2CQDA

Solution structure of the rna recognition motif in rna-binding region containing protein 1
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
116
structure length
116
Chain Sequence
GSSGSSGMHGSQKDTTFTKIFVGGLPYHTTDASLRKYFEGFGDIEEAVVITDRQTGKSRGYGFVTMADRAAAERACKDPNPIIDGRKANVNLAYLGAKPRSLQTGFAIGVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords RNA-binding region containing protein 1
publication title Solution Structure of the RNA recognition motif in RNA-binding region containing protein 1
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 14
structure length 116
sequence length 116
ec nomenclature
pdb deposition date 2005-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqdA01
1X4HA 1SXLA 1VQOS 1H6KX 1YWXA 5GAEU 2DHGA 3RW7A 2N3OA 2KXHA 3EGZA 2DO0A 2CQDA 2M8HA 1FHTA 3G71S 2KG0A 2DISA 1D9AA 2VONA 2QA4S 5JVGQ 3G9CA 1KOHA 3I55S 3US5A 3D2WA 2XS2A 4TLQA 1DBDA 2CQBA 1X4AA 2CPIA 3J7ZT 1SJRA 2LXUA 2MKHA 2KH9A 5GADU 2UP1A 1X5SA 2U1AA 3P49B 4WF9Q 4C4WA 3OW2R 1X4GA 2DH7A 4QU7A 1WWHA 3MD1A 1KD1T 2KXFA 3IWNC 4TU7A 1QVFR 2DIVA 2DNQA 2WBRA 1N52B 2E5IA 2RRAA 3CC4S 2MGZB 1X4DA 3H2UB 1U6BA 3H2VE 2YH0A 2DNNA 4TU9A 2X1AA 3NMRA 2DGQA 3TYTA 1M90T 3B4DA 2KXNB 2N3LA 1URNA 1HD1A 2DNGA 4CQ1A 2MQNA 2KI2A 2GO9A 2MSTA 3DXBA 1FJCA 2CJKA 2M9KA 5LSLA 3U1LA 2MQQA 1YHQS 1FJ7A 1PO6A 1U1OA 5LJ3Y 3SDEB 3ULHA 2CPYA 2LECA 3VAHA 2MKCA 5BJRA 2AYBA 2K3KA 2D9OA 3EGNA 1Q81T 2DGVA 4FXWA 2AYGA 3TP2A 2LA6A 2DNZA 2O3DA 3IRWP 3BO4A 2RNEA 3NNCA 2XNQA 2E5HA 3CCJS 2RU3A 1H2UX 1WHXA 5IM0A 3MXHP 1VQ7S 2DH9A 4LIRA 1KC8T 1JJ2R 2DGOA 4F26A 1VBZA 3EX7B 1K9MT 4WIIA 2M0GB 2DHSA 3BS9A 3MUMP 3S8SA 1WEYA 4YUDA 3S6EA 1VBXA 4WCEQ 2CQ3A 2MSSA 2LA4A 1PGZA 2DNMA 2CPFA 2J8AA 2RS8A 2HVZA 1S79A 3UD4P 1WHVA 4CH1A 1WI8A 2NZ4A 1OPIA 1Q7YT 1YTYA 5HO4A 2MY7A 2RQCA 3CCQS 1OIAA 1JJHA 2MJUA 3THTA 1WEXA 3UCUP 3TO8A 5ITHA 5CXTA 4WFBQ 1X4CA 5DETA 4IO9Q 2M4MA 1K8AT 4UQTA 3VAMA 2CQPA 2MZJA 1D8ZA 3CCVS 3UCZP 1HD0A 2KYXA 1X4FA 2MKSA 3VALA 5CYJA 1X5TA 1SJQA 3NS5A 2QFJA 2JVRA 1OO0B 2L41A 4W90B 1VC5A 2I2YA 1U2FA 3VF0B 2RT3A 2FHOB 3HI9A 2M52A 2VOPA 2ADBA 5DDOC 2DNLA 2EVZA 1JMTA 2X1GA 1WELA 2X1FA 5FJ4A 2A3JA 4A8XA 2F9DA 1UAWA 2FPHX 2LKZA 1FJEB 4CIOA 2ERRA 1NO8A 1U1NA 3G8TA 2DGXA 5IQQA 3VAKA 1WF0A 2KM8C 2D3OR 1YJNS 2VOOA 3BEGB 2E5JA 1IQTA 4ZKAA 2DGTA 1VC0A 2PE8A 1U1QA 2CQ2A 2KHCA 1WI6A 1N88A 2YH1A 2Q79A 3CCSS 3Q2TC 2JX2A 2DB1A 1Q86T 3ZZYA 3UE2A 2KM8B 4IOCQ 2DNPA 1X4BA 3R1HA 2YWKA 2XS5A 2M2BA 2F3JA 2YKAA 1NU4A 1VQPS 3CCUS 2EK6A 2M70A 3J7YU 1FNXH 3NNHA 3MUTP 2KVIA 2DK2A 2ZJRQ 3NNAA 4IOAQ 1YIJS 4ED5A 2MQLA 4QU6A 3SMZA 2CPZA 3CC7S 3Q2SC 2AD9A 1HA1A 2AYMA 3L3CA 1DHMA 3THPA 3UD3P 2CPXA 2K8GA 2PEHA 3G6ES 2ZJPQ 1UW4A 2E44A 2MZQA 1M5VC 1HL6A 1UP1A 3PIPQ 2DHXA 2J0SD 2MKIA 1UFWA 1M5PC 2G4BA 3HHNB 5IM0B 1L3KA 4QQBA 2KN4A 2ADCA 4WFNQ 2E5GA 1VQ5S 1RK8A 1U6FA 4TU8A 4PKDB 2MQPA 3G96A 2RRBA 2DGUA 3CPWR 1FT8A 2VODA 1X5PA 1X4EA 3UWTA 5GVQA 4Z2XA 3DLLQ 2CQGA 1NJIT 2HGMA 2XSFA 3R1LA 1VBYA 5JVHQ 2CPJA 2JVOA 1WTBA 2EK1A 3CCMS 1DRZA 1WEZA 2MZSA 3CC2S 1RKJA 4PRFA 1WG4A 2XS7A 1KQSR 2RVJA 1M5OC 4OZ1A 2DIUA 4PR6A 2DH8A 2DNYA 2DO4A 1U1PA 2MY8A 2V94A 3MURP 4P6QA 5LJ5Y 2GHPA 3CMAS 1ZZFA 3CUNA 4C7QA 1O0PA 2G0CA 3LPYA 1VQ4S 2MKKA 1VQLS 4WKRA 2FC9A 5EN1A 1H2TZ 1WHYA 2MPUA 1M5KC 2DNKA 3CMES 3NS6A 3N9UC 4OZ0A 2M88A 2MHNA 3VAJA 3RW6A 4F25A 2M8DB 1FO1A 2CPDA 2QEXS 1FXLA 2CPEA 3CF5Q 4Y0FA 3ZZZA 4F02A 4IUFA 2KG1A 3P5TL 3SXLA 3V4MA 2KT5A 2M7SA 1U1KA 4M5DB 1YJ9S 1N54B 3FEYB 1K73T 2BOPA 5DM7Q 3MOJB 2MXYA 1WF2A 4ERDA 3CCRS 3I56S 2X1BA 3P3DA 3CD6S 3U1MA 1U1MA 1WG5A 2CPHA 3P6YC 2MZTA 2LXIA 1VQKS 2J0QD 2MKJA 5MLCV 1VC6A 2MB0B 1YITS 2DNRA 2JRSA 2CQIA 2RQ4A 3B4MA 2MMYA 2MGZA 2DHAA 5H1SV 2DNHA 1P1TA 3CXCR 4LMZA 1ZZNA 1YJWS 2NLWA 1KOOA 1VQ8S 3VAIA 3BO3A 5HL7Q 1SJ4P 2HGNA 3CCES 5DDPC 2N82B 1DZ5A 2KFYA 4LJMA 1ZH5A 5GMKa 2U2FA 1SJ3P 4FXVA 2OSRA 4RU2A 1VQ6S 1R8HA 2MJNA 2OSQA 5DDRC 1U1RA 1VQ9S 1VQMS 3MI7X 4CH0S 1WHWA 2B0GA 3JB9k 3SDEA 1BY9A 4YOEA 2DGSA 3K0JA 2CQHA 2AYEA 3LQVA 2RUGA 5LSOA 5LXYA 2XB2D 4WFAQ 1JJ4A 2F9JA 2KRBA 2LEAA 1WF1A 2DGWA 2YTCA 4UY8T 3MUVP 1XN9A 3CCLS 5GAHU 1A7GE 2FC8A 3S01A 3R27A 3UCGA 5DM6Q 1X5OA 2BZ2A 5DDQC 2FY1A 2KRRA 1A9NB 3BO2A 2HGLA 2I38A 2LMIA 2ZJQQ 1YI2S 1N8RT 1R8PA 3CTRA 4J5OA 4QPTA 2OJ3A 2LCWA 1CVJA 2JWNA 5D78A 4Y00A 4U67Q 2OIHA 2N7CA 1AUDA 2XNRA 2LEBA 1X0FA 2DNOA 2CQ0A 3G4SS 1S72S 1M1KT 3G8SA 2RS2A 3MDFA 2MQMA 1F9FA 1SJFA 1WG1A 3VAGA 1U1LA 2HZCA 2L9WA 4W92B 2MQOA 4V19X 5IFMA 2MZ1A 2MYFA 3FEXB 3S7RA 5D77A 5CA5A 2CQCA 2KU7A 2OTLS 1QM9A 2LQ5A 4C0OC 1OWXA 2LYVA 2DITA 1B7FA 2HYIB 2CQ1A 2OTJS 1H2VZ 1P27B 2G1DA 2J76E 4EGLA 3VAFA 5GAGU 2MZRA 1Q82T 4BS2A 3MD3A 2D9PA 1W2BR 2L08A 3CULA 5LXRA 1QVGR 3PIOQ 4YB1P 2SXLA 2CQ4A 1VQNS 1G2EA
chains in the Genus database with same CATH superfamily
