2CQDA

Solution structure of the rna recognition motif in rna-binding region containing protein 1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
116
Chain Sequence
GSSGSSGMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the RNA recognition motif in RNA-binding region containing protein 1
rcsb
source organism Homo sapiens
molecule tags Translation
molecule keywords RNA-binding region containing protein 1
total genus 14
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqdA01
2DNPA 3D2WA 1RK8A 3MURP 1WHWA 3P49B 4ZKAA 3UD3P 3CD6S 3CCRS 3TO8A 2DNNA 4F25A 2HGLA 1KD1T 2DGOA 3VAJA 3Q2SC 2AYMA 3EX7B 3VAKA 1L3KA 1XN9A 2LEBA 1WHXA 3UD4P 4TU9A 1CVJA 4WCEQ 4Y00A 1ZZNA 1U1NA 1WF1A 2HGMA 2J8AA 2MKHA 2MB0B 1FT8A 1QVGR 1U1OA 1JJ2R 2OJ3A 2J0SD 1OO0B 1QVFR 2DGTA 5GAGU 3CF5Q 1HD1A 2OTJS 1WELA 2U1AA 5H1SV 1YWXA 3BS9A 3I55S 2CPXA 2AYEA 2N82B 3CCLS 4CQ1A 3G96A 3HHNB 4WIIA 3K0JA 4TU7A 3PIPQ 3I56S 2ZJQQ 1VQPS 2AYBA 3U1LA 1YHQS 2MSTA 4C7QA 1X5PA 2AYGA 1FHTA 1R8HA 5DDOC 2DNYA 1X4FA 2XS5A 1WEZA 2KRBA 1X4BA 2CPEA 3LQVA 4ERDA 2HGNA 1X4GA 1U1KA 2KYXA 3RW6A 2L9WA 2MKCA 5JVGQ 4PR6A 2DNKA 1AUDA 2CQ3A 4WFAQ 1S72S 3N9UC 2VONA 1U1QA 1NO8A 1WI8A 2O3DA 1WF2A 5LXYA 2RT3A 3CCES 2RRBA 3BEGB 2RRAA 2ADBA 1DHMA 2X1FA 1YTYA 1OPIA 2KT5A 1KOOA 3R1HA 3MDFA 2YH1A 1WEXA 1YI2S 2E5HA 4A8XA 2HVZA 3P5TL 4CH1A 2QA4S 2AD9A 1WEYA 3U1MA 2J0QD 3P3DA 1X4CA 2DIVA 2ERRA 1DRZA 2M88A 3CCMS 3R27A 2LECA 3CUNA 3VAHA 3ZZZA 3VAIA 4IOCQ 2DO0A 1HD0A 2KH9A 2DGXA 2KVIA 2DHAA 3S6EA 5D78A 5CXTA 1U1LA 2CPIA 2LQ5A 2FY1A 2MQQA 1VQOS 5IQQA 1U1MA 2LKZA 2DGUA 3P6YC 2CQCA 1X5TA 2SXLA 2DGQA 2DNZA 2RS2A 2DITA 3G8SA 2M7SA 1M5OC 2CQ4A 1WG5A 4QQBA 4BS2A 3CCUS 2BZ2A 2DB1A 3TYTA 2MXYA 2DIUA 2CPFA 2MKJA 2CQ2A 3Q2TC 1H6KX 2M52A 4WF9Q 3CCJS 5JVHQ 5LSLA 4FXWA 1M5KC 3NMRA 2LA4A 2MY7A 1KQSR 2DNLA 2WBRA 1UFWA 5HL7Q 2D9OA 1IQTA 1FJEB 5ITHA 2LYVA 1X4AA 1WI6A 2MMYA 3H2UB 3JB9k 2MQMA 2MZSA 2DISA 5DDPC 2CQBA 3S8SA 1X0FA 2I38A 1WHVA 2JVRA 1SJ3P 1U2FA 3MXHP 2D3OR 2EK1A 2CQ1A 1VBXA 4UQTA 1G2EA 2F3JA 1M5VC 2DNGA 4WFBQ 3UCUP 4TU8A 2CQDA 5DM6Q 2CPHA 3J7YU 1K8AT 4RU2A 1NU4A 1H2TZ 3NNAA 1O0PA 3G71S 2ADCA 3J7ZT 3B4DA 3ULHA 1S79A 2ZJPQ 1DBDA 1VQ9S 2DH9A 4IUFA 2M0GB 1PGZA 4W92B 2F9DA 2PE8A 1PO6A 1FXLA 2LXIA 4M5DB 2DH8A 1H2UX 2MZQA 1VQMS 1VQ7S 1VC5A 3BO3A 1WG1A 1P1TA 2D9PA 1OIAA 5IM0B 3NNHA 4J5OA 1WG4A 2U2FA 2YWKA 3V4MA 1QM9A 5FJ4A 2CQPA 4YUDA 1Q81T 2VODA 2MYFA 3OW2R 1SJRA 2MSSA 2E5IA 1URNA 2DNQA 3H2VE 3SXLA 2OTLS 1VBZA 2RQCA 2MPUA 1VQLS 2XS7A 3THTA 1FJ7A 2F9JA 2V94A 2X1AA 3UWTA 2BOPA 3CC7S 2RVJA 2YH0A 5DETA 2MZ1A 4UY8T 2LMIA 3CMES 3LPYA 2X1GA 1B7FA 5LJ5Y 5IFMA 2LCWA 2KM8B 2QEXS 1UP1A 1F9FA 1BY9A 2MQNA 5GAHU 1JMTA 1UW4A 3CCSS 1ZZFA 3EGZA 2FHOB 4C0OC 3BO4A 2DHSA 3UCGA 3CC2S 1X5SA 2VOPA 4W90B 1U1PA 2DNMA 5HO4A 1FJCA 2RNEA 2DGSA 4OZ0A 2XB2D 3NS5A 1K73T 1YITS 2VOOA 2MQLA 1VQ6S 2E5JA 2KN4A 2E44A 2MZRA 1JJ4A 4WKRA 2DHGA 3G9CA 2MGZB 2E5GA 1Q86T 1JJHA 2CPDA 2UP1A 1OWXA 1ZH5A 2MQOA 2MGZA 1U6BA 2Q79A 1FNXH 2JVOA 2X1BA 2LXUA 4CH0S 2L08A 2MKSA 1SJFA 3NS6A 3DXBA 2GO9A 2CQIA 2RUGA 2OSRA 5GADU 2NZ4A 2JWNA 5DDQC 3CCVS 1SJQA 2KRRA 2KG0A 3CXCR 2GHPA 1U1RA 1X4HA 1VC6A 3PIOQ 4TLQA 1R8PA 1Q82T 2KU7A 1DZ5A 2KXHA 3MD3A 5CYJA 1A7GE 2KXNB 2M4MA 2G1DA 2JRSA 3VALA 1WTBA 3FEXB 5LSOA 5GAEU 2DGWA 2CQ0A 2OIHA 4QPTA 4PRFA 4Y0FA 2DGVA 1KOHA 2G4BA 3G4SS 5DDRC 5GVQA 1VC0A 1VQ5S 4QU7A 3TP2A 3BO2A 2M9KA 2LEAA 3S7RA 1M5PC 2MHNA 3G6ES 3EGNA 3CC4S 4IOAQ 2N7CA 1RKJA 4FXVA 1VQNS 2YKAA 3HI9A 2M8HA 3SMZA 2KG1A 2M70A 2OSQA 1KC8T 4EGLA 2A3JA 3L3CA 2DK2A 3DLLQ 2CQGA 1WWHA 3MUTP 1M90T 2MKKA 2J76E 2I2YA 2KI2A 5DM7Q 2M2BA 3THPA 5D77A 4LIRA 3FEYB 1Q7YT 1WHYA 3B4MA 1YJWS 4YB1P 1FO1A 1D8ZA 1NJIT 3CPWR 1YJNS 2FC8A 3CMAS 1X4DA 4Z2XA 3ZZYA 4WFNQ 2MKIA 5IM0A 5LJ3Y 1X4EA 2KHCA 2MY8A 4CIOA 2NLWA 4V19X 3IRWP 5EN1A 2QFJA 2EK6A 2RQ4A 2MJNA 1VQ4S 3CCQS 4U67Q 3CULA 2K8GA 2PEHA 2M8DB 1U6FA 1SXLA 1YIJS 2DO4A 3RW7A 3SDEB 1M1KT 4P6QA 2LA6A 2N3LA 1N54B 4OZ1A 2MZTA 2CPJA 2K3KA 2DNHA 1HA1A 2FPHX 3MUMP 2HZCA 2MJUA 5MLCV 2CPYA 5GMKa 2MQPA 2XS2A 1N8RT 3IWNC 3MOJB 2CJKA 2CQHA 2B0GA 1UAWA 2G0CA 4ED5A 2ZJRQ 3MUVP 1X5OA 1A9NB 5LXRA 2JX2A 2KFYA 3S01A 2HYIB 4LJMA 3VF0B 2FC9A 4F26A 2EVZA 1N88A 2RS8A 2XSFA 2MZJA 1VQ8S 3US5A 5BJRA 1W2BR 4C4WA 1D9AA 2RU3A 3UE2A 2DH7A 4YOEA 3SDEA 1SJ4P 1N52B 3VAFA 2KM8C 3UCZP 2N3OA 2XNRA 4IO9Q 1H2VZ 1VBYA 2XNQA 1WF0A 1YJ9S 4QU6A 2DNOA 1VQKS 3CTRA 1HL6A 1K9MT 3G8TA 1P27B 3MD1A 2KXFA 3VAGA 4F02A 2DNRA 3VAMA 2DHXA 3R1LA 4PKDB 4LMZA 3MI7X 2L41A 2YTCA 5CA5A 2CPZA 3NNCA
chains in the Genus database with same CATH superfamily
