2CQHA

Solution structure of the rna binding domain of igf-ii mrna-binding protein 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
GSSGSSGMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGF-II mRNA-binding protein 2 isoform a
publication title Solution structure of the RNA binding domain of IGF-II mRNA-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqhA00
2DNHA 2KXNB 3ZZYA 5H1SV 3CD6S 2MKIA 2L41A 1U6BA 2CQ0A 2MPUA 2LEBA 3NNHA 3ZZZA 3JB9k 3DLLQ 2CQ4A 3J7YU 2CPYA 1JJ4A 3CMES 3TYTA 1SJRA 4J5OA 2K8GA 2WBRA 3CF5Q 3G8TA 4CH0S 3OW2R 3VAJA 3HI9A 3MXHP 2KT5A 1X5SA 4WFBQ 2U2FA 4CH1A 3CCSS 1WEXA 2MKKA 3SDEA 1HD1A 5GAEU 4IUFA 3ULHA 3FEYB 4C4WA 3G4SS 3G6ES 2MYFA 1VC6A 2MZ1A 1JJHA 4PRFA 1SJ3P 3J7ZT 3CCRS 2CQCA 1HD0A 1IQTA 2D9PA 1QVGR 3US5A 1M90T 2KG1A 2AYBA 2M4MA 2KXHA 1VC5A 4YB1P 3BS9A 2DNPA 4Y0FA 2LCWA 2LA4A 3VAIA 3CULA 2MQPA 2AYGA 4QU7A 3CCMS 3MDFA 1P27B 2N3LA 2FPHX 1X4FA 1NJIT 4V19X 2M8DB 3NS6A 2CQBA 2KM8B 2DNRA 2MKCA 3NS5A 1VQKS 3BO4A 4WCEQ 3H2UB 2MQNA 1VQPS 2M52A 4F26A 1WHVA 3CMAS 2PEHA 1ZZNA 5IQQA 2DHSA 1VQ5S 2MZSA 1Q81T 2MQLA 1F9FA 2I38A 1WTBA 4C0OC 1A7GE 3VAHA 1S72S 4UQTA 2M7SA 2NZ4A 2QA4S 3VALA 1FO1A 1NU4A 2QFJA 1VBXA 3S7RA 2CQ2A 2DGWA 2DISA 3R27A 1X4GA 2KYXA 1WI8A 4U67Q 2AYEA 1OO0B 2YWKA 4UY8T 2F9DA 2E44A 3D2WA 3VAKA 2I2YA 2RQ4A 3CCLS 3L3CA 2HGLA 4ZKAA 3FEXB 1M5PC 2JVRA 2LKZA 3BEGB 3B4DA 5JVHQ 5GVQA 2MKJA 2KH9A 1W2BR 2UP1A 2J0SD 3N9UC 4YOEA 5EN1A 3RW6A 4ED5A 3R1LA 2DNYA 2HYIB 1M5OC 2CQIA 4FXVA 1R8PA 2MY8A 1PGZA 2M0GB 2FC8A 1WF0A 3U1MA 4TLQA 2DK2A 1KOOA 3CCUS 2MY7A 1WEYA 2CPXA 3SXLA 1FJEB 5GADU 2LXUA 2F9JA 5LXRA 1L3KA 4IOCQ 1M1KT 1DRZA 2DHAA 4YUDA 1OIAA 4LJMA 1H2TZ 5LSLA 1Q86T 2XNRA 3S6EA 1QM9A 2DGTA 1U1MA 1VBYA 2CQ3A 1VQNS 2XB2D 1K73T 3MUTP 3BO3A 2LYVA 1D9AA 1JJ2R 2ZJPQ 1R8HA 3NMRA 3PIOQ 1G2EA 2XS5A 2V94A 2DIUA 2VONA 1X5OA 3EGZA 5CA5A 1DHMA 1B7FA 1X4HA 4BS2A 1BY9A 2MMYA 1X4BA 3Q2TC 5D78A 2E5JA 2VOOA 1X4DA 2CQPA 3S8SA 2DIVA 2JVOA 4OZ1A 4M5DB 4WIIA 2N3OA 3CC2S 2DGXA 2DHGA 2CPHA 2LECA 2ADBA 2U1AA 2DNLA 5IM0B 2HZCA 1KQSR 5HL7Q 2MGZB 3LQVA 2DB1A 2J0QD 1WG1A 3P6YC 2DNNA 4W92B 1X5TA 2HGNA 2VOPA 1U1NA 4WF9Q 2DGVA 5IFMA 1RKJA 5HO4A 2CQHA 2DNKA 1VQ8S 2EK1A 3V4MA 4Y00A 4PKDB 1OPIA 2M2BA 1VQLS 5FJ4A 2OJ3A 2RVJA 3VAMA 2KI2A 2DH9A 3U1LA 2KM8C 2A3JA 3NNAA 2KRRA 2G4BA 1WG5A 2MZRA 2RQCA 2XS7A 2OSRA 3CC4S 2CPDA 2LA6A 3UE2A 2D9OA 5GMKa 1N88A 2MZTA 2LEAA 3LPYA 1DBDA 5JVGQ 2KU7A 2RRAA 3UD3P 3CUNA 2MGZA 1U1OA 3Q2SC 2M8HA 1SJ4P 2DITA 3CC7S 1VQ7S 2ZJRQ 4C7QA 2QEXS 1UP1A 4ERDA 4OZ0A 2KRBA 2DGOA 3THTA 1PO6A 1YJWS 2GHPA 3THPA 2DHXA 2X1BA 1WF1A 2O3DA 1VQ6S 1FJCA 1YHQS 2MHNA 2KXFA 2RS8A 2AYMA 2JRSA 3MD1A 3UCUP 1WHWA 5DDQC 2YTCA 2EK6A 3RW7A 1FJ7A 2L08A 1YWXA 3MURP 2MJNA 3K0JA 3G8SA 1N52B 1U6FA 4IO9Q 1WHXA 3PIPQ 2SXLA 3CCQS 3CCES 2RT3A 4FXWA 2MJUA 1FT8A 1YIJS 4W90B 3H2VE 4TU8A 1D8ZA 5GAGU 2DNQA 2OIHA 1KOHA 2DNMA 4F02A 2DGSA 2HGMA 1Q82T 3UD4P 2CPEA 4TU9A 1VQOS 2OTLS 2MQMA 5MLCV 5DDOC 2FY1A 2MZJA 4PR6A 1JMTA 2ERRA 3HHNB 1WF2A 4P6QA 5LJ3Y 5ITHA 1P1TA 4WFAQ 3NNCA 3EX7B 1XN9A 2J76E 1RK8A 2LXIA 3UWTA 2DGQA 1OWXA 2N7CA 1SJFA 3SMZA 2MKSA 3S01A 3VAFA 4F25A 1CVJA 3IRWP 2M88A 2KVIA 1WELA 2X1GA 3SDEB 3DXBA 2CQ1A 2LQ5A 2MQQA 2ADCA 2XNQA 1U1PA 2G1DA 5CYJA 2CQGA 2OSQA 2HVZA 1N8RT 2E5HA 2DNOA 2CPJA 1KC8T 1NO8A 1H6KX 2MQOA 4RU2A 2E5IA 3MD3A 1WG4A 1HL6A 3IWNC 5LJ5Y 1UAWA 2DGUA 3EGNA 3G96A 1WWHA 2M9KA 5DDPC 2XS2A 3MI7X 1H2VZ 5DM7Q 2JWNA 2DO0A 1VBZA 1U1KA 3TO8A 1YI2S 1M5VC 2MKHA 4QPTA 1O0PA 2EVZA 2VODA 2CPZA 5CXTA 2MZQA 3B4MA 2FHOB 3UCGA 5GAHU 1Q7YT 2N82B 1WI6A 2CPFA 1URNA 1X0FA 3TP2A 1VQMS 1X5PA 4WFNQ 3G71S 3CXCR 3VF0B 1X4AA 1YJNS 1HA1A 2J8AA 2YH0A 3CPWR 2X1AA 2X1FA 5IM0A 2Q79A 4LMZA 2MSSA 2D3OR 3P3DA 5BJRA 2ZJQQ 1FXLA 1U1RA 2FC9A 5DM6Q 4Z2XA 3CCJS 2YH1A 