2FHKA 4GKJJ 3ZFVA 2YKNA 2DO0A 1FXRA 2KT2A 2P8IA 4O44A 2Z2MA 1E6YA 3K8VA 1KOHA 2QFIA 2KZZA 1X4AA 4LFAF 4TY8A 2KDOA 4ZVGA 2KH9A 4PPDA 3D3CJ 2PEBA 1LK7A 1TKTB 1HI1A 3CC4S 3M9NB 2QG9B 2DNNA 2BKPA 2QX0A 2Z56B 5LSLA 2K3IA 3H42A 1M5HA 4ZPAA 1FXDA 4ED7A 4BHQA 3LP2A 4ES3A 5C24B 1R43A 2HBZB 2R8JA 1WHXA 1CLFA 2BJ7A 1UWAA 1N36F 4GO7X 2OD6A 4ZCKA 1C4CA 4K4XA 3Q8UA 2OUGA 5GMDA 1HMVB 1FDNA 1S79A 1YJUA 2ZOFA 5A76A 2AMCB 5CD4H 3IRXB 4XAKA 1WACA 1RWNB 4J9UE 4JI2F 1OIAA 1YZ7A 3BJYA 4RW6A 2V6AA 1AT1B 1WOOA 2NUHA 1SVDA 1CSJA 2V68A 2E1AA 2VHGA 1VHIA 1SPBP 2FVSA 3ILOA 3ZTSA 1HFEL 4NLGA 4YMEA 2YKOA 1TV6B 1LQ9A 3MM8B 2C22A 2F40A 4J9PA 1C0TA 2F9DA 2LKZA 3BYPA 2EFNA 5HLFB 7FD1A 1NCLA 1TL3A 3SSSA 2KM8C 1UMJA 1IQTA 2EKNA 4GRSA 2LFVA 1BUXA 4G6VB 3CCSS 1TL5A 3JSMA 3ONQA 1YK9A 2DB1A 1HKAA 1Q86T 1HNWJ 5J1NA 2BJ8A 1CC8A 4LRCA 3VVTA 2PIIA 4QPXA 3NNAA 5KFFA 3DLGA 3CJQA 2XMWA 2CNNB 2O1PA 4Q43A 1M5SA 3M2VA 3AHPA 3A12A 3LAKA 4K5SA 2OO4A 8ATCB 4P9SA 3ZZRA 3CIMA 1U2RA 3MPUB 2RRBA 2DGUA 3W9IA 4MK8A 3TAPA 4DL3A 2P6TA 5H9EK 4NPOA 5KFOA 4AQYF 4RX6A 3JQKA 2IJNA 3CCMS 4CO3A 1NPKA 1XMBA 1T3OA 4QYRA 3TUJC 2JZ5A 4ECXA 2DNYA 4X65J 5AXNA 1JLAB 4NEYA 4K4SA 4X4TA 2CJ9A 3D68A 3K89A 3KLEB 3MMBB 2FC9A 1H2TZ 2FVRA 1I94J 3TUZC 4LQ9A 5AE2A 2XBPA 3ZZZA 1RBLA 3PRDA 2KT5A 2NR0A 5E0OA 4ZCLA 4ERDA 3KXDA 3OL8A 1Q95G 4KKOB 1NB7A 1P9YA 3P6YC 4RUCA 1U0SA 2YNFA 1VQKS 4H4KA 3AA9A 9ATCB 2RQ4A 4KGVB 1RA6A 5H1SV 2NLWA 3KKFA 5C2GA 3IGVA 1JLBA 1OY9A 4O3QA 5KFJA 1DZ5A 1ZM9A 3HP6A 1HNZF 1HIYA 4J9NA 1B7YB 1VGYA 1V3RA 2CG8A 2CZVC 1BY9A 2ASJA 1ZM3A 4ZHRA 1FX2A 1NK5A 3MR6A 4IFVA 1QSLA 4OZ5A 2DGWA 4F50A 4IRKA 3UDEA 3KNAA 5DDQC 3Q8SB 2BV3A 2MQ8A 4OI1A 3CJ2A 4RW8B 1FRIA 4KH0B 3IBCB 1NSAA 1U8WA 4BC9A 1HBOB 3DFEA 4U67Q 1AUSL 2HMIA 2DPIA 2HIQA 3GPAA 2FQQB 3IP0A 3C3LA 3NCPA 2JFKA 1B7FA 4NMLA 3QFHA 4DG1A 2OFHX 2IC3B 4AT1B 5HMYA 1NJXA 3H98A 2LDIA 1YJ7A 3T5KA 3KLHA 4IYQA 2NQPA 1JKHB 3D2WA 4IFYA 3MM9A 1T03A 3BH6B 4EMDA 3Q8VA 2BMBA 2V5HG 1U6ZA 3RRGA 4LRAA 3GJTB 4GKKF 3L7PA 1N52B 4JI7F 1T9VA 3IAS9 2PMZD 2CNLB 1DLOB 1KN6A 4CQ1A 1HQUA 3HF5A 3KG4A 5LMNJ 4LBIA 1PO6A 3PNIA 3K17A 1U1OA 2F8HA 4I1TA 1FI4A 3DU6A 2NS1B 2IPOB 1UFKA 3W60A 4X4NA 5CQGA 3EDRB 1Y0HA 5FDLB 3I82A 3QLHB 4P72A 1L3UA 3DHWC 3HHLD 4CLZA 3FNNA 1K9MT 4PG5A 5ADZA 2V9KA 4JI0J 4ALZA 2G2ZA 2VBXA 3QT5A 1FVQA 1PGZA 5F8JA 2HVZA 3TA2A 2ZM6J 1QDUB 2YX4A 4HHHA 2MHEA 1CJUB 2JC1A 2UVRA 1RT5B 5ETRA 4ID5A 1K8AT 1BC6A 1CJTB 2UUTA 3TAMA 4M5MA 1X5TA 4DEZA 3I0SB 1IKVA 2FHOB 3ENQA 2FLLA 4PZVA 1R89A 1VMBA 4LVOP 5EX0A 3G86A 4DL0C 1HI8A 4MKAA 4ED8A 3G8TA 3V6DA 2VOOA 2DR8A 4IR9A 4P75A 3G6VA 4LRDA 4PXDA 1KS2A 1TKXB 1RYSA 1SV5B 3KHGA 4PWDB 2YKAA 2F4VF 1JNRB 1RXOB 5KFTA 1OYDA 2HZAA 1LW0A 2AD9A 5KFYA 4RW9B 3G6ES 2ZJPQ 5DS7A 4DV5J 4CO1A 1J27A 1JNZB 4JI1F 4LSNB 2ADCA 2BJEA 2LEPA 2D3O1 2UVVA 1IJEB 1NK7A 3PRVA 5A8KA 1RT2B 2J0XA 2PMHA 4Y2MA 2EK1A 3W63A 4PRFA 4O3OA 1Y3JA 2UZAA 1K0TA 1J2VA 4TQSA 2CXEA 2BANA 3NP5A 4RZRA 1CEZA 1E6VA 4AUKA 1RISA 2YWEA 4F0MA 1VK8A 5ETNA 3DYAA 2MPUA 4DQRA 4KAIA 4Z7CA 1TMJA 1HWJA 3LGMA 3M05A 1S6PB 4HEA9 1X9MA 1H7WA 2XMJA 2CPDA 4DUYF 4LF4F 1S97A 1VJQA 4KHRA 1TL1B 1RTDA 1YBTA 4MTPA 3P3DA 4CLWA 4X4UA 3RB0A 3U1MA 1WG5A 2J0QD 2V63A 2HHHF 1DFDA 4NWBA 4J9QA 4LMZA 1H38A 3NOCA 1FNMA 3OTOJ 3EWGA 3FMBA 2Z2YB 1XERA 4HLBA 2HGNA 4Z37A 1R8HA 5D0HA 3I32A 2HPUA 1IBLF 1FKPA 1YX2A 2QLBB 5D4PA 3SDEA 5LSOA 3SI8A 3KNGA 4D3GA 2OAUA 1XR7A 3MMAB 2OKQA 4GVLA 2WSEC 4C0HA 3OLBA 4MFBA 4WE1B 2DR7A 3GG0A 2FLPA 4NLQA 3C66A 5D4NA 4ECUA 2HGLA 1YI2S 5D3GA 1QTNB 4EZ6A 4K7QA 4WIQA 2JWNA 3IGNA 1EP4A 4A8SA 1SCJB 5J2PA 3HXMA 4DV4F 3KHLA 3FVYA 2L9WA 1B3TA 5K9FA 1CJVA 5B09A 2HYIB 4QIGA 2RF2B 1SC6A 1UL3A 2H51B 4LF6F 4DR1F 2N3OA 4I69A 2HVHA 3CCTA 3ZNJ1 3T1YF 1VOMA 5JVGQ 2KB2A 4HH1A 1NHVA 3TVZA 5L1JA 2GHVC 2AKWB 4BC7A 1DQAA 3LA0A 4QU7A 1SH0A 3BQ1A 2ROEA 1U6BA 2HNYB 1X31C 2GFFA 3F44A 2OH2A 3POTB 3W2WB 1D09B 2QTWA 1URNA 1ULRA 4C8NA 3MM5B 1NDKA 4EBDA 4FYDA 2XO6A 3W2VA 5K14A 3UN3A 1Q53A 4C8ZA 1RAOA 2MKCA 1S6QA 5A6WA 5KFCA 5G0RA 2XNQA 3HHLA 2E5HA 4P10A 4DUTA 1JJ2R 2DGOA 1VBZA 3EX7B 3GZ7A 3DMJA 3GYNA 5EDWA 2RS8A 2FZKB 2X3GA 4ED6A 4IG0A 2Q6BA 2E1MC 4CRJA 4AL7A 5IWAF 4JV2A 3TAQA 3R9LA 3T1HF 4OYBA 1GT8A 2FZCB 2CJBA 2ZZMA 2IVYA 1RAEB 5KFSA 2QYGA 4LUBA 1D0EA 1TL7A 3RZAA 1WC1A 4NLSA 3RUBL 1VC5A 2I2YA 1RI7A 1HNXJ 2RT3A 2ADBA 1Q8IA 4DV0F 3DRRB 4LR7A 1IKYA 4A8XA 2V0NA 1NKBA 4DR2J 1EKSA 1FK9A 1FKOB 3A3NB 1LWCA 1KQFB 4NI2B 4UOFA 2KHCA 3ZNUA 3JSYA 2YNIB 4O23A 4IDKA 2FJWA 4P71A 3ZZYA 3LP1A 4FF2A 2DNPA 3EPIA 2M2BA 4J37A 1NU4A 5B0EA 1XBWA 1FNXH 2ZNZA 2DR5A 2KYZA 1MWQA 4DL5A 2GVZB 5HJYA 1DTQB 4UOGA 2HS3A 4I7FA 5ETTA 2F8EX 2ZZTA 3UNGC 1LFPA 1OMSA 2ZKUA 5LMUF 4LBHA 1OQ3A 4FYVB 2HSEB 3HFZB 2OMLA 3NGKA 5AE1A 4TU8A 1GFWB 3O3LA 3MEGB 2FUG9 1VBYA 2ZITA 3CGIA 3OUYB 2UU9F 1XIQA 3IM8A 4RWWA 3E2EA 3ZZ0A 4N47A 1HMVA 4DSEA 2Z4PA 2VICA 3KLFA 3W7BA 1N6QA 1SUQA 4O0NA 4NEZA 2M5YA 2OHDA 3NGSA 1ZZFA 3RRKA 1R6VA 3R8YA 4ZLNA 3LPYA 2KVQE 4LF5J 4C6AA 2IM0A 2GIFA 3MTJA 2R9LA 2W2NP 1TV6A 4F25A 3DOMA 2YWGA 2HFZA 4C8MA 1FXLA 1FJGJ 4FYYB 3WC2A 2W9AA 2M7SA 4KHPJ 5E3AA 3JAMY 1WNEA 2VJUA 1VBKA 2BJDA 2X1BA 4ZPVR 5ETVA 1JIHA 2CPHA 4C48A 3IS9A 5KAKA 4EK2A 4NXMJ 4RW4B 3ET6A 2O66A 4USMA 1SKWA 4MMOA 2PFDA 2RKIA 1WKJA 2C2RA 3IFEA 3OSNA 5DDPC 2N82B 2KFYA 2HFSA 2ZH4A 3CEDA 5KFZA 5F3TA 4RU2A 4L73A 1ZYQA 1SQEA 3EPGA 4UZCA 2A2CA 5LXYA 1NMEB 4LF2A 4KFBB 3PKYA 2YTCA 4OYIA 3MUVP 2RB7A 