2CQHA

Solution structure of the rna binding domain of igf-ii mrna-binding protein 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
GSSGSSGMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the RNA binding domain of IGF-II mRNA-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords IGF-II mRNA-binding protein 2 isoform a
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqhA00
1WHXA 1P1TA 2MKCA 3MUTP 2E5IA 3EGZA 3CULA 2DH8A 2N82B 2G4BA 4ERDA 2JRSA 3FEXB 5DDPC 3PIPQ 1YJWS 3ZZYA 4TU9A 2DNOA 2E5GA 3THTA 1NO8A 3UD4P 2DH9A 5IQQA 1H6KX 3G6ES 2OTLS 2CQPA 2OJ3A 2DGWA 2K8GA 2OSQA 1PGZA 1YTYA 3HHNB 2X1FA 4IOAQ 2EK1A 2YH1A 2FHOB 1WEXA 1VQOS 3P49B 4ZKAA 2XB2D 3G8TA 4IO9Q 4LJMA 5DM6Q 2DNGA 3U1MA 5GAHU 2CQGA 3FEYB 3SDEB 3L3CA 4F26A 3TP2A 2MQQA 2DNMA 3CCLS 3ULHA 3TO8A 2CQBA 2CPDA 2DNNA 3CMES 2CQ0A 3R1HA 4YUDA 1YHQS 4TU7A 4P6QA 4W90B 1R8PA 3VAIA 3P6YC 2KU7A 4LMZA 1H2TZ 3PIOQ 4WFBQ 2MXYA 3BO3A 4ED5A 2ZJPQ 2D3OR 2J0QD 3H2UB 2MQLA 2DGVA 4F02A 2CQ2A 1M5KC 1SJ3P 1AUDA 1FXLA 2XS2A 1HA1A 2J8AA 2DNRA 2OTJS 2ADCA 3I56S 2MQPA 1HD1A 2LEAA 4QU7A 4WFAQ 4EGLA 2F3JA 1M5PC 2MSSA 2MJUA 2O3DA 1FJCA 2MQNA 4WCEQ 2U1AA 2FC9A 5IM0B 1JJ2R 2CQHA 4J5OA 5LXYA 1U1NA 2DO4A 1B7FA 3SDEA 2JVOA 5JVHQ 1WI6A 3VAMA 1Q86T 3MUVP 2DHGA 2KM8B 4RU2A 2RRBA 2EK6A 3VALA 1Q81T 5HO4A 1RKJA 3Q2TC 4W92B 4OZ0A 3IWNC 1QVGR 4CH1A 2I2YA 3VF0B 1BY9A 4QQBA 2MKJA 2JX2A 2HVZA 3BS9A 1X5OA 2RQ4A 2KYXA 3NMRA 2MJNA 3I55S 1WI8A 1D9AA 5ITHA 1PO6A 2LYVA 2CQ3A 2DHXA 3TYTA 2DHSA 5LSLA 3G9CA 3VAHA 1VQ5S 2AYGA 3J7ZT 1FT8A 1S79A 4WFNQ 2DNKA 1N8RT 2RU3A 2XSFA 3R27A 1D8ZA 2JWNA 2KRRA 1U1OA 3CC7S 1JJHA 2MZTA 4WF9Q 3CXCR 3CTRA 3UD3P 4Z2XA 3CMAS 3UE2A 2FPHX 4IOCQ 2YH0A 4TU8A 2DISA 2HZCA 2ERRA 3N9UC 1X5TA 1X5SA 3Q2SC 3B4MA 3G4SS 3CPWR 2X1GA 1YWXA 2B0GA 2MSTA 1WHYA 1OIAA 2L9WA 1H2VZ 3UCZP 1U1RA 2CJKA 2VOPA 3D2WA 1XN9A 2DGSA 3J7YU 2HGLA 1JMTA 2MZ1A 1ZZNA 2J76E 2KXNB 2YWKA 1R8HA 4LIRA 5CYJA 1U1LA 1YJNS 2RQCA 3S6EA 1JJ4A 2KN4A 3H2VE 1CVJA 3EGNA 2LECA 1OO0B 2NLWA 1NJIT 1VQ9S 5EN1A 2AYBA 2ZJQQ 1VQ6S 2E5HA 1X4BA 1HD0A 3MD3A 3DXBA 2CPIA 1WWHA 4QPTA 3CCSS 5LJ3Y 5LJ5Y 2CQIA 2CPJA 1K73T 2MZSA 5FJ4A 4Y00A 2KG1A 2MQMA 2MKKA 1VBZA 3RW7A 1N54B 1KC8T 4WKRA 2JVRA 3G96A 2N7CA 5D77A 2D9OA 2G1DA 4Y0FA 5H1SV 1WG1A 2MZJA 1IQTA 3VAGA 2KG0A 1X4GA 1X4AA 2KXHA 2M8DB 5IM0A 3NNHA 3MXHP 3MI7X 1DBDA 2DNPA 2M2BA 2XNQA 3MOJB 1FJ7A 2F9DA 5IFMA 4C4WA 3UWTA 2M9KA 4IUFA 2LEBA 1SJQA 2YTCA 2M4MA 1A9NB 2N3OA 1URNA 1VQ4S 2CQ1A 1U1KA 2E44A 1L3KA 1VC0A 5LXRA 1S72S 1M5VC 1VQ8S 2F9JA 3NNCA 1ZZFA 2CQDA 1FHTA 1WF1A 2A3JA 1VQNS 4TLQA 2YKAA 3OW2R 2RRAA 2M7SA 2MKIA 5DDQC 2MQOA 2MY7A 2KFYA 3CCES 4C7QA 4YB1P 2Q79A 1VQ7S 3CC4S 3VAFA 4CIOA 2DHAA 2GO9A 2MKSA 1SJFA 1X4DA 2HYIB 2DNZA 2MZQA 2PE8A 2NZ4A 1RK8A 1N88A 1WG5A 2LA6A 3CCRS 1X5PA 2DNQA 2MMYA 3R1LA 1WEZA 1VC6A 2HGNA 4PR6A 4C0OC 2DIUA 1F9FA 3UCGA 3CCMS 2DGOA 5GVQA 1VQKS 2RUGA 2X1AA 2U2FA 3VAKA 3NS6A 2CQCA 3EX7B 1U6BA 3MURP 1M5OC 5GAEU 2DGUA 2AYMA 3CD6S 2N3LA 2KRBA 1U1MA 1KQSR 5BJRA 2QFJA 1K8AT 4QU6A 2HGMA 4FXVA 4F25A 3UCUP 4FXWA 2DH7A 2KI2A 2X1BA 4OZ1A 3THPA 5GMKa 4YOEA 1H2UX 2LKZA 1X4EA 1DZ5A 1VQLS 3JB9k 1WF0A 2D9PA 2OIHA 1UW4A 2ADBA 1N52B 3CCQS 1KD1T 1ZH5A 1FNXH 4CQ1A 5CA5A 5JVGQ 1WELA 1VQPS 2DB1A 3CCJS 2CPZA 2MGZA 5GAGU 2MPUA 3S7RA 3NNAA 1DRZA 4V19X 1P27B 2DIVA 2V94A 2RS8A 2RS2A 2CPXA 3CF5Q 2MY8A 1X4FA 4UQTA 2DITA 4WIIA 2LQ5A 2M70A 2K3KA 2VODA 2CPYA 3NS5A 1SJ4P 2GHPA 3B4DA 1KOHA 3P5TL 2KVIA 2UP1A 1DHMA 1YIJS 3DLLQ 5GADU 2LMIA 3BEGB 2MYFA 5DDRC 1UAWA 2BOPA 1WG4A 3P3DA 3MDFA 4PKDB 3MUMP 2M52A 2MZRA 2QA4S 1M1KT 3LQVA 2XS7A 1FJEB 5DM7Q 1X0FA 3MD1A 2KM8C 4PRFA 2LXUA 1U1QA 2BZ2A 1HL6A 3K0JA 4UY8T 2WBRA 2MB0B 2DNHA 2RVJA 1YJ9S 5HL7Q 1KOOA 1U2FA 2RT3A 2XNRA 2M8HA 1U6FA 3S8SA 2DGXA 3SMZA 2VONA 1W2BR 1OWXA 3CC2S 3US5A 1VQMS 2LCWA 4CH0S 1WEYA 1QM9A 3ZZZA 2DO0A 2LXIA 2PEHA 3BO2A 2DGQA 2CPEA 3LPYA 4BS2A 3RW6A 2QEXS 2MKHA 1X4HA 2G0CA 3V4MA 4U67Q 1WHVA 1O0PA 2FC8A 2MGZB 1VBYA 1U1PA 2SXLA 2DGTA 1SJRA 3BO4A 3HI9A 1NU4A 2ZJRQ 2XS5A 1WHWA 2J0SD 4A8XA 1G2EA 2EVZA 2KT5A 1X4CA 2KHCA 2AD9A 1Q82T 2FY1A 3SXLA 1WF2A 2MHNA 3S01A 1M90T 2M0GB 2DNYA 5MLCV 2KXFA 2M88A 1UFWA 5D78A 4M5DB 2CPHA 2OSRA 3G8SA 1YITS 1UP1A 2L41A 2DK2A 3G71S 1SXLA 3U1LA 1VC5A 1FO1A 2CQ4A 2DNLA 1QVFR 1K9MT 2AYEA 2LA4A 1VBXA 2VOOA 2CPFA 1WTBA 1YI2S 1A7GE 2I38A 2KH9A 3CUNA 2E5JA 1OPIA 5DETA 3CCUS 2RNEA 2L08A 5DDOC 1Q7YT 3VAJA 3IRWP 5LSOA 5CXTA 3CCVS
chains in the Genus database with same CATH superfamily