1FWPA 5KFMA 3RU0A 2LEBA 2E1MC 3T41A 3P49B 3E51A 1UMJA 3UD3P 3POTB 3QATA 2VV5A 4QR2A 1YX2A 1CBKA 2DEIA 3L4BC 5E3PA 1WKLA 3UFCX 1TAQA 1URRA 2GJ2A 3TO8A 1AW0A 1KEKA 3W1YC 3GFHA 4X4VA 3E2EA 1U47A 1VHFA 4OZJA 3VAJA 1LW0B 2V67A 3Q2SC 2UVUA 4NLUA 5J1EB 1OY9A 2RAQA 2AYMA 2NXCA 1VBXA 3AH6A 2CNNB 3MR6A 3AQPA 4MK7A 4FS1A 1XN9A 1JLEB 1WHXA 2IDLA 5CYMA 3UD4P 2CWXA 3M30A 1CJKB 3AD7C 1K44A 5BR8J 1WKKA 3PFOA 5F8LA 3HJFA 4NEZA 3NGTA 4LSNB 1ZZNA 3UW1A 5HK4A 1WF1A 4KV8A 1U1NA 1TKDA 2MB0B 2IAJB 5KFIA 5M2UA 4XO0A 1QVGR 4K4UA 4W98A 3QZ8A 2VFRA 1S9EB 5LL6d 4J9RA 1OO0B 2OEJA 2MQ8A 2WONB 4O0IA 5KFVA 1BC6A 4DHVA 3GJQB 2XYHB 1RLDA 4OYWA 1VLOA 4ZDNA 2D69A 1HD1A 4WE1B 4OZ2A 3BYPA 4GKKF 2W25A 3P45B 5E3CA 3GILA 2YKPA 1YWXA 2CJ9A 3MMCB 5LT5A 1YBAA 3I55S 2BDPA 1K0VA 1XTZA 1FDBA 1S6PA 4EI2A 2O1PA 1CS4B 1HLWA 1N5QA 4NXMF 2HNYB 1PBUA 2EG2A 2QC3A 3OTOJ 4ED7A 1IUJA 1LFWA 1RT7A 3DXSX 1GT8A 3IS9B 4RW7A 1RAFB 2R8KA 4PAAA 1YJUA 4DR7J 2AV5A 1HNIA 2GQCA 7FDRA 1S1XB 3ZZOA 1HBNA 1SUQA 3NL0A 2YX4A 1RT1B 3I56S 2ZJQQ 1F9HA 1TL1A 2UUBJ 2B9WA 3Q8RB 1OPZA 1TL4A 4PXEA 2BM1A 1X0PA 2HNZA 2OD4A 4C7QA 4A4JA 3IBFB 4AUKA 2C2NA 4YY3F 1S6QB 2B6AA 2DXEA 3LA0A 1R8HA 4KH1B 5DDOC 2DNYA 3QRQA 2JEIA 4HT5A 4LF5F 3F56A 4DX8H 4QWAA 3V4IA 4O3RA 1WEZA 5C25A 5KG6A 4DV0J 4RNOA 3ISND 3N5FA 2HGNA 2E1CA 1O5JA 3W65A 1H7WA 3AA9A 3KK1A 1FKPB 2WRMA 3W5YA 1JNRB 2F1FA 4IYQA 1QJHA 2YKQA 1RZMA 4DQPA 4ZHRA 2L9WA 2ZNZA 3B8HA 3QT7A 1RWMB 2MKCA 1RWOB 4TQSA 3I0SB 3LO3A 1FESA 3BBBA 5J2PB 2DNKA 1BQMB 3ET6A 2CQ3A 3OBIA 3IBWA 2CXEA 5EWEA 4WFAQ 3TUPA 3OTBA 1UETA 4QR0A 3CCWA 1TMMA 1JLQA 1U1QA 1N5VA 3GYGA 1NO8A 1NUEA 3G86A 1RTHA 2GGPA 2I1RA 5HBMB 5LXYA 2RT3A 4X4OA 3MPVA 2ZC4A 2V8PA 2XMVA 1LKZA 2XSJA 3BEGB 4OQJA 1RBAA 4DPWA 4ZPDA 3F41A 3NOGA 1DHMA 2KDOA 2ZOFA 1BMQB 5J2PA 1YTYA 3D6FB 1XBWA 1N6QB 3JQMA 1SKWA 2I6WA 2V9WA 5LMUF 1LXJA 3DC2A 1KOOA 4OI4A 3E8OA 3KJFB 3MMJA 3MDFA 4MFBB 1HIYA 5D4NA 4PG8A 5H9EK 1T9UA 2UU9J 4A8XA 3KHHA 1UEKA 4U7UK 4KTQA 1NSPA 2J0QD 3U1MA 1MMNA 1X4CA 3O44A 4R0EA 1R7IA 4X65F 4KYZA 1FXDA 1SV5B 2M88A 3R27A 4WTOB 2XLIA 2LECA 1DRZA 1RT3A 3MM8A 2LDIA 3GIRA 1S1WB 3BQ2A 3CUNA 2DPIA 4KRWA 3BSNA 3A1YG 4DV5F 1SH3A 3IAS9 2OELA 3HT3A 4IOCQ 4GRSA 2KH9A 3HHLB 4Q2LA 3FBFA 4RR5A 5E3RA 1RBLA 4X62J 1RU1A 1S6OA 3IR7B 3GYNA 1GMWA 1NH7A 2HIQA 2LDYA 2NUUG 1X9MA 1VQYA 4N8NA 4ZP6A 4K4VA 1MMLA 1YSJA 4FNIA 4FXDA 3NGSA 3NWGA 1HBOA 3DFEA 1GXUA 4OI2A 5IQQA 1XERA 2DGUA 2CQCA 5KFOA 2UXBF 1JKHB 3PY8A 4DFMA 3KLFB 1UFKA 2DGQA 1ITPA 5B7WA 1FWLA 1PJ5A 5F8JA 4KHPJ 3O8WA 3A3PB 1S4EA 3NRBA 3IS9A 2DITA 2JJ4D 4PG7A 4IRDA 1U8SA 2FQQB 4GKJJ 4DCPB 2VDIA 4LSNA 4NLDA 3CCUS 2DB1A 4PUOB 3CD0A 5C7PA 1TL1B 2DIUA 3TJ9A 2MKJA 3Q2TC 1Q16B 1BQNA 4Y3CA 1UPPA 1N0VC 3QAUA 3ISNC 3OJUA 2QTWA 4FXWA 3Q23A 3L7OA 2YPYA 3NP5A 1RT5B 3PKYA 4A8QA 3D6MB 4ZITA 3WC2A 4AT1B 2JC1A 1FEHA 1IBCB 4ENOA 1UFWA 4TY8A 5HL7Q 4DSLA 3ZTPA 1CULA 4ECZA 4ED4A 1IXKA 4G3IA 2GHVC 3MM5A 4UY85 4NL5A 2DISA 2CQBA 3J81j 1X0FA 4H4KA 2I38A 1WHVA 2OMLA 3R9LA 3UPFA 1U2FA 1VC5A 1CJUA 1NK9A 2D3OR 2EK1A 5J2QA 5IOLA 2CADA 2CQ1A 1UTAA 2HVDA 2F3JA 2OPRA 1E6VB 4FVMA 2DNGA 1C4CA 4DQRA 3UCUP 5FD1A 4TU8A 2PI4A 1GAOA 3I5AA 3C19A 4ZLNA 3J7YU 2RF2A 2XMJA 1PJ6A 1WUUA 1Y9OA 2CAJA 2RKIB 1AA1B 2I8EA 3DYAA 3FFIA 3LALA 4UTGA 2XMUA 3M30B 3RGIA 4BBYA 3DYAB 1RT4A 5J1PA 1YZ7A 2OI2A 2JC0A 1RI7A 1AT1B 1HMVB 1R6VA 2XYPB 4RWWA 1KLMA 1U6ZA 5KT3A 2R7UA 3ULHA 3GG1A 4C6AA 4NCAA 4ZK7M 1HWLA 1MSWD 1VIOA 1D0EA 4I7FB 2ROEA 2XBPA 4WFXA 8AT1B 1W25A 2QE5A 1DBDA 4B3OB 1U09A 5B09A 1FE0A 2W4PA 1VOMA 2M0GB 2KZZA 2Z8QA 4KPYA 4LFAJ 1TL7B 3ADAC 3CO9A 3JXOA 1SPBP 3G82B 1RCOB 4Z7CA 1U48A 1N32F 2R7TA 4D3HA 1OIAA 1S7IA 2CJYB 3MF5A 1Z4UA 3NNHA 4RWXA 3MMCA 3EICA 4RUBA 4X64J 2HHHF 3CT9A 4F4XA 3M8YA 2U2FA 2OO4A 3OL9A 3N6LA 1SKUB 4ID5B 4YFUA 3FQLA 2F40A 4YUDA 4U7CA 3OL8A 4LF6J 2YWFA 2MSSA 2E5IA 1BE4A 3DRXA 5KFQA 1VQSA 1RHKB 2CVEA 2C28A 5KT2A 1UJ6A 1RA6A 4DV2F 1VQLS 1KLNA 1Y5IB 1KR4A 1FJ7A 1NHUA 2OP5A 3OXFA 1T05B 1U45A 3KWMA 3JQKA 5AJ3J 2X1AA 1SC6A 1Q4RA 3ICLA 1KQFB 5K8NA 4ZN1A 1XC9A 3CD5A 2C2RA 2UXDJ 2ZH6A 2LMIA 4J37A 4S0MA 2YNIB 1QAIA 2Q1LA 3PRBA 1HMVA 5LJ5Y 1R8CA 4DR1J 4OX6A 3PRVA 3OT9A 2CRLA 3QGHA 1MN7A 4CP5A 3D6HB 2KM8B 2BJ8A 4ELTA 4RW6A 3VGSA 1UP1A 4DR5J 3KG1A 1F9FA 4CWBA 2KKHA 4HH0A 1LWFB 2MQNA 3CNQP 4LR7A 4QCLA 3AA8A 4P72A 5GAHU 2BRLA 1MW7A 2K06A 2QLXA 2R8IA 1S76D 3CCSS 4FYDA 2PDAA 4M5MA 5CABA 2EEYA 4FZVA 1T03B 1F5BA 3AOBA 4R0JA 4LFCJ 1D3WA 3WBZA 3PR4A 2DHSA 3CC2S 4EZ9A 2LQJA 1TKZA 5T41A 3JQJA 4DL6A 1B3TA 2CUYA 2XGQA 2B43A 2UXBJ 1FJCA 2RNEA 3M8SA 3W5XA 3B82A 3FSYA 3NS5A 1YITS 4KB7A 4J91A 2AZ1A 4I6YA 5EX0A 4F3QA 4UOCA 1T9WA 1VQ6S 5IV3A 4EK2A 2E7WA 4BCAA 3KKFA 3PRDA 2VC1A 2MDAA 3OFEA 2ZOMA 3QGIA 5IXUA 4QWDA 3TARA 4NCGA 3G9CA 1KSPA 1UWBB 4KO0B 2IDEA 3JSMB 3O3LA 3KLFA 2E5GA 5DO2A 4BWMA 4OZLA 3TAPA 1OWXA 2IVYA 2IFXA 2C3OA 3QSYB 5CH7B 1HQEB 1YGYA 1Y10A 2XG8A 2DEJA 4CLUA 3R2CJ 1RAOA 2BJDA 2HFUA 3OTCA 3D0GE 2VZ9A 3CCES 2BBEA 3DLKA 2LXUA 4CH0S 2MKSA 4G1QA 3GV7B 1PILA 2EI5A 3DXBA 4M5HA 4AXJA 4F0MA 5KFKA 3FGVA 4D3GA 3HHLC 3MMAA 2JDJA 2JWNA 3MM5B 5C24B 3OFGA 3U7JA 1DQAA 4F0HA 1NJWA 1TK5A 4OZ5A 3DMJB 4CNYA 4CLPA 2GHPA 2HBZB 3BN4A 1U1RA 1T8EA 4JV2A 2W2OP 1R8PA 3DN9A 1MU2A 1NHVA 5B0EA 4ZPTR 4CM2A 1FK9A 3MD3A 3O5TB 3OR1A 4DX6A 5CYJA 4FF4A 1CJTA 1IWGA 4I56A 1URNA 4BLGA 1AB8A 2N4CA 2G1DA 2UV8G 2H1YA 4O44A 3PO5A 4GC7A 3I87A 3HZEA 2ZHOA 2I5JB 3DLGA 4JI6J 1EIYB 2DGWA 2CQ0A 5IT4A 2OIHA 4QPTA 4P75A 3HP6A 3RTVA 4Y0FA 3T1AA 2DGVA 2HRTA 2L9NA 4CT9A 1N6QA 4ELUA 4KAIA 1AZSB 2C2DA 2BANA 3AAWB 4DV4J 2DKOB 3M05A 4UF4A 1ELOA 3Q8VA 3LWLA 1AUSL 