1FD8A 3C6TA 5EX3A 5I3QA 4ZPCA 2UXCF 2P9EA 2G0JA 2DR6A 4B9UA 5ETKA 3T6JA 1CS4B 3PJ9A 1H0HB 1V5IB 2G9OA 1PBUA 3B78A 5E2QA 4ECTA 4MKBA 2CQCA 2VH7A 3AD8C 2XY6A 2HWTA 1OWXA 5ETPA 4A46A 2R8KA 3HD2A 3TX8A 3D0IE 3PIOQ 2H4WB 1SXLA 2C2OB 1YSJA 3N6NA 1HW8A 1FHTA 3IWXA 3MTKA 1M0SA 3LH2S 2B9YA 2RH3A 2BKOA 3TR5A 4WF9Q 3EDQB 9RUBA 4I56A 4EI2A 1JLQB 4JUZA 1TFWA 2XY7A 4ECWA 2E1CA 3RR8A 3UN5A 4WKYA 1T3NA 3TYTA 4OZ3A 4BWMA 2YKPA 2KI2A 2BACA 5F8GA 3B6BA 4M5IA 5CCLA 4CO0A 5GAGI 1YHQS 1FJ7A 4UUWA 3W9HA 4BCAA 2Q43A 4U95A 2CPYA 4B9LA 4WYWA 1NKEA 4FNIA 3ETOA 2EPIA 4AFFA 5RUBA 2DH9A 3OFFA 4F26A 4MKYA 1S1VB 3DRSA 3ICLA 2AJ4A 3H4DA 1RTJB 3GFZA 3CD7A 1PBAA 4YHHJ 3GQCA 2DBBA 4E8UA 3CJSA 5IOLA 2DCLA 1NRKA 4L3NA 3OL6A 3M32B 1S6UA 1RT7B 2LU1A 1T8EA 1HD0A 1QAIA 5CYJA 2WTFA 4A8MP 3DGPB 1TKDA 4DPTA 4P2FA 4CO5A 3HMJG 4JI6J 1NAQA 5C2CA 3DLKB 4UF4A 1HBUA 1RHUB 2HWIA 4ZPWR 2NXEA 5DDOC 1U48A 3QT6A 2I1RA 4DV2J 1WOSA 3PYDA 1JMTA 4ZS6A 1SIWB 4FZVA 5IV3A 1T7PA 3VAKA 3E8OA 2XQCA 4MYUA 3NXZA 1FD2A 4EO6A 4DQQA 2OPPA 4Q5VA 3SYZA 1F5BA 1TQLA 3O8WA 1MLAA 2JC0A 5F8HA 4DR4F 3EM1A 2DK2A 4DL2A 2JH3A 2X7IA 4OYAA 2GMHA 2JLEA 3JYTA 2MKYA 5T14A 3DLHA 3KK1B 4X65F 1MWZA 4QQBA 1DTTA 1V6HA 4PYAA 1HWLA 5CABA 5FDLA 1C0UA 4K8RA 3BGLA 1BD6A 3UWTA 5CYQB 1GXLA 1KLMB 2DTJA 1RBOB 4LFBF 1UEVA 4PXBA 1I94F 4PCQA 4CH7A 1IR0A 2IYGA 2VBWA 2Y1IA 1QUPA 2ZH6A 1WJ9A 2KT3A 3DI6B 2W8LA 2QLXA 4OIXA 4FP9A 1U8SA 3ILIA 1N0UA 3MOZA 5DLGA 2H65B 1NH7A 3FMWA 2FVCA 3I96A 4MYTA 1XMOF 5DJBA 4ZLPA 1Q7LB 3G2XA 2QEXS 2VG6A 3ITHA 4ZCMA 3TJ9A 3QO9B 4F02A 3V4MA 1XNRJ 4TYBA 3TJ8A 4L75A 2QMUB 3M7VA 1Q5VA 2HHPA 1HR0F 5HJXA 4KHMA 4P7TA 1AW0A 4Q2MA 2MB0B 2C2ZB 1JWWA 2OELA 2MGZA 4R8UA 2PD1A 4Y65A 1TR0A 1UA1A 1B70B 1KOOA 3SV3A 1RAJA 2FJVA 3KTQA 1VHFA 3I4PA 4RL1A 4USTA 4KPCA 5EUHA 1MROB 1T11A 2GX8A 5CH7B 1VQMS 3VV2B 4JI3J 1FFSB 1S1TB 4EUVA 2QJ3A 3RBEA 1HW9A 1MN9A 2GC8A 1F5AA 5AT1B 4UY8T 2XHWA 3DGVA 3SEOA 1O8BA 2YXLA 4J9RA 2FY1A 4X66F 2PSZA 2LMIA 4CYUA 3BF4A 2WVCA 1BQXA 1HHSA 3BSNA 5B0AA 2W2QP 1RT2A 3QGHA 3DXSX 1X8DA 3I9V9 1KQGB 2WVEA 1M1HA 3BGRB 5KFPA 2ZBRA 4K2XA 2LYVA 1H2VZ 2XTJP 3VAFA 3FRZA 3MCOA 1QAJA 3CULA 3GB0A 2HAIA 2R7RA 3CDEA 1NEEA 3V6JA 3G71S 2HFVA 1HNVA 4KRWA 1GH8A 3G9CA 4BLGA 3VGSA 3I55S 1XTZA 2XMTA 4B9VA 4B9TA 2HQIA 3A4TA 1DBDA 2CPIA 3ZTRA 5E3PA 2YQ1A 2LXUA 5IT0A 3BBFA 4WTYA 1H3DA 4YFUA 1APSA 2CJQA 1C1BB 2DH7A 4RNHA 2PI4A 1U25A 1HBNA 5CYMA 2AX1A 2ASLA 2QC3A 1VCTA 4DPUA 5DRKA 1AXQA 1LWXA 2ZH2A 3TRGA 1R8BA 2L9NA 1Q1KA 1RT6B 3BH7B 2J6UA 2XC9A 4OI6A 1MG7A 4DV3J 2GA7A 2V2VA 2HHTA 3OFEA 3RU0A 4ICLA 3NWGA 5D6GA 3M9MB 3LGHA 3AQPA 3ULHA 2QE5A 3MMCB 5KFHA 2VA3A 3TP2A 3VZHA 4ZP6A 1RT4A 2CA9A 4ITSA 5FLXU 2HQGA 3SBMA 1V9OA 1FRHA 3HJVA 3N01A 3MUMP 1YGYA 3MR5A 1PG5B 3CSKA 5B0BA 3FBCA 1BGXT 1YJRA 3HSGA 2C2DA 1F3VA 4DU8A 1PJ6A 4MJKA 4BWJA 1HQEB 1JLEB 3R5JB 2RQKA 3CO0P 3THTA 2JNJA 2PT0A 3VGTA 1BLUA 3GCXP 3UQSA 3HHKA 1S4EA 1S0VA 4FF3A 3TWZA 3G87A 2PMWA 4YB7A 5DG8A 5I3UB 2RRNA 2JVRA 3VF0B 2GS8A 2GJFA 2UXDF 2YKNB 4AXJA 2WOMB 1FEHA 2DNLA 1PJ5A 4O44B 4HT5A 1E6YB 3OV7A 3A13A 2B3TB 1WC6A 4WFYA 1ZS6A 4CIOA 2H9ZA 3HULA 5IQQA 4TY8B 1F60B 4MAKA 2DGTA 3KJQB 2JX2A 5IQ6A 2W4DA 1B64A 2YWKA 5IC4B 4RW7B 1VQPS 4FPIA 3MUTP 1QTMA 4X4QA 2HNYA 4ED5A 2MQLA 3CC7S 3QIPA 4ETXA 3W2WA 4I2PA 2X3DA 4MKVA 2HBQB 2QO3A 2ZZNA 3OJUA 3HHNB 1RCOB 3AB2B 1L3KA 5F8MA 4WFNQ 2ZH9A 4MIBA 3R5CA 1U6FA 2IM1A 4G1QA 7AT1B 5KG6A 3CJTA 2DPJA 4AE5A 3RTVA 3AH6A 3GFXA 4LT6A 1TKZA 2EFOA 3ISNC 1RKJA 4RW6B 5SZTA 1PAUB 4G1IA 3CJKA 5KFRA 2RVJA 2L9DA 2DH8A 3KDNA 4YY3J 2F5GA 3BSAA 1MMLA 2NXUA 3WX8A 4OI3A 3QATA 4AXIA 3CMAS 4C7QA 3DOLA 3T3FA 1NK6A 4OYZA 1M5KC 4CLSA 4DCPB 1C0TB 3VAJA 2WVFA 4HTJA 4PWWA 2XMKA 1TL3B 3WIVA 3I87A 2KG1A 1S1XA 5KFVA 4ZVQB 3JSMB 2Z58B 4B9SA 1VC6A 4O3SA 4CI0B 1S9GA 3CXCR 3DLGB 1VQ8S 5HL7Q 3DKDA 4LJMA 5GMKa 3PX0A 1W7WA 3M2VB 1LXNA 3BB5A 4CT8A 3H25A 4HKQA 4ANEA 3Q8RB 1T05B 3K0JA 5LSRA 2B56A 5IS2A 2KRBA 1TUGB 3K59A 5GAHU 4ZIWA 5DM6Q 3G8QA 3EUNA 1RGVA 1FRJA 1DY3A 2OJ3A 5J2MA 5D78A 3MEGA 2A0FB 1K0VA 3EGWB 3AJDA 5KOWA 3GTYX 4LF1A 4NA2A 4DX5A 1YLXA 2V8GA 5KFKA 3TX0A 2KU7A 1FCAA 3MCMA 4K4VA 1RHJB 3HHDA 1LK5A 1I6JA 3D66A 2FVQA 4B3SF 2ZBCA 2QRRA 4ZJQA 1I51B 4YEAA 4KIAA 4UTGA 3D54A 2XLJA 4BDPA 1KHVA 2CQDA 1W25A 3GR1A 3OVSA 2CQBA 1MU2A 4OLOA 3MGJA 2UP1A 2YNFB 1EX8A 3WQPA 4XTTA 2FHJD 2WBRA 2E5IA 4ZLLA 1RP5A 1X4DA 3H2UB 4ZN3A 1U49A 2F7VA 3DDKA 1GMVA 5L39A 4Y2KA 4TU9A 1JLBB 3GJRB 2QLWA 4HVZA 5DQGA 1MSWD 4GC7A 1FJCA 4NZ6A 3AJ2A 3U1LA 1AA1B 4S0MA 4U8YA 4WPAA 2LECA 4L3KA 4ZHRB 2Y0BB 1F6TA 4HI2A 4IFVB 2W2OP 4WP9A 1Y5LB 3FK4A 2DY1A 2H5EA 2LQ8A 2P2CB 4LF9F 1RDRA 1N33F 4P2XA 2I9SA 5JMNA 1HNXF 2RD5C 4NRTA 4DV7F 1UVNA 5ETOA 4CO2A 3CJ8A 4DUZJ 1HWIA 2VFRA 3CCQS 1J5EJ 2BJ1A 4OX9F 3WC0A 4JBCA 4B3MF 2MZJA 3DHXA 1S10A 4DLEA 3WHIA 3AJ1A 4JI8F 2B7CB 4MK9A 1OSCA 3NS5A 1BQMB 1RAHB 1U2FA 2G2YA 2IRYA 1NZAA 2IDEA 3KLHB 2EXUA 1Q16B 5ETMA 2V4JA 3OR2A 1VYAA 1UAWA 4IFYB 1LWEA 3MM9B 3IC1A 4QW9A 1T03B 3QZ8A 2O5DA 4M5DA 1R31A 2HS4A 2FJEB 1R0BG 3HLUA 2IJRA 4F4YA 5CZVA 3X1LB 2DRDA 4DLGA 1FWLA 2EK6A 4ILMA 3D6TB 4QBUA 1HQUB 3CJ5A 3BKUA 3EXYA 2EC0A 3HJFA 