1IKXB 3VR1A 2H54B 3FCHA 4DQSA 2VKZG 4DR3F 3TA2A 2MKCA 1I51B 7FD1A 4B3SF 2C22A 1TK8A 1M5SA 3CJRA 2E5IA 1U09A 1F6TA 2IAJB 3CULA 3EGZA 3I9ZA 1IJEB 2DH8A 2I9SA 1RJJA 5HATA 2N82B 2UU9F 1TUGB 1NSAA 4A4JA 4DI6A 2IPOB 3QRQA 3SFUA 2ZH9A 4K4UA 3THTA 1HBMB 2AF6A 2XI2A 3UD4P 2J0WA 2AJ0A 5IQQA 2OTLS 4PYDA 3N01A 5CH7B 2VV5A 3IAM9 2QSFA 1FEEA 1S6QB 2BJ7A 2CUYA 3KLIA 3TA1A 5DLGA 2W9BB 3M8SA 2CZ9A 4ECWA 1ZM9A 4ELVA 1OS5A 1VQOS 1FRXA 3P49B 3KXDA 2XB2D 4MFBA 4KPCA 3G8TA 4IO9Q 4LJMA 8ATCB 4YDDB 2OGUA 5DM6Q 3MFHA 4L3NA 3J80Y 1PILA 1SH3A 1FKPB 4C3LA 2V8DA 4YY3F 4JB8B 3ENAA 3H0PA 5F8LA 3M8ZA 4F4YA 5H9EJ 1S6PB 3RAXA 3HO1A 2VQFJ 1NRKA 3ULHA 4KR0B 1I3OB 1W7WA 3LANA 4QZVB 5IWAF 1XTZA 4RUCA 1P9YA 5E2QA 1GK8A 1TKXA 4TY9A 4AD6A 1TK5A 2MKYA 4J7CA 4K4SA 1YBTA 4C8KA 2YKMA 2IY5B 4ZVSB 1RWVB 4I6YA 2F63A 2ZHAA 1SQFA 3PIOQ 1XR6A 5KFFA 2GW8A 3M8PA 4RWWA 1GXLA 1WKKA 2KB2A 2XI3A 1WC6A 3PNIA 1NK5A 3RR7A 3CDAA 4LSNB 4DUYJ 1UEKA 2Z2MA 5C42B 4PPZA 5KFDA 2NREA 3EUNA 2GCFA 1TAQA 1RHKB 2ACMA 2VU5A 3D3BJ 3E01B 4DR3J 4C8YA 1N33F 1AZSB 1H74A 2CQ2A 3QIDA 3DCAA 2HNYB 3RBXA 4F02A 2KHDA 4CLWA 1M5KC 1GTEA 3FUYA 3R3TA 4OJ1A 2YKQA 3M8PB 2UUAF 1FD8A 2WOMB 3KMSA 2B8QA 3EZUA 3NXZA 5HQ8A 1B64A 1ZAWA 1JXVA 1VLOA 3O5TB 3FK4A 3ILLA 4CT9A 4ZVOB 1UJ5A 4NASA 4A8YA 2NR0A 3N28A 4YN3B 5KT4A 2ADCA 2P9CA 3HVTB 3NAHA 2VBZA 4PG8A 2FLLA 3OXFA 1UKUA 3BN4A 4JV0A 3NOGA 1M5PC 1S0VA 3RTVA 4B3RF 2LEPA 2ZZMA 4H4OA 3PYDA 3V6DB 3CJSA 2XSJB 3SV4A 1D0EA 5F8NA 1RKIA 5IM0B 2CQHA 4CWBA 3OTOF 3D1OA 4NLPA 3UI3A 2VDIA 1S5ZA 4J5OA 5LXYA 1KFSA 1GXTA 1WSRA 2K7JA 1B7FA 1KLMB 2QTWA 2CJBA 2AJ4A 1WI6A 4ZLPA 1H0HB 1ZBTA 2C2DA 2V8HA 3HHKA 4Y65A 1X0PA 4RW8B 2ZD1A 2KM8B 4RU2A 1RT2B 2RRBA 4L6V3 3A8IA 4L3KA 2JOQA 5HO4A 3Q2TC 4G6VB 4ECUA 4FPIA 3V81B 1S99A 3V6KA 3D7SB 1FFGB 3CO0P 5KT7A 3DLBA 2V8PA 1BY9A 4ZLJA 3FCWA 1HKAA 2Z2YB 2XZTB 4M5HA 3F0NA 2MKJA 1T05B 2A2CA 2LVWA 5F41A 2I5JA 2HVZA 3GG1A 4ZPDA 3VTIA 1VJQA 4DHVA 2BVZA 4QWEA 3HHLC 3GWCA 2R8KA 1X5OA 3GJRB 1H73A 3IGNA 4PWWA 5IS2A 1GEHA 2IDLA 3BSCA 3G6YA 3HF5A 4LFBF 4J9KA 3W64A 5KFPA 4V19J 3IN5A 3EPIA 1PO6A 2LYVA 4FVCA 2RD5C 2X3DA 4N8OA 2YKNA 4TYAA 4AXIA 2LFVA 3D6FB 2R2RA 3KJNB 2DPJA 5ETLA 5B0BA 1SC1B 2ZE2B 1U2CA 4YB7A 4Q45A 3M1VA 3QMQA 3VAHA 3O8WA 1FKOB 1J5OB 1VQ5S 3TUPA 4O3RA 1FT8A 2VC0A 2IM2A 2RU3A 1VS3A 2KJWA 5CYQA 3GP9A 5EGYA 2ILZA 4XTTA 3KKFA 1D8ZA 2JWNA 2KRRA 1NKCA 1U1OA 4F4KA 3CJ5A 1NPPA 4WF9Q 3CXCR 1XMBA 4NOHA 1P9QC 1NK8A 3PFEA 3BR8A 3WIUA 3BGUA 3FKBA 2RILA 1RTIB 2IYGA 2IA6A 4N41A 1T9VA 2DKOB 3OFFA 2APOA 3GYXB 4ECYA 2DVIA 3Q22A 2NPFA 4TU8A 2WTFA 3NOCA 3TJ9A 5L9NA 4QBUA 2ERRA 2N4DA 2F40A 3BGRA 3OFGA 3SSSA 3HZEA 2B4OA 2CA9A 3CDBA 1NPRA 3EXCX 2BQUA 5E0OA 5T7LA 3EGVA 1XQIA 4OHWA 5EX3A 3GB0A 1RHRB 1OIAA 1WHYA 5KFTA 3UCZP 1HQ2A 3HFZB 1F3VA 1XN9A 5HVFA 3D2WA 5D0GA 2W2MP 3LALA 5FIIA 2NYIA 4M5MA 2VFVA 3KG0A 4J9MA 1L3TA 2W4DA 1PIEA 4URQU 3GSDA 4K7QA 1RE1B 4EU0A 3M8QB 1U1LA 4H4MA 3KHHA 1IJFB 5LL6d 4C97A 3NGRA 1FXDA 2B51A 2JSXA 1G4CA 2WB1D 3H2VE 3OJUA 3I31A 3GIIA 4DV5F 3UQSA 4DL6A 4KV8B 2QLWA 3D6MB 2NLWA 2ROPA 3L09A 1NJIT 2XY6A 4B9UA 3H4BA 3HK2A 1T0TV 4A8OA 1IM6A 1IKVA 5K8NA 2EXUA 2KYZA 3LGHA 4JI8J 2IMOA 1VYAA 2HLTA 1X4BA 1HI8A 4J9OA 2L9NA 4RLEA 1CQMA 3T5JA 1K73T 5HN0A 1RHMB 2MZSA 3I0SA 4Y00A 1NH7A 4CP5A 4ED8A 3H98A 3NL0A 2EKYA 1ZS6A 2CADA 1I5OB 2MKKA 5C2CA 4M5LA 1N54B 2W1BA 3RW7A 4ECRA 4S0MA 3IR7B 4R0EA 3T1HJ 1CQNA 1Q5YA 2BW7A 2C1EB 3DMJA 3MPYA 2B9XA 4K59A 5D77A 2XQCA 1UA1A 2KTQA 3K5LA 4IR9A 1RSCA 2P6SA 1LWFA 1HNZJ 3EGWB 4KE5A 5H1SV 2CJYB 1WG1A 3MMCB 3HSJA 4JV2A 2B6AA 1TL1A 1X9WA 2UUCF 2HNZA 3J7AN 1N0UA 3VAGA 4FYYB 5HLFA 2E7WA 4IRCA 1X4GA 4PG6A 4X2BA 1APSA 3M9OB 1RAGB 2FLOA 3TOQA 3SSRA 2ZH8A 4NZ0A 3NNHA 1N34J 4KB7A 3R5BA 4NLRA 2QL5B 4IDKB 3PRBA 4FYWB 3CCWA 3R2DJ 2HQCA 1IKYA 4O3NA 3W5XA 2OD6A 2KFZA 3DOKA 5GAEI 1DQ9A 5BYRA 2YQ3A 3ISZA 3D6TB 4USJC 4GKJJ 2R7OA 2RU9A 4A8FA 5HVGA 2C2OB 2V34A 3UWTA 3I87A 1RT4B 2WONB 1ZTTA 4F0MA 2LEBA 2AGQA 2M4MA 2XMAA 2B56A 3JQJA 1URNA 4IFVB 1VQ4S 4OJHA 5D0EA 1U1KA 5F0WA 4B9LA 3TUIC 1FDBA 4J9QA 1VC0A 3BGRB 2YPZA 1CULA 1EHWA 1RP5A 4OYWA 1LW2A 4OI3A 1M5VC 2F9JA 3NNCA 1SIWB 1K0VA 4F2RA 2JNJA 5F9NA 1YBAA 2PFFB 4HACA 2RH3A 3LP2B 3NP5A 4A8WA 3M6XA 2W7PA 1RB0A 1RT2A 2ZOFA 1DTTA 1U0HA 2YKAA 3VVUA 5B09A 4X4PA 2E9ZA 2CAJA 2HHHF 3GG0A 4WU2A 5A0YA 4EUVA 4AQYJ 3IP0A 1NHKL 1CJKB 3AFGA 3OTEA 3QGHA 4H4KA 4PYAA 4ANCA 2VPZB 1FKOA 1U49A 4W4MA 1J5OA 5U47A 1ACMB 3M8QA 1JNZB 2HVIA 3KLVA 1VQ7S 1BQMA 4OHXA 4DV6J 2I8EA 1YRXA 3CCZA 3CC4S 1FJGF 1T02A 4XO0A 4CIOA 1SJ1A 1MNEA 2HKEA 4NLUA 4LF9F 4PWDA 2WSFC 2DNZA 3DOMA 2V4QA 1UA0A 1S12A 5KG2A 1LQ9A 4JI8F 1N88A 4RNNA 3N6LA 1P1LA 3HVTA 2J7WA 3CCRS 2PC6A 1F5AA 2DNQA 3TRGA 1SKRA 2W7AA 2RKIB 1YKWA 1TV6A 3R6GB 5I3PA 3QAEA 5A8WA 2FHJA 1FWKA 1RAHB 3FQLA 2X1AA 1U8WA 2U2FA 1U48A 2PMHA 1N5SA 3TQEA 3OL6A 2JL9A 3HVWA 5J1EB 2ZH3A 5GAEU 1S0OA 1QDUB 2DGUA 5HMYA 3ETMA 3SYZA 1IKWB 2F8EX 2P9EA 5HROB 3TW0A 1HNIB 3VQTA 3HM9A 1YK9A 3DGVA 2ZD1B 5MAOA 3MEDB 4RO0A 3FJ2A 4DG1A 1UJ4A 2X7IA 3I9V9 1GNKA 3KG4A 3LP0B 4F25A 2W2QP 4YP3A 3KK2A 3M2RB 3V81A 5THWA 1IBMJ 2DH7A 5HMXA 1C0UB 4PQAA 4U7UK 3BSAA 4KGZB 5LMNF 3EM1A 1KR4A 2YQ0A 2V4JA 3HT3A 2CKWA 4DR5F 2YNFA 3BSOA 4YOEA 1H2UX 2OPSA 4GO7X 4ZVUB 2QRRA 3D0HE 2XMKA 3N5BA 2IDEA 4ID5A 1VQLS 3JB9k 2E29A 1WC0A 1R8BA 3DDKA 3JSBA 2ZH4A 2HW3A 3HHEA 2KZZA 6FDRA 4N5SA 2UUTA 2BBEA 1L3UA 2HHHJ 5FLXU 5KFXA 3CJQA 4OV6A 4OYIA 2R7TA 1VRQC 4A47A 3CCQS 1KD1T 1LXNA 2PN6A 2R2TA 1KWMA 1S7IA 2BYCA 4ZLNA 2VPWB 3D67A 1FJGJ 5HI7A 5J2MA 4P75A 3PZPA 1YGYA 4IG3B 3AB4B 3W7BA 1VQPS 2DB1A 4G65A 1RAFB 3DKDA 3G6VA 3EJMA 1YJRA 4HHHA 2HNYA 2MGZA 1HHQA 1X7VA 2QA1A 3P96A 5EUHA 3TVZA 4RW6B 3W9IA 