2QL7B 2FJXA 1H3DA 4JI4F 3M32A 4YR2A 1VQ5S 5A8WB 2NYHA 4DL3A 1F60B 3DM2B 4QU7A 3HSDA 2BA9A 2NPIA 1M5PC 1UCNA 2MHNA 2PO4A 3L9ZA 5G4DA 4RUAA 3CC4S 4KT0C 5F8MA 2V4QA 1S1VB 3HT0A 1VQNS 4L73A 3ZTRA 3HI9A 4UZBA 1P9YA 3SMZA 2AGQA 1SV5A 1KC8T 3VCDA 5IS2A 2AEFA 4Y2KA 3OHAA 3L3CA 3KK1B 1FX2A 2HK2A 3HFKA 3TQEA 1NLKL 4FF3A 5SUHA 2W9CA 4ES2A 1G7CB 2VG6B 1ZM3A 2CVIA 1NK8A 1OYDA 2W8LA 2W2NP 2W01A 4X66F 2RDJA 2L3MA 1K1QA 4KY3A 1EX8A 4P2SA 1R0AB 1LOUA 1TV6B 4NXMJ 2QA2A 1N34J 4URGA 1VFJA 2ZC3A 5HVGA 5F9NA 3D0HE 1GEHA 1S5ZA 5HBMA 2V2ZA 3CJQA 5L9XA 4WYLA 1Q7YT 5D0RA 2RHQB 1FDNA 3M9MB 1YJWS 1FXRA 3ONQA 1RAJA 2WVBA 3CMQA 4OIXA 6AT1B 1EETB 4IDKB 2ZKUA 4DSEA 1NJIT 4OHZA 5HJYA 3KJQB 2V2QA 1M0SA 4RNNA 2FC8A 4DG1B 3W9JA 3OJSA 4UOFA 3ENAA 4OZNA 3ZZYA 3ZNUA 4A8MP 3R5JB 2NZCA 2HBRB 2MKIA 4MTPA 5IM0A 2VA3A 4ILRA 1T03A 4ILLA 2VDHA 4WE1A 5EWGA 1OMSA 4DQIA 3P4UB 1IBLJ 4JI7F 4OZ3A 1N32J 3GSIA 4V19X 2BQ3A 4DUYJ 1V3RA 4I67A 2ZZTA 2RQ4A 2MJNA 4G6VB 5DRKA 3CCQS 4O3PA 2KL8A 2EFQA 3C14A 1SC1B 1RT2B 2VBZA 2QA4G 5L1KA 2NREA 3IAM9 3M2UB 3R8YA 4CLFA 3PW2A 2M8DB 4C3LA 1SXLA 2MHEA 3HVTA 2RDIA 1V3SA 3RW7A 1M1KT 1IJFB 2GAGC 2CJBA 2LA6A 1YBUA 3K7RA 2M5YA 4A48A 3N5BA 5FIIA 5KFNA 2BQUA 2VA2A 1OSCA 2MZTA 3QJPA 2K3KA 1E6VA 2VL1A 4H4MA 2BJ1A 3IA0A 1HA1A 2EKNA 3PVXA 4PCQA 5CCMA 3MFIA 3E01A 3LGNA 2QMUB 4I6WA 2ZH4A 4HYKA 1ZYQA 1I94F 3B54A 5ETVA 5KFZA 4DDFA 4KE5A 4OHVA 1NSAA 3DOLB 4RL1A 5L1IA 1JB0C 3PYGA 4RU9A 3RR8A 3IWNC 4K4SA 4DU7A 3W63A 2RD5C 4Q8EA 4ZP7A 2J0XA 3EM1A 2G0CA 5CAAA 3MMAB 3FBEA 1SIZA 1ICEB 2HVEA 2WONA 3MEGA 3CDAA 2JX2A 3KHLA 1NSQA 4LJMA 5L1LA 4DMZA 3G82A 1S1VA 4P52A 1HBUA 3KUGA 5DQHA 1N88A 5J2MA 2EFVA 2YQ3A 2OPPB 4O3SA 3DU6A 3MM6B 4W4MA 4I6AA 3KHRA 1W2BR 1HPZA 2B4OA 2E9ZA 2QJ3A 1FTCA 4B3RF 2ZBIA 3DLGB 3WHIA 3I9ZA 4C4WA 5F8HA 3FBBA 3NKYA 2YQ1A 1PCAA 1UL3A 2VIHA 2V8DA 2ABYA 3BGRA 4A8FA 4M5IA 2BANB 3TUIC 4QYZJ 4JI0F 3BB5A 5DLGA 4WFYA 4XAKA 1D8YA 4YOEA 3T19A 3VAFA 3U1NA 2HWHA 2KM8C 4WP8A 3PHEA 2NXJA 3M8ZA 2N3OA 3UCZP 1FRKA 1JLEA 4CLTA 3KMQA 3VZIA 4DUZF 4EFAC 2YNIA 3EDRB 3D3BJ 2FY8A 3OR2A 5IZHA 3P5BP 1FRXA 1SQGA 2BYCA 2CYYA 2ZDPA 4ECYA 8ATCB 4OL8A 4AL7A 3V5RA 2QV6A 3ZZRA 1D9DA 2FB0A 3BGFA 3MHYA 3G8TA 2FJAB 1QUVA 1P27B 3MEEA 4I1TA 3PCOB 1JQGA 5HQLA 3RBZA 4B9UA 2HVHA 2V2VA 2N4DA 4F02A 2P6TA 2LVWA 4M5DA 1VDHA 2WBMA 2APOA 1MWYA 4PKDB 4JOUA 1J5OA 2DR8A 4LF7J 3MI7X 4PG5A 3VGTA 4OYBA 3T1YF 1I94J 2F8HA 1I51B 4N77A 3LTOA 4OYZA 3SZ2A 2G2ZA 1RK8A 3T1HJ 1WHWA 2A6OA 3QQCD 2Y0SD 3CCZA 4IFVA 4TN2A 2AGOA 3CCRS 3RR7A 2GVDA 1TKXA 4OFZA 4KHRA 1NMEB 1WC1A 2O67A 2IVMA 2AEJA 4ZN3A 5K8OA 1CJVB 2WW4A 4F25A 5HROB 4B3RJ 1AZSA 3SYZA 3ZZUA 2DGOA 2B56A 4G1IA 4LR9A 3T9ZA 1ZETA 3RRGA 2OPSB 1KRPA 3DOMB 4DPOA 2LEPA 4ZJOA 3C8YA 3H20A 3EX7B 1TUWA 4J9KA 5BR8F 4C97A 5J1EA 2QLJB 2AF6A 3IR6B 3MPUB 4MAKA 4OYAA 4CO1A 1HQUB 2V4RA 4MK9A 3SV3A 1CVJA 4URQU 1IJEB 3K5LA 2R7OA 2XWXA 2UXCF 3IN5A 2PN6A 5HATA 5F8GA 3KLHA 1JX4A 2QG9B 2J8AA 3W62A 4M1KA 3QJLA 1FT8A 4WK1A 3K8VA 4ZCLA 5C24A 2WSFC 3A8KA 5GMEA 2J0SD 3CIZA 1L3VA 4LSLB 4I69A 3D1QA 3QGGA 2M3DA 4C8MA 3QIPB 2HLUA 3TR5A 1S9EA 5EHHA 5I4MA 3FSIA 3CF5Q 3FKBA 5J2NA 2ASLA 4JI4J 3MMBB 4OYIA 3KLGA 3JSBA 4CO0A 2U1AA 5H1SV 3EUNA 1B0VA 3R6GB 4DFPA 1QDUB 2Y3YA 1EQMA 2R9LA 3NXZA 1NJXA 3MPDA 2AYEA 4USKA 3FMBA 2AIRB 3D1OA 2IM1A 5ADZA 5LSRA 1SBRA 2JFKA 5IQ6A 3G96A 4DV6J 2RH3A 4WIIA 1KLMB 5AXKA 2IMOA 3UQSA 3CJRA 4LRFA 5GAGI 3TVZA 5DGAA 3MAAA 4CDIA 4TU7A 3PIPQ 5D15A 2R2UA 3U1LA 2AYBA 4QIWD 4DR7F 2R7QA 1YHQS 1TKTB 1GX5A 2RF2B 1LFPA 2VBXA 3W3SA 1EP4A 2G1HA 1IKWB 5KFLA 1FHTA 3MCMA 4F4ZA 3G87A 4JV5J 2BE2B 1KHWA 3UR0A 3HLUA 2BM0A 1SH2A 3DGPB 3DI6B 3ENQA 4NI2A 4X4SA 1X4FA 1JJCB 5E3QA 1ZS6A 3PJ9A 4JI3J 1G6BA 2KRBA 3DGPA 3BSOA 2YX1A 1X4BA 1JWWA 1NM2A 2DTJA 2VC0A 4HEA9 4O4RA 1X4GA 2DHHA 3BBCA 4C11B 4ES3A 4UT4A 4ZLJA 3F73A 1FVSA 1FVQA 2N7YA 4ZIWA 1YDLA 3ITHA 1RCXB 1ZA1B 3M6VA 4OI3A 5D4PA 3J80Y 4OHYA 3PHTA 2NUHA 2Z30B 3FNNA 4O4GB 1P1LA 2E1RA 2IM2A 3OTDA 3I0RA 3W66A 4ELVA 1HNZJ 2CZ4A 1S72S 1UVLA 3R7NB 3LP2A 4WTYA 3D4JA 4NLVA 4OX9J 5FLXU 1RADB 1WI8A 2AJ2A 4ZVTB 4Q44A 2XY5A 3W2WB 2ALYB 3HFVA 2DRBA 4C3MA 4LRAA 3UN5A 2E66A 2HFSA 1FJGF 1CJVA 2OEKA 3KOAA 4YHHJ 1OJ4A 1GMUA 4ED2A 2X1FA 1KVKA 3GV8B 3M9NB 1SIWB 3IWLA 2JEGA 5B0BA 4Q0BA 2YH1A 3HO1A 1UZHA 3SV4A 3HPOA 2IMWP 1LWXA 1Q8LA 2HVZA 2AJ0A 3KJVB 3SCIE 3MM8B 3P3DA 1HWKA 4CO3A 2DY9A 1QE1A 5A8KB 2ERRA 4TY8B 3CCMS 1Q78A 1U2CA 3VAHA 2XWYA 4NX9A 4MKAA 3S1TA 1REGX 4YP3A 3KK2A 4TY9A 3ZZZA 3IFEA 3KK3B 4QJVA 2R7WA 3N6MA 2LQ9A 4LVOP 3WC0A 2QL9B 2KTQA 5HQ8A 4RKUC 5E2QA 2KVIA 4LF8F 5E3AA 1TFWA 2BXJA 3WX8A 2XC9A 3AODA 2LU1A 3EXYA 1PYTA 3S6EA 1QSLA 2R8HA 3UNGC 1U1LA 2XULA 2CPIA 3UDVA 3P8BB 3W7BA 2LQ5A 2HRYA 1EKSA 2NXNA 2YNHB 1BHNA 5KOXA 2MQQA 3ZXWA 3A8IA 4DV6F 4Q8FA 3TZXA 3VVTA 1QSYA 1VQOS 1CSJA 3EPGA 3DRSA 4PABA 2CDRB 2H51B 2UXDF 3P6YC 2SXLA 4K4YA 1Q5VA 3TVYA 1IQZA 1CC7A 1RAEB 1XR5A 2VG5A 3KG4A 4DR3J 1DY3A 1JKHA 5D0EA 1VRTA 4RBUA 1JXVA 2GA7A 2VG5B 5CZXA 4B3MJ 3G8SA 3FRYA 3UDCA 1IKXA 2LXFA 4NYOA 4QQBA 4BS2A 2V4JB 2HHXA 1R0CB 3TYTA 4RNMA 2MXYA 2W2PP 2MLZA 2ATCB 3M1VB 2BABA 3IP0A 