3MUMP 2M70A 1SXLA 1ZZFA 5LXYA 1WHYA 2L9WA 1A9NB 2OTJS 2PE8A 1UW4A 1X4EA 4A8XA 2AD9A 2E5GA 3P49B 1M5KC 2DH7A 3G9CA 1DZ5A 1S79A 1QVFR 3CTRA 1H2UX 3MUVP 2CQDA 4QU6A 4IOAQ 2DH8A 3I56S 1SJQA 1VQ4S 2BOPA 1WEZA 2DNGA 2KHCA 2RRBA 2RS2A 1YTYA 2B0GA 2KN4A 1KD1T 5DETA 1U1LA 2MXYA 1VQ9S 2K3KA 4CIOA 1YJ9S 5LSOA 1YITS 2RNEA 1UFWA 3MOJB 2RU3A 2CJKA 3VAGA 4CQ1A 2BZ2A 2MB0B 2F3JA 2MSTA 2XSFA 1X4CA 5DDRC 1ZH5A 4WKRA 3R1HA 2LMIA 1AUDA 4LIRA 1U2FA 2JX2A 2RUGA 1FHTA 1N54B 2YKAA 2GO9A 3I55S 1FNXH 2CPIA 3CCVS 3P5TL 1VC0A 2G0CA 1U1QA 2KFYA 2KG0A 1K8AT 4EGLA 4QQBA 5D77A 2DNZA 1K9MT 2NLWA 2DO4A 4TU7A 3BO2A 3UCZP
chains in the Genus database with same CATH superfamily
2X51A 2CQ0A 3JB9k 4CO2A 1R0AA 1RT3B 2HS0A 2JZ5A 3CMES 3JSYA 4NOHA 2UXBJ 4WFBQ 4M5IA 4DR6F 3CJTA 4A8YA 2DHHA 2C2DA 3M8SA 4DBQA 5CQGA 3ILLA 3MCNA 4B3OA 1AA1B 2V0NA 4LRBA 3W7BA 1KHVA 3IBCB 3UNGC 2LA4A 6FD1A 1S9GA 3AB4B 5F3ZA 2ZKTA 4DV4F 2J6SA 3T41A 2YKMA 1N5YB 3CT9A 4OJ3A 4YFUA 2I6WA 2NZ4A 4OX9F 2ZWPA 2DGWA 2DISA 3ITHA 1RHQB 4U95A 2C2OB 1NRKA 4QWBA 2J9EA 3IR7B 3CNQP 3THVA 3EWGA 2GVDA 5J2NB 3SQGB 4C6AA 4MYUA 1W2IA 2BX6A 2XY6A 3MM9B 4DL3A 5EN1A 5KG2A 4P2XA 4ECRA 3CD7A 1GQEA 5LSLA 1Q86T 5CH7B 1QM9A 4NLWA 5F41A 1JX4A 1BGXT 1ZOTA 1LWFA 5KFLA 5CD4H 1QAJA 2Z30B 4FYYB 4FYWB 2IYIA 5FIIA 4J9SA 1WOPA 3Q8PB 2J5AA 2DGXA 3KK2A 3BREA 2MEWA 4K8RA 2U1AA 2RD5C 4HI1A 3G87A 2EFPA 4RNNA 4OYXA 1KQFB 4EU0A 3DLEA 4ANEA 2XC9A 4X4NA 3T1AA 4DL2A 4F67A 2EK1A 4LSZB 4LF8F 3A8KA 2OJ3A 2E9TA 2VPZB 2R8GA 2JC1A 2PGCA 4PABA 2HHUA 3V4IA 4LSNA 1H0HB 4J9PA 3FKBA 2W9CA 1MG7A 4ZPVR 2LEAA 2YWEA 2ZD1B 5ETKA 2AJFE 5I3PA 3HT0A 1UP1A 1DTTB 2R7RA 1BMQB 1JQGA 3ADAC 5HI7A 3DCAA 1JLAB 1DTQB 1RWWB 2G13A 1AYEA 3PIPQ 4W98A 4W90B 2BW7A 3FJ2A 2MLZA 3BH7B 2QLWA 1QTMA 5DQHA 2FGCA 2ASJA 4B3MF 1R0AB 3UQSA 2IIHA 3FEZA 2QYCA 2LXIA 3HM9A 3JTOA 4PXBA 3HFKA 2RHQB 2E9RX 2G1DA 4B3OB 3I4HX 2GAHC 1UJ5A 1RWNB 2DRBA 1KTQA 3L7UA 2DXFA 4OHWA 3MAQA 4ED1A 3ICLA 1Q5YA 2G9OA 1NDKA 3IWNC 1S9GB 3IN5A 2B56A 2CZVC 3ETMA 3G96A 1IBMF 4KGXB 5LM7E 2ZH4A 4QPTA 1N36F 3D67A 1KTVA 2FZGB 2YKMB 1HR0F 1HW9A 5KFNA 1Q7YT 1NLKL 3W5XA 3OJSA 4NWBA 1OYEA 3RRKA 2JSXA 3ITHB 1SKSA 1XNRJ 2W24A 3BN7A 1TKTA 4LFAF 3M2VA 2GVDB 3MEEB 2AJQA 3FBEA 4ZJLA 1M5KC 3NCRA 2RH3A 3G9CA 2P9GA 3OXFA 2BRKA 3GV5B 1S79A 1QVFR 2BKOA 2KT3A 4L75A 3T5JA 1BC6A 1D0EA 2CNNB 2D7SA 4RNMA 4YB7A 2KN4A 2AWZA 3BBCA 2EBEA 3DYAA 4L3KA 1LWFB 4ES1A 4IRDA 3LF0A 3PZPA 1LXNA 1FHTA 4X66F 4XTTA 1KVJA 3CCVS 3KK2B 4YHHF 3RAQA 2WK4A 4DQRA 4PQUA 4X4OA 4TU7A 2ZNYA 4A8SA 3DLEB 1HHQA 1ZAWA 4OV1A 3NNHA 1T0TV 4O3RA 5G4DA 2IRXA 4LRCA 3TJ9A 3V4IB 2U2FA 4LSNB 3CCSS 1NEEA 2GQQA 1RTHA 1JK9B 2W9CB 4WU3A 3G6ES 2MYFA 4K4UA 3PACA 5CYMA 1SC3B 2FHKA 4TQRA 3MEGA 4A8OA 4USHA 4FNIA 4P10A 2RKIA 1R89A 4NL5A 4F4XA 3DLBA 1NZAA 3IM8A 4B3SF 2IVMA 1KDNA 2P8IA 3CCMS 4QIWD 1TK8A 1FVQA 1R7IA 2Z8QA 2YX7A 1QSLA 1F9FA 1SBRA 5KG1A 1CULA 2NQPA 1CG2A 2WVDA 4J9UE 2E29A 3MR7A 1VRTA 4QW8A 4R0JA 1UVMA 4AT1B 2DYAA 1RWVB 1RGVA 4A4JA 2GFFA 1TL4A 2RQ4A 1V5VA 1Q53A 3FBCA 4DV3F 1CJUA 4LF9F 1FVSA 1DQ9A 2V8VA 4GRSA 2CQIA 3CVKA 2DK2A 2MY7A 2YWGA 3HVTA 1DRZA 4CH7A 4YUDA 2GC8A 4ZCMA 4NLVA 2FB0A 2LLZA 2XS5A 2VONA 4DPOA 3EGZA 1CJTA 1K0TA 1H7XA 3I9V9 2CQPA 3FBBA 2YQ3A 2VA3A 5D4OA 2ZDOA 2BVZA 3GSDA 1N32F 3GTYX 1TV6A 5F3TA 4U96A 3KHGA 4DN9A 2YPYA 2B4PA 3RBEA 4C8OA 1WSVA 3M2VB 4ZVUB 4WFXA 1YBUA 1U8WA 2KM8C 2A3JA 4R25A 3TUZC 3HCXA 4UOCA 3IWXA 1Q8BA 2K2PA 1S1UA 3AD9C 4UZBA 5JVGQ 3HSZA 3UD3P 4C97A 2R7QA 3PX4A 4EWTA 2QEXS 4DV2F 3OLAA 3DYAB 4ECYA 2Y1RI 4AQYF 2DHXA 4XIUA 2O3DA 3DDKA 1SUQA 2RS8A 3ZTRA 3J7Z5 1KKHA 4P7TA 4IH7A 2BKNA 3UDCA 3PTWA 1U6FA 1JLFA 1F9HA 3TA0A 3J80Y 2V68A 3QGHA 2DNMA 2KT2A 1E6YA 3VTIA 1J2VA 1HFEL 4NI2A 3X1LB 2G2OA 3NMAA 3DRXA 3M6VA 4RNFA 4JB8B 2OELA 4Z7CA 2XY7A 