ERRA 4MTPA 2EKYA 1G1XA 1NK0A 1RQ0A 2QV6A 2GGPA 3TYTA 1VC5A 5KAKA 3VWSA 2OAUA 3MMBB 5IS2A 3VAMA 1KFDA 3C66A 3MHYA 3CCTA 4OZ5A 1IUJA 3DDKA 2RU9A 4QU7A 4WE1B 2DNMA 3TUJC 4LSNA 2W9BB 3OL8A 4FF4A 3R1LA 3U1NA 1X5PA 5THWA 1GQEA 3RYLA 3CMES 2VBYA 5DDQC 3NS6A 1FK9B 3B4DA 2CDQA 3I0RA 2CFXA 3DLEB 3KJVB 4KFBB 3G9CA 2PIIA 4B3RF 3DOMA 2W7OA 2CG4A 5EUHA 3ENWA 4B3SF 3FEYB 2DGXA 1IR0A 2QLXA 3DHXA 1S1WB 2W9AA 2B5JA 2A2DA 3LUYA 4NOHA 2GQ2A 3JTNA 1LV5A 2CQ2A 1U48A 2J8AA 3CJ3A 4DQQA 2RMLA 3E3XA 4KV8A 2PGCA 2KU7A 5KFMA 4KT0C 3M8PB 3IAS9 2Q6CA 3DOLB 3H8YA 1RT4A 2HQ3A 3FDSA 4DN0A 4QW9A 2JLEA 5CQGA 1UEUA 1UVJA 2UXCF 4IOBA 1FRIA 2XZWA 3KLEA 4YR0A 1OWXA 1N5QA 3LP2A 4DQPA 4KE5A 5IM0A 4DQSA 4ED7A 3QAEA 1RP5A 3HHLD 5J1EA 3DFEA 4JI0F 2ALZA 4QYRA 1IKWA 2NPIA 3LP0A 3DLLQ 2GIQA 2RQ4A 1NAQA 3KWMA 1P1TA 3KK2A 1ZM4A 1F9FA 1WTBA 1B7FA 2IA0A 3FRYA 4O44A 4P7TA 1BGXT 3G8QA 5LJ3Y 2CPZA 2E5HA 4QIVA 2VL1A 3MM6A 2YH1A 3WDOA 2DNRA 3K8WA 1SUQA 3E8OA 2B51A 2EPIA 2L9NA 4DL6A 1Q78A 3DM2A 4DFPA 1WEYA 3S8SA 4NMLA 2AGQA 4GMKA 1N32F 1M5HA 5CYQA 5A8RA 3CMAS 2LDIA 4LFCF 2HWHA 3UE2A 3WC0A 1KFSA 4BDPA 2PFFB 2MY8A 3BQ1A 2PMHA 5F8NA 4BWMA 3UNGC 4DHVA 3CO9A 3OFFA 1U1KA 2RKIB 3L7PA 3P96A 4G1QA 4ZPVR 2E66A 5L39A 3NGDA 2LU2A 2VG7A 1H0HB 3DOKA 5A0YA 1BY9A 2AJFE 4CH0S 4YMEA 3OTCA 5IQQA 5EHHA 1KEKA 4XDDA 3SCKE 2E7WA 4MFBA 2W24A 2I2YA 4P2SA 2WB4A 4V19J 4O4RA 2SXLA 5FIIA 3FQKA 4OI3A 2XLJA 3BSCA 2ZH7A 4U7UK 1TKZA 5DG8A 4C11A 3I5BA 1Q4RA 4Q0BA 3NCRA 2NPFA 2F8MA 3J81Y 1N5YA 3SXLA 5F9LA 4KR0B 3BS9A 4TKTA 4WXWA 1U1PA 3T5KA 3QLHA 2DGOA 4J9RA 1G6BA 2IC3B 5L1JA 1KSPA 4Q43A 4DV2F 3S6EA 1TQLA 2ZD1A 5F3TA 2GQQA 1ZPVA 3O1LA 3SDEB 4DR3F 4JUZA 5F8LA 4IQMA 1JLAB 5A6WA 1XERA 2LXUA 3ETOA 4PWUA 1G3OA 1MWYA 4RNOA 5E5NA 2XBPA 1GXUA 2CPYA 4DV7F 4ZHRA 1FRKA 3ONQA 5BYQA 3MCSA 3ZZUA 5L8RC 2VONA 2GHVC 4OI0A 1KR4A 3GR0A 3X1LB 2OIHA 2YKOA 1XWLA 1U2FA 1VQ4S 1NHUA 4ES3A 4ZA1A 1NK6A 2XY6A 4Q5VA 1VRTB 2DR9A 4MKYA 2F3JA 3FRZA 4IG3A 2GFFA 5KFRA 4DSIA 4YB1P 1UKUA 2O5DA 3G8TA 3LWMA 4FYDA 4Q44A 1HL6A 1YGYA 3QMQA 4B9LA 1FERA 1JLEA