3LP0B 2XTJP 5FDLB 3W64A 4N8OA 1U02A 4UUWA 3R97A 2ASDA 2J6TA 1KQGB 4OHXA 1FFWB 1W7WA 2QA1A 4HLBA 4BWJA 4A8WA 2LA4A 4TLRA 2UXCJ 4LRBA 3MWBA 4WWSA 4XDCA 2WBRA 4ZPWR 4ZMMA 1Q79A 4JI5J 1JXEA 2LYVA 1VHIA 1WI6A 3H2UB 1NAQA 3FEZA 4I2PA 4NA3A 2MZSA 1KHVA 3MCSA 1N36F 3GPAA 1U24A 1U0SA 2QRRA 3G2XA 4TVAB 5KFRA 1NDPA 3MXHP 1NB7A 4KGKA 4TQRA 3HKZD 4UQTA 5KG5A 2E7XA 3CDBA 3CJ8A 1RE1B 3JTOA 4E0DA 2ATLA 4JI3F 2J9CA 2BKOA 4OX7A 4QIGA 3KMSA 3V6HA 2WCXA 1K8AT 1HWJA 3PACA 1NU4A 1H2TZ 4HTIA 4AXIA 5KFWA 2B51A 1O0PA 1LWEB 3M8WA 4P7TA 3EXCX 2ADCA 1X60A 1S1XA 3C46A 3J7AN 1YJTA 5I42A 3DRPB 2JNJA 3SQOP 2ASJA 4NZ0A 2KHDA 4P73A 4URSA 5H9FK 2WTFA 3B78A 1OYEA 2DH9A 1VQ9S 3DM2A 2AU0A 2F9DA 2PE8A 3NCQA 4ZP9A 1PO6A 1KTVA 1FXLA 2XLKA 2CDQA 2HFVA 1Y00A 2R2TA 3KJVA 5HANA 1BWEA 5IM0B 2IC3B 5AT1B 2HMIB 3ILLA 2D41A 4J5OA 2YVSA 5L9NA 2R7VA 1QUPA 2IM0A 2B8PA 2EW9A 5EGYA 4FVCA 1QM9A 2C2ZB 4USWA 3H42A 4B3TF 4ZVUB 1UZDA 4DV2J 1UJ4A 2MYFA 3GJTB 4PWUA 4K0KJ 1CLFA 2B4PA 1HPZB 3NS7B 2HQGA 1F9EB 3TW0A 3UN3A 3SXLA 3TI0A 2OTLS 1VBZA 2MPUA 2XS7A 1RT1A 1A0OB 2E1PA 2VFTA 2X7IA 3THTA 1HYSB 5U47A 1TR0A 1YJ7A 4YR0A 4KO0A 1RWKB 1IBKF 4CM0A 1FNOA 4JI2F 4X64F 1R0AA 2BACA 2F5GA 2PMWA 1K47A 1F5CA 5DETA 2HURA 2ZWPA 3P96A 4MYTA 2R7RA 2NPFA 3MECB 4UY8T 3DLHA 1R89A 4NI2B 1NHKL 2IBOA 2XMKA 3CMES 3NGKA 1QE1B 2GX8A 3LPYA 5A8KA 2X1GA 1TELA 1B7FA 2LCWA 2XLJA 3EPIA 2GJFA 2OMOA 4RJVA 4B3OA 1I6JA 3GR1A 5CYQA 2XO6A 4LBIA 1JMTA 4NA2A 3H5XA 1UW4A 1WC0A 1ZZFA 3HSZA 4NYPA 1PKUA 5D4LA 1NK0A 1GH8A 2RQMA 4ANDA 4C0OC 5L46A 4ZCMA 2GQ2A 1IBKJ 4NLTA 5K9FA 2KFZA 1TAUA 1I1GA 3T1YJ 2Y1LB 2XZTB 4W90B 2E7VA 2DRAA 3L7UA 1U1PA 4U8YA 4DR4J 2V8GA 2UZAA 4K4XA 1VGYA 4XTTA 3E01B 4K4WA 4LUBA 2XB2D 1PAEX 2VOOA 1ZTTA 3RAQA 3U27A 2MQLA 3SCJE 4NRTA 4Z7YA 1RTZA 4OYMA 2FLPA 3OD2A 1FNMA 1YRUA 2W7PA 1E6YA 1JJHA 2MGZA 1HW8A 3OL7A 3A8JA 1GTHA 4PPDA 2ZHBA 1VS3A 1FNXH 3LGHA 2VPYB 2JVOA 2LLZA 3HJVA 2HQFA 5KOWA 2IRXA 4JYAJ 3CDUA 4TNOA 3ZO7A 1SJFA 2IYIA 4RLEA 1LXNA 2RRNA 4N41A 2RUGA 3FVYA 1J27A 4RW6B 3UVJB 3OL6A 2BJ9A 1OSDA 4WP3A 2Z0GA 1SJQA 3GZ7A 3M4XA 5F0UA 4CO2A 4R25A 3L09A 2KG0A 5KG3A 3CXCR 1D9FA 1OQ3A 2KB2A 5KAKA 3FRZA 2GCFA 1IR1A 3KDNA 4ED3A 4MKVA 2FJDB 3H5SA 3MMBA 4FP9A 2K1RB 2KU7A 3IM9A 4GO5X 4QIFA 1Q82T 2W4CA 1NSKL 1EAYC 3DCAA 4KBIA 2YKMA 4KHMA 4ZA1A 4YY3J 2XZWA 4LRCA 1XMBA 2FJEB 4OJ1A 5K8MA 2DVIA 1PAUB 2GV1A 1KTQA 2IRUA 3AHPA 1LW2A 4PQUA 2HAFA 2O01C 4LF8J 4ZVQB 4NPOA 1NPPA 3NBPB 1JLGB 2K7KA 1RP5A 2XY7A 5DDRC 5GVQA 4M5NA 2R42A 2B9EA 4ANCA 3BO2A 3IMQJ 2M9KA 2LEAA 3IBCB 3S7RA 4QW9A 3PO4A 4DSJA 3G6ES 3EGNA 2AX0A 2CWKA 2QGFB 2N7CA 4IOAQ 4Y34A 2DXFA 4FXVA 1JLAB 4X4QA 1TVRA 5J2MB 1FKPA 3DHXA 2HFOA 3UI3A 5A6WA 1DTQA 1DJ0A 2M70A 3QFHA 4NE9C 3QRRA 4EGLA 4JI8F 1NDKA 4AL6A 3T5JA 2A3JA 3CJ2A 2R7SA 4X4NA 2OUGA 2LP4A 1SI9A 2ZBCA 1WTFA 1TMJA 4IR1A 2VPWB 1SC4B 4R5PB 2DD8S 1RABB 2EG1A 4Q2MA 4LFBJ 2P9GA 1CQNA 4ZLPA 4M63A 1YKWA 2GIQA 3O1LA 3MR5A 2OD6A 4C98A 1EB0A 4ETZA 4RU2A 4Q5VA 2PFFB 2MKKA 4JI6F 1U8WA 1HNZF 2KZMA 2KI2A 4Q45A 4DV1J 2NS1B 3AJ1A 3SSSA 2HHPA 2DPJA 4LSZB 2M2BA 1C1CA 2X3DA 1RUSA 4B9VA 3FEYB 4NZ6A 3RB6A 2ASYA 1RJJA 2HHUA 4GKKJ 3X3UA 4Q43A 3CJ5A 5THWA 3NY0A 1RACB 5DS7A 1FO1A 1PC4A 1D8ZA 3ZZ0A 1N56A 2O5DA 2R8GA 2J9DA 3DGVA 2HHSA 3TQ1A 2KT2A 5C5JA 3H5UA 2DR9A 1LWFA 2ROGA 5A8RB 3N79A 1JLBB 1X4DA 1X8DA 4FYWB 4OI0A 2OAUA 4USTA 4I4BA 4NLYA 3B6BA 4DV3J 4N5SA 3RZAA 2DJWA 1XNRF 3JSYA 1EHWA 2A2DA 1QTNB 4XDDA 3PYFA 2ROPA 3DLKB 1PJ7A 1EKRA 1LEOA 2XMWA 4ICLA 3BR8A 4EUVA 3C6UB 3NAIA 2EC0A 1MN9A 4RNFA 3HSGA 4P71A 3UDLA 3OSNA 3BQ0A 1S0MA 2MEWA 3BGRB 2FVCA 1KDNA 1SL1A 2FHJA 4DSFA 2DO4A 4H4OB 1KVIA 3BKTA 2IRYA 2N3LA 3OFHA 4H4MB 2LFVA 4OV1A 1D09B 2RKIA 4DV7J 1V5IB 1WOSA 4PXBA 5L38A 1RA7A 2P2CB 4ANEA 1TUVA 5B0GA 2GMLA 5D6GA 4I0WA 4A8YA 3MR3A 2YKOA 3EGVA 3W9HA 3M8PA 4J9SA 2BKPA 3M1VA 5B0DA 2CJKA 3HCXA 2B0GA 3PTWA 1TUGB 1FFGB 3G6VA 4ED5A 4MKBA 1EARA 5I42B 4MFBA 4H54A 5HI7A 1Y5NB 5ETQA 2KJWA 4ZVRB 2RJZA 4HVZA 3UN2A 3H40A 2OFGX 4ED0A 4ZIVA 3VF0B 2XCAA 4Y2AA 4U7UD 1GXTA 3ETMA 1AYEA 2O66A 3LW5C 5T7LA 2XSFA 3ZZTA 3J7YI 1BXNA 2GVDB 2MZJA 3US5A 1ZM2A 1VRUB 4ECTA 3V4IB 4JI2J 3CJKB 5IWAJ 3CGIA 2HFZA 1TK0A 1HNIB 2W2MP 3L95X 2HAIA 4L6V3 4B3SJ 1RLCL 3Q8UA 3PEHA 5G0RA 3SDEA 1N52B 5B0FA 4DCOB 3TNVA 2P9CA 5JUMA 4MH8A 5IV4A 3W8GA 2VH7A 1IWAA 3WDOA 3Q8PB 2XNQA 1VBYA 1J5EJ 3IO1A 4RW8B 4WYWA 3DI6A 1C0UA 1HI1A 3EMTA 3L7PA 5BYQA 1HNVB 3HULA 1N33F 3MPWA 2G9OA 3UD5A 1IN0A 1H72C 4USHA 3W60A 2VFSA 3I96A 7AT1B 4ZOSA 3BDPA 2IIHA 2H65B 1WSRA 2KXFA 5E5NA 3DLBA 5A8RA 3DMJA 4WPAA 3TEGA 3VAGA 4DUYF 2K2PA 3CIMA 2C2OB 4Y2MA 3VAMA 3TAMA 1HNWJ 3OLAA 2Z4PA 4ECVA 2J7UA 2DY1A 2L41A 4LMZA 1DQ9A 1NJZA 4F7VA 4Z37A 3E3XA 3VQSA 2DNPA 2B7CB 2QT7A 4ICLB 2FZCB 3D2WA 1XR7A 4GMKA 4F2SA 5SZTA 1TV6A 4J90A 5ETNA 3I82A 5EWFA 3MOZA 2VFVA 5HROA 4K4TA 3SSRA 1R8BA 1VI7A 2DNNA 4TYAA 4WJBA 3K59A 1UVIA 4PG6A 1HBNB 4UZCA 3M2UA 4USUA 2HGLA 2VG6A 3PYEA 4G65A 4CLSA 3V6DA 3GG0A 1KD1T 1ZM9A 3FK4A 2GO8A 3VV2B 4AL5A 1VK3A 1S0VA 1KN6A 1S4FA 4KIAA 1IBMJ 4ZVSB 4Q0BB 1FWKA 3RB3A 5DZ6A 1L3KA 4DXLA 3IRXA 4DWIA 4WXWA 4F2RA 4FPIA 2XGPA 