4DSFA 5F8MA 4MK7A 2GV1A 3UN3A 3KK3B 1DRZA 3NNAA 3RAQA 4TYBA 4P7VA 3PJ9A 3MR2A 1XBWA 2QO3A 4K4XA 4LFCJ 1ZM2A 2BJDA 1RAJA 4DMZA 4KJIA 3L4BC 3ZO7A 3QT6A 4ZLLA 4USVA 1LXJA 1N5TA 1UZHA 1X4FA 1ZA2B 2DITA 4WIIA 2AJ2A 3FC9A 2J9EA 5D3GB 1RU1A 3DLKA 3GV7B 3I4PA 1Z2ZA 5KTQA 3K8VA 3T5KA 4V1Ak 3HSGA 3PY8A 3P5TL 2HHSA 3VGSA 1QSLA 2KVIA 3JTOA 3FZBA 4XIUA 3DLLQ 1OSDA 3C14A 4Q5VA 2LMIA 2H5IB 5SZTA 3QSYB 4ILMA 4C9DA 1PKUA 2ZZNA 5DDRC 1XNQF 3A3PB 2BOPA 1RCOB 2VFSA 5LMUF 3MDFA 1N34F 2AP6A 3UDVA 4TLRA 1UMJA 2RDIA 3MUMP 1T9YA 4ZP6A 3H20A 4JI3J 3T9ZA 2QX0A 2O01C 4ZP8A 3M8YA 2ZEJA 5L1IA 2HQFA 9ATCB 1M1KT 1HMVA 2GNKA 4NRUA 3JS9A 1SVDA 2VASA 3LQVA 3J80U 3ET6A 4DX6A 4Q2MA 1KDNA 3J81U 2V50A 5ETRA 4JI2J 3TANA 2GQQA 2ZBIA 4RBTA 3TAPA 2WVFA 5KFMA 3LGNA 3DRRA 4JI2F 2WBRA 5KT5A 1RYRA 4HKQA 2PT0A 4I69A 4J90A 4NCGB 1S1WA 2RVJA 4R5PA 1NJYA 3RU0A 3D1HA 1VK8A 1SKSA 4DBQA 2IBKA 3MAHA 2C28A 2HURA 3M6WA 1AROP 2YKMB 1IKYB 5IV4A 2M8HA 4F04B 2XNRA 1Z4UA 4OZLA 1HQUB 4X66F 3SMZA 2F8MA 1HFEL 3LP1B 3M1VB 4OI1A 5BYSA 1PJ7A 5KOWA 1OWXA 5IZHA 3CC2S 3THVA 2BQ3A 1W25A 1JLGA 3QGPA 5FDLB 2HBZB 3FSIA 2W9CB 1QM9A 3TEGA 2V2QA 4DFJA 2DO0A 2LXIA 3BO2A 2AEJA 1HNWJ 1G1XA 4YMEA 3BV8A 4FYVB 5DG8A 3O2IA 2QMXA 4ZDNA 1VQ8S 2FZGB 4C2MA 4KT0C 4A8QA 1X4HA 2HQ3A 3V4MA 2R7WA 2CVIA 1OYDA 4IFYA 1O0PA 3H90A 2IMWP 2HVEA 2OPQA 3V4IA 5F9LA 1S1XA 3W2VB 2MGZB 4OFZA 3RB6A 1HNIA 1IR1A 2PMZD 3AOAA 4FNIA 1U1PA 5KFZA 3W60A 1H7XA 2SXLA 4KO0A 2DGTA 2QIFA 2ZJRQ 4EBDA 1P6TA 4ALZA 2B3TB 1NBEB 4RW9B 1G2EA 3J81Y 2O66A 4RPFA 1VQNS 1H98A 2FVSA 3E2EA 3DYAA 3A1YG 4QYZK 5KOXA 1Q5VA 4LREA 2OPQB 2YXLA 2AD9A 2ZBQA 4IH7A 3POTA 4P2XA 3CJKA 3WHIA 3HMJG 4U8VA 1FDDA 1RAIB 2DNYA 5MLCV 3IBCB 2KXFA 4FVMA 3ZZ0A 1VRUB 2YNHB 1FTCA 2H4YB 1UFWA 3DLEA 4ELUA 2RRNA 4M5DB 3A12A 3NLCA 3EDQB 3G8SA 3GSIA 1YITS 3OFEA 3QGGA 1X9MA 1O6XA 3C16B 5DZ7A 2Y3YA 3E3XA 1VC5A 3MR3A 3MFIA 5L39A 1OJ4A 3M2VB 4Y2CA 1QVFR 1K9MT 1NZ8A 2LA4A 4X4TA 2YY3A 3MM6A 4X4NA 2CNOB 2AGOA 1CG2A 2G2YA 4M5GA 1QAXA 3HSDA 3O1LA 2BE2A 2FJXA 1UVLA 1WTBA 4OZNA 4ICLB 2GHWA 2ZUAA 2MLYA 2BKPA 1OYEA 1NLKL 5KT6A 2E5JA 1IWGA 5A0YB 3Q89A 3D0GE 4CRJA 2AV5A 5KG5A 2L08A 4DPYA 3OVSA 2LQ9A 2XMVA 4K4TA 1TKZB 3IG1A 3IRWP 3CVKA 1HNWF 1R0BG 2J9DA 2KT2A 3QNWB 5CXTA 3GCWP 1S9EB 3MOZA 4NLQA 1WHXA 2ZH2A 1GX5A 5IT9Y 2BANA 1YQHA 5G0RB 4NA1A 3MUTP 3TR5A 1Z2LA 2CJQA 2RJZA 1NK9A 1TKTB 1CJTA 3EICA 4YDXA 4ZOSA 2Y1JA 3QWPA 1RWUA 2K3IA 3MMBA 4WP8A 3SIPB 1D3WA 1RCXB 3KJVB 3Q0AA 1SL0A 1JIHA 4MYUA 2J5AA 2XY7A 4X65J 2JRSA 4RW8A 1CJVA 1RQ0A 5CYQB 5C7PA 5BXIA 4OYOA 3UW1A 1N36J 4U8YA 1HQUA 3DRSA 1RABB 1TZ0A 3FSYA 4A8SA 2XO7A 1QD1A 2AW0A 1HARA 3EVWA 5JMNA 2CQPA 3FGVA 4HTJA 3JYTA 4U9RA 5J2PB 1S10A 3OPKA 4M95A 3I96A 1IM4A 4DFPA 5IC4B 3BKUA 3WDOA 4JI1F 2Q66A 4K4VA 2Z8QA 1IBKF 3HHNB 4DL7A 3V6HA 1N5YB 2EK1A 4KBIA 4P9SA 2C2NA 2YH1A 2QMUB 2NQPA 3A8KA 3IR6B 4HR2A 4M5IA 3ZZPA 3ILJA 2C3UA 1T3NA 1BQNB 2V67A 4RBVA 1QUPA 3F73A 4NXMF 2DNGA 3U1MA 5GAHU 2CQGA 2BOAA 1MWZA 1MW7A 2AQ4A 1FDNA 2HHWA 2CNLB 1CSJA 3FEYB 1VIOA 3L3CA 4C48A 4F26A 3QFWA 2DNMA 2VG6A 1NNDA 1R0CB 4JP8A 4DU7A 3KLEA 3CCLS 4EEYA 2CZVC 2JLFA 1HNVA 2XYPB 3TAMA 4KIAA 4WTOB 1KNZA 3PW0A 5A76A 1L5UA 3HKZD 3CCTA 2HIQA 1S77D 4TU7A 4DSJA 4NLOA 4NEZA 4NZ6A 1RTDA 1SC6A 1C4AA 3CE8A 5HANA 4OYMA 3BPSP 2KU7A 2RDDA 3PX6A 4JYAF 1AW0A 2N7YA 3BO3A 2Y1IA 4JI7F 3H8YA 3VVTA 4ED5A 3K8WA 3MPVA 2W9CA 2CFXA 3H2UB 2FB0A 1WC3A 3QGIA 3R6LB 4JI0F 1YG0A 5KG7A 2EFPA 3LP1A 2BABA 3RJMB 1LWXA 1MSWD 2IM3A 3M30A 4C11A 2B9EA 1RT7A 2XMJA 3UD5A 1Z1ZA 2D3UA 5F8GA 1FXLA 1HA1A 1TL5A 2EBGA 4I0WA 1BXNA 2J8AA 2DNRA 3DOKB 2YX7A 2IYIA 4ZPCA 4NCGA 1FESA 4USIA 4CLKA 1QSYA 3MHYA 4RW7A 4X66J 5L9XA 2V63A 2HAFA 1HHTP 4L73A 2MQPA 3WC2A 2FGCA 2NPIA 2HFZA 3DLKB 3HULA 2LEAA 1NAQA 2QV6A 3QFHA 4EGLA 3QT5A 2F3JA 3DOLA 5L38A 2MSSA 3OLAA 4I6AA 2VQFF 2O3DA 3V4IB 1JLBB 1DQ8A 2ATCB 2AX0A 2V69A 5C2GA 3Q8SB 1B3TA 1D8YA 2U1AA 2FC9A 1JJ2R 1TK0A 2PEBA 5CABA 1TU0B 4F0KA 1JK9B 2W24A 1U1NA 1S57A 3NRBA 4MAKA 2DO4A 3GILA 2DXDA 5JVHQ 2JVOA 2V2ZA 2VG6B 2DHGA 3W9HA 6AT1B 1KVJA 1UWAA 2GVDA 2WCXA 8RUCA 2HWHA 3T1YF 4K5SA 2ABYA 2VBWA 3MMAA 4HYKA 1BUXA 4CH1A 3PKYA 2I2YA 3MGJA 1PG5B 1GTHA 1MG7A 2MDAA 4RUBA 2ASDA 1DTQA 2P6TA 3UR3C 3DLGA 2XO6A 1U45A 2JX2A 5GAHI 4ECSA 1MU2B 5KAKA 2OUGA 2OPSB 5JJBA 2UVUA 2KDOA 4OIXA 3C2PA 4JI7J 3FEZA 2ZVSA 2KYXA 3NMRA 3DMJB 1T8EA 1ROFA 5AE2A 1D9AA 3RBZA 3PO5A 2JHEA 2CQ3A 3ENWA 4OX9J 3TYTA 1LK7A 3P8BB 5BYQA 3ZC4A 4U7CA 1V3RA 4ECQA 4LF4J 4QWAA 3D4JA 4NMXA 8AT1B 2OPPA 4UOCA 3J7ZT 3RYLA 4WFNQ 3C46A 4ELTA 3OLBA 3MMJA 3BH7B 4Y2MA 4O0NA 1HBUB 4KHPJ 1FRJA 1MLAA 4RNOA 4CYUB 2FLNA 1ITPA 2IVFB 4MKVA 4AL7A 3CC7S 1JJHA 2MZTA 4L74A 4ZHRB 2AEFA 5E3AA 1K47A 5DGAA 3M6VA 4ID5B 2OPPB 4LF8J 3PYEA 1FRHA 1NH8A 5KG6A 2ZBCA 2WSCC 3ZXWA 1NB7A 4UW2A 1CC8A 3CMAS 1S1XB 5KFSA 3W2VA 1F2HA 3N0VA 5C24B 5T41A 3T5LA 2FPHX 4IOCQ 2YH0A 3CW2C 5DG7A 2DISA 4QIEA 3QIPB 4L76A 4B17A 2VD3A 1X5SA 3ILIA 4BDPA 3W2WB 3B4MA 3G4SS 4DDFA 1Q8LA 3BGOP 3JQMA 1VHFA 3HD1A 1WACA 1N33J 3ISND 3TWZA 3MEGB 2XMMA 1H2VZ 2CJKA 4ED2A 1VRUA 3OTCA 4QWCA 3J7YU 2GGPA 2MZ1A 3L9ZA 3EE3A 