2J76E 2QZ8A 3GPAA 3S01A 3EVOA 4F25A 4QCLA 1FWLA 1RTHB 2CQ1A 2DPJA 5CYMB 5HMWA 1VQSA 4FBUA 1AB8A 2G2YA 3MEGB 5K9FA 4KH1B 2MQOA 5A2QY 4JI3F 2RKIB 1HL6A 5KFEA 2FY8A 3MI7X 5K20B 2B43A 2CZ4A 2HNYA 3ZZPA 3FRYA 3NCQA 3OFGA 1WI6A 3GZ7A 5K14A 3T1YJ 1CULB 4WFNQ 4DPXA 4DR1F 1VRTB 2AGOA 3RBXA 3ZNJ1 4B3TF 1QUVA 1AW0A 4WPAA 3CDAA 3NWGA 1CJUB 4L72B 5J1PA 1UW4A 3NXZA 2ABYA 2E5GA 3AT1B 4GMKA 3SV4A 3NAIA 2BV3A 4WWSA 1AZSA 4I2QA 2XGQA 3AD8C 4JI2J 4LFCF 3HVTB 3HX9A 4DQQA 2OI2A 4X4UA 1FDBA 1JIHA 1EARA 3I6PA 3QT5A 1C1BA 4MFBA 3MOJB 4LF5J 2CVIA 1CJTB 2HMIA 4LBPA 3AJDA 1T9VA 2IBKA 3QGGA 3SFGA 3H40A 1CBKA 4P2SA 1TV6B 4X62J 3RAXA 1R3NA 3HHLC 2HKEA 5KFTA 5F8NA 2GHVC 4FF3A 4AYBD 3OW2R 1JNZB 2XMTA 1MMLA 4DFMA 3NAHA 2W01A 1SCJB 1S1UB 1UVIA 1X31C 2K06A 4MMOA 4EI2A 2FD2A 2HAFA 3JTNA 4KJIA 3W5YA 4LF1A 3Q8RB 3JSRA 1AFIA 4IFVA 3HLUA 2AYGA 5D6GA 1D8YA 1V3SA 1SUQB 1P27B 1KVKA 2CQBA 3C66A 3NS5A 5LSRA 4FN5A 3KNAA 3TJAA 4ETXA 1IKVA 1SIWB 2OFGX 3CJKA 1JLFB 4CZCA 2EFVA 2L9NA 1E6YB 4NI2B 1F3VA 4A48A 3V81A 2YWKA 1H7WA 2XYGB 4UZCA 3CJRA 2P9EA 3BR9A 3CCLS 4LF7J 1MNEA 1RSCA 4NMLA 2UP1A 1YRXA 1R8CA 1OSCA 4JI0F 4Z7YA 1R8PA 2FC8A 3U1MA 1NK9A 1S12A 3QRRA 2HRTA 3N28A 1VQNS 1K73T 5D4PA 5I42A 2J0XA 2KVQE 4D3GA 3PIOQ 3D3BJ 2V94A 1KS2A 5HVFA 2BJ9A 2HNYB 3L4BC 4RW8A 1XMQJ 5K8PA 5K14B 1ZA1B 2XHCA 4QJVA 5KG4A 2V34A 4YR0A 1RTIA 1PYTA 3QRQA 2NPFA 4QYZJ 5BYSA 4WF9Q 4FF1A 3JXOA 3LGMA 5KT7A 2AGQA 2VQFJ 5F8LA 3A1YG 3DLJA 1FRKA 3DGVA 4X84A 4K59A 3W9JA 4HL9A 3OBIA 2PO4A 1UEKA 1H98A 4ED4A 2MZRA 5ETSA 2OSRA 2GGPA 4OQJA 1AZSB 2HK3A 4I2QB 3SQOP 3HT3A 4FS1A 2MZTA 2RU9A 1SH3A 2XI3A 5LMNF 2E9ZA 2HIQA 3JSMA 3MAHA 3N6MA 1C1BB 3EXYA 4MFBB 1C0UA 4KGZB 1NKBA 2BJ8A 2XY5A 1H38A 2HMIB 1FJCA 2HW3A 2KXFA 3KNGA 3K0JA 4Y2IA 4NEYA 1RAHB 4DXLA 5GAGU 2DNQA 4ECUA 1MROA 3OR1A 3ZTSA 2HHHF 4LRFA 2V9WA 2ERRA 3NRBA 2WW8A 1A6LA 3EVMA 3UWTA 4LF6J 4FF2A 5D8HB 3QYYA 4GO5X 3M2RA 2MQQA 1SL1A 3NGTA 3K17A 2J7KA 3FFIA 2E5HA 3MCMA 2CAJA 2NCKL 4KE5A 5CABA 2CRLA 3FSIA 4IFVB 5GAGI 3KLEA 3QAEA 2F40A 3OQ2A 1DFDA 4OI6A 4DJBA 1M5VC 3ZZTA 3MZIA 1IKVB 2N82B 3CJKB 3I5CA 3FNNA 1X60A 1AT1B 4CM0A 1X5PA 4DF4A 3QAUA 1TL1A 1T8EA 2X1AA 2OO4A 5ETOA 1RKIA 2Q79A 1TMMA 1CQNA 5B0CA 3BGFA 5E3AA 3V81B 4OFZA 1XJWB 2P6SA 2OD4A 4F8RA 5LXYA 5L39A 3QSYB 2XMUA 4A8XA 5DG7A 2IM0A 3CJ5A 4G3IA 1SJQA 4ED6A 2A2DA 3L95X 3HZGA 1CS4A 2OEKA 3EZ5A 5L1KA 2KB2A 2XGPA 5J2QA 4UT4A 4ZP6A 2K3KA 4E0DA 4CO5A 5I42B 1PIEA 4OI1A 1SL2A 2V50A 3QFWA 4J7CA 2WHOA 5DDRC 2JNJA 4F2SA 4RW8B 3D0GE 4F50A 4CRJA 2L3MA 2UUWA 4K5SA 3MCOA 2XULA 5E3QA 3TAMA 1G4CA 1RTIB 2RDIA 3JQJA 4R5PA 4ZJQA 3PW0A 4P52A 4DQSA 2R8IA 2GZOA 1HARA 4FZVA 3PYGA 2AZ3A 1PYSB 3M30A 4NYOA 3MXHP 5EDWA 2GGPB 2BJEA 3ULHA 3G4SS 1FNOA 3GR1A 3O1LA 4OX8A 4J9NA 5IV4A 4DL5A 2F4FA 4MK8A 3R9LA 2CQCA 3JSMB 1I3OB 3US5A 4OI4A 5DGBA 1WKLA 3JQMA 3NCPA 2RJZA 1C0UB 3VR1A 2MQPA 2D74B 2DY9A 3UN3A 5ETVA 4IO1A 1MWZA 3GIJA 4F4KA 3QJJA 3NS6A 2MKCA 4PQAA 1IBLJ 4JV1A 1LWCA 4DX8H 1VQ5S 2DKOB 3T3FA 4DQIA 1MROB 2L48A 3OR1B 2W8KA 2HQFA 3MPWA 2GX8A 3RU0A 3T6BA 1WC6A 3VGUA 3NOCA 2Z4PA 2OP5A 3QIDA 3AQOA 4C8NA 1XBWA 3H4DA 3J80U 3V6DA 3ZC4A 1GTEA 1FKPA 2DBBA 2DNYA 5KFXA 4ZVPB 3FFIB 1QY7A 2VFRA 1GAOA 4C8LA 3PO4A 4DR2J 3KLEB 3OSNA 2ZOFA 3MUTP 2B4UA 3RJMB 4RBUA 3A13A 5A2QU 3S8SA 5C5JA 3TX8A 5F8HA 1U2RA 5D4LA 3V6KA 3NGRA 4DPTA 1UFKA 1YRUA 1UW9A 1YZ6A 1TL1B 1V9OA 1TUGB 3QGIA 1LW2A 2ACMA 4M5GA 3B82A 3U7JA 3MPYA 2ASDA 3MFHA 3N5BA 2BR0A 3O2IA 1ZM2A 3PHEA 1D9FA 5GMKa 2BE9B 2KU7A 4MIWA 1CS4B 5J2QB 2Y1IA 2WVBA 3THTA 2LU2A 5RUBA 1YJWS 1U24A 2BXJA 3PDNA 3T19A 2BANA 5DDQC 1OQ6A 1WTFA 2BOAA 4ANCA 3FCVA 3WZ0A 3H2VE 2OIHA 3TAMB 4RW6A 3IRXA 2FZCB 2CPEA 4R5PB 2ZH2A 1YJUA 3W61A 2CNLB 4OX7A 3BGRA 3M30B 2QC3A 4ED0A 1NJXA 4NLXA 3SMZA 2ZZTA 2R2TA 3VAFA 3T1HJ 1WELA 3DKDA 