2DRDA 1FRMA 1Y4ZB 2ZUAA 1LWEA 2ZH8A 2R2RA 1JLAA 2FVSA 3DOLA 1YJRA 3M7VA 2RMLA 3R5GA 4PUOA 3KFWX 1F3FA 4X4RA 1O51A 3O2IA 1ZA2B 1S0NA 4QIVA 1U1OA 1JJ2R 4ZCIA 2OJ3A 3AOCA 2Y8WA 2H4WB 5HLFB 1RTDA 2PT0A 1QVFR 1T95A 5IT9U 5D3GB 1G1XA 5M2PA 1LWCA 2COLA 3NGUA 4ZP8A 4ZVGA 4LQ3A 1V9OA 4C0BA 4UOGA 1WELA 2B7BB 3KNGA 3DLEB 4YB7A 3H4DA 4NXNF 3DRSB 3PKMA 3EZOA 3BS9A 3WQPA 4LVNP 1RTHB 2GGPB 2HK3A 3R5DA 4I64A 1FRHA 5KFEA 3QZ7A 3SSQA 3NAHA 5LMNF 1S59A 3LAMA 2AJ4A 1DARA 4CQ1A 2HHWA 2GIRA 1ZAWA 3FQKA 1VQPS 2AHOB 4V1Ak 4P9SA 3T6JA 2XYGB 3JAMU 1AFIA 2XZDB 4CYUB 4B08A 2J7WA 3D5MA 1MNEA 3RB0A 4KKOB 4JI7J 2MSTA 2HKEA 1X5PA 4DN9A 1Z2LA 1FRIA 2J7KA 1HWUA 1QSSA 1JK9B 3IM8A 3IXQA 3Q0AA 5K20B 3QWPA 2AGPA 4C8YA 1BLUA 4FKYA 5CCLA 1HQEA 2CNOB 3IG1B 2XS5A 5KG7A 1F3VA 3LH2S 2H5IB 3I5CA 4I7FA 1QTMA 2C3MA 4ERDA 3W2VA 2HHQA 1MLAA 4F04B 3H98A 2A2CA 4KV8B 4B3SF 2KYXA 4HKQA 1DTQB 3CE8A 2EFOA 3RW6A 3GIIA 1SCJB 3WX4A 2Y1JA 2QX0A 5IWAF 2QSFA 2AJQA 2V2KA 5D0HA 5KFTA 1IR2A 1RHUB 3AXKA 4L75A 1FA0A 1VCTA 4PR6A 2YKMB 4DJBA 5D4OA 4JI5F 3BN7A 3LP2B 3QIDA 2JOQA 3ILJA 1UFLA 2J5AA 2OPPA 3DRRB 3FZ2A 5EUHA 2VBWA 2V8VA 3QLHB 1NNDA 2VONA 3RBDA 4M5GA 2O3DA 2XSJB 4L3KA 5I3PA 1RT4B 2HQDA 3FSXA 4J9UE 5BYRA 1T02A 2RRBA 3CSKA 1T9VA 1OY6A 4P7VA 4YB6A 3WIVA 8RUCA 4EBEA 2RRAA 1UPMB 3CWJA 4RW4B 4U95A 4PQUB 1HNVA 1RGVA 2RILA 3I31A 4J7CA 4JV0A 1YQHA 4BC7A 2HLTA 1GTEA 3R1HA 1SL0A 2GZOA 1HFEL 1FERA 1YI2S 4HL9A 4GKJF 1UA0A 2E5HA 5A8WA 4B3MF 5H9EJ 4QBUA 1RT5A 1Y0HA 3D1HA 3T5HA 1MG7A 3OR2B 3PX4A 3TANA 1UA1A 4IH7A 2AD9A 1W2IA 2DIVA 5KFSA 4PEOA 2NXEA 2HHVA 3Q86A 3PXGa 7FD1A 4LF5J 3U02A 4KJIA 3RRHA 1I3OB 1DLOB 3KTQA 5KTQA 1HD0A 3MM9B 1O6XA 4YHHF 3C3LA 2QSWA 4MIWA 3EZ5A 2R4FA 2Y8YA 4RPFA 3CJ4A 2CG4A 3VGVA 2IJRA 4LF4F 2FY1A 4F36A 1HYSA 3EYZA 1M5SA 1Q95G 3FCWA 4CO5A 2FZKB 3OSPA 3OXGA 5KG0A 1U1MA 1S49A 3NMAA 4A46A 2YKNA 4GVBB 3POTA 3IR5B 3KLEA 1RWXB 4YDXA 3BQ1A 2HEKA 2L48A 4O44B 4RW8A 3T5LA 2G0IA 2RUSA 4OJGA 2VFUA 3QO9A 4OI1A 3OVSA 1QAYA 2B9XA 2M7SA 1M1HA 2ZH5A 3J7A1 2CQ4A 1WG5A 1WOPA 3DRPA 4EBCA 2HNDB 3HM9A 2HZVA 1OY8A 4RUHA 1U49A 4DG1A 3RAMA 4NLGA 3MEEB 1JLBA 2CPFA 2V4JA 2AEMA 3A8EA 3I4HX 3MTKA 3QYYA 3R2DJ 4DQSA 1OS5A 4QWBA 1H98A 2AW0A 1FCAA 5KG4A 3CCJS 2XY6A 3UR3C 1VJQA 4Y28C 5F3ZA 5LSLA 1BQXA 5D3GA 5F0WA 3GJRB 3H2LA 1KWMA 2JLEA 3A12A 3J7Z5 1KQSR 2YY3A 4OX9F 1IKYA 4CTAA 1SB6A 1X9SA 1FKAF 5IT9Y 1NBEB 3HHKA 5K5MA 1RT3B 2D1CA 5DJBA 4RW9B 5ITHA 5LOQA 1BGXT 1X4AA 3Q22A 3JB9k 4DSIA 2MQMA 3JTNA 2HS3A 4ZVPB 5DDPC 4QOTA 3RBXA 4LFBF 3BSAA 2JVRA 2VJVA 1X31C 5LMNJ 3QWUA 4JI1J 3C14B 4YN3B 1SC3B 2KYZA 2ZH7A 4JI8J 1G2EA 1M5VC 1APSA 3FJ2A 4IR9A 1VRQC 3QBCA 2CQDA 1H73A 1JNZB 1RWPB 2CPHA 3HX9A 3ILOA 4KFBA 5DM6Q 4ZPVR 2RQKA 4OJ3A 1C1BA 2QZ8A 3ZNJ1 3HK2A 4OYOA 3V6KA 4MIAA 1PIEA 4AE5A 3T1HF 4ILMA 2R7XA 3GFZA 1S57A 3JAMY 2BQRA 3VZHA 1P6TA 5KT4A 3VVUA 4LQ9A 3G71S 3T3FA 3R3TA 4NMLA 3B4DA 4BHQA 4ECWA 2VG7A 2UUTA 2VQEF 6FD1A 3EVWA 1V5VA 1SKSA 4DFKA 1NK5A 1CEZA 2UUBF 3KLVA 2ZJPQ 1NXIA 3C6TA 2ZFHA 3GCXP 1YLXA 2XM3A 2ZH1A 4IUFA 2MLXA 3CO0P 1PGZA 1IKWA 1FFSB 2ZEJA 4PXCA 5FDLA 2LXIA 2W1BA 1H2UX 3N4WA 1GQEA 1DAXA 1Q53A 3PEJA 3AOAA 4J9QA 3W9IA 1WG1A 2E29A 1VQ7S 2HMIA 1P1TA 2D9PA 2WW8A 1NDLA 4MK8A 2AWZA 5T7LB 1YG0A 1XNRJ 1G4CA 1N0UA 1LK5A 1Q0NA 2G2OA 4IG3A 4M5LA 4K5SA 4CTAB 2XMAA 1WG4A 4J9MA 2PD1A 4FF1A 1CJTB 2YWKA 3VGUA 4U6PA 1S99A 1UW9A 3DDKA 3MM9A 1NJYA 2CQPA 3FZBA 1Q81T 3HHLA 3TA0A 2VODA 3RUBL 4ID5A 1SJRA 4O3QA 3OW2R 4A8SA 2DNQA 2QIFA 2GNKA 2W9CB 2HQIA 5L1JA 3HXMA 2E1AA 3V81A 3IWXA 5JMNA 5RUBA 2CJQA 5F8NA 1HR0J 4DSKA 3C16B 3BF4A 2YNHA 4HDHA 4USVA 3WIUA 2OEMA 1R8AA 4ZPCA 2V94A 2DR7A 2BOPA 2PGCA 1UKUA 2BRKA 1XJWB 2YH0A 4NA1A 4CRJA 5AE2A 3K5NA 2FUG9 3D7SB 1C0UB 1C1BB 3EZUA 4F67A 2MZ1A 4O0NA 2BE2A 3KLEB 1U4BA 1HNWF 1C1CB 2XI2A 2H4YB 4TYBA 4WP9A 4NMXA 3HSJA 5J1NA 1Q8BA 3OVBA 2BUNA 4ZS6A 3J81Y 1FRJA 3VWSA 1S7HA 2HBYB 1L3UA 5KFHA 4B9NA 4R8UA 1N33J 4ECRA 2J9EA 2B5JA 3G8QA 1BY9A 3H5YA 2BX6A 2J6SA 3H0PA 2IJNA 4DV5J 2AJFE 4H4KC 3V6JA 2YNFB 1XR6A 3EGZA 1WC4A 2FHOB 2VB6A 2PA3A 5KFCA 3BH6B 2K1RA 4ZCKA 4X65J 2QO3A 2RU9A 4H4OA 3HFZB 3BM7A 2DCUB 3KUHA 4EMDA 5HMZA 5KFBA 3KK2B 3UCGA 1X5SA 4KPCA 1NK6A 4UQGA 2WB1D 1F5AA 2HRUA 4RW9A 5EDWA 1FX4A 4J9LA 2DNMA 3GLJA 4LF9F 4PPZA 2DGSA 2Z2LA 2VJUA 4KR0B 4IKAA 4NASA 5KFGA 3UO0A 1K73T 1KNZA 2BJEA 2WHOA 1RT7B 4UW2A 3CJ0A 2E5JA 2E44A 1JJ4A 4C8ZA 1F2HA 4WZQA 1UVKA 1Y3JA 5KT7A 4B9MA 5DQIA 1NPKA 1SJ1A 1K1SA 2B6AB 2MGZB 4KC5A 4DS5A 4DR6F 1ZPVA 4AYBD 1B7YB 2CPDA 1ACMB 2W4DA 4IH5A 4CYUA 2MQOA 2AJ1A 2H5JB 3O6QA 3T5KA 3D68A 3PFEA 2Q79A 2DXDA 2HWIA 4X4TA 1CJKA 1EQ0A 1NZAA 5HP1B 2XHCA 1IKVA 2D74B 4G1QB 2CNKB 3ZTOA 3R6LB 1WACA 3THVA 1NKBA 3GU0A 1S10A 2BOAA 2J8SA 3M2VB 1SH0A 2EWHA 3K17A 4NWBA 5KFUA 5GADU 4WZMA 3CJKA 2KRRA 3NGRA 1WDTA 4U8VA 1HNXF 3DLEA 5JJBA 4LF7F 2WVDA 3OFFA 1X4HA 2WOMA 2A6MA 2FLLA 4TLQA 2OHDA 2GAHC 4ETXA 4DV7F 2VASA 1RHMB 2KXHA 4WU2A 3LOUA 2WVCA 1UVNA 3EDQB 3X1LB 5IC6B 2OPQB 2KXNB 2VKRA 2M4MA 4AQYJ 2JLFA 2JRSA 4B9LA 3MFHA 1VR6A 1T3OA 3FEXB 4I68A 2IVFB 5LSOA 1GFWB 4X66J 3GTYX 1S1UB 2C1EB 1FKOA 2P8IA 2PC6A 4XK8C 5JXSA 