1U26A 2KXNB 2CRLA 4WU3A 4DPWA 4JV5J 1ELOA 2F5GA 4O3QA 2UXCF 3O3LA 4LIRA 5K14A 3I4HX 2NUUG 3NWRA 4TY8B 2RQCA 1N48A 2R7UA 2KN4A 1SB6A 4G1PA 3LUYA 1EQMA 2AJ1A 4B3RJ 5K8PA 2LECA 5KT3A 4WPAA 1OO0B 3W62A 1XR5A 3F44A 4I2QA 4DFKA 1RT5B 1GX6A 1V3ZA 3Q8QB 3VGUA 2E7XA 2GAHC 3KNGA 4MTPA 3KJQB 1B0VA 1C1BB 1JLAB 3DHXA 2GIRA 2CPIA 2AWZA 3PJWA 3W1YC 5D0RA 1PAUB 4KHMA 4DV1F 1ZETA 1EZZB 5F8IA 2IC3A 4BHQA 3MMCA 1HW8A 2HRTA 2E1RA 2AEMA 3Q8VA 2MQMA 4J9VA 1VBZA 3HVAA 4PXDA 3AOBA 3OUYB 5F3ZA 5HBMB 4PCQA 4WXWA 3KDOA 5DRKA 3OJSA 3C3LA 2R8HA 2D9OA 3D54A 1DQAA 4WE1A 1C0TB 2Z56B 3GZ7A 2B9WA 1V3SA 4XDCA 1R0AA 5IT9U 1RU2A 2V2KA 2MZJA 5HMWA 4FYXB 4ENOA 1F1BB 2YNGB 5I3QA 3NCQA 1YJUA 2KG0A 3RZAA 2OEJA 1SPBP 3H25A 3RR8A 4AQYF 2F1FA 4DL4A 4PXEA 1QTMA 2DR7A 2Y9HA 2AJFE 3QO9A 3MI7X 4UUXA 1DBDA 1UJ6A 4DN9A 2FVPA 1YZ6A 2D7SA 4AL5A 2IRUA 3D1QA 3K5MA 3BKTA 1MWQA 1P8GA 2XNQA 1M5HA 3K5PA 2YWEA 4DV5J 1UETA 3OXGA 4WK3A 4DQPA 4C4WA 2M9KA 3BZQA 1B0PA 2B43A 3NGUA 3BYPA 3IBFB 4PPDA 2UVWA 3MEEB 1F0XA 5J1PA 2OFGX 4DR1J 2GIQA 4YFUA 4RW4B 2ATLA 2CQ1A 3QBCA 2EBEA 4N77A 3WC0A 5DG9A 3V6DA 2DR6A 1NSPA 2E44A 1MMNA 5LXRA 1W26A 4RJVA 1VIXA 4OZ3A 2ZBPA 2VHGA 4QJVA 4O4GB 4RL1A 3KUEA 2AJQA 2CWKA 2QL7B 3ZZOA 1R31A 1V6HA 1WF1A 2FHJD 3QAUA 5K5MA 1TVRB 1B0TA 4EMDA 4CT8A 4IR1A 1E6YB 2ZE2A 3OVAA 4DSLA 4KKOB 2IC3B 3OW2R 4NRTA 3Q24A 3PW2A 2RRAA 1Q16B 2FUG9 5B0FA 4UUWA 1VISA 2Q3PA 4HTIA 4K50A 5D3GA 2EFGA 4I1TA 1OY6A 2HBYB 4OYPA 1JLFA 5DDQC 4DV0J 2CG8A 1WUUA 1FVQA 1SH2A 3PTWA 2QGFB 2QLJB 5LMUJ 3OQ2A 1LFPA 3M32A 4YB1P 2JEJA 5F3TA 2HHTA 3J81j 1F9HA 5C25B 3AODA 3HCXA 1SH0A 2DHAA 4B3MF 3GTYX 2HRUA 5AJ3J 2MZQA 2PE8A 1RADB 3TJ8A 4FF2A 5A6WA 5I3UA 1TL3B 4P2FA 2UUBF 4IDKA 4ETZA 3D66A 4NLWA 3DFEA 4KC5A 4PR6A 2DIUA 2B5JB 3UCGA 1RLDA 2E66A 3ITHA 4FN5A 3UN2A 3KLHB 5GVQA 3IMQJ 2ASLA 2R7VA 2RUGA 1I1GA 4AFFA 2FD2A 2WVCA 1DLOA 2G0JA 2H65B 3KHRA 1KHVA 2W01A 3MEGA 1U6BA 4NXNJ 3AB2B 4LFCF 1VK3A 2FJBB 3RB3A 2AYMA 3FMWA 2HHVA 4EWTA 5J2NB 2N3LA 1VBKA 3W65A 2QFJA 2HQGA 1Q8IA 1RXOB 1HBNA 1FWLA 1KQFB 2HGMA 2EC0A 4DV3F 2BUNA 4FXVA 1FE0A 1FX2A 4I68A 1K1QA 5KFCA 3PYFA 1GMWD 2FIUA 2BJ1A 2V5HG 4OZ1A 1BMQB 3THPA 6FD1A 2XWYA 4AL6A 2MLZA 4ZPWR 4GVLA 1R3NA 1AB8A 5D0HA 2E5LJ 2JEFA 2E9TA 5IT4A 4Q0BA 1X4EA 2JZ5A 2RE1A 1WF0A 2QLBB 2WZ1A 4N56A 1I94J 2OIHA 3MAAB 1UW4A 2IM0A 2YX4A 1U7LA 1X31C 4NZ7A 2WW8A 2EWHA 1Y0HA 5KFIA 2ZBRA 1J5EF 4J91A 4MKYA 1QTNB 4DF8A 2HHUA 1SQGA 3I6PA 1J5EJ 1PJ6A 4LSNA 3C15A 5JVGQ 1NHUA 1WELA 2OMLA 2V8VA 1F5CA 2RQMA 2NZCA 4ED0A 4L75A 1PBUA 1LW0A 3CCJS 4PUOB 4UY85 4LQ9A 4DWIA 1RAOA 3NMAA 1XERA 4I7FA 1FRLA 3NEKA 1UTAA 2MPUA 3NCRA 1YRTA 1FK9B 4DUZJ 3VQSA 4BLGA 1P27B 2OO4A 2V94A 1S6OA 4I56A 1X9SA 3MM8A 2BRKA 5KFJA 2XMTA 4CLSA 4QCLA 3PXGa 3RAMA 3HLUA 1RBLA 1REVA 4QW9A 1HWIA 4IRDA 2HQDA 5ETQA 3X3UA 2D1CA 3GFYA 2IVYA 1RYSA 1VQYA 1WC4A 1IBMF 3TVKA 3GV8B 3ZTOA 5HVHA 3B4DA 3M32B 2R2SA 1SJ4P 1NJXA 2ZDPA 2JC0A 3CO9A 1S9GB 3TZXA 4DF4A 4ILLA 2B7BB 3NBPA 3JTPA 1YIJS 3W2WA 3K89A 5EWEA 5GADU 1ZA1B 2IRXA 2CJAA 2CJ9A 1NCLA 2ZKTA 3BBBA 5CAAA 2ILYA 1KBRA 1NUEA 4E2FB 4U95A 3WX8A 4K4YA 1N32J 4DL3A 1HBOB 1RWNB 3DRYA 2ZHOA 4PKDB 4DQIA 3MM9B 1UFKA 4O4GA 1Y4ZB 2G9OA 2AZ1A 2DCLA 2FTRA 2HBQB 2K1RB 2YNGA 4MK8A 4NI2A 4OI4A 3W5ZA 5L1LA 3CSKA 1QAIA 4PUOA 1XEZA 3GJQB 5CHCB 1DLOB 1HNXJ 1VRTA 1SI9A 2DRBA 1FKPA 1MROB 1WSVA 2ZNYA 2C3YA 5DM7Q 1DTTB 4HLBA 4OHZA 3MD1A 2R42A 3MR5A 1V5VA 1X0FA 2JEGA 2UXDF 2BZ2A 4L72B 5ETMA 1G6BA 2MB0B 4IKAA 4DS4A 5HLFB 4KV8A 2DR9A 1CJKA 3R7SB 5LSRA 4O44A 1U8SA 2ZH7A 1CPZA 4KFBB 4ATNA 1KOOA 3NAIA 5E3RA 4CM2A 3U1NA 2COLA 1LWEA 4KGMA 4JI0J 4JI4J 3W66A 1NJWA 3FZ2A 4HI2A 2DGXA 2PI4A 5A8KA 4M94A 2VONA 3E01A 4JI4F 2QZ8A 2Q1LA 4HEA9 5DJBA 2H3EB 4CH7A 1RT6B 3US5A 1GMUA 5ETTA 1RT4A 1LW2B 4CH0S 5GADI 5M2RA 4Q8EA 1C2PA 4OV1A 3ELHA 2XLJA 3KLGB 2BDPA 4QYZJ 3DRPA 2DR8A 4DSKA 3FFIA 3LPYA 2FLPA 3OXLA 3PX0A 2OHDA 3MECB 2KKHA 3AT1B 4F4ZA 4BS2A 5IOLA 2EFVA 4B3SJ 3IXQA 3FRZA 1XMQF 2WHOA 1TL7B 3KMQA 2ZVIA 3BBCA 4OX8A 5GMDA 2MEWA 2HWTA 3PACA 5JUMA 2ZH1A 1U0SA 3CIZA 3SBMA 2IVMA 3N6MA 3UFCX 3C14B 4U67Q 1JJCB 2IAJA 1KVKA 4ZCLA 3AY0A 3JAMU 4ES1A 2HLUA 1XR7A 2CNNB 2RHQB 3BO4A 3HI9A 2XMWA 2O67A 4UZCA 1SUQA 4CI0B 2GX8A 2XGPA 2PDAA 1TKXB 1AA1B 1TFYA 4GO5X 2HHQA 5H9FJ 2EVZA 1U47A 1X4CA 1BD6A 3R8YA 2WBMA 1ICEB 4HHJA 3S01A 2V68A 2UUWA 3AAWB 2VFTA 3KYLA 1FVSA 4P2SA 1AYEA 1TP7A 4IG0A 4Y34A 3MTJA 3Q83A 3PYGA 2WRMA 5B08A 2VF3A 3DLJA 5D78A 3DRRB 5KFHA 1TL4A 2OSRA 5I42B 2OJ3A 2UXDJ 2OP5A 3TZZA 2DHHA 1S1UA 1GQEA 3UDEA 3G71S 1SXLA 4B3OB 4DR6J 2H51B 4TN2A 2OPRA 3GE9A 2CQ4A 2DNLA 2JC1A 4RZRA 2HZAA 2ZHBA 1VBXA 4DL2A 1HBUA 3DRXA 4TQSA 3CD7A 3MCOA 5HROA 2CPFA 4JV5F 3QLHA 5E7OB 4PZVA 5K9FA 4IG3A 1E6YA 4DCPB 3HHLD 1L3SA 1GAOA 4RW7B 1OY9A 1ZPWX 1FA0A 3SFGA 2NS1B 3T1AA 4DR2J 3D28A 4I7FB 3DC2A 1BHNA 4I2PA 5J1NA 1QLNA 2RNEA 2EC2A 1LW0B 2CYYA 3QQCD 5DDOC 2J9DE 3AJDA 3VAJA 1VRTB 4JI5F 1S6UA 5C24A 5LSOA 3J7Z5 2AIRB 2XGQA 1KSPA 3CCVS 3UR0A 2XEXA 1P1TA 2EFOA 4F2SA 5E3QA 4XDDA 4GVBB 1YRUA 3M2RA 3OUYA 2R7RA 1HHSA 5T7LB 1DJ0A 3MAAA 2XY5A 2LQJA 1C0UA 1YJVA 2AX1A 2JLEA 2G13A 