3MAAA 2VA2A 3M6WA 2C22A 5CD4A 1X7VA 3DGPA 4PAAA 1VK8A 1NDLA 4RUHA 1C4CA 1UAWA 1U4BA 3E01A 4DR4J 1FEHA 2K7JA 4OYMA 1O0PA 5KT2A 3MMBA 3NOGA 1B4SA 2VFTA 4DS4A 1LWCB 3EZUA 4M5DA 4ZITA 3TP2A 3CJQA 3I5AA 1VQMS 1IM4A 1Y0HA 2C2KB 2YNIA 3UN2A 3HD1A 4DUZJ 1NPPA 3MUMP 3V6DB 5EX0A 2HPUA 4FVCA 2WONA 1HNZF 4EO8A 1V3ZA 3RB4A 3UN5A 4F4ZA 1Q95G 1GMVA 4WYWA 2FJXA 3KUHA 2BOPA 3LP0A 1RADB 3EXCX 4NASA 2NXNA 3MM5A 2B7BB 2POKA 4ECVA 2IFXA 3HSDA 3QLHA 4CQ1A 1NK4A 3RUBL 1G6BA 4GKJF 4WKYA 1ZTWA 4CLTA 3VGSA 4X65F 1RT4A 3LGNA 1K8AT 3HVAA 1XEZA 1R6YA 4QIGA 1LW2B 2IRUA 2NLWA 1HQ2A 3UCZP 1U25A 4KIAA 1HWLA 1EAYC 4J9RA 2EFNA 3ZZZA 4OYWA 2F63A 1TKXA 3AOCA 2APOA 4J5OA 4P2FA 4H4OA 3QFHA 4K4VA 2KO1A 3M8WA 4O3QA 1Q5VA 3PYFA 5E41A 4USJC 1Q8IA 2MZ1A 1RT5A 1P6TA 1OSDA 3TVZA 4I1TA 1CEZA 4NCAA 2KXHA 4RL1A 3TZWA 1RLCL 3CULA 2BANB 1UVNA 2WW4A 1RU1A 2VBXA 4WCEQ 6FDRA 2M52A 2H1YA 3C6UA 1UA0A 4DV7J 4URGA 5EX3A 5F9LA 4PPZA 4YY3F 2Q3PA 2D3ZA 2MQLA 1IWAA 2I38A 1VOMA 4DWIA 4RW6B 3IRXB 3PCOB 5H9EJ 4MK9A 4DV6F 2H9ZA 3WC0A 5F8MA 1TL3A 1OO0B 4NXMJ 3BBFA 5C24A 2NXUA 3BGRB 1RAJA 2HS4A 5CZVA 4K4XA 1N36J 4ZKAA 3BYRA 3LUYA 3JYTB 3PW7A 3MAAB 2KH9A 4RWXA 2J0SD 3N9UC 5EGYA 4DV5F 2MQ8A 4KY3A 3DGPB 3VGVA 3OXLA 4WP3A 4L3NA 2ZH6A 4XK8C 4DDFA 3DOMA 2LQ9A 4U7UK 2R2SA 2R7UA 2DT9A 3E01B 1ZA2B 1X5OA 4CTAA 4AL6A 3MMBB 5AJ3J 4UF4A 3EDQB 1ZBTA 2JLFA 3W2VA 1RB0A 4M5DB 1TAUA 4ZA1A 2VPXB 2C3PA 1Q4RA 2YNIB 5BR8F 4DOZA 3K5NA 5FDLA 2HHXA 1HPZA 3LANA 5ETPA 4ED8A 2FJAB 4AFFA 5DS7A 1RA7A 3GLJA 4H54A 3O8WA 3V4MA 3C16A 2C2MB 4PXDA 3RAMA 4Y2AA 3G82A 4K4SA 1PG5B 4MH8A 4A8MP 3LPYA 4KR0B 3LP0B 2NR0A 1F5AA 3QT8A 1WACA 3MM5B 2XYHB 4PXCA 1XMOF 4ERDA 4DL7A 3QLHB 4A46A 2JOQA 2FUG9 1N5QA 3MD1A 5KFMA 4PWDA 5HK4A 1S6PA 1RT4B 3M8ZA 4BC7A 3EE3A 2W2NP 2RT3A 1YIJS 5LL6d 3K58A 5L38A 3NS7B 3R7NB 4DSLA 5KFKA 3F44A 2FHJA 2GJFA 2HURA 5DDOC 3IAS9 3MWBA 1JMTA 1TKXB 2GV1A 3J81Y 4N8NA 4H4OB 1QLNA 3PX0A 2HVDA 2N7CA 1FI4A 1CVJA 4KHPJ 3N5FA 4EO6A 4I0WA 2DR7A 1RT5B 4ELUA 4AD6A 3CW2C 2OSQA 2X7IA 4WFYA 1RTDA 1WDTA 3KUGA 2PI4A 3H20A 4DCJB 4DLGA 4ZVRB 3MD3A 4IH6A 4OHZA 1NPRA 2XM3A 1FJGJ 4JI1J 3KK1A 4QYZK 2EKNA 4JBCA 3M8PA 3C6UB 3OTOF 4X4PA 1X0FA 1Y4ZB 2Y1JA 4QR0A 2BM0A 1TL3B 1FKAF 1Q1KA 5C24B 3H4BA 4ZVTB 1JLGA 4DPYA 4OJHA 2F8EX 2M70A 3D0HE 3H5SA 2L9WA 2YNHA 1UEVA 4ZN1A 3H5XA 3DHWC 2DXEA 2OD6A 2QA4G 1IBCB 3GJRB 4CLSA 1HBUA 2DNGA 2CWXA 3DOMB 2Y8YA 3R8YA 5LSOA 4L73A 1S0MA 2EFGA 4CTAB 1RHMB 1RAOA 2B9YA 3DOLA 2ROGA 2AV5A 2LMIA 1AUDA 5F0UA 3TANA 2ILYA 3W2VB 1VISA 4PG6A 4EK2A 2UUCJ 5CHCB 1WOOA 2R7VA 2AW0A 4E98A 2LQ8A 3UDEA 4NLGA 4QIVA 2R7TA 5FDLB 1HPZB 2H5JB 2P9CA 3FVYA 4AQYJ 2ATCB 3QSIA 3OSPA 3C16B 1XC9A 4B9UA 1V3RA 3VAJA 2LXFA 2J0WA 3G82B 1N33F 3K5LA 3CCZA 2B8PA 3BSNA 2W2MP 1UA1A 4UUXA 1OJ4A 4BDPA 1IQTA 4K0KF 3QGPA 1D9DA 3GCWP 4X4QA 1A0OB 4QWCA 1SC6A 3VQSA 4CLZA 1UVLA 2VBZA 1DARA 2COLA 2FPHX 4PWDB 1KQKA 3IMQJ 1ZPWX 2NPIA 1S6PB 1NH8A 3A3PB 4YN3B 1ZZNA 2HBRB 2GMLA 3RBDA 4C0OC 1S72S 3VAHA 4ZPDA 2M7SA 3LOUA 3D1HA 4N5SA 1FO1A 2AYEA 4NLYA 1HI0P 2UUAJ 1RT7A 2V69A 3FEXB 2AJ0A 2ZUAA 2BM1A 2XLJA 1UVJA 1B99A 4DV0F 4AUKA 2VPYB 4ZPTR 1RTDB 2M0GB 3D66A 2HS3A 4TLQA 2R4FA 3GIRA 3OVBA 2HBQB 1SB6A 3GJSB 4CWBA 3GIMA 2IVYA 2CQ3A 3K5PA 4P72A 2ZJPQ 3KK1B 2NUUG 2IPOB 4FYXB 4EMDA 5CA5A 3PVXA 3M8PB 2MMYA 1S9EA 2A0FB 4CI0B 2C3OA 2Z2ZA 3IAM9 1FRXA 4JV5F 2CPHA 4LVOP 4LFCJ 1B0VA 3D6HB 2JDJA 1JLGB 5KFFA 2VV5A 4TLRA 2Z2LA 3LP2A 4NYPA 2M2BA 2KTQA 2DH9A 3MEDA 2YNHB 3D7SB 3HFZB 4MKBA 2ZHBA 2UU9F 2G4BA 3TAPA 2UUBF 3ELHA 1Q8KA 2G1HA 3GWCA 3NG8A 1HBUB 1C1CA 3CJ2A 1DLOA 1VQYA 2J6TA 3CO9A 4WK1A 2J9DE 2V9KA 1SKWA 2UXDF 3T5HA 1WC4A 1RXOB 3TUJC 3THPA 3OLBA 2Z56B 1R8AA 3DOLB 3UCUP 2YTCA 5KAKA 4YDDB 3A12A 3KHLA 3CDBA 3BDPA 2OHDA 1MSWD 3D1OA 3UD4P 2K7KA 2HHTA 2FHMA 5DQIA 5HROA 2OTLS 