4J9NA 4DL2A 3HKWA 3MR7A 4FPRA 1H38A 1S1UA 3JTPA 2G4BA 3AT1B 1XQIA 3H90A 2ZDOA 3V2UC 5KFAA 3G4SS 4DPYA 2B3TB 4A47A 2F8EX 4L74A 1VC0A 2RHSB 4RZRA 3SI8A 2WK4A 4NCGB 3TP2A 3OUYA 3MEGB 4UUXA 4L3NA 4CT8A 2UVVA 1YRXA 5BXIA 5DLFA 3HF5A 4ED6A 1ZBTA 2MLYA 4FYXB 2QLFB 2EFNA 2UU9F 4DX7A 1RKJA 1Q1KA 4DI6A 4QWCA 2YWHA 4LIWA 4LBHA 2VUGA 3BZQA 1NPRA 2RDDA 3HVAA 2OSQA 4R8UB 2KG1A 5LMUJ 1TVRB 2JZ5A 1MMDA 1S9GA 3MZIA 4YEAA 5E33A 3ISZA 3ZFVA 4C11A 1L5UA 1B0TA 4B9SA 1TKXB 2CQGA 5HJXA 3UVJA 1N36J 2DBBA 3QIPA 1YBTA 1U0HB 1BQMA 4GVLA 1SQEA 1WWHA 3PNIA 4WFZA 5ETSA 3MUTP 4DV1F 4B17A 4L76A 1X9WA 4LF1A 2HPUA 4ZPBA 4G1PA 2IY5B 3M2RA 2I2YA 5KT6A 2NXUA 3AFGA 3JSRA 3TX8A 4RBTA 1NCLA 5DM7Q 4GC6A 3MECA 1RTIA 3NG8A 5KFYA 3V81B 1HQUA 3GQCA 2GMJA 4F0KA 1NKEA 3DDIA 4NXNJ 2HNDA 1S97A 1M5HA 4EBDA 1KP6A 3SEOA 1HARA 3VTIA 1VRTB 2ZH2A 4DQQA 1HR0F 2V50A 3PX0A 3GP9A 3KLHB 1BQNB 2Q66A 3DOMA 4DV0F 3CPWR 3AJ2A 2YQ0A 3TJ8A 2IAJA 4O23A 3TJAA 4LF2A 1YJNS 2J6UA 4KKOA 3NCPA 2ZH9A 1IVZA 1NK7A 3A3OB 4IOBA 3K58A 1TL7A 3MR2A 1K0TA 3PDNA 4Z2XA 4WFNQ 1TTHB 3GIJA 3MM7B 1TL3A 3MGJA 3M8QB 2KHCA 4PYDA 1XMOJ 2F7VA 2MY8A 5HVFA 2NLWA 2RSQA 9RUBA 3IG1A 5GADI 4MKYA 2QFJA 3VR1A 4DV4F 2W2QP 2EK6A 1VIXA 3LP1B 4HI2A 1VQ4S 3ZZPA 4Y65A 1SL2A 3EE3A 4EYIB 3BGOP 1TQLA 2W7OA 3QFWA 4C8LA 2K8GA 2BMBA 1QAXA 3ITHB 3CULA 1WKJA 2PEHA 3N6NA 1U6FA 1HBMB 4A8KA 2UUAF 3AQOA 1YIJS 2CA9A 2FGOA 1SUQB 1T9YA 1WOOA 1UWAA 2GQQA 3CCTA 4P6QA 5AXMA 1ROFA 3CVKA 4X4UA 1N54B 1FEEA 1VYAA 2OPRB 2QMWA 2VU5A 4HACB 4OZ1A 3EWGA 4WBFA 3PW0A 2IBKA 2DNHA 2EBEA 2GC8A 1RU2A 1SQFA 2FPHX 1RISA 3GFYA 3RG6A 4MT1A 4Y2IA 1N5TA 3OVAA 2FJWA 3M8PB 1VLYA 4OJHA 2MJUA 4E8UA 2CZVC 5GMKa 4OI6A 4HI1A 1RWNB 2JEJA 2P6SA 2I0XA 4ZJQA 3ENVA 3HDSA 2ZE2A 1JLFB 3HHEA 3BPSP 1X5OA 4YR3A 4QR1A 4CI0B 2KFYA 3S01A 1AROP 1J5OB 4IG3B 5F8IA 2WOMB 3CB4A 3UNYA 1HHTP 2A10A 2YX7A 4HT7A 4KGMA 5GAHI 4ECUA 4F26A 3JYTA 1B4SA 2RS8A 2IC3A 3HHDA 1RDRA 3LAKA 3R5CA 4A8OA 2F8MA 3J80U 2C3PA 3DNCA 3TA1A 1VQ8S 1Y11A 1Y5LB 1HQ2A 2A1BA 4FNHA 1D9AA 2H48B 3PJWA 3UE2A 3SQGA 4OV6A 4NRUA 5F41A 4ZHRB 3PR5B 2FYXA 4DL7A 4DR4F 2P9EA 3QAEA 2BJ3A 3LGMA 2YPZA 1FDDA 3GIKA 1Q8IA 3CDWA 3HVTB 2VQFF 4QYZK 2W9BB 2FHMA 3T6BA 1SJ4P 2FZGB 1KKHA 4DPUA 2E9RX 1TKTA 4LF6F 2XNRA 3G6YA 4IO9Q 3FC9A 5T14A 4V19J 4CLZA 1J2VA 1WF0A 4JBCA 1YJ9S 4QU6A 4ZVFA 1LW2B 1RAGB 4N7TA 1WSVA 1YJVA 1HWIA 3QO9B 1MROA 4F4WA 1T9TA 1VQKS 2FHJD 5DG8A 4N76A 1TK8A 4DFJA 2IJFA 1S1WA 4M5JA 4KGXB 3ETOA 4C3KA 2A18A 1HHQA 4B9TA 2Y9HA 2H3EB 1I5OB 2F63A 1S1TB 3I4PA 1S48A 1XEZA 3MD1A 4K59A 3OXLA 2B4UA 4O3OA 2YXLA 3QGPA 3HVRA 2R8JA 3HZGA 2VHGA 5K8PA 4CNZA 2CNLB 2DHXA 3R1LA 3A3NB 1WC3A 5A6PA 1AFJA 3I0RB 2BE9B 5AJ3F 3OR1B 3NNCA 4DCJB 4F3OA 3A13A 1DLOA 4IH6A 2VD3A 3TRGA 3MURP 4NCBA 3R5BA 3SBMA 4WIQA 4MMOA 4E98A 4Q7AA 3DU5A 2CZ9A 3A4TA 4ZKAA 2J9DE 3CD6S 1NRKA 5DZ7A 4ALZA 3GIMA 1SKRA 3MTJA 3PW7A 1KFDA 1VMBA 1UEVA 5KG1A 3MPYA 2EFGA 2Z2MA 4FYVB 1RAAB 3T9NA 1XNQF 2F4FA 2IHR1 5A76A 4DF8A 5MAOA 1FDAA 1YK9A 2UUWA 2UV8A 5A2QU 2DYAA 2HHTA 4IDKA 4HACA 3DDNA 3IRXB 3MCOA 4PZVA 1R3NA 2YKNB 1RT6B 3Q8SB 3HVWA 2ZBQA 5KFJA 3VAKA 4TU9A 3IC1A 4LFAF 3BBFA 4FBTA 1PYSB 4DR2J 2V34A 4WCEQ 3GJSB 3C15A 1N5YB 2C3YA 1JLCB 4FDFA 4MYUA 1T9XA 1VJWA 4Y00A 3D6TB 1RHJB 2PA8D 4IO1A 4DPTA 4WKYA 3NLCA 4QIEA 2DCLA 1T0TV 1XWLA 2HGMA 2MKHA 3BGUA 3MEDB 5CHCB 1GK8A 4JP8A 5L39A 1JLFA 3GR0A 3M6XA 2B5JB 2DGTA 5GAGU 4CO4A 1TL3B 1NDCA 1FRLA 1CJUB 1XMQJ 4O3NA 2I9SA 5ETMA 2OTJS 2JSXA 1S6PB 1PSDA 3KLGB 1T7PA 4KHPF 2C2EA 5DQGA 2CPXA 1G3OA 5C42B 1B99A 4JV5F 2I5JA 2PMHA 2Q6CA 3PYDA 4F4KA 1RYRA 1P8GA 2WAQD 4P2FA 4DEZA 3KHGA 3K57A 2N82B 3CCLS 2HNYA 5KFXA 4OMFG 4ATNA 1PYOB 1HBMA 3HHNB 1TZ0A 4DZ6A 3K0JA 2UUCJ 1KS2A 2V5HG 3AXMA 4ZVEA 3TUJC 3M32B 3TWZA 4CLKA 4X62F 4Y2CA 2AT1B 4LR8A 2DR5A 3OHBA 5B08A 4AQYF 5ETOA 1FE4A 4PXDA 4DBQA 2AYGA 4DPXA 1PG5B 2RIJA 1WC5A 4DL0C 3F0NA 2W9AA 3K2YA 3BPDA 4Y6IA 3TA2A 3DKDA 3RAXA 4YQWA 1IKYB 4KH0B 4M94A 2FHKA 2GMHA 1CQMA 1H7XA 2CPEA 3LQVA 2YNGA 1S9GB 4DN0A 4EO8A 1F0XA 2FGCA 3KK3A 5HP1A 2ZM6J 4BDPA 4J9VA 4JI0J 3MM6A 3D3CJ 5KFFA 3MEDA 4KSEB 1U1KA 1VRUA 4NYZA 4F8RA 1KFSA 4HHUA 4DU8A 1TU0B 3AD9C 1S0OA 2PIIA 1NK4A 2NSBA 2H54B 1KQKA 1BD6A 4KGVB 4N47A 3C66A 5E7OB 2BR0A 4R5PA 4JUZA 4IQMA 1AUDA 4EZ6A 1Y3KA 2ILZA 4FN5A 4C9DA 1U7LA 3N9UC 2L9DA 2MKYA 2WZ1A 4DR6J 2OGUA 2C22A 1NB2A 1FD8A 4DLGA 1WF2A 4OLOA 1IBMF 2FD2A 4QW8A 3CDEA 1P9QC 4F4AA 2R2SA 1REVB 2KO1A 2JH3A 2V63A 3OQ2A 4CZCA 2ADBA 4X84A 1OPIA 5CQGA 4RO0A 1OQ6A 4XPCA 2KT5A 4B02A 3AY0A 2D3ZA 3MAQA 1U25A 4LF9J 2OKQA 1MWQA 2Z2YB 4FKXA 4U96A 2XQCA 2EPIA 3HD1A 1WEXA 3ZC4A 5DGBA 2EXUA 3J81U 4NLOA 2HS4A 4BC9A 4IG0A 4HDGA 3RRKA 2EBGA 2HSEB 3P5TL 4QPXA 4CH1A 4OYXA 2QA4S 1WEYA 1GMWD 2Y1IA 3PW5A 4JYAF 2C3UA 5GAEI 3C15B 1N5YA 1IM6A 4IFYB 3BR9A 1Z1ZA 2G2YA 3LP1A 2OH2A 1VK8A 3FDSA 2PEBA 1S1TA 3VAIA 2DO0A 1UVMA 2KT3A 4HHJA 3MEKA 2DGXA 5ETRA 4CLLA 2KJVA 4DZDA 3KYLA 1HKAA 2C42A 1R0BG 2WSCC 3C6UA 2DHAA 2V9KA 3OPKA 5D78A 5CXTA 2V8HA 2HQ3A 1KBRA 1S12A 4M95A 2G13A 4DOZA 1KONA 2DT9A 4ZLLA 1YZ6A 3JS9A 2BV3A 4P74A 4C0HA 5HQMA 3AB2B 2JFDA 3CD7A 2LKZA 2FVPA 3SCLE 