2XLKA 3HSDA 1DHMA 2LQBA 2O67A 5H9EJ 2ILZA 1RE1B 2FJBB 3N79A 4EU0A 4O3PA 4IRCA 4LR8A 1EJ7L 1HPZA 3EE3A 3KLIA 5D0RA 4DL7A 3UN2A 2CQGA 1RU1A 3LALA 3RR7A 4FF4A 2IIHA 4P74A 4I68A 1GTHA 3OR1A 1DRZA 4ZJLA 4X62J 4ID5B 4KHPF 2UUAJ 3ZXWA 1U1PA 3LF0A 3EXCX 3ZZPA 4C3LA 4C2MA 5KFUA 1RWKB 1H72C 4RUHA 2J8SA 3CUNA 3C19A 1O0PA 1IBCB 3HX9A 1C1CA 2GMLA 1IKVB 5DG9A 5E3CA 3HD1A 1F2HA 3M32A 3R7SB 3BKTA 1WHYA 3V6HA 2DNKA 4ECSA 2ACYA 4J9VA 4URQU 3NWRA 1F5CA 5HAOA 3IAM9 2HNDA 4ZVOB 3V6DB 1FO1A 4KPYA 1WUUA 3W64A 4DCJB 5L1KA 2Y3YA 5D15A 3MOJB 1O5JA 2XYGB 3VVUA 3ZTOA 3AXMA 2B5JA 1P1LA 1X60A 2ATCB 1KVKA 5K20B 3K5MA 2J7WA 2MKJA 1IM4A 3D1QA 1O6XA 4ZOSA 2VBZA 2E9ZA 2RAQA 3GCWP 5BR8J 3EJMA 1LW0B 4C8KA 1GMWD 1KTQA 2YX7A 3HHEA 4W4MA 4CH0S 2ZUAA 4CLTA 1J5OA 3QAEA 3HT3A 3LQVA 3NGTA 1KR4A 1Q79A 4NX9A 5KFWA 1D3WA 4DN0A 1JLFA 1IQZA 3UVJB 1QD1A 3BM7A 4DI6A 5KFLA 4UUXA 5A8KB 2CYYA 2ZH3A 2BW7A 4A8QA 1VLYA 2DD8S 2UUWA 4G3IA 1T0TV 5EHHA 2ZD1A 5A0YB 2WSFC 4RNNA 4DR3J 1S72S 3G8SA 3MDFA 3UR0A 1SJFA 2BANB 2EWHA 2MZ1A 2PFFB 3S7RA 3CD5A 1UTAA 4C0OC 3IO1A 4EGLA 2H4YB 4NLVA 3DYAB 2D9PA 4EBEA 4R5PA 4YP3A 2ASYA 3QGPA 2RHSB 1RT1B 1TMMA 2DHGA 4A8WA 2KKHA 4RBTA 2M8HA 2BABA 3OTBA 1JXLA 3MM6A 1IBMF 2ZEJA 4OYOA 2GW8A 2MKHA 5GADU 1X5SA 4W98A 5L38A 3MM7A 2DIVA 1KVJA 4K0KJ 5FD1A 3OXFA 3M8QA 3QRPA 4LRFA 4B9NA 2KFNA 1N5QA 2RQMA 1RTZA 3NMRA 3G82A 4DV6F 1KLNA 2N3LA 5F0WA 4RU9A 1HD1A 1U0HA 2C3YA 3E01A 3ENVA 2I0XA 3MCSA 1FKPB 3SDEB 3M2UA 2HHQA 5BJRA 2W9BB 5KOXA 4I2QA 1N34J 3HSJA 3VGUA 2LA6A 3IRWP 4MFBB 3G6YA 3MXHP 4EBCA 2GVDA 4O3NA 5THWA 2DHSA 3S8SA 5B0GA 2G0IA 3RBDA 1KONA 3M8PA 2DNMA 3DRPA 1WHVA 1EP4B 4N8NA 3PXGa 2MDAA 1SQGA 3HZEA 1FRMA 2C2NA 5J2PB 2WBMA 1Y00A 2EG2A 3D1HA 4IO9Q 2V2QA 1VK3A 1CJVB 3KJFB 3VAMA 4JYAJ 2RMLA 3CCWA 2ZVIA 3ISND 5A8RA 2Q3PA 3O5TB 4UOCA 4ZJOA 1B99A 2W7AA 4JI5F 2BR0A 4DS4A 2F63A 1G3OA 2FGCA 2B4PA 4ETZA 1Q8LA 5IC6B 5K8NA 3TANA 3K2YA 4PXCA 4EWTA 4YR0A 2M3DA 4JV5J 2QV6A 3BEGB 5B0DA 4ES2A 5IV4A 4F4ZA 2GAGC 5HI7A 4USVA 2YH1A 4JV1A 1IBKF 3M8RA 5HQMA 1Q0NA 1URRA 2COLA 4FDFA 2R7XA 2HHVA 4JB8B 1YIJS 3W2VB 3LGNA 5K14B 5DGAA 1RT6A 4F2SA 4LFAJ 3THPA 4DCOB 1S6QB 2EC2A 4RNFA 1UW4A 1S1UA 5G0RB 1UP1A 3PIPQ 3HHLB 2VL1A 4ZN1A 3O44A 2YKQA 2GQCA 4UW2A 4F4AA 1FKAF 1OJ4A 3A3OB 4OX7A 1RA7A 2NXJA 2ZBQA 1FT8A 3KFWX 4DU7A 4IG0B 2YWHA 4DZ6A 5JVHQ 4EZ9A 4UQGA 5B0CA 2QN6B 2MZSA 3CC2S 5F9LA 3J7YI 3DCAA 2XHCA 3FSXA 5CHCB 2YWWA 1JQGA 3DLBA 2V34A 3RJMB 3BR9A 2CVEA 4HYKA 2UUCF 1N5SA 1JLEA 1TL7B 4LRBA 2V50A 2HKEA 3UW1A 2B9XA 3TOQA 3SZ2A 5DZ6A 2MKKA 4N5SA 4CNYA 2VG5A 3OD2A 1IKYB 1HARA 1Z1ZA 1T9YA 2AJ2A 1FK9B 3FCWA 5A8WA 1LWCB 2WOMA 3P5TL 3GIIA 1JXEA 3FKBA 4RO0A 1S57A 4OX6A 4TXSA 3I56S 4IDKB 3LP1B 1TK0A 1LOUA 1N5TA 4G65A 1G4CA 1IXKA 2DNHA 4Y6IA 1KFDA 2ZC3A 4K4TA 1GMWA 2Z2LA 4I7FB 4RW7A 3VZIA 1D1UA 3IBWA 2OSRA 2ROPA 3ZTPA 1SKSA 3CT9A 4LF7F 2VUGA 2Y8YA 3GU0A 3L95X 1L3SA 1NBEB 1XQIA 4NE9C 3PJWA 2VIHA 4DR7F 1KKHA 4U7UK 1IM6A 5ETQA 4M5LA 4A47A 1DQ9A 2ZH8A 3LW5C 1RYRA 4X64F 3TA0A 3J80U 2OIHA 2LEBA 5E5NA 3KLFB 1M1KT 2A6MA 1N6QB 1NKCA 4JOUA 1SUQB 5L1LA 2HRYA 4USJC 1VRQC 2R42A 3N4WA 4K2JA 2AEJA 1FVSA 4P7VA 4BS2A 4AQYJ 2ZHAA 5KG5A 2XMVA 1QVGR 4OV1A 3HSZA 3BZQA 2RIJA 4JI4F 1OY6A 2CG4A 3EGZA 3N6LA 3DOMB 1WORA 2DHHA 1N4LA 2CVIA 2GZOA 3FEZA 1RWPB 1RUSA 3SCLE 4FN5A 3IS9B 1X4GA 4A8FA 3M8YA 2ASDA 4ZPBA 2KXFA 2XLIA 4TU7A 3ET6B 4KB7A 3C16A 3L09A 1YRXA 2RKIB 1LNQA 1IWGA 2Z30B 2DNGA 2VQFF 4ZCIA 2MQNA 3HK2A 3UDLA 4NA1A 3A8EA 4PQUB 3I0RA 4QR2A 4KGXB 5GAEI 5C25A 2H5IB 5I42A 2IRUA 3NNCA 3FQLA 2H5JB 3C6TB 1T05A 3H20A 2OLWA 2HS0A 1QY7A 1F9HA 2XZWA 2LA4A 2BVZA 2CPFA 1HNZJ 1VRUA 1BMQB 1OPIA 1FTCA 3M30B 2YKMA 5KG0A 3VWSA 3BDEA 3L9ZA 4X4SA 3Q8YA 2RHQB 1RABB 1N5YA 2M4MA 2V8VA 4WBFA 1D8ZA 4Q0BA 1KVIA 1L5UA 3SQGA 4HI1A 2XG8A 1HLWA 2L41A 4DR6F 4PG8A 4QJVA 2ZWOA 5K8OA 2FD2A 2W1BA 4B08A 3BYRA 3EVMA 5L46A 2XMAA 3MPVA 2HBRB 3RG6A 2XM3A 4B3TJ 3QYYA 1HYSA 4P2MA 1YJNS 3TQEA 3AODA 1TTHB 2JEGA 4RNMA 3Q8PB 3GYGA 3X3UA 2QL5B 1TU0B 2KM8B 4NCBA 2F3JA 2AEMA 1PC5A 3QAUA 1RBAA 3CCUS 5A2QU 1DAXA 3MEDA 2FY8A 1JK9B 3KMQA 2JEFA 3D0GE 4ECQA 3SSQA 3CDBA 1T02A 4O4GA 4GKKJ 1NPRA 1REVA 2J0SD 1YG0A 3FFIB 5D4LA 1BWEA 3J7A1 1CULA 3DRSB 2F1FA 4PKDB 2MQPA 2XYPB 2VODA 1X5PA 3HO1A 3HCXA 4YDXA 2CPJA 3BV8A 4OZNA 4OQJA 2J6TA 2V9WA 1RADB 3QJLA 2IHR1 5L9NA 2HFNA 2Z57B 1RJJA 2G0CA 2DCUB 3V81B 1HBUB 1IUJA 3NCQA 2M88A 4RBUA 1FEEA 3I6PA 1BQMA 3D5MA 3AOBA 4YN3B 3QQCD 4IUFA 3OLAA 1Q5YA 1KEKA 3CCRS 3NGDA 2OPPB 3QT7A 4OMFG 2RDJA 4GMKA 2MMYA 2QL9B 5B08A 2MLXA 1NJZA 1P1TA 3MR3A 2V8DA 1IN0A 3BGUA 2GIRA 4HHUA 3JYTB 2U2FA 4G1PA 4C98A 4KGMA 5DDRC 3TNVA 2I8EA 3PV8A 3JB9k 1NNDA 1DTTB 2PC6A 2F4VJ 3SSRA 5J2NA 3GYXB 4DWIA 3CCLS 4IR1A 1A7GE 1C0UB 3HT0A 4FS1A 2R7TA 5F8LA 3KMSA 1WC5A 3M1VA 1R8PA 4QWBA 3CTRA 3MEEA 2CRLA 2BJ9A 1EIYB 4K4ZA 1CQMA 4GVBB 2N7CA 1C2PA 3D6HB 4JI1J 1F9FA 3UNYA 4KQZA 1QSSA 4U7UD 2ALYB 4DFJA 3OHBA 5CA5A 4CLPA 2LQ5A 5AXMA 2OTJS 2OGUA 2SXLA 1G2EA 3ISZA 5F3ZA 2ZOMA 2VG6B 3ITHB 2CJXB 4CLKA 3TVYA 3ZZTA 4DSFA 3IBFB 3R5DA 3M6UA 3GFHA 3AD7C 1CPZA 2A1BA 4YR2A 3RAMA 2DNQA 2W2PP 4LBPA 3T1AA 2ZE2A 4E2FB 2MGZB 4R8UB 2VQEF 