2DVIA 2YQ0A 1FFWB 2MZJA 2CYYA 4C48A 3GG0A 1FRIA 3K5OA 2FLNA 2UV8G 2VDIA 3W3SA 4N77A 2AEFA 4DR5J 2KVIA 2X1GA 1BQNA 3RGIA 2LQ5A 1RACB 4U7CA 1ZM9A 4HEA9 4GKKF 3C19A 1S10A 3QO9A 3OFHA 4JI6F 2E5IA 3GV8B 5BYRA 2DGUA 1M5HA 3A3NB 2BA9A 3T9NA 3V6JA 3EGWB 2DO0A 1IBKF 1YI2S 1NSQA 1RHJB 1OYDA 2EVZA 3D68A 1G3OA 4PG8A 3K8WA 4LIWA 3BPDA 1URNA 4B9LA 3GSIA 3G71S 3CJ3A 2E5LJ 4I64A 1U09A 3ZTQA 4YB6A 4NA3A 1REGX 4C0HA 1IKWA 1IN0A 1IR0A 2VIHA 4Z2XA 3KJVA 3CCJS 1CLFA 1RT7B 1JXVA 2OTJS 4ZK7M 3VWSA 1X0PA 4ZVQB 4O3OA 1BHNA 3H5UA 4ER8A 2CJ9A 2KFNA 1VJQA 9RUBA 4BWMA 2HQCA 4NLUA 2UXBF 2QLBB 3GG1A 1PAUB 1HWKA 2QV6A 1B70B 1RYRA 4CIOA 1YITS 2PFDA 4ZP7A 2XMAA 2F3JA 1S9EB 4K4TA 4WKRA 1FRMA 3I55S 4ZCLA 4RW4A 1S0OA 1S4FA 3JTPA 5IWAJ 4JI4J 5J2MA 2RQKA 4YB5A 1UL3A 1VMBA 3CDUA 4ZP9A 5ETMA 2MKIA 4KPCA 3H59A 5KFBA 3J7YU 1S77D 2CPYA 4QOTA 1MMDA 5L1JA 1RHKB 4ZVGA 3MEDB 2GNKA 3LW5C 4ILLA 1Z1ZA 1GEHA 1WEXA 1HD1A 1IR1A 1TUVA 4F4AA 4CT8A 5DG9A 1C1CB 4QZVB 1DLOB 2J9DA 2ZITA 2XHWA 1LV5A 4NZ6A 4I69A 3HF5A 1N5TA 1YZ7A 2GQ2A 4IQXA 4ED3A 3NEKA 1NJIT 2VG5A 3MMCA 4F0HA 5E3RA 3CEDA 3PR5B 3J7YI 2JLEA 3W60A 3GONA 1QAXA 5IQ6A 4ZVFA 1WTBA 1JB0C 1F5BA 1TKDA 2R8HA 5HROB 4QPXA 3VALA 1VBXA 2CQ2A 2CDQA 4PUOA 2VH7A 5KTQA 1VJWA 1FK9A 5HJYA 5L46A 1U45A 1M5PC 1N5YA 1WKKA 4EZ9A 4ED5A 3VQTA 1C0TA 2B3TB 1TL7A 3J81U 1Y3KA 3ISND 3QO9B 1XR5A 3H5YA 2V8DA 5HQMA 2XNRA 1S48A 2DGTA 2WSFC 1VBYA 1GTHA 1D9AA 2QA1A 3F41A 1UZDA 4DI6A 1IKYA 2FDNA 3MM9A 5ETLA 1MWYA 1FRLA 4W4MA 3JQKA 1VRUA 2IBOA 4HHUA 2LFVA 3PM9A 2CWKA 2QLFB 1VLYA 1NHUA 1ICEB 2CJQA 4TXSA 2BE2A 2LDIA 4RPFA 2LECA 4RNHA 3AAWB 1FRJA 2J0QD 1WC3A 1IKWB 4CLFA 1L3UA 2QGFB 3E51A 1S57A 3OT9A 5HP1A 5C2CA 3KJVB 5A0YA 4NLDA 2CQHA 1VQ8S 1RAEB 1OPIA 5A6WA 4CO0A 1HBOA 3R2CJ 4DMZA 3MM6A 5ETRA 3ET6A 1JLBA 2G0IA 2FJDB 2D9OA 1NZ8A 3W9IA 2CNKB 3OHBA 4UOFA 3P96A 3Q2SC 1FCAA 1MN9A 4N47A 2VB6A 4USUA 2XWXA 4MT1A 5H9EK 4OJGA 5HVHA 5C42A 3VGTA 4TYAA 5SUHA 1YHQS 4MIAA 2HRYA 2ZZMA 4RUBA 2RIJA 4RW4B 2ZWOA 3G8SA 4I67A 1WHXA 1TMJA 3EICA 5J2MB 3N79A 1FT8A 2ZFHA 3KUEA 3M9NB 1F0XA 2YWWA 2KZMA 3U27A 4UW2A 4WTOB 3FSXA 4ZLNA 2N4CA 2F1FA 2VFSA 3I87A 4F0MA 5LJ3Y 2E1MC 1RK8A 2QLJB 1XNRF 4ELVA 4LFBF 1YDLA 2GVZA 2M88A 5A6PA 4I68A 2OPSA 3I96A 5BYQA 4MYTA 1U1PA 4HVZA 2DRAA 2B9WA 3T5LA 4Q8FA 2RE1A 2R3VA 1RU2A 1M1HA 2O66A 4B3RJ 2PA3A 4JI8J 2VG5B 3U02A 3MMCB 1VBZA 5E3PA 1QSSA 2ALZA 3ZFVA 1FX4A 2Y0BB 3IFEA 5GAHU 1SKRA 2MZQA 3W64A 3FQLA 4ZVEA 1F9EB 5DJBA 3TR5A 2R42A 4OHVA 5B0BA 4DS5A 3CPWR 3HD2A 2ZE2A 1U49A 2W7AA 2MSSA 4PUOB 4C8MA 4M5JA 3IO1A 1YKWA 3UNYA 5BJRA 3BB5A 4NA1A 1NH7A 1IR2A 4WIQA 1FK9B 2YH1A 2VF3A 2ZH1A 3Q8YA 4CLWA 2DH7A 1N5SA 3GJQB 3I31A 3ENVA 1C0TB 3DMJA 1JLCA 1TL7B 1SL0A 2ASYA 3CB4A 1RHRB 2QLXA 1VQ4S 4KO0A 5DO2A 5GAHI 2ZKUA 1B64A 4NYZA 2HQDA 3DC2A 4FNHA 3AJ2A 1UPMB 4YMEA 4Q8EA 2PEBA 2DEIA 2HAIA 2RU3A 3MEEA 1IKYB 2BZ2A 4BLGA 5KT5A 5EHHA 4TY8A 1VRUB 1YJTA 1FNXH 3P5TL 1VC0A 2BE2B 1S7IA 2Y9HA 3LA0A 5L1IA 5B0EA 3G8QA 2DNHA 3HP6A 5HP1B 5H1SV 4DLEA 4UOGA 5A0YB 3SZ2A 2IM1A 5IS2A 3BBBA 2WSCC 1JJ4A 2XQCA 3J7A1 3RBZA 1HBOB 3W1YC 3MM6B 2CNOB 2HBYB 2XO6A 3ET6B 1JLBB 2HFZA 4AXJA 4PG7A 5I3QA 1HWJA 2VG6A 3P45B 4H4KC 5F9NA 4ZCKA 4YB1P 4MIBA 4Q44A 4OL8A 5C42B 3MDFA 3BGUA 3VHQA 1JXEA 2KM8B 3R5JB 1VQKS 4P74A 2O67A 4EYHB 2MHEA 5T14A 2W9BA 2Z0GA 4X64J 4IRCA 4MK7A 2MZSA 2RQMA 2HSEB 2ZM6J 8RUCA 1A7GE 4J9VA 4P2MA 5B7WA 1NM2A 1V6HA 2QFJA 2Q6BA 3G6YA 2QMXA 3M4XA 1R43A 5K8NA 3PW4A 4PWUA 1U26A 2GVZB 1NKEA 4ILMA 2VD3A 1YX2A 2ROPA 2N4DA 5EWGA 1W2BR 2OPSB 2VJVA 1XQIA 5I3UA 3UPFA 4JV0A 3R6GB 3LO3A 5LXRA 2DHAA 1H2TZ 1QE1A 3D6MB 1U1MA 1G1XA 3CSKA 4G1IA 3DDNA 2A18A 3W66A 2DD8S 4O0NA 2DIUA 1Q8LA 4Q0BA 1FE0A 1X4HA 1BY9A 1T9UA 2VOOA 2AU0A 2CXEA 3LALA 2AZ1A 1HHTP 1S1XA 4Y2CA 2MGZB 3LQVA 3RR7A 2ZE2B 3EVWA 2BJ3A 2CUYA 