1QUVA 1YVFA 2Q6CA 2XYGB 1LWCB 3C66A 3QPIA 4M5KA 4CYUA 1JKHB 2GO8A 1S6QA 1WOOA 3KLIB 3R9LA 5DDPC 3PIPQ 4F4XA 1RBOB 5G0RA 2XHCA 5A8RA 4ZS6A 4IO1A 2QT7A 2E5GA 4TU9A 3Q23A 1NO8A 4LRDA 5A8KB 3CEDA 3DGPA 2W2PP 3TQ1A 4QYRA 4ZHRA 4MIAA 2H48B 2DGWA 1RT5A 1FDAA 1T9XA 2OSQA 4XPEA 2VZ9A 4RW6A 4TNOA 4MYTA 5J1EA 2XC9A 4ANDA 3BDEA 1R7IA 3EYZA 1YTYA 4PQUA 2R7XA 3ZTSA 4O4RA 3TUZC 2X1FA 4WIQA 4IOAQ 2BQRA 4LF4F 2FHOB 1YJ7A 3ADAC 1WEXA 5J2NA 4OJ3A 3K57A 3DLHA 1EX8A 3G2XA 4MIWA 4OI6A 3DM2B 3J7YI 1SC3B 2F7VA 1CS4B 4OZ2A 1EKRA 4IFYB 5D8HB 3MCSA 4NE9C 3UDCA 3TP2A 4FBUA 4ZVTB 1ZM3A 1BE4A 1IUJA 2DRDA 4QR1A 3D3CJ 2ZC4A 3N79A 2CQBA 3EXYA 1RT1A 4N47A 1SUQB 2DNNA 5L8RC 3SCIE 3MMAB 1K0TA 2AGPA 2M5YA 3R1HA 3MM5A 4LQ3A 1KVIA 1R8PA 3B6BA 2CIMA 3VAIA 4O3SA 4M1KA 3IWLA 1H2TZ 1JXEA 3MCNA 4OZJA 1LWFB 5L46A 3H5SA 1Q78A 1BGXT 4X65F 2ZJPQ 2D3OR 1TMJA 3C15B 2OEMA 4CCHA 3PW7A 1FFSB 1PJ5A 3SZ2A 5B0AA 3JSMB 2DGVA 1HLWA 1OQ3A 1VDHA 2IA0A 3DNCA 1HNZF 4JI1J 3DU5A 2O1PA 3PJXA 3SQOP 1SJ3P 4FF1A 1AUDA 5G4DA 5H9FK 2BEFA 3R5GA 2XS2A 3ILOA 1G7CB 2OTJS 1V5IB 4NYOA 4CO4A 4K4WA 3LW5C 4ZPTR 1UVNA 3QWUA 2DR5A 4HDGA 4WYWA 4NLDA 1IWAA 1AZSA 2PIIA 3QJLA 3I56S 2HHPA 2BM0A 3GR1A 5K8MA 1UFLA 4QU7A 2EG1A 3FCVA 4Y6IA 3IWXA 2X3GA 5E3CA 1ZOTA 4ZVGA 2MJUA 2XG8A 3SCJE 4BBYA 2Q6BA 5AJ3F 1AFIA 1EAYC 1FJCA 2DXEA 4ZP9A 1WD6A 4DU8A 3DU6A 4Z37A 3TJAA 2F4VJ 1RA7A 1BQNA 3IM8A 2AHOB 3DM2A 1H38A 4FS2A 2B4UA 4G1IA 2DD8S 4ID8A 4RBUA 5HJYA 4FDFA 4ED6A 2FVQA 4G3IA 2YNHA 2P9GA 5D4PA 1ZAXA 1Q86T 3NGKA 4H4OB 3OTBA 3RRGA 4X62F 3CJKB 3G82B 1EP4B 1MU2A 1Q81T 3VALA 1QAJA 1B4SA 3GLJA 4W92B 4OZ0A 1QVGR 2QSWA 1A0OB 4MMOA 4PXBA 2FZKB 4B3OA 4QQBA 5ADZA 1FX4A 1O51A 2GQCA 1X60A 1VR6A 2YWHA 3HHLB 3TAQA 2WONA 2IJFA 4AYBD 2HS3A 3PCOB 3PV8A 2WVDA 3BS9A 1F60B 4TVAB 2W9BA 2RHSB 1YLXA 2UV8A 1S0NA 3MPWA 1Q8BA 3HT0A 3TI0A 1RWWB 4RUAA 1XNRF 2I1RA 2RQ4A 1OMSA 2MJNA 1S1TA 2ZM6J 1UVMA 1TVRA 2H5JB 1XMOJ 2C3PA 3NY0A 1WI8A 2DT9A 3DI6B 3QYYA 4FKXA 2DHXA 3NG8A 4NA3A 3PKMA 4NLSA 1KLNA 1R43A 3CD5A 2HNZB 3CDUA 2HRYA 5J2MB 5IWAJ 3Q8RB 4WWSA 5LSLA 1C4CA 1TR0A 3MR7A 1T9TA 4WXOA 3C6UB 4DCOB 4LRCA 4UF4A 3H5UA 1HI1A 3D5MA 1T03B 2DNKA 4CLPA 2D69A 4CDIA 1T7PA 1REGX 2MQ8A 4NWBA 5KFYA 1QE1B 4MT1A 5KG3A 3KHGA 3R27A 4CO3A 2NUHA 3PEHA 3MEDA 3HKWA 3I0SB 3JXOA 3AA8A 4M8LA 2PA8D 2PSZA 4YB5A 3W8GA 1PCAA 4DPUA 3UPFA 5FJ4A 3IGVA 1MMDA 2ZKUA 3FBFA 1EKSA 1RA6A 3KLFA 3Q8YA 3UE2A 1Y10A 1KKHA 2RIJA 2ZWPA 3CJ2A 3SSQA 2VPXB 4DX7A 2PD1A 2H5EA 3M7VA 4KH0B 3N9UC 4OHYA 1FNOA 4QIGA 3Q2SC 4ECTA 3U7JA 1PC5A 3BH6B 4MIBA 2VA3A 3A4TA 2X1GA 4K2XA 3QRPA 4RWXA 2MLXA 2DCUB 2H1YA 4OYXA 3ZFVA 5L1KA 3BPDA 3I32A 1TFWA 4DLEA 3GV5B 2G1HA 2RQKA 1U1RA 3RRKA 1RLCL 3AJ1A 4O0IA 3QZ8A 2VOPA 2XHWA 2FVRA 2DGSA 2RF2B 2RMLA 3OVBA 1ZZNA 1KRPA 4EZ6A 5LOQA 3DGPB 4NMLA 1NB2A 4ZITA 4ZIVA 3FQKA 3MM7B 1XJWB 2YWKA 1RTZA 1S48A 1N5QA 1RDRA 4LFBJ 1D09B 5CYJA 2YWFA 1CJUB 4FNHA 5HMZA 2FGOA 1XMOF 1JJ4A 1VJWA 2YKNB 1IR0A 4DV6F 2XTJP 5ETVA 4Z7CA 3P4UB 4RNHA 3EGNA 3HSZA 2GAGC 1VQ9S 5GAGI 4LF8F 5EN1A 4Q7AA 4OLPA 3R7BB 2AYBA 2ZJQQ 1FI4A 2Z2ZA 3C19A 2HBRB 5AT1B 3OBIA 3PW5A 4FS1A 4OI2A 2E5HA 3KUHA 3ZZUA 3DXBA 4F36A 3CCSS 1NHVA 4LSLB 1GT8A 3H5XA 3RG6A 3KLEB 1S9EA 1EARA 2CQIA 4DV3J 1U0HB 3RGIA 4LF7J 1Q7LB 1Q4RA 2DRAA 1RT3A 5CD4A 4LF7F 2Y8WA 4DN0A 4WKRA 1RTHB 2JVRA 4F0HA 3G96A 2JH3A 3GONA 1CJTB 3O44A 2LDYA 2N7CA 1HW9A 4JI6F 2IRYA 2NXCA 2QLFB 3LO3A 3TZWA 3QZ7A 4UTGA 4CLYA 1JKHA 4C3KA 4ECZA 4Y0FA 1FK9A 1MWYA 1NMEB 1RHUB 3H40A 5ETOA 1I94F 4Y3CA 2KVQE 1X4AA 2R9LA 2VFRA 3GFZA 1KLMA 3I5BA 3JYTB 1RWKB 5IM0A 2M8DB 5KFKA 2UVRA 3BB5A 2KL8A 4B08A 3JAMY 2DNPA 3OFHA 2M3DA 5CYMA 2VQEF 4DR7J 3IS9A 4DV2F 4Y2KA 5KFBA 1SKWA 1QE1A 4YB6A 3CWJA 4WK1A 1HR0J 4DV2J 2DEJA 3RBEA 3QRRA 1FJ7A 1S1WB 4R5PB 4DX8H 5IFMA 5KFAA 3NBPB 2F4VF 1UEVA 2BXJA 1M1GA 2BW2A 4WFZA 1SJQA 4N7TA 1U6ZA 2H4WB 3A8JA 1R8CA 3BBFA 4HL9A 3MZIA 3FFIB 4NLVA 4WZQA 4DSEA 2V9KA 3BYRA 1ZM4A 2IJNA 4X84A 2A10A 4YR0A 1XC9A 1N6QA 1UL3A 1N5VA 3HPOA 3IR5B 4USKA 3VV2B 1RT6A 2FJDB 1S72S 3HJFA 2RAQA 1U25A 4NX9A 2BR0A 2W9AA 1FHTA 4GMKA 3PFOA 4IFVA 2OKQA 4ZJOA 2A3JA 3T5HA 3GIRA 4HI1A 4I4BA 1JLBA 1Y11A 2BE2B 4FP9A 2HFSA 4TLQA 4DEZA 4DQQA 1NKBA 1HI0P 2J8SA 1JLEB 3AQPA 2QE5A 3BJYA 4E8UA 3D0IE 5FD1A 2MKIA 2GJFA 3DOMB 2PGCA 2E9RX 3NS7B 2MQOA 1VHIA 4WFYA 5IC6B 4K0KF 4URGA 5HSPA 3HXMA 1DTQB 1T9UA 3ETOA 3KOAA 4UT4A 4MH8A 1GXUA 2Q79A 1KQKA 2ZDOA 2LU1A 3IO1A 4RKUC 4ZK7M 5K8OA 3VAFA 4PEOA 5IT0A 2GO9A 2MKSA 1PYSB 1SJFA 4J37A 2HYIB 3PM9A 5D6GA 2QA2A 1D1UA 4D3HA 2NZ4A 4G1QA 3Q8PB 2LA6A 3HZGA 3OSNA 1JLGB 5FDLA 5IQ6A 1CBKA 3ZZTA 1RUSA 2JJ4D 4ZJQA 3R1LA 4C8LA 4FYDA 1TL7A 3DRPB 3MWBA 2HGNA 2XCAA 4ED4A 5EWFA 2JDJA 3MECA 4DR1F 2RUSA 3RBDA 4LR9A 2Z0GA 1H3DA 2JFDA 1HMVB 3VAKA 4OI0A 4Z7YA 2E1PA 4MJKA 3MURP 2HIYA 2QN6B 4K8RA 3SCKE 3G6XA 4OQJA 3GIJA 2CDQA 4XPCA 5LT5A 2KRBA 4CZCA 1RWMB 3WBZA 2FDNA 3H42A 5BJRA 3FMBA 3C6UA 3HVRA 3RB0A 3FNNA 4KAIA 3KDNA 5CZVA 4ECXA 4KGKA 3GU0A 4LF5F 2VJVA 4FXWA 1A6LA 1FXRA 2E1AA 1NXIA 1RTIA 2KI2A 3MAQA 4AE5A 3TVYA 3UDLA 4CLUA 4DR5J 2V8GA 2KO1A 2AZ3A 3MTKA 4H4MB 4EYIB 2VG5A 1RWPB 2Y0SD 