3DC2A 3N5BA 2FLNA 2YH0A 2X1AA 4WJBA 1ROFA 3U1NA 1NDCA 3AOCA 3LP0A 1ACMB 2WVBA 4LF4J 2X51A 2UXBF 2Z0GA 2IMOA 4DDFA 2E9RX 2N4CA 2HHHJ 3OPKA 5FLXY 1UWBA 1RWWB 4YB6A 1H2UX 2HIYA 3KLVA 1JB0C 1NSQA 1RAIB 2WVDA 4FKYA 3SCJE 4H4MB 3ZTQA 5KFDA 2VBYA 3QJJA 4CYUB 2W9CA 3FBEA 5CZXA 4EYHB 1IBLJ 3ZZUA 4F4XA 3UVJA 2HQDA 1FTRA 2XMMA 3MHYA 3BKFA 3GFYA 2RQCA 3M9OB 3PW5A 3CJRA 3UCUP 5A0YA 3SCKE 4PABA 2HQFA 3N0VA 4NLRA 3JQMA 3UCZP 3HVTB 2MKSA 3CIZA 4LREA 1TP7A 2XGQA 3D7SB 4B3OA 1R8AA 2QFJA 2R2RA 1OSDA 3KLGA 2B9WA 4DXLA 1AROP 3OHAA 1UEKA 2VG7A 1HNVB 4BBYA 2VDHA 3LAMA 3H59A 3R7NB 2FPHX 1U47A 3PDNA 2ERRA 1U1NA 1RT1A 4ECVA 3Q8QB 3BSCA 2CFXA 1HBNB 5CYMB 2EW9A 2E7XA 5DG7A 4IOCQ 2HZVA 3R1HA 2HBYB 5I4MA 4DR1J 3M8WA 3T1YJ 2WW8A 5KFQA 4B3RF 4ICLB 4KV8A 3TI0A 4CNZA 3OSPA 4Q45A 3BN4A 1VQYA 4NXNF 3AOAA 2PI5A 4TY9A 3PM9A 3HVWA 1FWKA 2E66A 1RT4B 3FQKA 1X0PA 3IM9A 4CT9A 2W9BA 3MFIA 1CJKA 3HZGA 4ES1A 2ZNYA 4DPWA 1X4EA 4Q8FA 3VGVA 4CWBA 3RBXA 1RWOB 3R1LA 4ANCA 3OTEA 4WFZA 2YPZA 3CWJA 2VDIA 3J7Z5 2IVFB 3QIDA 5J2QA 2B8PA 1RACB 2NCKL 1GK8A 3NG8A 1LKZA 1O51A 1S12A 1YRTA 4UT4A 3IA0A 4L6V3 1XMQJ 1VQ4S 2FGOA 3PO4A 3IWLA 1VI7A 3A1YG 1WC0A 3NS6A 1NK9A 5BR8F 5IWAJ 4LF8F 3T1HJ 2FZGB 2BW2A 2KTQA 4KO0A 4NYPA 3FEYB 1K73T 2EBGA 3PVXA 1KHWA 4RWXA 1B4SA 2IYIA 2EI5A 4LSLA 4TQRA 3WIUA 1YITS 2DXFA 4DV0J 4ZK7M 2GJ2A 1DQ8A 5I3PA 2ATLA 3RB4A 6FD1A 4RR5A 1KNZA 3QIPB 1XWLA 3FRYA 1ZH5A 4I2PB 5D4OA 5HVGA 4QWEA 1VQ9S 2B0GA 2XULA 3GV7B 2DGSA 4DR5F 1R0AA 4ED4A 3C6UA 1RTHA 2XB2D 4WFAQ 1NSKL 2QMXA 4FXDA 3VHQA 4G1QB 1LV5A 4ED2A 1EETA 2HHSA 4KR0B 2GV1A 4IG3B 1KQKA 3IR5B 5MAOA 3UCGA 1TKZB 2BZ2A 3MECB 1A9NB 3LO3A 3RYLA 4ED3A 2LCWA 4DL4A 3CJKB 4OLPA 2HRTA 3ELHA 2Y8WA 4OI2A 2AJQA 2BDPA 1U1LA 2J9DE 4LFCJ 3F0NA 5HATA 1IKXA 1QM9A 2VPWB 3DOLB 5KFXA 2BE9B 1OY8A 2UU9J 1I3OB 4NLDA 1UKUA 3U7JA 2GJIA 4NL5A 3FBFA 4DX7A 4U7CA 2QT7A 1K1QA 4DL6A 1F1BB 2DISA 3UI3A 1S1XB 2VONA 4WFXA 4I6WA 2B9EA 3QZ7A 4TLQA 2FHMA 2WRMA 5EWGA 1PJ7A 2IAJA 1N34F 4OL8A 1WSRA 4C4WA 2D3ZA 2HNZB 3VCDA 4K59A 1OPZA 2ZWPA 2GGPA 1S9GB 3DOKA 2YNHA 4F4WA 2DGQA 4LSZB 4ELUA 4HL9A 2GO9A 3TJAA 4DSIA 1QUVA 2BBEA 1NUEA 1Q78A 5IXUA 4ZVEA 3HVRA 4OHVA 5LJ3Y 3MMJA 3EGNA 3JTNA 2W2MP 2DNZA 2KFZA 1PC4A 3TZWA 3OXLA 4HHJA 1JLCA 3EZOA 1AZSA 3GSIA 4LIRA 4JYAF 4C3KA 4WTOB 2M0GB 2B6AA 3S6EA 4C0BA 1JXVA 3Q89A 3GLJA 2YVSA 1LW2A 4I6AA 5J2MB 3UD4P 1WI8A 4DBQA 1KFSA 1SC1B 3UR3C 2MY7A 2JJ4D 2OPSA 3H0PA 2W4PA 3QPIA 2HVEA 1BQNA 2D69A 3VALA 3J7AN 2WCXA 1RT3A 2UXCJ 4ZP7A 1VRTB 4OHXA 2POKA 4RPFA 1N48A 2M52A 2G1HA 2VOPA 2KZMA 3P45B 4ER8A 2X1FA 2A3JA 2D1CA 3T41A 4V19J 3PHTA 4B02A 4WK1A 7FDRA 1MU2B 1SC4B 2VPYB 2AGOA 1SL1A 2Q79A 4L72B 4KSEB 3DU5A 1EQ0A 3UE2A 5KFMA 3IMQJ 3CE8A 1FX4A 1UA0A 4ENOA 4J9OA 3S1TA 5HP1A 3SMZA 3T5LA 5T7LB 8RUCA 1HNIB 1QJHA 3DRYA 4CTAA 1U02A 4DQSA 3I9ZA 1UFWA 2JDJA 3NBPA 4PQUA 2L3MA 4WWSA 2K06A 1VR6A 5KTQA 1IKWA 4RUBA 3R5AA 4N41A 4DF4A 1FRXA 4NZ0A 5C42A 5HQ8A 4XDCA 3PR4A 2R7WA 3H4BA 4GKJF 3K58A 5EWFA 2YPYA 1P9QC 3M30A 4ZA1A 2NYHA 3KG1A 5AE3A 2W4CA 3MF5A 1ZPVA 1VQLS 4WKRA 4TVAB 3D4JA 2OD4A 1S49A 3GWCA 4MIWA 2V4JB 3OR2B 3OTCA 5LOQA 3PW0A 1LWEB 4ECYA 3RW6A 3U27A 3TUPA 1T9TA 5KFIA 2CPEA 4Y0FA 2PN6A 2DYAA 4M5DB 2E9TA 2XSJA 1F0XA 3ZZOA 2I5JA 3AAWB 3M2RA 1MN7A 1UVJA 5MLCV 2CQIA 4D3HA 1LWFA 4PWUA 3V6KA 4J90A 3MEKA 2R2SA 4I6YA 3CCES 5KG3A 3TEGA 1U1RA 4L74A 5L9XA 1HHTP 2WK4A 1CC7A 3GV5B 3THVA 1WTFA 1REGX 1QLNA 1HPZB 3A8IA 3KLIB 4NLTA 1AFIA 1XN9A 4DR4J 1C4AA 3FFIA 3KJVA 4J7CA 2OPRA 1VISA 2VKZG 2GCFA 3OR1B 1ZPWX 3NGUA 5KT7A 4PG6A 2AWZA 5IZHA 4N7TA 5A6PA 2W25A 1L3TA 2KHDA 3W8PA 2MQOA 3FEXB 4OI0A 1YVFA 2PGCA 1C1CB 5CD4A 2CQ1A 1Q82T 5GAGU 4I0WA 4DOZA 3MD3A 4DJBA 4LFBJ 2L08A 5LXRA 3ZO7A 4OHWA 2ILYA 1VJWA 4DFKA 1HNWF 2KXHA 2HNDB 5E7OB 3V81A 3P4UB 2D74B 4QWCA 1B0TA 4KGKA 5HVHA 3H5YA 3N28A 2UV8G 3US5A 3MPYA 3L7OA 2B5JB 1PSDA 2DR9A 2QSWA 3IWNC 1TVRB 4CM0A 1U26A 3W66A 3KK2A 2HQCA 1H98A 2KJVA 1XMOJ 5IT9U 1M90T 4MK7A 1CQNA 5KFEA 3V4IA 4M95A 5EWEA 1FNOA 4B9MA 4TYAA 4DN9A 2G13A 1J5OB 2K1RA 1HR0J 1WDTA 2AYBA 1Y9OA 4RLEA 4WU2A 2HLUA 3KK3A 1KDNA 3CCJS 5IM0A 4OJHA 1KC8T 1JLFB 1UPPA 3DDNA 4RNOA 4WIIA 2LP4A 4Y2AA 3WX4A 4NZ7A 1HBMA 1EARA 2R7UA 3IG1A 4N56A 2ZD1B 4CH1A 2YQ3A 4KJIA 2CWXA 2OMOA 3FUYA 3MR2A 4B3TF 2K7JA 2WONA 2MJUA 1UVIA 3TA1A 4X4OA 4ZMMA 3GONA 5CXTA 4F04B 4GVBA 5DETA 4HR2A 4AD6A 1YZ6A 2QLFB 5HROA 2D41A 2EG1A 3BQ2A 2KYXA 4X66J 4R5PB 3O1LA 3L4BC 2AGPA 4W90B 3T9NA 4I64A 3HPOA 1GTEA 2UUBJ 1M1GA 1MW7A 3I5AA 3SQOP 3FDSA 3MM6B 2JSXA 3JSBA 1FJEB 3JSRA 3K7RA 2D3OR 2QGFB 1CG2A 1S1WB 2CZ9A 3MM7B 3QT8A 1MNEA 2IA0A 2W24A 2EKYA 2GHWA 4F3MA 3M8QB 3R5GA 2VC0A 4F67A 1VLOA 2I6WA 5D0EA 2R7VA 2MLYA 2C28A 3G82B 3H5SA 2M70A 1U0HB 3E01B 4IQXA 3W5ZA 2O01C 3BSOA 2YBVA 4H4OA 1BXNA 4ZVTB 2BE7D 3M2UB 1PCAA 4NCGA 1DJ0A 4I2QB 3NOGA 1VS3A 3ADAC 3C15A 1AFJA 1PIEA 1YBAA 1SBRA 2GVDB 1XJWB 1B0PA 2ZBPA 4M1KA 4A8OA 3G96A 4FVCA 5M2PA 1V5VA 2VFVA 3M8PB 3KDOA 2HEKA 3DRPB 3NKYA 4DHVA 2DRBA 1FRKA 3BGOP 1RHKB 2AGQA 5D8HB 3TEHB 1XC9A 4AL5A 4XIUA 4H4MA 5DGBA 4NOHA 3R7BB 1UZDA 3DLEA 2ACMA 2BKNA 3SV4A 2LU2A 5A8RB 3UDVA 2MY8A 2V94A 3DRXA 1N32J 2FB0A 2H48B 