1RP5A 4I6YA 1APSA 1WG1A 1H73A 4WXOA 2CDRB 3UVJA 2WBMA 2QA2A 1TVRA 1EKSA 3SI8A 3VAMA 1QAIA 4OX6A 5E5NA 3MFIA 3D6TB 2QL9B 3DMJB 1JLCB 4WP9A 3OVSA 2D41A 1S49A 4KO0B 3IBFB 4K4ZA 4LBHA 4LF4J 1VQ7S 2F8HA 2ZJRQ 3PKYA 4K4YA 4DSEA 1VLOA 2E1CA 1NB7A 4OZ0A 5KFZA 2O01C 2J8SA 4A8WA 2BQUA 1BWEA 2HFNA 4J9QA 3KDOA 4TY8B 2Q43A 4EZ6A 1VGYA 1N52B 3EUNA 2SXLA 3WIVA 1FA0A 1EIYB 3CCQS 4HDGA 4OJ1A 2YNGA 5HATA 5EWEA 1KOHA 1VS3A 2BKPA 1U0HA 3T1YF 2H51B 7FDRA 2X3GA 5KFUA 2DEJA 2FY1A 3NGSA 5GMEA 4M5HA 2XTJP 1CJVA 4J37A 2JEGA 1XN9A 3KLVA 3MPDA 3FDSA 4EUVA 2Z57B 3TZXA 4BBYA 4ZLJA 3MTKA 3DRPA 5IT9U 1TR0A 2VG6B 4NRTA 4HYKA 5CYJA 3BJYA 3DI6A 2I1RA 1PC4A 1J5EJ 4KHRA 4JI2F 2HWHA 1N0VC 4RX6A 3DRSA 4WZQA 1H2VZ 4JYAJ 2FHJD 2MKHA 4WXWA 2W9BB 4DZ6A 2XZTB 4LF5F 3OVAA 2AT1B 5H9FJ 3GFZA 1MLAA 2B9XA 1MWQA 4FPRA 3T6JA 4CP5A 4ENOA 1RWMB 2ZBIA 1TK5A 2FYXA 2B7CB 5HAOA 4LSLA 2J8AA 2CKWA 5IT4A 3I0RA 2XBPA 3TVKA 1FEEA 4CNZA 2IMWP 2RDJA 2DPIA 2JHEA 4C8YA 1NSPA 4URQU 3PYDA 4TVAB 4KGMA 1R31A 4DUTA 2HBZB 1FNMA 3KHHA 5AT1B 1SIZA 5I3UB 2K1RA 2GA7A 1I51B 2E7XA 3SIPB 4IQMA 5KFAA 3AD7C 3WQPA 4ICLA 3I56S 4Y3CA 3QATA 2YKNA 1QE1B 2MXYA 2K3IA 1URRA 3POTB 1XK8A 4Q0BB 2EI5A 3PEJA 2QMWA 3AFGA 1X4CA 3A4TA 4Q7AA 2B51A 1N54B 2CFXA 3NL0A 1UJ4A 3EYZA 4ZVOB 1S1XB 1U1QA 2KFYA 4DF8A 2W9AA 3FUYA 2EFQA 4LT6A 5L9XA 1NHKL 5KG3A 2KXNB 3FGVA 1UVKA 3UVJB 2UUTA 2CVEA 3ZZRA 5G0RA 1TVRB 3GFYA 4Z37A 1SVDA 1TKZA 3H25A 3KJFB 3G8TA 4DR3J 1Y00A 1AXQA 1EB0A 4ZPCA 4ED2A 3UFCX 4LF7F 1RT6A 3OPKA 1JJHA 2XG8A 1SJ3P 4QR1A 2E1AA 4NEZA 1WC1A 1VC5A 2F5GA 2DNPA 1FDDA 4QU7A 3PRVA 4M5MA 4MAKA 2W7PA 4M5NA 1HI1A 2QX0A 2DNRA 4CLKA 4ZDNA 2ZEJA 2W4PA 3H7HB 3QQCD 2JL9A 4L6V3 1XMQF 2YNGB 5B0GA 4FP9A 1U0HB 3BH6B 1ZAVA 4KKOA 2VBYA 2GCFA 3DHXA 4U9RA 3VZHA 1CJVB 2YBVA 1T7PA 4V1Ak 4I6AA 3H2LA 5SZTA 1MW7A 1RE1B 3DRPB 1Y7PA 1EETB 4K7QA 1RCXB 4UTGA 1M5OC 4ECWA 3DI6B 4FYDA 1KR4A 2LXUA 3TW0A 3M32A 3DRSB 1JJ2R 3I5BA 3NMRA 2AEMA 3KK3A 1ZPVA 4BS2A 1NMEB 3MPVA 1SPBP 2C2RA 4WIIA 2EXUA 3CC2S 1GX6A 4LSLB 3I0RB 3DLHA 3VVTA 4LRAA 2EC2A 2B6AA 1F1BB 3MMJA 2HGNA 2ZOMA 1RKJA 4QWAA 3DU5A 1PILA 1J27A 5CCLA 1HNWJ 5KG0A 2IAJA 5E3CA 1HQEA 5IV3A 1BXNA 1WG5A 3O6QA 2K1RB 1GMUA 2XS7A 4LF6F 4ICLB 1DBDA 2KYZA 4B9VA 1IXKA 3KJQB 4DV1J 1SJ4P 2YKNB 2GMHA 4URSA 3CC7S 4DG1A 2GIFA 2XCPA 4I6WA 1VQ6S 4F4YA 4XO0A 2VICA 3RW7A 3MURP 2MJNA 4HT7A 2IVFB 4PPDA 1ZM3A 1Z2ZA 3GV7B 2MJUA 3C8YA 2UVWA 2DGSA 3R5BA 3PKMA 3DRRB 4N41A 3NP5A 2HLUA 2W4CA 2HQ3A 4PR6A 5G0RB 5DLFA 1TKZB 4EFAC 2FJVA 1HWUA 2DGQA 1EQMA 1W25A 2CJYB 5EWFA 4WBFA 4NLSA 3ZTPA 3DXBA 1RT6B 2WB1D 3M6XA 2V2ZA 1RAAB 1DJ0A 4DR7J 2IYGA 3HDSA 4PXEA 1N34J 5LJ5Y 2HHWA 2C3YA 5DDPC 4DSFA 3DFEA 2JWNA 5KFJA 3QZ7A 1S1TA 1NK0A 5CXTA 2VKRA 2IJNA 3KG4A 4WYLA 1X4AA 1PBUA 4KKOB 2HQIA 4I7FB 3TEGA 1KRPA 1RBLA 1GK8A 4DPUA 5CYQA 3DLKA 3P3DA 4PG5A 1UKUA 5AXMA 4KYZA 2FC9A 2AKWB 4C3KA 1NK5A 2XYPB 1D09B 4ALZA 3IGNA 4IG0B 4G1QA 2GIRA 3S1TA 1QSYA 3RRHA 5IOLA 2DH8A 2FZKB 4J90A 1GXTA 4ES2A 1X9SA 5E0OA 3HKZD 2DJWA 1JLQA 1UWAA 3M32B 2C28A 1UMJA 4C98A 5KFGA 1BUXA 2BUNA 1NKCA 4ECXA 1LQ9A 1XR6A 3KK3B 1S97A 4DN0A 4RBVA 1VHFA 1MU2A 4C3LA 5KFYA 2YVSA 2UVVA 4N7TA 1LK5A 1IBLF 2B6AB 4ZPBA 4PG4A 4YDXA 2GS8A 3PW2A 1JNRB 4ZIVA 2CQ4A 4RU9A 4KGVB 2IAJB 1HQEB 2XLKA 4CH0S 2PN6A 5M2UA 3Q83A 4ZVSB 2Y8WA 2IM2A 4R0EA 4B08A 4NLRA 3W9HA 3WBZA 1HD0A 1IWGA 4DG1B 4IR9A 2NUHA 2QE5A 3TX0A 1I1GA 3CJ4A 4DR2F 2I5JA 2QTWA 3G2XA 5J1NA 4Y6IA 1LWEA 1VQPS 1QDUB 4X4VA 2R9LA 4O0IA 3ETOA 2CJXB 4NCGA 4UOHA 2KJVA 1HWIA 3BSAA 2QG9B 5B0AA 4I4BA 3S7RA 3SSQA 1LEOA 3HHDA 3LH2S 4DFKA 4UY8T 2P6TA 2H5EA 3D2WA 3FZ2A 3IG1A 4F04B 2J7UA 4LR8A 2LKZA 2PIIA 3JSBA 3KTQA 2XMMA 3OTCA 4J91A 2IY5B 4F3QA 1KOOA 1UZHA 5JXSA 4DU7A 2IMOA 2Z58B 4DSKA 3SCJE 4DUYJ 4FPIA 2QMUB 3BO3A 4M5KA 4NX9A 4YEAA 1S1TB 3DM2A 