1SVDA 5F3TA 1UWBA 1X5TA 4LT6A 3BREA 2QYGA 1GX6A 2DNZA 4LRDA 3QLHA 2RS2A 1DTTA 2ZD1A 2GW8A 1BWVA 3CJSA 4EU0A 4GVBA 4DX5A 5A2QY 3M8RA 1O8BA 4DV3F 1HNXJ 4MIBA 1B0PA 1C4AA 2XMMA 1RTIB 1T94A 3LUYA 1M5OC 1NKCA 2BZ2A 1JLGA 5E41A 2AMCB 2GVZA 1FD2A 1W26A 3M6UA 4LBPA 5K14B 2CQ2A 4K2XA 2CJAA 1ZAXA 2FTRA 1H6KX 2M52A 3M2VA 4WF9Q 2D3UA 5JVHQ 3QSIA 1UEUA 4RBVA 2DR6A 1M5KC 5J2NB 3NMRA 2XMTA 4IG0B 4NLQA 2MY7A 1WNEA 2IM3A 1PC5A 4NEYA 2DNLA 3SCKE 2WVEA 2WB4A 3GMGA 2D9OA 4FF2A 1FK9B 3QNWB 3OV7A 3C2PA 1IQTA 1FJEB 1XK8A 1FF2A 2FLOA 2MMYA 4NLXA 4HH1A 5E0OA 2JLGA 4IQXA 3H8YA 2FJBB 3LPEA 2PSZA 3S8SA 1GMVA 4DL4A 2VQEJ 1SJ3P 1FKOB 4DF4A 4NLWA 4NLPA 2AX1A 4OYPA 3UDEA 1XNQJ 1N4LA 4PWDA 1FI4A 3IGVA 4WFBQ 2BVZA 4C8NA 3TUZC 5J2QB 4M5KA 5C42A 4K0KF 2BE7D 1RAHB 2CFXA 4WK3A 1HI8A 5IC4B 2VPZB 1Z2ZA 1PBAA 3NNAA 3SFUA 2V68A 4WU3A 3J7ZT 4GO7X 3NGDA 3NBPA 5C25B 1S79A 4JI1F 2GHWA 2CKWA 2EFPA 3I32A 4J9OA 4ECQA 3PZPA 2FVRA 4C2MA 5ETTA 5H9FJ 4I2QB 2ZZMA 2QYCA 1R6YA 5A0YB 2Z57B 3GE9A 3R7SB 3OUYB 3H25A 4F50A 3PW4A 2ZE2B 4W92B 1B64A 3M9OB 4M5DB 2DH8A 2MZQA 4P2MA 3K8WA 1VQMS 3QRPA 3BO3A 5ETKA 4OX8A 1IBLF 2RE1A 3OTOF 3MM7A 1QAJA 4HR2A 3R7BB 2E9TA 1TFYA 2UVRA 2YNGB 1TKZB 3TX0A 4YB5A 1F2GA 3K5PA 1JXLA 2P5VA 4AFFA 2QL5B 3QT5A 3V4MA 5FJ4A 4DS4A 4EEYA 2ACMA 3EJMA 1L3SA 2HBQB 2HG4A 3IGNA 3H2VE 3D0IE 1GXLA 1REVA 5AE1A 2VQFJ 2ACYA 2RQCA 4X4PA 5FLXY 2NZ4A 5CD4H 2ZBRA 4OLPA 2WVFA 4PYAA 3GYXB 2F9JA 2H5EA 3UWTA 3CC7S 2EC2A 2RVJA 3QMQA 2WSEC 4NLRA 4AD6A 1RHQB 3K5OA 1RB0A 3EVMA 1F1BB 3D9BA 1LV5A 2JL9A 1QD1A 3DOKA 3FCVA 1ZTWA 5HMYA 1IKVB 4LF4J 3M8QA 1V6HA 5IFMA 2VPXB 4KGZB 4RNHA 3QT8A 3QT6A 1B70B 2XEXA 2XO7A 1RAIB 2QEXS 4EYHB 1H0HB 3AB4B 4ER8A 4DL5A 1RTDB 3BH7B 3BJYA 5A0YA 1A6LA 2X3GA 3KDOA 5KT5A 3GONA 3FCHA 1WD6A 3PG9A 4LSLA 4O4GA 4QZVB 4ZJLA 3W61A 1CPZA 3TAMB 3ET6B 2POKA 2W7AA 1RTJA 1HBOB 3BO4A 2ALZA 1HBUB 2KVQE 1IM4A 1YRTA 2VOPA 3SIPB 4M8LA 1WJ9A 4QYRA 1LK7A 2HQCA 4XIUA 3I6PA 1RSCA 5HO4A 4OZ0A 3N28A 2IYGA 1T11A 1D1UA 1VISA 1ZPWX 2CJXB 5F9LA 3Q24A 2ZH3A 3PM9A 2UUAJ 3AD8C 4F3MA 1IKXB 4U9RA 1WDDA 2HWTA 1RWVB 5HAOA 1DQ8A 2G0JA 3G6XA 2E5LJ 2GS8A 2KN4A 2MZRA 5I3QA 3VQTA 4WKRA 2DHGA 2ZITA 3WZ0A 1KVJA 1MWZA 4DR1F 3LP0A 2B9YA 4ECSA 1Q86T 2PI5A 2UP1A 1R31A 2F4VJ 3KLIB 1ZH5A 2BJ7A 2YBVA 3H7HB 3JSMA 1UJ5A 2AKWB 1VBKA 2W24A 2ZNYA 4PQAA 1R43A 3KLIA 1XMOF 3D66A 1N48A 1U6BA 3R5AA 4OHWA 2FLNA 2X1BA 4HTJA 5D8HB 2AP6A 2L08A 1CG2A 3VHQA 4QWEA 3NS6A 4YDDB 5HLFA 1XIQA 2JHEA 2GO9A 2CQIA 2EKYA 2MTLA 2K3IA 2OSRA 3K89A 3M6WA 4I2PB 2QLWA 4PG4A 3TEHB 5DDQC 5C2GA 3CCVS 5CYQB 4C8KA 1U2RA 6FDRA 2ZVIA 1WORA 1LNQA 2ZBPA 2ZUGA 5HN0A 4DLEA 1VC6A 3PIOQ 2LQBA 2NQPA 4E2FB 1DZ5A 3H59A 3OLBA 5AE3A 1CULB 3LWMA 2HHHJ 4CLWA 1RTJB 3I0SA 1A7GE 2FJVA 4RW7B 1BUXA 2OLWA 1DTTB 2ZD1B 1HI0P 3VALA 1WTBA 4FYYB 4WXOA 2B4VA 2OPQA 1CS4A 1A9NB 2Y0BB 2HVIA 4RW4A 5GAEU 2ZWOA 4FS2A 3DHWC 3RB4A 4PRFA 2UUCF 4HHHA 4TKTA 3Q8QB 3KXDA 1KOHA 3V6DB 1L3TA 4TXSA 2H9ZA 2W9BA 2LQ8A 2Q3PA 4KFBB 4K7QA 4EWTA 3EVOA 3BKUA 1R27B 1FTRA 1TP7A 1ZAVA 1RT6A 3CJTA 5I3UB 2HZAA 2GFFA 1QY7A 3HD2A 5GMDA 3KNAA 1S6QA 4ZVHA 1JIHA 2B8QA 5I3UA 2QLBB 2YWGA 4ID8A 3NOCA 4ZPAA 3GSDA 4IFYA 3ELHA 3TZWA 3HMJG 1XMQF 5KFDA 4XPEA 4C8OA 2YKAA 2Z2ZA 2M8HA 3Q83A 2V0NA 3JYTB 2IA6A 4IRCA 5HMWA 5HVHA 5JVGQ 1RYSA 2J0WA 4IFVB 2DK2A 1RHRB 1RT2A 4DR5F 1N34F 3GFXA 3DLLQ 3CW2C 3BV8A 3N0VA 2X51A 1S9FA 5ETPA 4ED8A 1M90T 2ZZNA 3QPIA 4C48A 4RUCA 1HHSA 2UVWA 4ZVOB 2W8KA 1H74A 2NYIA 3LF0A 2IPOB 2J76E 3KG0A 1HW9A 3H4BA 1TL5A 2Y1RI 5AXNA 3Q89A 2GIFA 2NSCA 3OTEA 4P10A 5D77A 4LIRA 5L8RC 3THPA 3TZZA 3TAQA 4FBUA 1WHYA 3B4MA 1EETA 1V3ZA 3CEDA 4YB1P 2OFHX 4L72B 3W5ZA 4CLYA 2ZM6F 1T05A 4K50A 4K8RA 1LW0A 2GJIA 2RB7A 5HSPA 2D3O1 1ULRA 2C2MB 2FVQA 2GVZB 2ZKTA 3FMWA 2VKZG 4JB8B 4USJC 4B3TJ 3CMAS 1S77D 3AJDA 5CYMB 1X7VA 3D67A 4CCHA 3KJNB 1DURA 2VF3A 1X4EA 2XI3A 5HMXA 3GB0A 4MJKA 5LJ3Y 1ZM4A 2CIMA 3PX6A 3NEKA 4K5RA 2ZHAA 2HFNA 3IRWP 2NCKL 2HS0A 5EN1A 4ITSA 5CD4A 4U67Q 4J9PA 4IRKA 4F4YA 3D28A 1DFDA 3TZYA 3Q8YA 3RBEA 1CC8A 2BKNA 3I9V9 5G0RB 3SDEB 3RYLA 2HW3A 3ZTQA 3MAAB 1Q5YA 3PV8A 2FDNA 5B0AA 4K4ZA 2PFDA 3DLJA 2BEFA 2BW2A 3ENWA 1ZOTA 5B0CA 1J5EF 1M1GA 1RXOB 2CPJA 3DRRA 2QMXA 1RBOB 1RWWB 3GCWP 1EP4B 3FBCA 2PMZD 2F65A 4N56A 2ZOGA 3MUMP 5C2CA 2HZCA 4NLSA 5MLCV 2CPYA 5D0GA 2MQPA 2XS2A 3TOQA 1JLCA 1C0TB 2Z58B 4UOHA 1Q7LB 3SFGA 1WC6A 1N8RT 3MOJB 2C2KB 1NEEA 1AXQA 1U26A 2CG8A 1C0TA 1LQ9A 2CQHA 3D54A 2BW7A 1RWUA 3KUEA 4I2QA 4P2XA 5AXLA 4USIA 5LM7E 1UAWA 3W2VB 2LU2A 4RX6A 1IR0A 4DUTA 3MUVP 2ZJRQ 4YS2A 5KFPA 3K5MA 1NH8A 4DR2F 1FJGJ 2YNFA 3C6TB 2VBYA 5LXRA 2ILYA 2K7JA 5DG9A 2Q6BA 2HYIB 1GNKA 2D7SA 4K2JA 5M2RA 3N01A 3CJ3A 1S6UA 1RKIA 2FC9A 1MU2B 4ES1A 4X2BA 2EVZA 5EX3A 3BSCA 2NR0A 1NZ8A 2ZVSA 4NZ7A 4DUZJ 4ED1A 3FUYA 1N5SA 1JLQB 5BJRA 2Z56B 5KG2A 4PWDB 3MAHA 3ZTSA 2RU3A 3QJJA 3PJXA 3BDEA 3NWRA 1U0HA 3NCRA 3SQGB 1C2PA 2OPSA 3F44A 4CH7A 2DH7A 3I5BA 3GV5B 5DG7A 1Y7PA 2QFIA 4LFCF 3C16A 3M2RB 2HNZB 3W8PA 1E6YB 2FIUA 4DR3F 2R3VA 4CIOA 1H2VZ 1EJ7L 2QN6B 3BGLA 1YVFA 1EZZB 3W2WA 2XCPA 2DNOA 3FFIB 2A0FB 5ETLA 2JEFA 3DRYA 2F4VF 3ILIA 4NOHA 1Q8KA 3CTRA 2YWWA 1HL6A 4EO6A 3DOKB 4USMA 4KQZA 2AQ4A 2VICA 3BKFA 4ECXA 1MROB 1T3NA 1UVJA 1K9MT 2HIYA 2VG7B 1RQ0A 2XHWA 2Q43A 4YMEA 5K14A 2E5LF 1QLNA 9ATCB 2V6AA 2AZ3A 5IT0A 3EGWB 1F6TA 1LWCB 4PWWA 2DNRA 5BYSA 5CZVA 2KFNA 3MCNA 3LANA 2IA0A 4JV1A 3HHLD 4LREA 3GWCA 2YTCA 2YWEA 3BYRA 3TVKA 2CPZA 2V69A 5CA5A 3RJMB