4A8KA 3B82A 3PX6A 2HK2A 4DX6A 3PR5B 5DZ7A 2DXDA 3SIPB 4Y34A 3HVTA 3N9UC 3WBZA 5HK4A 5L1IA 4NCAA 4H54A 4PQAA 5LMNF 1N54B 3C14A 1S59A 2IM3A 2HVIA 4OJ3A 1FWPA 3CD6S 1U1MA 3NRBA 2UXDJ 3OL7A 1T95A 2V2KA 4RUAA 4QIFA 1GX6A 4IKAA 2QMWA 2QIFA 4JI0F 5H9FJ 2AZ3A 2YQ0A 5JXSA 2FTRA 2MJNA 1NK0A 3G6XA 2WB4A 2OP5A 1S1UB 2ZM6F 3R3TA 3PRBA 4ED0A 3HVAA 4UZBA 3Q0AA 2R4FA 1ITPA 3K5OA 1RTIA 2L48A 3NAHA 2B8QA 2GAHC 4P52A 3MWBA 2R2UA 3R27A 4LR9A 1XNQJ 1X5OA 1DURA 2KRRA 2OI2A 2CDRB 3J80Y 2ALZA 2HHUA 4PG7A 2XNRA 2GO8A 3G4SS 3IR6B 1JLGA 4ED1A 2HZCA 4K50A 4W92B 2YX1A 5IFMA 4DV1J 1Y5IB 2B51A 5F8NA 5BYSA 1G1XA 4USWA 2RILA 3W62A 2RUSA 1P8GA 2VG5B 3MR7A 2B43A 1S7IA 4YB1P 2CQ4A 1VQNS 1NDLA 1X4HA 4NMXA 1UVLA 3JTOA 4WZMA 5A8WB 2WHOA 1WKLA 1EZZB 2NXNA 2VFSA 1Y3KA 4QYZK 1WSVA 4KC5A 4QIWD 1SJRA 2NXCA 2VJVA 2NSCA 4X4PA 1XR5A 4DV5F 3V2UC 3T5JA 2WSCC 5GMEA 2NZCA 3H2VE 4ZP8A 4QR0A 3VQTA 2BE2A 4LVNP 3D1OA 2XZDB 4J91A 3FCVA 3PYEA 3DM2A 4F36A 1SH2A 1UETA 2MQQA 1UFLA 2NSBA 3MAAB 2ZUGA 3CJ0A 4Y28C 4XO0A 2D9OA 3BPDA 1GXTA 3TZYA 2ZH5A 1R8CA 3AB4B 1XEZA 3D9BA 3ENAA 2BOAA 1X9SA 5AXLA 3D6MB 3UPFA 1NK4A 1VBXA 4X2BA 5FIIA 4IG3A 4ZVHA 2RJZA 2E5LJ 2C3PA 3MECA 3E3XA 1X9WA 2BX6A 6FDRA 4GC6A 3RBZA 3PACA 3BPSP 5ITHA 3CCZA 4M5NA 2XCAA 2XO7A 2EBEA 4N77A 2Y1RI 3K5LA 2NYIA 5K8PA 3I4HX 1N5VA 3HDSA 4CCHA 3NCRA 1RHRB 2B4VA 3A8KA 1SI9A 2CNOB 3D6FB 4C11A 3P8BB 1WELA 3GJQB 2DXEA 3OTOF 3HKWA 1NZ8A 4Y2CA 5HBMA 4FF1A 2DT9A 4NLUA 1VC0A 1Z2ZA 3CD0A 4RKUC 3CO9A 3CDWA 4PXEA 2J6SA 4B3SJ 3C16B 4EYIB 2DRAA 1X4BA 4RBVA 5KT2A 1NXIA 3K57A 3UDCA 5A2QY 2FJXA 2HNZA 3ILLA 5ETSA 5SUHA 5JJBA 3I0RB 3JS9A 2CPXA 2PEHA 1GMUA 1K47A 5C25B 4FYXB 2YNGA 2HG4A 5JUMA 5I42B 2DHXA 1ZAVA 3ILJA 4QIEA 3KG0A 1RK8A 4OJ1A 2DVIA 2BRLA 2H1YA 1XMQF 1VRUB 2C42A 2J9CA 3IR7B 4X84A 4ECRA 2UVWA 4HDHA 5GVQA 2V4RA 3W61A 2HGMA 2XSFA 4WK3A 1RAGB 2YKMB 1R27B 1MMDA 4QW8A 2DKOB 1FFWB 3ZC4A 5DLFA 1QE1A 5F0UA 2LVWA 2E1PA 1KTVA 3AQOA 3K8WA 3C2PA 2AHOB 1F3FA 3GMGA 1N5YB 4LF9J 3TZXA 3BR8A 4ELTA 4Q0BB 3H40A 3QWUA 3SQGB 5J1EA 3GR0A 1N33J 5LM7E 5LT5A 4E98A 4DV7J 1WC4A 1FDBA 1G7CB 2W01A 1S0MA 2DY9A 1VRTA 2Q1LA 4OX9J 5IT4A 1HYSB 3EZUA 2Y1JA 4B3MJ 3D3BJ 5DM7Q 4PYDA 3R6GB 4F0KA 1D8YA 4JI8J 4EFAC 5C5JA 2NPFA 2J7KA 1EHWA 4AYBD 1UVKA 4C8OA 2JRSA 1TKTA 2DHAA 1B0VA 3QNWB 3HFKA 4Q8EA 1LFWA 4ELVA 3GIMA 3TW0A 3MEDB 4C9DA 3T6BA 4U96A 1SJ3P 4CZCA 4FXVA 3MZIA 1KRPA 5E3RA 5HMZA 3LPEA 1TK8A 4O4GB 1WHWA 1REVB 4FYWB 2GNKA 2CQHA 5T7LA 2AYEA 2BJ3A 2CUYA 1HNIA 2RUGA 4FBTA 1CULB 2F9JA 4LFCF 1RWVB 3NS7B 5L8RC 5C24A 4OI4A 1EAYC 1QAXA 2C3MA 4QCLA 2LDYA 2XEXA 4M63A 2F4FA 4DFPA 2ZKTA 1NK8A 3KUGA 1RWMB 3MAHA 3FJ2A 4CLUA 2FIUA 3Q23A 1Z2LA 1AUDA 1UZHA 3IRXA 4OYMA 1QSYA 3H2LA 5M2RA 2NPIA 2ZHOA 1WG1A 3GIKA 1H73A 1SL2A 3H5UA 1H74A 4V19X 3N6MA 4DR2F 4E0DA 2R2TA 2DJWA 1YDLA 1A0OB 3AA8A 3PFEA 2G1DA 4Y3CA 2AU0A 2V67A 3VR1A 3QRQA 3HKZD 1R3NA 4OFZA 2B7BB 3NLCA 3MM8A 2D7SA 3PTWA 3FSYA 2Y9HA 4DX8H 5HLFA 3P49B 3T9ZA 1WWHA 4PPZA 1Y5NB 2RRAA 3QSIA 1N0VC 3B4DA 2KXNB 2V8PA 1RQ0A 2CJKA 1U45A 2MEWA 1I1GA 2EFGA 1ZAXA 3PO5A 4HT7A 2B4UA 5KFAA 2QSFA 3J81Y 2ZBIA 3B54A 5J2NB 1SC3B 1D9DA 3KWMA 1PILA 2FYXA 3O2IA 3M1VB 4ZVRB 3GV8B 2WAQD 4PAAA 3MEEB 4LF5F 2J7UA 1RSCA 3DLJA 1Q7YT 1YTYA 5HO4A 2IJFA 1WEXA 3PY8A 5BYRA 1YKWA 1RCXB 2HHXA 2JLFA 5KT4A 1FJGF 4UQTA 3QRRA 1GEHA 2VPXB 3LWLA 2BQUA 1JLAA 2A2DA 4V1Ak 3R6LB 3KYLA 4YQWA 1TUVA 4NLOA 5HVFA 4FNHA 2ZH1A 3KLEA 3MMBA 3PYFA 4NXMF 3PEHA 5BYQA 4LIWA 2CWKA 3UO0A 1NLKL 1S0OA 1UEUA 3KHHA 2E7VA 3C46A 2H3EB 4ZKAA 4O3RA 2AF6A 3QSYB 2A10A 2ZE2B 3Q2TC 3M8ZA 3W5XA 4KKOA 5HMWA 2CIMA 2HWHA 3LP0B 5C7PA 4DSJA 2P5VA 1TVRA 2JHEA 1PYOB 4PUOB 3PW2A 2ZOGA 1IBMJ 3H7HB 1PYTA 3Q2SC 1HA1A 3L3CA 2Q66A 4Y2IA 1HL6A 1UWBB 1M5PC 2E29A 1HWKA 1SH3A 4NA3A 1RHQB 4O0IA 2MTLA 1VIXA 1JX4A 4DV6J 5AJ3J 2W9CB 2A18A 1NHUA 5H9FK 4Z2XA 1NJYA 1HI0P 3D0HE 3V5RA 4C3MA 2JVOA 3QGIA 4RW8A 6AT1B 4WYLA 1HBOA 2ZC4A 1PAEX 2HK3A 1M5OC 4FS2A 2DIUA 4KT0C 2LQJA 2CKWA 3MURP 5LJ5Y 1FA0A 2AX0A 3M6XA 4B3OB 2VB6A 2XWXA 2Y0SD 3KLGB 4M5JA 5U47A 3LWMA 2VG7B 3FBBA 3HFVA 3NL0A 1BWVA 5K8MA 4C97A 2CNKB 2IC3A 2MHNA 1Y10A 2EFQA 1OS5A 2M8DB 5D0GA 1DARA 2CDQA 3CF5Q 2VPZB 1YBUA 2C2MB 2BQRA 1U1KA 2IRXA 4TLRA 3ETMA 2BOPA 2MXYA 1JKHA 1WF2A 4HH0A 4JI5J 3N5FA 2E1RA 1RZMA 2AJ1A 2MZTA 3CDUA 1S1WA 5DQHA 4X4RA 2HFOA 2FHJA 3QJPA 4CO4A 3I31A 4KV8B 1RKIA 1FE4A 1DLOA 2RU9A 2BXJA 1IR1A 4ZVSB 2W8KA 1V3ZA 4YHHF 3QFWA 1IBKJ 2VASA 1S4FA 1S9FA 2P9CA 4A48A 2VZ9A 1CJKB 2PO4A 4ZVFA 3WDOA 4ZIVA 2H54B 3QLHA 3SFGA 3S01A 3EMTA 4DFMA 4QZVB 4FBUA 1A6LA 2HQ3A 2XY5A 3BO2A 2I38A 4QPTA 1CVJA 4JI6F 4CLYA 2LXFA 1RWUA 3GILA 1X0FA 3KUEA 2CQ0A 5J2QB 4DV2F 1FESA 5HANA 4QWAA 1U4BA 1CJUA 1RU2A 3VAGA 3CMQA 3GG1A 1RT5A 2MYFA 2ZHBA 3QMQA 1KWMA 2QLJB 5DQIA 2VU5A 2DITA 1CJTA 1P27B 4PEOA 2VFUA 2V4QA 1F2GA 3A3PB 3VTIA 1VDHA 2E7WA 2GQ2A 1OYEA 1VQOS 3R2CJ 3I0SA 3W8GA 1ZOTA 3RW7A 4WXWA 3CB4A 4KO0B 2JOQA 3RB3A 3K5NA 2QA4S 2UUCJ 2RE1A 2RSQA 5KFGA 1K1SA 2XS2A 4NYZA 4F0HA 1ZTTA 5E33A 4LSLB 3OW2R 1YJTA 3MD1A 1KD1T 1TKXA 2CADA 1FDAA 1SV5A 3UFCX 2OPQB 4YB5A 4PWDA 3AY0A 3F56A 3QWPA 2QL7B 4ZVPB 4R0JA 5DO2A 1R0AB 3C6UB 4RW9A 1RTHB 