1X4DA 1B3TA 3TOQA 2HFSA 3CGIA 3K2YA 3GIKA 5CYQB 3CD0A 3DLKB 3HK2A 4AL5A 3BQ0A 5KT3A 4NA2A 5CCMA 1WNEA 1S1VA 1S4EA 1NSKL 2KI2A 4G1QB 4P71A 3U1LA 1W7WA 3KOAA 4OV6A 3BN4A 5FLXU 3T1HF 3KXDA 2ZH5A 3RYLA 4ZHRA 3UO0A 2VQEJ 4I2PA 1JLQB 1K1SA 2XZDB 1FERA 1RI7A 4EBDA 1HHSA 3R5GA 5HSPA 1PO6A 3OUYA 1G7CB 3C3LA 4KPYA 2ZDPA 2EK6A 1MU2B 4QWDA 2L08A 4CO4A 3R97A 1YJRA 2WTFA 2OUGA 3WIUA 4DR4F 2JFDA 5AXKA 4WE1A 3WC2A 1WC0A 4O3NA 2J7WA 1XIQA 2HGMA 3AA8A 1CC8A 1VQOS 3HSJA 3OL8A 2F65A 1CSJA 5KFIA 1E6VA 4YP3A 3CDEA 4RUCA 1PJ7A 5E7OB 4F3OA 1AFJA 4DUZF 3FRZA 3NKYA 3Q8UA 4ATNA 4DHVA 2HVZA 4KHMA 4O23A 4RU2A 2W8LA 1HNXJ 4OHYA 5EUHA 4LR9A 3B78A 1HNIA 2DRDA 2XI2A 5LMUJ 2I5JB 4Q2MA 3GIIA 5AE1A 1LWEB 5T7LA 2VODA 3OL6A 3UCGA 2ZOGA 3FC9A 4NCGB 2KJWA 3IA0A 2QO3A 3SBMA 1PC5A 4FXDA 1VK3A 3X3UA 4XAKA 1U1RA 1XNQJ 1YSJA 3D0IE 3IG1B 2R7XA 3K59A 1P1LA 3Q86A 1X4EA 2AD9A 1PBAA 5KFVA 4JI7J 4J9LA 2R7SA 4C8ZA 2RS2A 4K4WA 1U1LA 2V67A 4RW7A 2BMBA 3CIZA 5KFDA 5M2PA 3Q8VA 3DM2B 4E8UA 2DCLA 1I94J 2XSFA 3RRGA 3KMQA 2F8MA 1VHIA 2E7WA 2GMJA 4TKTA 3BF4A 3KLGA 1GXUA 1FD2A 1ZYQA 3ENAA 4DV7F 4M1KA 1K9MT 3BO2A 4G1PA 2LEBA 1MMNA 1WORA 4A8FA 1KFDA 1S1VB 3QZ8A 1MN7A 4OI3A 2K8GA 3PG9A 4NXMF 1WD6A 4JI5J 3HI9A 4HACA 2NXEA 2ACYA 5KFCA 1R0CB 3CE8A 5DZ7A 3NGUA 4C4WA 2QN6B 2XEXA 4U6PA 4ZHRB 3GU0A 3VZIA 4PRFA 4OHXA 5H9FK 2O5DA 4I2PB 3GJTB 4C0BA 1FX2A 4OLPA 2LQBA 2XLIA 1VYAA 3QMQA 3B54A 2LCWA 4NCBA 4LBIA 3OUYB 2AX0A 4DU8A 1ITPA 2N3LA 2NSCA 4LFBJ 1S0VA 1FFSB 2R7OA 3SEOA 4F26A 3H42A 2F4VJ 4QBUA 3WX4A 4WE1B 4KB7A 5THWA 4F4WA 5AJ3F 3M7VA 4U7UD 1RTJA 1YJ7A 3D6FB 2OFHX 2HFOA 2OH2A 3EPGA 3K57A 3Q24A 1Y5LB 3LP1A 5HMZA 3HHLD 2AJ2A 3HJFA 3MCSA 1LW0A 1E6VB 1L5UA 4DR6J 3L3CA 4X2BA 4QW9A 1YJVA 4RO0A 3MM8A 4RR5A 3BV8A 5HMXA 3SXLA 5AE3A 1ZETA 5B08A 4TYBA 3S6EA 2V2KA 1HNIB 4DV4J 1CJKA 1O6XA 2AQ4A 1RWPB 4OZ3A 3PJWA 1DHMA 4IDKA 3JYTA 2YNFA 1X4BA 4EEYA 3L7PA 5T7LB 3MR2A 5JMNA 1SQFA 5DLGA 1VIOA 2KZZA 3PW5A 4HH0A 4OX9J 2DHGA 1T03A 2NSBA 3HPOA 1KWMA 3C2PA 4KV8A 2H54B 1T3OA 2FJEB 3EMTA 2DB1A 5HANA 4IR1A 4KFBA 4W92B 3D1QA 1X5TA 3IC1A 2VU5A 1AUSL 3FCHA 1UTAA 4Y00A 4ECTA 3N6LA 2VUGA 1CC7A 3ZZUA 3CC4S 2CPDA 4USMA 4KHPF 3V2UC 2RRAA 3DXSX 4OLOA 4C3MA 3GFXA 2DITA 4WZMA 2QL5B 5HVGA 2BW2A 4RW7B 2R8KA 1SV5A 2HEKA 3OFFA 3PV8A 5L8RC 3KG1A 4NPOA 4M8LA 1FJGF 5D0EA 4JI1F 3TRGA 3K8VA 3KLGB 2KDOA 4F0KA 5J2PA 4FXWA 2FJWA 3OTDA 1WDDA 2HK2A 3E8OA 4TU8A 4F02A 3M05A 3FCWA 4TU9A 2Q66A 2EEYA 1KHWA 4HDHA 2ZZNA 2V63A 4LF8J 3ZXWA 3FZBA 2VZ9A 2I0XA 4DX6A 1SJFA 3DDIA 4HACB 2CJAA 4FKYA 4ID8A 2GJ2A 2ATLA 1TZ0A 2HHQA 4IFYA 4DPWA 2XNQA 3SV3A 5DGAA 4RKUC 3FBFA 4WU2A 1KC8T 4NE9C 4NLTA 1RABB 4FKXA 1ELOA 1TKTB 2PC6A 1GMWD 2AGPA 3GB0A 3R5DA 2VC0A 3HSGA 4GO7X 2NS1B 2KHDA 5C25A 3GFHA 3B4MA 2GJIA 4DX7A 4CCHA 2PMHA 5DQGA 3ZO7A 1RBAA 1U48A 2UXCF 1KLNA 3CXCR 4P7VA 1RTJB 3MPUB 3J81j 4PYAA 4QR2A 1HA1A 4H4MA 2X1FA 4B3MJ 5IM0A 3BYPA 2UUCF 1NSAA 3LP1B 3KYLA 2IRYA 2ZJQQ 1TU0B 1KP6A 1LW0B 2IC3A 2NYIA 2R2UA 5DZ6A 3IGVA 4ZOSA 3KDNA 4OZNA 2Z2MA 4CYUA 3MM8B 1RWKB 3CTRA 1R8BA 3MUVP 2CQDA 5KFQA 4QYRA 4NXNF 4UQGA 3G6VA 4PQUB 3OJUA 1IBMJ 3A8IA 2W7OA 1RZMA 4D3HA 3BGLA 2RNEA 2F7VA 3OTBA 1HQUA 1CJKB 1HR0J 4QIFA 2HIYA 4IDKB 2YNFB 2P5VA 2ZHAA 5KOXA 4FDFA 3TQEA 2JX2A 1HMVA 3TUIC 2GO9A 3K89A 2CPIA 4I56A 2G0CA 1T03B 4KV8B 2O1PA 2A1BA 2XZWA 2DO4A 4KFBB 1D1UA 3V5RA 1RUSA 4LFAJ 2IM3A 2AIRB 2OGUA 3EDRB 2MPUA 1S6UA 3DLLQ 4CO3A 2VKZG 4AL7A 4ZP8A 4HHHA 2H48B 2Q6CA 3AHPA 2YWFA 1X5SA 1NBEB 2NXCA 2UUAF 5GAEU 3KWMA 1S59A 3NY0A 1H74A 1FWPA 1QVGR 1M90T 1SV5B 1CQMA 3VAIA 5IXUA 4Y2MA 3KFWX 2B4OA 1SKUB 4V19X 4X66J 2M8DB 4ZPAA 4YHHJ 2LDYA 4XPEA 4F36A 5F8JA 4KTQA 5J2PB 2DHSA 2KFZA 1BQXA 1F3FA 3L09A 2FVCA 2BJDA 5GAEI 1RWOB 1WI8A 4HI2A 1WKJA 3I0SA 1TTHB 2XMJA 4K2JA 2E44A 2YKOA 2ZH3A 3R7BB 2HGLA 