chains in the Genus database with same CATH topology
5KFMA 3RU0A 2E1MC 3P49B 3E51A 1UMJA 3UD3P 3POTB 2VV5A 4QR2A 3UFCX 5E3PA 1TAQA 1URRA 2GJ2A 3TO8A 1AW0A 1KEKA 3GFHA 4X4VA 3E2EA 1U47A 1VHFA 4OZJA 3VAJA 1LW0B 3Q2SC 2UVUA 4NLUA 5J1EB 2AYMA 3AH6A 3MR6A 3AQPA 4MK7A 4FS1A 1XN9A 1JLEB 1WHXA 3UD4P 5CYMA 3M30A 3HJFA 3PFOA 5F8LA 4LSNB 1ZZNA 3UW1A 1U1NA 1WF1A 4KV8A 1TKDA 2MB0B 2IAJB 5KFIA 5M2UA 4XO0A 1QVGR 4K4UA 3QZ8A 2VFRA 1S9EB 5LL6d 4J9RA 1OO0B 4O0IA 2WONB 1BC6A 5KFVA 4DHVA 4ZDNA 1HD1A 4WE1B 4GKKF 2W25A 5E3CA 3GILA 2YKPA 1YWXA 2CJ9A 3MMCB 5LT5A 1YBAA 3I55S 2BDPA 1K0VA 1XTZA 1FDBA 1S6PA 2O1PA 1N5QA 4NXMF 2HNYB 2EG2A 4ED7A 1IUJA 1LFWA 1RT7A 3DXSX 1GT8A 3IS9B 4RW7A 2R8KA 1YJUA 2AV5A 1HNIA 2GQCA 7FDRA 1S1XB 3ZZOA 1HBNA 1SUQA 3NL0A 2YX4A 1RT1B 3I56S 2ZJQQ 1TL1A 2B9WA 3Q8RB 1OPZA 1TL4A 4PXEA 2BM1A 1X0PA 2HNZA 2OD4A 4C7QA 4A4JA 4AUKA 4YY3F 1S6QB 2B6AA 1R8HA 5DDOC 2JEIA 2DNYA 4HT5A 4LF5F 3F56A 4DX8H 4QWAA 3V4IA 4O3RA 1WEZA 5C25A 5KG6A 4RNOA 3ISND 3N5FA 2HGNA 2E1CA 1O5JA 3KK1A 1H7WA 3AA9A 1FKPB 2WRMA 1JNRB 2F1FA 4IYQA 1QJHA 2YKQA 4DQPA 4ZHRA 2L9WA 2ZNZA 3B8HA 2MKCA 4TQSA 3I0SB 3LO3A 1FESA 5J2PB 2DNKA 1BQMB 5EWEA 2CQ3A 3OBIA 3IBWA 4WFAQ 3OTBA 1UETA 4QR0A 3CCWA 1JLQA 1U1QA 1N5VA 1NO8A 5HBMB 3G86A 1RTHA 2GGPA 2I1RA 5LXYA 4X4OA 2RT3A 3MPVA 2ZC4A 2XMVA 1LKZA 2XSJA 3BEGB 4OQJA 4ZPDA 3F41A 1DHMA 2KDOA 2ZOFA 1YTYA 1XBWA 1N6QB 2V9WA 1SKWA 5LMUF 1LXJA 3DC2A 1KOOA 4OI4A 3E8OA 3MMJA 3MDFA 4MFBB 5D4NA 4PG8A 4A8XA 3KHHA 4U7UK 4KTQA 2J0QD 3U1MA 1MMNA 1X4CA 3O44A 4R0EA 1R7IA 4X65F 2XLIA 1FXDA 1SV5B 2M88A 3R27A 2LECA 1DRZA 1QSLA 1RT3A 3MM8A 2LDIA 3BQ2A 1S1WB 3CUNA 2DPIA 4KRWA 3BSNA 3A1YG 4DV5F 1SH3A 3IAS9 3HT3A 4IOCQ 2KH9A 3HHLB 4Q2LA 5E3RA 1S6OA 3IR7B 3GYNA 1NH7A 2HIQA 2LDYA 2NUUG 1X9MA 1VQYA 4N8NA 4ZP6A 4K4VA 1MMLA 1YSJA 4FNIA 4FXDA 3NWGA 1HBOA 3DFEA 1GXUA 4OI2A 5IQQA 1XERA 2DGUA 2CQCA 5KFOA 2UXBF 1JKHB 3PY8A 4DFMA 3KLFB 2DGQA 5B7WA 5F8JA 3O8WA 3NRBA 3IS9A 2DITA 2JJ4D 4PG7A 4IRDA 1U8SA 4LSNA 4NLDA 3CCUS 2DB1A 4PUOB 3CD0A 1TL1B 2DIUA 2MKJA 3Q2TC 1Q16B 1BQNA 4Y3CA 3QAUA 1N0VC 3ISNC 3OJUA 4FXWA 3Q23A 3L7OA 3NP5A 1RT5B 3PKYA 4A8QA 3WC2A 2JC1A 1FEHA 1UFWA 4TY8A 5HL7Q 4DSLA 4ECZA 1IXKA 4G3IA 2GHVC 3MM5A 4UY85 4NL5A 2DISA 2CQBA 1X0FA 4H4KA 2I38A 1WHVA 2OMLA 3UPFA 1U2FA 1NK9A 2D3OR 2EK1A 5J2QA 2CQ1A 2OPRA 4FVMA 1VBXA 2F3JA 4DQRA 1E6VB 3NMAA 2DNGA 1C4CA 3UCUP 5FD1A 4TU8A 2PI4A 1GAOA 3I5AA 3J7YU 2RF2A 2XMJA 2RKIB 3DYAA 1Y9OA 3LALA 3FFIA 2I8EA 1IBKF 4RU2A 1AFJA 2XMUA 3M30B 4BBYA 3DYAB 1RT4A 5J1PA 2JC0A 1RI7A 1HMVB 4RWWA 2R7UA 1KLMA 1U6ZA 5KT3A 3ULHA 3GG1A 4NCAA 4ZK7M 1HWLA 1MSWD 1VIOA 1D0EA 4I7FB 2ROEA 2XBPA 4WFXA 1W25A 2QE5A 1DBDA 4B3OB 1U09A 5B09A 1FE0A 2W4PA 1VOMA 2M0GB 2KZZA 2Z8QA 4KPYA 3CO9A 1U48A 2R7TA 1N32F 4D3HA 1OIAA 3NNHA 3MF5A 1Z4UA 4RWXA 3MMCA 2HHHF 3CT9A 4F4XA 2U2FA 2OO4A 3OL9A 3N6LA 4ID5B 4YFUA 3FQLA 2F40A 4YUDA 4U7CA 3OL8A 2YWFA 2MSSA 2E5IA 3DRXA 5KFQA 1VQSA 2CVEA 2C28A 5KT2A 1UJ6A 1RA6A 4DV2F 1VQLS 1KLNA 1Y5IB 1KR4A 1FJ7A 1NHUA 2OP5A 3OXFA 1T05B 1U45A 3KWMA 2X1AA 1SC6A 1Q4RA 3ICLA 1KQFB 5K8NA 1XC9A 3CD5A 2C2RA 2ZH6A 2LMIA 4J37A 2YNIB 1QAIA 2Q1LA 3PRBA 1HMVA 5LJ5Y 1R8CA 4OX6A 2CRLA 3QGHA 2KM8B 4ELTA 4RW6A 1UP1A 3KG1A 1F9FA 2KKHA 4HH0A 1LWFB 2MQNA 4QCLA 3AA8A 5GAHU 2BRLA 1MW7A 2QLXA 2R8IA 1S76D 3CCSS 4FYDA 2PDAA 4FZVA 1T03B 1F5BA 4R0JA 1D3WA 3WBZA 3PR4A 2DHSA 3CC2S 4EZ9A 2LQJA 1TKZA 5T41A 4DL6A 2XGQA 2B43A 1FJCA 2RNEA 3M8SA 3B82A 3FSYA 3NS5A 1YITS 4KB7A 5EX0A 4I6YA 4F3QA 4UOCA 1VQ6S 2E7WA 4BCAA 3KKFA 3PRDA 2VC1A 2MDAA 3OFEA 2ZOMA 3QGIA 5IXUA 4QWDA 3TARA 4NCGA 3G9CA 1KSPA 1UWBB 4KO0B 3JSMB 3O3LA 3KLFA 2E5GA 5DO2A 4BWMA 4OZLA 3TAPA 1OWXA 2IVYA 2IFXA 2C3OA 5CH7B 1HQEB 1YGYA 2XG8A 2BJDA 3OTCA 3D0GE 2VZ9A 2BBEA 3DLKA 2LXUA 4CH0S 2MKSA 4G1QA 3GV7B 1PILA 2EI5A 3DXBA 4AXJA 5KFKA 3FGVA 4D3GA 3HHLC 3MMAA 2JDJA 2JWNA 3MM5B 5C24B 3OFGA 3U7JA 1DQAA 1NJWA 1TK5A 4OZ5A 3DMJB 4CNYA 2GHPA 3BN4A 1U1RA 1T8EA 4JV2A 1R8PA 3DN9A 1MU2A 1NHVA 5B0EA 4ZPTR 1FK9A 3MD3A 3O5TB 3OR1A 5CYJA 4FF4A 4I56A 1URNA 2N4CA 2G1DA 2UV8G 4O44A 3PO5A 4GC7A 3I87A 3HZEA 2ZHOA 2I5JB 3DLGA 2DGWA 2CQ0A 5IT4A 2OIHA 4QPTA 3HP6A 3RTVA 1N6QA 4Y0FA 3T1AA 2DGVA 2L9NA 4CT9A 4ELUA 4KAIA 2C2DA 2BANA 3AAWB 3M05A 3LWLA 2FJXA 1ELOA 4JI4F 1H3DA 3M32A 4YR2A 1VQ5S 5A8WB 4DL3A 1F60B 3DM2B 4QU7A 2BA9A 2NPIA 1M5PC 2MHNA 2PO4A 5G4DA 4RUAA 3CC4S 4KT0C 5F8MA 2V4QA 1S1VB 1VQNS 3HI9A 3SMZA 2AGQA 1SV5A 1KC8T 3VCDA 5IS2A 3OHAA 4Y2KA 3L3CA 3KK1B 3HFKA 4FF3A 5SUHA 2W9CA 4ES2A 1G7CB 2VG6B 1ZM3A 2CVIA 1NK8A 2W8LA 4X66F 2RDJA 2L3MA 1K1QA 4P2SA 1R0AB 1LOUA 1TV6B 2QA2A 4URGA 1VFJA 2ZC3A 5F9NA 3D0HE 5HBMA 5L9XA 4WYLA 1Q7YT 1FDNA 3M9MB 1YJWS 1FXRA 3ONQA 1RAJA 4OIXA 1EETB 4IDKB 2ZKUA 4DSEA 1NJIT 4OHZA 1M0SA 4RNNA 2FC8A 4DG1B 3OJSA 4OZNA 3ZZYA 4A8MP