4XDDA 2AQ4A 1HHQA 2RNEA 3O6QA 2RU3A 1EETB 4JV0A 2ZDPA 4LSNA 4OYXA 4HACB 5J1PA 2DEJA 3GSDA 1SKRA 2N4DA 4LF7J 2NZ4A 4MIAA 2R3VA 2UUBF 1R7IA 1BE4A 4OJGA 1F9EB 1NM2A 3H8YA 4LQ3A 1X4CA 1IKXB 2CZ4A 2QZ8A 1XNRF 3EVOA 4DR7J 1WKKA 1N36J 1L3VA 8AT1B 1Y7PA 4K5RA 4IQMA 4X64J 1S9EB 4NRUA 1N56A 2EVZA 2X1GA 5FJ4A 1S6PA 3DN9A 5B7WA 2NUUG 4JI2J 1S0NA 1NO8A 3PEJA 2DGXA 1UJ5A 2HURA 2IAJB 1RLDA 2E5JA 4MH8A 4J9SA 2CQ2A 2LQ9A 4OX8A 1TL1A 4JI3F 1WI6A 3RAQA 1N88A 2GGPB 1PKUA 5HSPA 3DOKB 2YNHB 4JI4J 2XS5A 3I5CA 3J7YU 1FE0A 3B8HA 1UJ6A 2CPZA 1GXUA 2LLZA 4DPYA 1JLCB 1AZSB 2G4BA 3MAAA 3FCHA 2B6AB 3MMAA 3EGVA 1N32F 4WE1A 2J9EA 2VQFJ 3KOAA 3CPWR 1RLCL 4ATNA 1LW2B 1T9UA 1R0CB 1SL0A 4DZDA 4M94A 2OEMA 4NASA 5K5MA 2OPSB 4NYOA 2XS7A 2K7KA 4ZPTR 3GE9A 2DO4A 3FGVA 1BQNB 4KY3A 1IVZA 1PYSB 2GHPA 2YWFA 1RT3B 2W7PA 3PFOA 1IWAA 5F8IA 3ENWA 5EN1A 1SKUB 2RF2A 5B0FA 4NLWA 5F41A 1T9XA 1WDDA 4DV3F 4DQIA 3VQSA 2UVUA 2VC1A 2J5AA 5T41A 1TK5A 4FVMA 4HTIA 3NGRA 1NHKL 1LXJA 4ANDA 4DR6J 4M8LA 4QIVA 2DNRA 2AEFA 1UJ4A 2QA1A 2APOA 4I67A 5HP1B 1XNQF 3JXOA 5E3QA 3POTA 1ZETA 5KG4A 3MM5A 3LP2B 2CJAA 4CTAB 2OSQA 4EO8A 3M4XA 4QWDA 3NBPB 4DV1F 2C3UA 1IKWB 2BRKA 4OYWA 4K4YA 5CAAA 2FC8A 2V2ZA 5KG2A 1Q8KA 5C42B 4NLPA 4ECZA 2VA2A 4USUA 2BYCA 3AFGA 2DNOA 1SIZA 4P2SA 2RS2A 2MQMA 2XI2A 1K44A 3KJNB 3PYGA 4CDIA 5D77A 2OTLS 3MPWA 1XR6A 4YR3A 3PZPA 3OBIA 2MZRA 4OZ2A 2JLGA 2P6SA 1VIOA 2C1EB 3BREA 1WD6A 2CAJA 4J9MA 3OQ2A 2IBOA 5GAEU 4C8YA 1KBRA 5GAHI 2WW4A 2KG0A 4X4VA 3OT9A 3DRRA 5KT5A 4H4KC 4OYPA 2XSJB 1NPPA 4MT1A 3T19A 1FKOA 2I5JB 3J7ZT 3MFHA 2HFUA 3M2RB 4NI2A 4CM2A 4WP8A 2YY3A 2N7YA 2HW3A 1QVFR 2C2KB 5IT9Y 2YNIA 3QGGA 1S76D 3KHRA 1LWFB 4YDDB 4B17A 3BN7A 3CVKA 2XCPA 4IH6A 4HDGA 3DXBA 3R97A 5EGYA 2ABYA 5ETLA 3M6WA 4M5HA 2EEYA 2IBKA 2E5LF 2GVZA 4IO1A 2HRUA 1DTQA 3DNCA 1G6BA 2R7QA 5KG7A 3VAHA 4ID8A 1VFJA 2K3KA 2DGVA 4FXWA 2AYGA 1ELOA 1TAUA 4JI7J 1YQHA 4ZDNA 1VQ7S 4NLYA 2R8HA 4K4UA 2R8GA 4YY3F 3KJVB 2OPRB 4ILRA 1WEYA 4YUDA 2BA9A 1U24A 4WCEQ 3DDIA 1WOPA 3R2DJ 3OUYA 2FVPA 4K4WA 1SB6A 2VFTA 3RB6A 4L76A 1Z4UA 2R8IA 1MWYA 3A8JA 1S48A 2DEIA 1VQSA 3CCVS 1X4FA 5G4DA 2Z2ZA 1SJQA 2C2EA 4ZP9A 3Q86A 2PDAA 3FSIA 3HI9A 1Q8BA 4DPXA 4F7VA 2VV5A 3OVBA 2OFGX 1UW9A 3OFHA 4CLFA 5LL6d 3W9JA 4AL6A 1UCNA 3BBCA 1WF0A 3LOUA 3PX4A 1U1QA 1S77D 4UY85 3TQ1A 3W65A 1S5ZA 4U6PA 1Y11A 3H90A 3Q24A 3OXGA 3KK2B 4ZLJA 2AV5A 3OVAA 1GX5A 1GAOA 4OHYA 1RWXB 4RW4A 3V4IB 1XK8A 2KVIA 2ZJRQ 1JJCB 2ZFHA 3GP9A 4QU6A 2RDDA 1CBKA 2K1RB 3K5PA 1KP6A 2E44A 1EB0A 3KK3B 2AJ0A 3OL9A 2VF3A 5IM0B 2MLZA 2VQEJ 2KN4A 4KFBA 1U7LA 3EZ5A 4KYZA 1HBMB 3IG1B 3BGFA 3GIJA 1W2IA 1RAFB 3JQJA 2HMIB 4DMZA 4EEYA 2UXBJ 1WTBA 3SCIE 3RRHA 4U9RA 2WONB 2IMWP 1SJ1A 1WG4A 2XMUA 1TFYA 2EFVA 4M5GA 4USHA 3LTOA 3KUHA 4P73A 1KQSR 1CS4A 2UV8A 2PA3A 1ZAWA 3CJ4A 5HROB 2IM2A 3EYZA 2A6OA 4DG1B 4R0EA 2JEJA 2PA8D 1ZBTA 1ZTWA 4KTQA 3H5XA 4CP5A 3P5BP 4N76A 5KT6A 3F73A 1ZA2B 3CMES 2BM0A 1WC3A 1T9WA 2K2PA 1R6YA 2ZH7A 3RAXA 4R25A 5HQLA 2XWYA 1UVMA 3TVKA 2EFPA 2BUNA 3CJ3A 3W5YA 4Z7YA 3JAMU 2XYHB 3PW7A 1UPMB 2J0WA 1JLQA 3BDPA 1U09A 3Q83A 3AT1B 1ZZNA 4H4OB 2WZ1A 1TAQA 4NCGB 4DUYJ 1TL4A 3NEKA 2FDNA 4PUOA 3T5HA 3MI7X 3C15B 4DUZF 2QYCA 2ZDOA 1JJ4A 1J5EF 2LEAA 4KBIA 1MMNA 2WB1D 3BBBA 3LANA 3NAIA 3E51A 4B3RJ 4USKA 3J81U 1S1VA 3J81j 4USIA 2OEKA 3QBCA 4URGA 2ZJQQ 4NXNJ 2XGPA 1N8RT 1RTJA 3SFUA 1ZM2A 4J5OA 2IVMA 1TZ0A 4Y00A 1GQEA 3DLEB 2IDLA 4F3QA 4ZPDA 2FLOA 2HHWA 2R7OA 3D67A 4KGZB 3TAMB 2AIRB 1KSPA 3EICA 1D9FA 4CLLA 4A8YA 1U2CA 1EQMA 4ILLA 2J76E 1RT7A 1TUWA 2NREA 5BXIA 4UOHA 3DGPA 1H6KX 1YWXA 2AJFE 3DLKA 4DSLA 4O4RA 4OZLA 4FKXA 3LUYA 1D9AA 4Q2LA 4DV4J 3WZ0A 3C14B 3OFGA 5AXKA 2IA6A 1NDPA 2B4OA 4JP8A 4KH1B 2U1AA 2ROGA 2R7SA 4QOTA 5E41A 4XPCA 1IJFB 4WZQA 1FFGB 3GIRA 2AP6A 3BQ0A 2BEFA 1HQ2A 1S6OA 4LF8J 4LF6J 3MAQA 2MSTA 2M9KA 1ZM4A 5F9NA 1S99A 4Q44A 1Q81T 4ZVUB 1RTIB 4X62F 2O3DA 3KK1A 3BO4A 4FPRA 3NMAA 4DSKA 2UUAF 4WXOA 5KT3A 1NSPA 1X7VA 3BS9A 3M8SA 2Q6CA 4XK8C 4F2RA 5GADI 2CQ3A 2MSSA 2XI3A 2J8AA 2JFDA 3OTDA 5CYQA 4IRDA 1KLMA 2QA4G 4F8RA 3W3SA 2Y1LB 1JLGB 4DR5J 3TZZA 1T94A 3PHEA 1JJHA 3TO8A 1E6VB 1Y4ZB 2OEJA 2J9DA 4WFBQ 1IR2A 5CCMA 1NH8A 1FDDA 4TNOA 2ZVSA 2HAFA 1AYEA 1ICEB 2W7OA 2CQPA 5KG1A 3DI6A 3FC9A 1Q4RA 3CW2C 1OO0B 2BQ3A 3UD5A 4J9KA 3TUIC 4DPOA 2KO1A 3RGIA 1RTDB 3CNQP 1GNKA 4KE5A 3D28A 4DQPA 3QO9A 2HVDA 4DF8A 3CDAA 2PE8A 1H7XA 1NB2A 2IFXA 2BE2B 2BM1A 4C8LA 5HMXA 3NY0A 5AJ3F 3C8YA 1S7HA 3DM2B 4TKTA 2GQQA 4WP3A 3NNHA 4GO5X 4IOAQ 2AZ1A 2AT1B 3HHLC 2OPQA 1I5OB 2AYMA 4M5KA 1OQ6A 2KJWA 4I4BA 3UD3P 2K8GA 1MROA 2MZQA 1M5VC 2XZTB 1YJVA 4IH7A 4RJVA 4F4KA 1S1TA 3U02A 2MKIA 4DR3F 3FZBA 2G2OA 2P9GA 4WU3A 2E5GA 1VQ5S 1LEOA 2V8HA 5D3GB 1W26A 3OJSA 4YS2A 4ZITA 4NLXA 3DLLQ 1NJIT 2GMJA 4OV6A 4HACA 4IOBA 3GJSB 1WEZA 5LMUJ 4J9LA 5M2UA 1FRLA 4U8VA 2FJDB 4OZ1A 4PR6A 2GIQA 1RB0A 2JEIA 4QR1A 2D3UA 3FZ2A 4P6QA 3BGRA 4F3OA 3IN5A 1V3SA 2IY5B 4Q7AA 3W1YC 4K0KF 5HN0A 4C11B 3PW4A 4URSA 2VD3A 3EVWA 2Z8QA 4OZJA 4OZ0A 1SQFA 1RAAB 3AXKA 1S9EA 5HBMB 5KFNA 2VKRA 3SXLA 1YJ9S 4A4JA 1ZA1B 2HLTA 2LXIA 1C1BA 2JL9A 2QA2A 3B4MA 3AD9C 1YJWS 1QAYA 3VAIA 3PKMA 3Q22A 3BO3A 4OHZA 1SJ4P 2FJAB 3M6VA 1YRUA 1VQ6S 2YNGB 4N8OA 3PCOB 2F8MA 3PG9A 1AB8A 1P6TA 4DS5A 1EKRA 1BHNA 4YOEA 3MMCA 1TELA 3JTPA 2F65A 3DMJB 3IXQA 2KL8A 1WF1A 4PG4A 2V69A 1FF2A 3MPDA 1NJWA 4XPEA 2C3OA 1RHMB 4IH5A 5KFBA 3L7UA 1QE1B 2RDIA 3F41A 1FERA 1HWUA 1HQEA 3MCNA 2CJYB 3I5BA 5J1EB 4JV5F 3P96A 3TARA 4QYZJ 4TN2A 3HM9A 1W2BR 2AW0A 5I3UA 3PJXA 3R5BA