4XAKA 3FBBA 4B3MJ 3PRVA 3IA0A 2KFNA 4DV4F 2GVZB 1DZ5A 2ZNZA 1DY3A 5HJXA 4ER8A 2NCKL 4O3PA 3EMTA 4DZDA 2AMCB 2O5DA 3LWMA 3KG1A 2G2ZA 4C0BA 1KHWA 3M9MB 2QG9B 3I5AA 2ADBA 1IBLJ 5GMEA 1EJ7L 2XLKA 5E5NA 1VQSA 4LFAJ 1VMBA 2FHKA 3MEEA 4IQMA 4CQ1A 5CA5A 1SKUB 1FNXH 2XBPA 3DDIA 2PO4A 3AOCA 4LVOP 2FZCB 4WJBA 5HAOA 3UVJB 2EG2A 2HFUA 5SUHA 2J9CA 4BCAA 1CS4A 1NEEA 3PRDA 5CCMA 4RU9A 1S97A 1WC5A 5K14B 3S7RA 4CM0A 2BANB 5ETSA 4V19X 2ZC3A 4P73A 2GMJA 3V5RA 4LRAA 2RS8A 3VGVA 5DLFA 3BDPA 3OR1A 2CPXA 3CF5Q 5B7WA 1WKJA 3TAMB 2WW4A 5DQGA 4EZ9A 1GMWA 3HFKA 4F3OA 4CO0A 2D74B 3CJTA 1K1SA 1JLQB 2LQ5A 2C2KB 4CNYA 2M70A 2K3KA 2VODA 2VBXA 3CD0A 1LNQA 3QSIA 2B8PA 2UXBF 3GR0A 3SCLE 4LVNP 3WX4A 2J6UA 3IS9B 1RTJB 5A8RB 1XIQA 1IXKA 2ZWOA 4M5DA 4QR2A 2YNIB 2B4PA 1ZYQA 1KOHA 2K2PA 3GYGA 2NXUA 3G8QA 2C2EA 3QIPA 1RT1B 3TZYA 4R8UB 4B3TJ 3VGTA 1DHMA 3SEOA 4UOFA 3M2VA 1C1CA 3FBEA 5EHHA 2A6MA 3FBCA 1RBAA 1UWBB 2GQ2A 3BEGB 4DJBA 1HIYA 2MYFA 2C3MA 2AKWB 3S1TA 1A9NB 3HHDA 1UAWA 3IBWA 2GIFA 1LOUA 3N4WA 1WG4A 2CNKB 3P3DA 2YNFB 4HH0A 3ZTQA 3PHEA 2W7OA 4DLGA 4J9SA 1L3VA 1UVJA 5EWGA 4OYBA 1UCNA 2F8HA 5KG1A 2CXEA 4DOZA 4ZVHA 4KRWA 4DV4J 4NA2A 4J9NA 3N6NA 3PHTA 4GC7A 1MN7A 2OLWA 3TEHB 1NKEA 1FTRA 2XS7A 2R3VA 4X4QA 2V4RA 4C8ZA 1C0TA 5KFLA 2H9ZA 4K2JA 2KM8C 4ED7A 5CQGA 3HDSA 3KJFB 4LBPA 4WP3A 1IKWA 4ZIWA 4LFAF 4F3QA 1S9FA 3K0JA 3C6TB 5KFVA 3VZHA 2DNHA 1JLFB 1RAAB 2BE7D 3MF5A 5AE3A 3UVJA 4B9SA 2BJ3A 1HBNB 4USUA 1DARA 2ROGA 2ZITA 3ENVA 4KPYA 3BGLA 4O23A 4ES3A 1KFDA 3OHBA 1U2FA 3PEJA 4HT7A 5C25A 2RT3A 4NXNF 5CYMB 5F8JA 1U6FA 5EDWA 2EW9A 3MM8B 4W98A 2HG4A 2V4JB 1PSDA 4EK2A 1W2BR 3TX8A 3KHLA 1TTHB 1SBRA 2FQQB 4YY3J 2R8GA 2EKNA 1HPZB 5D4OA 2Y1RI 4I6WA 3ZZZA 2PEHA 3M8WA 2DPIA 1YBUA 2DGQA 2ZOMA 1Y9OA 2CPEA 4FF4A 3M30B 4C11B 4RW4A 3AD8C 1CLFA 4TKTA 1T05A 3FVYA 3ITHB 4DR2F 1NZAA 3KNAA 4K0KJ 2CDRB 3RW6A 4MFBB 4PXCA 4YR3A 2GVDB 4RW9A 2QEXS 1S0MA 2G0CA 1BQXA 1WHVA 2WVBA 4UQGA 3PVXA 4DSIA 4NXMJ 4NCAA 5B0DA 3RUBL 2CG4A 4CNZA 2FC8A 1EIYB 4I67A 2QA4G 4A46A 4EYHB 4PWUA 1LWCA 5B0EA 2DYAA 4USMA 1JXLA 1SJRA 3LTOA 4LUBA 1NU4A 4WKYA 4A8KA 1WHWA 1PBAA 1W2IA 3TUJC 3NGSA 3PDNA 4X4RA 3OTDA 4JI3F 2HS4A 1F3FA 2KHCA 3AHPA 1Q8KA 4DS5A 2HQIA 2XYHB 3GMGA 1WOSA 1WF2A 2MHNA 5DS7A 3SXLA 1M90T 2UUAJ 4N8NA 3OR2B 4M5NA 2FJAB 3BM7A 2DBBA 4OJGA 2B5JA 1N56A 1QSSA 2YNIA 2VG5B 3I0RA 1Y5IB 2HS0A 4DX5A 2LXFA 4FBTA 2OI2A 2Z57B 3MM7A 3IFEA 5KT2A 1RT7B 3KFWX 2HFNA 3WIVA 2AYEA 4TQRA 1D9DA 1XNQJ 2PFDA 1NSKL 1UEUA 3MR6A 2A2DA 2RDJA 4NCBA 2VOOA 2VUGA 1M1HA 2BJEA 3DLGB 2YX1A 4H54A 4OYZA 4NYZA 4DPTA 2UVVA 1S1VB 1X8DA 2HFOA 2KZMA 1IKXA 1YI2S 1KTVA 1A7GE 5AXKA 5HP1B 4CTAB 2VBYA 4NLYA 1Y5NB 1HYSB 5DETA 3KK2B 4ZCMA 2J0XA 3K5OA 5CZXA 1NDPA 5IXUA 4X62J 2XMUA 4WTYA 2FY8A 3HFVA 4FKYA 2A0FB 4UOGA 2GFFA 1NPKA 2POKA 4LIWA 1IVZA 4M63A 2ZH5A 2QLXA 2B9YA 2C3OA 1QJHA 4BC9A 2ASJA 4DZ6A 4YS2A 4X4UA 1E6VB 3LPEA 4EI2A 2ALYB 2I0XA 1VOMA 4O44B 2NYHA 1REVB 3EZ5A 4RNMA 4YHHF 1M0SA 4J9LA 2G4BA 4ERDA 1VGYA 4A48A 2W4CA 3FEXB 3U27A 2KT3A 3EWGA 1YJWS 4YR2A 4USWA 2MHEA 1S7HA 3K17A 3ZZYA 2DNOA 1Y3KA 1T95A 2OMOA 4LR7A 2QL9B 5KFUA 3SQGA 1N36F 2DH9A 4LRBA 1H6KX 3G6ES 2YKOA 3WQPA 2F65A 2K8GA 1WKLA 1TELA 2A1BA 3KK1A 1PGZA 1IBKJ 4RX6A 1C1CB 4B9TA 2VFUA 3OR2A 3OHAA 2VG7A 3H59A 3KLGA 4J9PA 2ASYA 1C1BA 1JLAA 4RUHA 3B54A 3CIMA 1VCTA 4NI2B 3LA0A 4ZKAA 1FCAA 4AUKA 1UW9A 2CJXB 2OFHX 5A2QU 3R2CJ 1F2GA 2FHMA 3ET6B 2KJVA 3KK3A 4DV7F 1H72C 2LP4A 2RF2A 3SDEB 2XCPA 2BE9B 2MQQA 2VC1A 4WFXA 2BA9A 4LSLA 5B0GA 3C6TA 4C8NA 3GCXP 5KFNA 1AXQA 3TO8A 2G2OA 4JV1A 1LK5A 2CPDA 1YDLA 4ZVQB 3AA9A 3CMES 3BQ2A 1PYTA 1U24A 1JQGA 2CQ0A 3QT8A 4LF2A 3W61A 4YUDA 5DQHA 4P6QA 1YSJA 4F3MA 3K59A 1LWEB 4W90B 5ETKA 4JOUA 4HT5A 3P6YC 1DURA 4BC7A 4KFBA 4LMZA 4QW8A 2NSBA 4WFBQ 2MXYA 3IM9A 1ZTWA 2UU9J 4FF3A 1WTFA 3CJ4A 1R0AB 1JX4A 3R5CA 2BKOA 5A6PA 4YEAA 2FJVA 2J0QD 1RGVA 1FD2A 1SL1A 1I6JA 2C2RA 1MMLA 1HQEA 2GJ2A 2MQLA 7FDRA 3M4XA 2YBVA 4B9VA 3OT9A 1MROA 5JXSA 2R2UA 2EFNA 3T19A 3T3FA 2QYGA 4PG4A 3U02A 3WZ0A 4CO5A 4LBIA 2WAQD 3BKFA 3OR1B 4QWBA 1V9OA 2OAUA 4EBEA 1TUVA 2DEIA 2XSJA 3CDWA 3R5DA 3EVMA 4B02A 3M8RA 4ZN1A 1D9FA 5EX0A 1HD1A 3M2UA 4OX7A 4WFAQ 3N5FA 2JFKA 2WOMA 2B6AB 7AT1B 4B9MA 2MQNA 5F8HA 1U02A 1LEOA 4K5RA 4KSEB 1N6QB 4X4VA 4MKAA 4PG5A 4WCEQ 1EQ0A 4OZ5A 2K06A 5BR8J 1LFWA 2VH7A 4R0JA 4DPOA 5DQIA 1NM2A 3ZNJ1 2BACA 4F4WA 3SDEA 3VAMA 4KTQA 3MCMA 2R8JA 3M6UA 3MUVP 3V6JA 2I5JB 4KKOA 2EK6A 4TXSA 1NDLA 1S1UB 4ANEA 4DPXA 3ZNUA 3LWLA 3JSRA 5H9EK 4DCJB 1RKJA 4PWDB 2A6OA 2VIHA 5I42A 3G87A 3IWNC 3VF0B 1VFJA 3QATA 2UZAA 1BLUA 1QY7A 4OLOA 2UUCJ 2DY9A 2OEKA 3MM6B 4QIFA 4JYAJ 4AXJA 2HAIA 3PX4A 3F56A 2VKRA 1NDKA 3AJ2A 1KTQA 3GFHA 2UV8G 4P7TA 2CWXA 1YHQS 4QR0A 4C98A 4EFAC 3AXMA 3NWGA 4URSA 1HQEB 2WB4A 2PMWA 4ITSA 3I55S 3LP2A 1Y5LB 2IFXA 2V2VA 4KGVB 3BF4A 4IQXA 3W5YA 5ITHA 4KO0B 1T11A 5LM7E 5AXNA 2HHXA 1JLEA 3A8EA 1TKZA 3IG1B 4I64A 2DHSA 1EETB 4HDHA 2Y0BB 5L1JA 1T94A 4H4KC 3H2LA 2GZOA 3I0RB 1IBCB 1S4FA 3DYAB 4OX6A 5CCLA 3G9CA 2J7UA 1UVIA 1WNEA 2HPUA 2AYGA 1U2RA 2YWGA 2FVCA 1RZMA 1S79A 4ZJLA 4NL5A 4DV1J 1N8RT 2VDHA 5E3PA 1NK0A 2XSFA 2WSEC 1AFJA 2Z4PA 2P2CB 4R25A 2WVEA 5HP1A 2BV3A 4ES2A 3CTRA 3UD3P 1SC4B 3W9JA 4Z2XA 3OL9A 1NK7A 3SQGB 4BWJA 4G1QB 4GKKJ 2WK4A 1RTJA 1EB0A 2FYXA 2VPYB 5M2PA 1SV5B 1N5YA 3QT7A 4KHPF 2W25A 4EO6A 2VG7B 2HZCA 2EI5A 3EVOA 1HWUA 1XNRJ 1X5TA 1R89A 3ICLA 4PQUB 3KLHA 2ZM6F 3CPWR 3BSNA 1TAUA 4ZMMA 3LOUA 1YWXA 4KYZA 1Q79A 4HACB 4LRFA 4RR5A 4Y2AA 2B0GA 2MSTA 2Z2LA 5HQLA 2E1MC 2E5LF 5CD4H 4OL8A 3L7PA 3KWMA 4CO1A 2L9WA 5AXLA 1KQGB 2QFIA 2HGLA 4NLGA 1JMTA 1JB0C 1FNMA 2J76E 1TKTA 3L95X 1GMVA 3TNVA 3JTNA 3OD2A 2W8KA 2IBOA 4ZVPB 2HMIA 4LT6A 3ZTPA 3NGTA 1R8HA 5AXMA 5KFWA 1PC4A 1YJNS 1Y3JA 2HEKA 3S6EA 4P52A 1WDDA 4E98A 2OELA 3TARA 2GGPB 1CVJA 4C8MA 1NSQA 5KFGA 3OL8A 1EP4A 1S9GA 3JSMA 2GVZA 4GKJF 4X4OA 3MPDA 1BC6A 2GC8A 2LQ8A 3JSYA 3VWSA 2V9WA 3AQOA 3CJ8A 4ZVEA 1T03A 4E0DA 1VQ6S 3KUGA 1FE4A 4EBCA 2BX6A 1FRKA 2EEYA 1HD0A 1XWLA 3FRYA 3MD3A 3UNYA 1WWHA 4QPTA 4Q8FA 3B78A 5LJ3Y 3B8HA 1B70B 2L9DA 4BWMA 5LJ5Y 3HP6A 4GRSA 4F4AA 2CPJA 2HZVA 1WC1A 1NDCA 3CMQA 4Q2LA 3UNGC 4C3MA 1TL1B 4R8UA 2KG1A 2QJ3A 1KC8T 1NK6A 4O3OA 4GVBA 2MTLA 1TKDA 4KQZA 5LMNJ 1RHQB 3VZIA 4IYQA 2JLGA 4DL5A 1S1TB 3DDNA 3L7UA 3RB4A 1NK4A 3CDEA 3R7NB 9RUBA 5RUBA 1FRMA 3NCPA 4GKKF 2G1DA 2ZH6A 1HNVB 2Z58B 3L7OA 4ZA1A 4DG1B 4HHUA 3GQCA 2YWWA 2W4PA 3CJ3A 4P10A 1IQTA 1EETA 4NPOA 1YJTA 2LQBA 1R8AA 2KXHA 4U6PA 4ECVA 1HYSA 3MXHP 1IQZA 1KP6A 4OMFG 4D3GA 3CGIA 4ZCIA 2R7SA 1CEZA 1TL3A 1ULRA 4QPXA 1KN6A 4WZMA 2P5VA 3QJJA 2M2BA 3P45B 2I6WA 3D6HB 3C8YA 4IH6A 4KGXB 3O6QA 1J27A 2XZWA 1WDTA 3MOJB 3G82A 1FWPA 1RISA 2LDIA 1TUWA 3PG9A 4P71A 2F9DA 4HH1A 1FKAF 4LF9J 3K5NA 4CLFA 2HNDA 1RHJB 1HPZA 3MPUB 1G3OA 3AD9C 5ETNA 3M2UB 4IUFA 1R6YA 1F5BA 2AT1B 2YTCA 2VJUA 2QYCA 4NLTA 2A18A 2DY1A 4USTA 2N3OA 4F50A 2AU0A 3CB4A 3HJVA 2DXFA 1K44A 2RSQA 2N4CA 5KG0A 3UN5A 2DTJA 4DFMA 1BWEA 2FJWA 1L3KA 3HD2A 3NKYA 5F0UA 3W63A 3Q86A 3K58A 2VICA 2K1RA 1CC7A 4Q43A 1FF2A 1ZZFA 2CQDA 3MM5B 4LF1A 4JI6J 1FEHA 2YPYA 1TMMA 2V6AA 1O8BA 3GYNA 3QLHB 4KH1B 3AXKA 3I5CA 2J7KA 3H5YA 1FERA 2M7SA 2XWXA 4LF6F 4PG7A 1OPZA 2MY7A 1YZ7A 2KFYA 3CCES 3LGMA 2F4FA 4PAAA 4C7QA 1NJZA 1MN9A 4LF6J 1DFDA 2GHVC 1JLCA 2Z30B 5I3UB 4LR8A 3IC1A 5D15A 1TV6B 3M9NB 3ONQA 4IG0B 4QIVA 1HWLA 2EPIA 4J9UE 1FRIA 3CJ0A 4P72A 1X4DA 4OX9F 1Q53A 4DR4J 4IOBA 1ZPVA 3M05A 1RK8A 4FZVA 1WG5A 1Q0NA 4Y28C 2R7QA 2G0IA 2ZFHA 1S49A 3HHLA 2LU2A 4ED3A 2XULA 5DO2A 3QO9B 1X5PA 2MMYA 1KS2A 1WEZA 1VC6A 2UUBJ 1OSCA 3IAS9 3T1YJ 2Y8YA 1GFWB 1T9WA 1F9FA 2Y1LB 4C0OC 3CCMS 1KONA 2DGOA 4CLLA 1URRA 3A3NB 1VQKS 1YX2A 2XZDB 4MK9A 4YHHJ 2J6SA 2LLZA 4ZN3A 1SIZA 2CZ4A 2CQCA 3NS6A 4CTAA 3EX7B 2R8IA 4IH5A 1M5OC 1KEKA 4ED1A 4I2PB 3E51A 2HK3A 3X1LB 3B82A 3DN9A 3K7RA 5E33A 3CD6S 3BR9A 1U1MA 2BKNA 2D3ZA 4C6AA 4XK8C 4GC6A 2DJWA 1KQSR 3RRHA 4B9NA 1K8AT 4QU6A 3POTB 3UCUP 5J2QB 5I4MA 1N32F 2V0NA 2X1BA 3GPAA 2HMIB 3FDSA 2NXEA 3T1HF 5GMKa 3OSPA 2B7CB 1HBOA 2YKPA 4ZPBA 1JWWA 4USHA 2RB7A 4MKBA 3AD7C 2LKZA 4I2QB 4KY3A 1WJ9A 3SV3A 2C42A 3J7A1 4U96A 2D9PA 1HNXF 3K2YA 2JEIA 4DV0F 2OPRB 1F9EB 1B7YB 3JQKA 1N52B 2QMWA 2GS8A 4LBHA 2XM3A 3KK1B 1S1VA 1BQMB 2HK2A 1IR2A 1ZH5A 1B99A 4PABA 5FLXY 4QOTA 5C42A 5ETPA 3BREA 3LF0A 3V2UC 2VQEJ 4DR7F 5KFQA 4F8RA 4UZBA 5DGBA 3TA0A 2CPZA 5J2PA 2VA2A 3GIKA 1UPPA 1TQLA 1Q1KA 2NXJA 3A13A 5GAGU 3I82A 3SI8A 3BN7A 5HBMA 2NSCA 3BQ1A 1OQ6A 3R5AA 2DIVA 4JUZA 1N4LA 2RS2A 2E7VA 3QJPA 1VI7A 4CLTA 5T14A 4DL0C 4WP9A 1BWVA 2MY8A 3GJSB 4UQTA 2ROEA 5IV3A 2ZOGA 4ZVFA 3R97A 5D4NA 3ZZRA 3KJVA 2X51A 2XS5A 2E1CA 2L48A 1OY8A 3DXSX 1SL2A 5KG4A 4NEYA 4TY8A 1E6VA 5HK4A 4LF5J 3W3SA 3KLFB 3CT9A 2CPYA 2ACYA 3NS5A 1JLCB 2GHPA 4QWDA 3H7HB 1XMQJ 4YQWA 1PAEX 1RAEB 2BJ8A 1CJVB 1Q95G 1ZAVA 2UP1A 1RT3B 3LP0A 1IKVB 4DR4F 2ZUGA 5HQMA 1RACB 3BGFA 3G86A 3UO0A 1H7WA 2CVEA 4RNFA 4C8OA 1WOPA 2IM1A 4CLZA 2EFQA 4WE1B 2RKIA 1LKZA 2BMBA 4X64F 2BM1A 5BR8F 2BRLA 1DAXA 1QAYA 4C0HA 3T6BA 1FFWB 2M52A 2MZRA 4DQRA 4F67A 2QA4S 1S59A 3GFXA 4NYPA 1S6PA 5B0CA 5DZ6A 3PR4A 3OV7A 1UVKA 3F41A 2VL1A 1CJUA 5KFRA 3T9NA 5KFEA 5A2QY 4DUYF 1FJEB 4PRFA 4M5JA 3CNQP 2LXUA 3MM9A 1Y7PA 1HL6A 3DLEB 5AE1A 1U1QA 3T6JA 1LV5A 3KTQA 2GA7A 3W8PA 1RI7A 2HWIA 4ZPVR 4UY8T 3AH6A 2K7KA 2HFVA 3MMBB 2NXNA 4WYLA 4P2MA 1YJ9S 4ZVRB 3MEKA 5HL7Q 4IRKA 1JNRB 2FJEB 3A3OB 1RTDB 2OD4A 1S76D 1HWKA 1SQEA 5C5JA 2HVHA 3S8SA 2UXBJ 3P5BP 2W2OP 4JBCA 1T3OA 1HBMA 1UPMB 2YVSA 1J2VA 2J6TA 3EZOA 1VQMS 1JLQA 2LCWA 1WEYA 1RTHA 4DXLA 4K4ZA 2B4VA 1RWXB 3BQ0A 3FSXA 4JI5J 1PYOB 2C2MB 3VHQA 4FXDA 3GJTB 2P8IA 4KHRA 2XLIA 2GMHA 5A8WB 2HVDA 2ALZA 3OTOJ 4P74A 4ILRA 3IRXB 1CULB 2MKHA 1R6VA 4UOHA 3OL7A 3DHWC 1RWOB 1UZDA 4ZPAA 4HVZA 3H4DA 3D68A 1HR0F 3D9BA 2L3MA 4OHVA 3ZTRA 4DUZF 1VBYA 3E8OA 1IBLF 4NLXA 1GH8A 4DR6F 3IRXA 4X64J 2PI5A 1AUSL 4A8XA 4EO8A 3DRSB 2J0SD 4QIWD 2OH2A 2IHR1 2PA3A 2IIHA 3LAKA 2R4FA 3LAMA 2KT5A 4WBFA 4OYAA 5D4LA 3PR5B 2VB6A 5K20B 4U7UD 2HNDB 1Q82T 2FY1A 2UXCJ 1HWJA 2M0GB 3DI6A 3ENQA 2Q43A 3LH2S 3T41A 2M88A 4Y2IA 4Q0BB 1AT1B 2BJ9A 2HSEB 3EPGA 2D3O1 4FPRA 2CPHA 2D41A 1Y00A 4DUTA 3Q8UA 1UP1A 2L41A 2DK2A 4ICLA 3ISNC 1VLYA 4ZP7A 3U1LA 5E41A 1FO1A 1S4EA 4LSZB 2W2NP 2GMLA 2W8LA 1O5JA 1UWBA 1XK8A 4N76A 3PO4A 2GJIA 3TX0A 3VCDA 4F7VA 4J9RA 4Q44A 4A8MP 2C2ZB 1R27B 4ZCKA 4AT1B 3HX9A 3GIMA 1U4BA 2YQ1A 3C16A 2I38A 4X4SA 2KH9A 2ZZTA 3CUNA 1N0VC 5M2UA 4ETXA 1WORA 1OPIA 2QC3A 3R5JB 5J2QA 4B3TF 3CCUS 1SCJB 3EDRB 1IN0A 3DOLB 1Q7YT 4CO2A 5KFOA 4DV7J 1SV5A 3NGDA 2IJRA 3PW4A