chains in the Genus database with same CATH topology
1R3NA 2FHKA 2HAIA 2R7RA 3CDEA 3ZFVA 4OFZA 2YKNA 1NEEA 2B7BB 2ZOMA 3V6JA 3NLCA 2DO0A 2VG6B 3ITHB 1FXRA 2KT2A 3MM8A 3G71S 1HNVA 4O44A 4KRWA 2D7SA 1GH8A 2Z2MA 1E6YA 3G9CA 3K8VA 3FSYA 1KOHA 3I55S 3TVYA 4DX8H 1XTZA 3ZZTA 2XMTA 4B9VA 4DSFA 4B9TA 2HQIA 5HLFA 3R5DA 1DBDA 2KZZA 1X4AA 4LFAF 3M6UA 2CPIA 4TY8A 2KDOA 5E3PA 4ZVGA 2LXUA 5IT0A 2KH9A 4PPDA 3P49B 3GFHA 4WTYA 3T9ZA 1H3DA 4YFUA 1APSA 2CJQA 1C1BB 2A1BA 1WWHA 2DH7A 4RNHA 3RAMA 4YR2A 2PI4A 1CPZA 1U25A 1HBNA 4PPZA 5CYMA 1LK7A 2DNQA 1TKTB 3T1AA 2AX1A 1HI1A 2ASLA 2ZE2A 1Y5NB 2RRAA 3CC4S 2MGZB 4R8UB 3M9NB 5DRKA 1AXQA 2VQEF 3DC2A 3N5BA 2ZH2A 3TRGA 1R8BA 2FLNA 2YH0A 2DNNA 2X1AA 2L9NA 4WJBA 1ROFA 1N0VC 1Q1KA 1RT6B 3U1NA 3B4DA 3LP0A 2KXNB 2XC9A 2J6UA 4OI6A 1RQ0A 2GA7A 2CJKA 5LSLA 1U45A 2HHTA 3OFEA 2K3IA 1I1GA 3RU0A 4ICLA 2X51A 3NWGA 5D6GA 3M9MB 1M5HA 4ZPAA 3AQPA 2UXBF 1FXDA 2EFGA 3ULHA 2QE5A 3MMCB 4ED7A 1ZAXA 2Z0GA 2IMOA 4BHQA 3PO5A 4HT7A 4DDFA 2B4UA 3LP2A 4ES3A 5KFHA 2VA3A 2E9RX 5KFAA 3TP2A 2N4CA 2QSFA 3J81Y 5C24B 3VZHA 2ZBIA 1R43A 4ZP6A 3OPKA 5FLXY 5J2NB 1UWBA 1RT4A 2R8JA 4YB6A 1H2UX 3KLVA 1WHXA 1D9DA 3KWMA 1CLFA 1JB0C 4ITSA 1N36F 1PILA 4GO7X 1V9OA 1FRHA 3N01A 3O2IA 2OD6A 3MUMP 1YGYA 3SCJE 4H4MB 3MR5A 3M1VB 3GV8B 2WAQD 4ZCKA 5KFDA 2VBYA 1C4CA 3QJJA 3CSKA 3MEEB 2W9CA 4K4XA 1HMVB 5B0BA 1FDNA 1S79A 1YJUA 5CZXA 4EYHB 1BGXT 2ZOFA 2J7UA 3DLJA 3ZZUA 4F4XA 1YJRA 1Q7YT 2C2DA 1YTYA 5CD4H 3IRXB 4XAKA 1WACA 1FTRA 2XMMA 3MHYA 4MJKA 3GFYA 5HO4A 2RQCA 3M9OB 4BWJA 3PW5A 1HQEB 1JLEB 4JI2F 1OIAA 2RQKA 2IJFA 3BJYA 3THTA 4RW6A 1WEXA 3UCUP 3PY8A 2NUHA 5BYRA 2HHXA 2PT0A 5A0YA 3SCKE 2JLFA 5KT4A 1FJGF 1BLUA 3UQSA 3HHKA 1CSJA 2E1AA 1S0VA 4FF3A 4UQTA 3N0VA 2VPXB 4NLRA 4YB7A 3LWLA 2FVSA 2BQUA 1JLAA 3UCZP 3HVTB 2MKSA 3CIZA 2A2DA 5DG8A 3KYLA 1TP7A 5I3UB 2XGQA 1HFEL 4YQWA 4B3OA 1R8AA 2RRNA 1TUVA 2JVRA 2R2RA 4NLOA 4YMEA 2QFJA 4NLGA 4FNHA 3VF0B 2YKOA 1TV6B 1OSDA 2ZH1A 3KLGA 3KLEA 2YKNB 1LQ9A 2B9WA 3MMBA 4NXMF 2UXDF 3PEHA 4AXJA 1AROP 3OHAA 5BYQA 2VG7A 2WOMB 3MM8B 1FEHA 2DNLA 2C22A 1HNVB 4O44B 4LIWA 4BBYA 2F40A 4HT5A 1E6YB 3OV7A 4J9PA 3LAMA 1C0TA 2B3TB 3H59A 2F9DA 2LKZA 2FPHX 4WFYA 1U47A 3PDNA 2EFNA 4CIOA 2ERRA 2H9ZA 1S0OA 5HLFB 1U1NA 1UEUA 7FD1A 3KHHA 1RT1A 5IQQA 1TL3A 4TY8B 3SSSA 1F60B 2KM8C 1UMJA 3C46A 4MAKA 4ECVA 1IQTA 4ZKAA 2DGTA 3Q8QB 4O3RA 3BSCA 2CFXA 1HBNB 5CYMB 2AF6A 2EW9A 2A10A 2E7XA 2ZE2B 4G6VB 3CCSS 1TL5A 3Q2TC 3JSMA 3ONQA 2JX2A 2DB1A 5DG7A 5IQ6A 1Q86T 2W4DA 4IOCQ 4KKOA 3R1HA 2YWKA 5HMWA 1B64A 5J1NA 5I4MA 4RW7B 1VQPS 2CIMA 2HWHA 1CC8A 3LP0B 4DSJA 2P5VA 1TVRA 2JHEA 2PIIA 3MUTP 4QPXA 3NNAA 2WW8A 1QTMA 4X4QA 5KFQA 5KFFA 4B3RF 4ICLB 4PUOB 3DLGA 4KV8A 2HNYA 3PW2A 4ED5A 3TI0A 2MQLA 4CNZA 2ZOGA 3OSPA 3CC7S 3QIPA 2XMWA 4ETXA 3BN4A 4Q45A 3Q2SC 1VQYA 4NXNF 1HA1A 3L3CA 3W2WA 2O1PA 4Q43A 2PI5A 4TY9A 3PM9A 1M5SA 4I2PA 2Q66A 4Y2IA 3M2VA 3HVWA 3AHPA 3LAKA 1HL6A 2QO3A 2E66A 2ZZNA 1UWBB 1RT4B 3FQKA 3OJUA 4K5SA 1M5PC 3HHNB 2E29A 3AB2B 2OO4A 1L3KA 1X0PA 1HWKA 5F8MA 1SH3A 4NA3A 4CT9A 3ZZRA 4WFNQ 2ZH9A 4O0IA 4MIBA 3CIMA 2W9BA 3R5CA 1VIXA 1U6FA 3MFIA 1JX4A 2IM1A 1U2RA 3HZGA 4G1QA 4ES1A 2RRBA 2DGUA 2ZNYA 4LF5F 5KG6A 4MK8A 2W9CB 2A18A 2DPJA 1NHUA 3TAPA 1X4EA 4DL3A 4Q8FA 4Z2XA 1NJYA 2P6TA 4AE5A 3RTVA 3AH6A 3GFXA 4LT6A 4NPOA 5KFOA 3R1LA 1TKZA 2EFOA 4AQYF 1HI0P 3D0HE 4RX6A 3OTEA 3V5RA 2JVOA 4C3MA 3ISNC 3QGIA 4WFZA 2IJNA 3CCMS 3CWJA 4RW8A 4CO3A 1RKJA 4RW6B 5SZTA 4WYLA 1HBOA 2ZC4A 1XMBA 4G1IA 1T3OA 3CJKA 4QYRA 2IVFB 5KFRA 3QIDA 3TUJC 3J7Z5 2RVJA 5J2QA 1M5OC 4FS2A 2JZ5A 2DIUA 2L9DA 4KT0C 4ECXA 2LQJA 2DH8A 2DNYA 3NG8A 5AXNA 2CKWA 1LKZA 1JLAB 1MMLA 2NXUA 3BSAA 5LJ5Y 3MURP 4OI3A 4AXIA 3CMAS 1FA0A 4K4SA 2AX0A 3M6XA 4B3OB 4C7QA 1O51A 4X4TA 2VB6A 1YRTA 2XWXA 2CJ9A 3IA0A 4L6V3 3DOLA 1VQ4S 3T3FA 2FGOA 2Y0SD 3KLGB 3KLEB 3MMBB 3PO4A 2FC9A 3IWLA 1H2TZ 5U47A 1NK6A 1VI7A 2VG7B 3LWMA 3A1YG 1M5KC 3NL0A 2FVRA 3NS6A 1NK9A 3TUZC 5BR8F 5K8MA 4LQ9A 1C0TB 2IC3A 4C97A 2MHNA 4LF8F 3VAJA 2EFQA 4HTJA 5AE2A 2XMKA 1OS5A 2M8DB 2BW2A 1TL3B 2KTQA 1DARA 2CDQA 2XBPA 4KO0A 3CF5Q 2VPZB 3ZZZA 3I87A 3PRDA 2BQRA 2KG1A 1S1XA 2KT5A 1U1KA 4NYPA 3FEYB 1K73T 2IRXA 4TLRA 2EBGA 2BOPA 5E0OA 4ZCLA 2NR0A 3PVXA 2MXYA 1JKHA 5KFVA 1WF2A 4ERDA 1KHWA 4HH0A 4RWXA 3JSMB 3N5FA 3OL8A 2IYIA 2EI5A 2E1RA 4KKOB 1NB7A 2AJ1A 4B9SA 3P6YC 4RUCA 2MZTA 4LSLA 4TQRA 2YNFA 1VQKS 4H4KA 3AA9A 3CDUA 1S1WA 5DQHA 1VC6A 4X4RA 2HFOA 1YITS 2FHJA 4O3SA 3QJPA 2RQ4A 4CI0B 4CO4A 4ZK7M 1RA6A 5H1SV 2GJ2A 1S9GA 3CXCR 3I31A 3DLGB 4KV8B 1DQ8A 2NLWA 1RKIA 3KKFA 1FE4A 5I3PA 2ATLA 1VQ8S 3RB4A 6FD1A 3IGVA 1DLOA 2RU9A 5HL7Q 1KNZA 3QIPB 1JLBA 1XWLA 2BXJA 4O3QA 5KFJA 1DZ5A 1ZM9A 3FRYA 4LJMA 1ZH5A 5GMKa 3PX0A 3HP6A 4I2PB 5D4OA 1HNZF 3M2VB 4J9NA 1LXNA 4QWEA 1VGYA 3BB5A 1VQ9S 4CT8A 2W8KA 3H25A