chains in the Genus database with same CATH topology
1IKXB 3VR1A 3FCHA 4DQSA 2VKZG 4DR3F 3TA2A 2MKCA 7FD1A 4B3SF 2C22A 1TK8A 1M5SA 2E5IA 1U09A 2IAJB 3CULA 3EGZA 3I9ZA 1IJEB 2DH8A 2I9SA 1RJJA 2N82B 2UU9F 4A4JA 3SFUA 2ZH9A 4K4UA 3THTA 1HBMB 2AF6A 2XI2A 3UD4P 2J0WA 2AJ0A 5IQQA 2OTLS 3N01A 5CH7B 2VV5A 3IAM9 2QSFA 1FEEA 1S6QB 3KLIA 3TA1A 5DLGA 2W9BB 3M8SA 4ECWA 1ZM9A 4ELVA 1OS5A 1VQOS 1FRXA 3P49B 2XB2D 4MFBA 3G8TA 4IO9Q 4LJMA 4YDDB 5DM6Q 3MFHA 4L3NA 3J80Y 1PILA 1SH3A 1FKPB 4C3LA 2V8DA 4YY3F 4F4YA 5F8LA 5H9EJ 1S6PB 3RAXA 3HO1A 1NRKA 3ULHA 4KR0B 3LANA 4QZVB 5IWAF 1XTZA 4RUCA 5E2QA 1TKXA 4TY9A 1TK5A 4K4SA 4C8KA 2YKMA 4I6YA 3PIOQ 1XR6A 5KFFA 2GW8A 3M8PA 4RWWA 1GXLA 2KB2A 2XI3A 1NK5A 3PNIA 3RR7A 3CDAA 4LSNB 2Z2MA 5C42B 4PPZA 5KFDA 2NREA 3EUNA 1TAQA 2GCFA 1N33F 3E01B 4C8YA 4F02A 2CQ2A 3QIDA 3DCAA 2HNYB 2KHDA 1M5KC 1GTEA 3R3TA 4OJ1A 2YKQA 3M8PB 2UUAF 1FD8A 2WOMB 3KMSA 3EZUA 5HQ8A 1B64A 1ZAWA 3O5TB 4CT9A 1UJ5A 4A8YA 2NR0A 3N28A 5KT4A 2ADCA 2P9CA 3HVTB 3NAHA 2VBZA 4PG8A 2FLLA 3OXFA 1UKUA 3BN4A 4JV0A 1S0VA 1M5PC 3RTVA 4B3RF 2LEPA 2ZZMA 4H4OA 3V6DB 2XSJB 3SV4A 1D0EA 1RKIA 5IM0B 2CQHA 3OTOF 3D1OA 4NLPA 3UI3A 4J5OA 5LXYA 1KFSA 1GXTA 2K7JA 1B7FA 1KLMB 2CJBA 2AJ4A 1WI6A 4ZLPA 1H0HB 1ZBTA 2C2DA 2V8HA 3HHKA 4Y65A 1X0PA 4RW8B 2ZD1A 2KM8B 4RU2A 1RT2B 2RRBA 4L6V3 5HO4A 2JOQA 3Q2TC 4G6VB 4ECUA 3V81B 1S99A 3V6KA 3DLBA 5KT7A 1BY9A 2MKJA 1T05B 2A2CA 2LVWA 5F41A 2I5JA 2HVZA 3GG1A 4ZPDA 3VTIA 4DHVA 2BVZA 4QWEA 3HHLC 3GWCA 2R8KA 1X5OA 3IGNA 5IS2A 3BSCA 3G6YA 4LFBF 3HF5A 4J9KA 5KFPA 4V19J 3IN5A 3EPIA 1PO6A 2LYVA 4FVCA 2RD5C 4N8OA 4TYAA 2YKNA 4AXIA 2R2RA 2DPJA 5B0BA 2ZE2B 4YB7A 4Q45A 3M1VA 3QMQA 3VAHA 3O8WA 1FKOB 1J5OB 1VQ5S 4O3RA 1FT8A 2VC0A 2IM2A 2RU3A 1VS3A 2KJWA 5CYQA 5EGYA 2ILZA 3KKFA 1D8ZA 2JWNA 2KRRA 1NKCA 1U1OA 4F4KA 3CJ5A 4WF9Q 3CXCR 1XMBA 4NOHA 1P9QC 1NK8A 3PFEA 3BR8A 3BGUA 2RILA 1RTIB 2IYGA 2IA6A 4N41A 3OFFA 2APOA 3GYXB 4ECYA 2DVIA 3Q22A 2NPFA 4TU8A 2WTFA 5L9NA 4QBUA 2ERRA 2N4DA 2F40A 3BGRA 3OFGA 3SSSA 3HZEA 2B4OA 2BQUA 3CDBA 3EXCX 5E0OA 5T7LA 4OHWA 5EX3A 3GB0A 1WHYA 1OIAA 5KFTA 3UCZP 3D2WA 1XN9A 3LALA 5FIIA 1L3TA 2NYIA 2VFVA 3KG0A 4J9MA 2W4DA 4URQU 3GSDA 4EU0A 3M8QB 1U1LA 4H4MA 3KHHA 1IJFB 5LL6d 4C97A 1FXDA 2B51A 2JSXA 2WB1D 3H2VE 3OJUA 3GIIA 3I31A 4DV5F 4DL6A 3UQSA 4KV8B 2QLWA 2NLWA 2ROPA 3L09A 1NJIT 2XY6A 3H4BA 3HK2A 4A8OA 5K8NA 1IKVA 2KYZA 2IMOA 2HLTA 1X4BA 1HI8A 4J9OA 2L9NA 4RLEA 1CQMA 3T5JA 1K73T 5HN0A 2MZSA 3I0SA 4Y00A 4ED8A 1NH7A 3NL0A 5FJ4A 3H98A 2EKYA 2MKKA 3RW7A 1N54B 4ECRA 3IR7B 4R0EA 1CQNA 2KTQA 3DMJA 3MPYA 2B9XA 4K59A 5D77A 1UA1A 3K5LA 4IR9A 2P6SA 1LWFA 3EGWB 4KE5A 5H1SV 1WG1A 3MMCB 4JV2A 2B6AA 1TL1A 1X9WA 2UUCF 2HNZA 1N0UA 3VAGA 5HLFA 4IRCA 2E7WA 4X2BA 1X4GA 4PG6A 1APSA 3M9OB 2FLOA 3TOQA 3SSRA 2ZH8A 4NZ0A 3NNHA 4KB7A 3R5BA 4NLRA 4IDKB 3PRBA 3CCWA 1IKYA 4O3NA 2OD6A 2KFZA 3DOKA 5GAEI 1DQ9A 5BYRA 2YQ3A 3ISZA 4USJC 2R7OA 2RU9A 4A8FA 3UWTA 3I87A 1RT4B 2WONB 1ZTTA 2LEBA 2AGQA 2M4MA 2B56A 1URNA 4IFVB 1VQ4S 4OJHA 1U1KA 4B9LA 5F0WA 3TUIC 1FDBA 4J9QA 1VC0A 3BGRB 1RP5A 1LW2A 4OI3A 1M5VC 2F9JA 3NNCA 1SIWB 1K0VA 4F2RA 5F9NA 1YBAA 2PFFB 2RH3A 3LP2B 3NP5A 4A8WA 3M6XA 2W7PA 1RT2A 2ZOFA 1DTTA 5B09A 2YKAA 2E9ZA 4X4PA 2HHHF 3GG0A 4WU2A 5A0YA 4EUVA 3OTEA 4H4KA 3QGHA 2VPZB 1FKOA 1U49A 1J5OA 5U47A 2HVIA 3M8QA 1JNZB 3KLVA 1VQ7S 1BQMA 4OHXA 3CC4S 2I8EA 1YRXA 3CCZA 1FJGF 1T02A 4XO0A 4CIOA 1SJ1A 1MNEA 4PWDA 4NLUA 4LF9F 2WSFC 2DNZA 3DOMA 2V4QA 1UA0A 5KG2A 1LQ9A 4JI8F 1N88A 4RNNA 3N6LA 1P1LA 3HVTA 2J7WA 3CCRS 2PC6A 1F5AA 2DNQA 3TRGA 1SKRA 2W7AA 2RKIB 1TV6A 5I3PA 3QAEA 5A8WA 2FHJA 3FQLA 2X1AA 2U2FA 2PMHA 1N5SA 3OL6A 2JL9A 3HVWA 5J1EB 2ZH3A 5GAEU 1S0OA 2DGUA 5HMYA 3SYZA 1IKWB 2F8EX 2P9EA 5HROB 3TW0A 1HNIB 3VQTA 3HM9A 2ZD1B 5MAOA 3MEDB 3FJ2A 4DG1A 1UJ4A 3I9V9 3KG4A 1GNKA 3LP0B 4F25A 4YP3A 4ILLA 3KK2A 3M2RB 5THWA 2DH7A 5HMXA 1C0UB 4PQAA 4U7UK 3BSAA 5LMNF 1KR4A 2V4JA 3HT3A 2CKWA 4DR5F 2YNFA 3BSOA 4YOEA 1H2UX 2OPSA 4GO7X 3C2PA 2QRRA 3D0HE 2XMKA 3N5BA 4ID5A 1VQLS 3JB9k 2E29A 1R8BA 3DDKA 3JSBA 2ZH4A 2HW3A 3HHEA 2KZZA 6FDRA 4N5SA 2UUTA 2BBEA 1L3UA 5KFXA 2R7TA 4A47A 3CCQS 1KD1T 1LXNA 2PN6A 2R2TA 2BYCA 2VPWB 5HI7A 5J2MA 3PZPA 1YGYA 4IG3B 3AB4B 3W7BA 1VQPS 2DB1A 3G6VA 1YJRA 2HNYA 2MGZA 1X7VA 3TVZA 2QA1A 3P96A 5EUHA 4DSFA 4RW6B 5F8MA 4MK7A 2GV1A 3KK3B 1DRZA 3NNAA 3RAQA 4TYBA 4P7VA 3MR2A 1XBWA 2QO3A 4K4XA 4KJIA 1ZM2A 2BJDA 1RAJA 4DMZA 1LXJA 1N5TA 1X4FA 2DITA 4WIIA 2J9EA 5D3GB 3DLKA 3GV7B 3I4PA 1Z2ZA 5KTQA 3K8VA 3T5KA 3PY8A 3P5TL 2HHSA 1QSLA 2KVIA 3JTOA 3FZBA 4XIUA 3DLLQ 1OSDA 4Q5VA 2LMIA 5SZTA 4ILMA 4C9DA 2ZZNA 5DDRC 1XNQF 2BOPA 2VFSA 5LMUF 3MDFA 1N34F 2AP6A 4TLRA 1UMJA 2RDIA 3MUMP 4ZP6A 3H20A 3T9ZA 2O01C 5L1IA 1M1KT 1HMVA 2GNKA 4NRUA 2VASA 3LQVA 4Q2MA 3TANA 2GQQA 2ZBIA 4RBTA 3TAPA 5KFMA