4LVNP 4P75A 2KKHA 5B09A 2HG4A 4IFYB 4DEZA 2HYIB 3AH6A 3I9ZA 3Q0AA 4FXVA 3PFEA 1YBTA 2C2EA 2M5YA 4B3SJ 2F9JA 1L3KA 1OIAA 2EW9A 2NREA 3HXMA 2AJ4A 1BE4A 2IJFA 1R8HA 4ZMMA 2W25A 2PT0A 1Z2LA 3LWLA 5C25B 2I9SA 3MM7A 1EX8A 3MECA 4O44A 4RNOA 2D3O1 2J9CA 1AROP 1N56A 2NYHA 3MR6A 4H4MB 5IM0B 1TP7A 1OY9A 1S5ZA 1JJCB 2ZBQA 2DNNA 2XSJA 4O3SA 4DV3J 2VOPA 1U1NA 1HKAA 2IC3B 2PDAA 4LF9J 2RVJA 3GYNA 1SQGA 4B9TA 3MR3A 4CYUB 3ZNUA 1OMSA 1F2GA 3BKUA 5F8GA 5KOWA 4ZN3A 3UE2A 4DR5F 1L3VA 3I32A 3CUNA 1TELA 1YRTA 1GT8A 2YY3A 2WZ1A 1YQHA 3BZQA 2DR9A 1HQUB 4YR3A 2UZAA 3QRPA 1VBKA 1WF1A 2ZHOA 2JRSA 4CLPA 3CIMA 2JJ4D 1WHWA 1N32J 1HMVB 2GHWA 3VVUA 4OYBA 4ED7A 4KAIA 4DSJA 2A6MA 3CCES 4BCAA 4K5RA 1Q0NA 1Q82T 4LUBA 3U1NA 3SCIE 2E5LF 3ILJA 5B0DA 3NNCA 3EX7B 4OYIA 5FD1A 2VFVA 2YXLA 1R6VA 2VBWA 4OYZA 1QUPA 2MTLA 1KQGB 3OL9A 4DV2J 3DOKA 3PHTA 2DNOA 2CPJA 5KFRA 2VHGA 4K50A 1WG4A 4C9DA 5L9NA 1VRQC 1I6JA 2M9KA 2XS2A 1S0NA 3TZYA 1IQZA 3NGDA 1IM6A 4OYPA 1EQ0A 3BKTA 4YR2A 2WOMA 1YJNS 4PZVA 5IWAF 3FK4A 2HHPA 4LMZA 4JI4F 2R7WA 3I0SB 5A8WA 5F0WA 5DM6Q 3CJ8A 1ZZFA 4QWEA 2BQ3A 4C2MA 3P49B 1KBRA 3SFUA 1ROFA 2CZ9A 1BWVA 3RB6A 2OEMA 3HZEA 4IOAQ 5AE2A 4JI3J 2M3DA 1FXDA 1H3DA 2KHCA 2DCUB 1HIYA 4LREA 2FVSA 2Q1LA 4HKQA 3MOZA 3NGKA 4G65A 1TFYA 5HMYA 3HVWA 4NLQA 2CJKA 3LAMA 1M5SA 3WHIA 2MSTA 1TFWA 2XCAA 2LP4A 3MR5A 3MM7B 2RUGA 3MECB 4O44B 1RCOB 4HH1A 5C7PA 3RR8A 4DR1J 2VC1A 3NWRA 1D3WA 4MJKA 1JKHA 4ZPWR 4B3TJ 2XSJB 1T3NA 1P8GA 2XMVA 1O8BA 1ACMB 3R2DJ 1PYOB 3N0VA 3E2EA 5AXLA 4J9KA 2DXDA 4TNOA 1R27B 2HNDA 2EG2A 3C15A 4IH5A 9ATCB 3B8HA 2UVUA 2XMKA 2W1BA 3D9BA 1Y11A 2OPPA 2H5IB 2KG1A 4K2XA 3JS9A 1F6TA 3BS9A 1T94A 4Y0FA 2IHR1 5L1LA 4EBCA 3PO5A 3HVRA 3TJ8A 2GW8A 3H2UB 5GMDA 2GAGC 4LRDA 4CLLA 2PEHA 4OI2A 2V4QA 2XO7A 1JWWA 1JXLA 3ZZOA 2DY1A 4H4KA 4L76A 1BQMA 2ZH7A 3W2WA 1C4AA 1T9XA 3RTVA 4A47A 4ZCIA 3L7OA 2ROEA 3H90A 3R27A 1X4GA 2WVCA 4ILRA 2OPRA 3P5BP 5E2QA 5KFPA 1HBMA 3O5TB 1UFLA 2JVRA 3BQ1A 1FXRA 2YPZA 3Q8SB 2QL7B 5JJBA 3DOKB 1UWBA 3UDLA 7FD1A 2C2NA 1OQ3A 3OTEA 1O51A 3W8GA 4IOCQ 4ZLPA 4LJMA 3K5MA 1ZTTA 2XB2D 3DN9A 2YQ1A 2EBGA 4IYQA 1M1GA 3GE9A 1SH2A 1FE4A 1XMBA 3D54A 3ENWA 3PRBA 2BDPA 3DU6A 3Q2TC 2HHSA 2R2RA 2Y0SD 3BSOA 3LAKA 2WOMB 3IP0A 1LWXA 5IT0A 2N7YA 3IM9A 4FVMA 1VI7A 2HZVA 3MEKA 3P6YC 4ID5A 5A8WB 3KMSA 5IFMA 2CA9A 1K47A 1X8DA 3I4PA 1QJHA 1PSDA 5FJ4A 3FMBA 3UR3C 4KRWA 1KN6A 4JI0J 1RTZA 2RQCA 3HULA 4Q45A 3H0PA 1N88A 4ZLLA 3Q22A 1TQLA 2M8HA 3MGJA 2KRBA 2WRMA 4EYIB 4NLOA 1GX5A 2FJBB 1Y3JA 1FJ7A 1YWXA 4B3RF 1Y9OA 4JI8F 1ZS6A 5F8IA 2E66A 3M2RB 2FVRA 3UD5A 2YX4A 2VASA 1JKHB 2A2CA 4MKVA 2B9EA 5ADZA 4B02A 2X3DA 3HHNB 4P6QA 1HNVA 2AF6A 2EWHA 1OWXA 2FLPA 4LF2A 2HNDB 1EP4A 2LEPA 5LMNJ 3C15B 5D0HA 4OIXA 4UY85 2OMLA 2CQGA 2PD1A 2OPPB 4WK3A 5IT9Y 1IKXA 2V8HA 1NB2A 3KHRA 1UEUA 4ELTA 3PXGa 3V6HA 3N01A 3TEHB 3TO8A 2RDDA 3RG6A 2WSEC 3RB0A 1T95A 1KVIA 2CPFA 2GQCA 2B8QA 1S6OA 2HRUA 2HHHJ 4YQWA 1BQMB 5HQLA 3W2WB 1P9YA 3OHAA 2HVEA 4Y65A 4HTIA 2OMOA 2V8GA 2BJ7A 2OPRB 1FXLA 2GO8A 2RHSB 1HBMB 4NZ0A 1YBAA 1SXLA 1K1QA 1YG0A 1H72C 1A9NB 2PE8A 1XERA 5IC4B 2E1PA 2FQQB 1H2UX 4JOUA 1UWBB 3M9OB 2RRBA 2AMCB 5MAOA 2HZAA 5KG7A 4USWA 2ZBCA 1VQ9S 3HHEA 3QIPA 5LOQA 2GIQA 5IZHA 1HW8A 2R8JA 4DCPB 2MB0B 2EPIA 1RBOB 3R1HA 1RWXB 1FRHA 1O5JA 3PR4A 3CDWA 5ETTA 1Y10A 4MKYA 2WVFA 1T9TA 3NLCA 4X64F 4EGLA 2CG8A 2EKYA 2DNZA 1N4LA 1PCAA 4ID5B 3M8RA 1L3SA 2ZM6F 3CD6S 3WX8A 5CAAA 1U6BA 1F2HA 3PJXA 4ECQA 4OI0A 1Q79A 1SJRA 2RRNA 2BACA 3CF5Q 2DR6A 3CMQA 1EZZB 2J6UA 2KT5A 5BXIA 4CH1A 4RW9A 3SDEA 2Y3YA 3FEYB 2KL8A 1N6QA 1YGYA 2UVRA 4GVBA 2LQJA 3BPSP 3W63A 5A8RA 4P9SA 4CDIA 4J9MA 3JAMY 2PFFB 2YKPA 2Y1LB 3P4UB 1XTZA 2CADA 3MHYA 4O4RA 3TUPA 1X4FA 1IJFB 1QTNB 2XWYA 1IVZA 1R0BG 2PI5A 2FLLA 2MQNA 1WHVA 1XR7A 5IQQA 2VFUA 2JLGA 1SC1B 1FKPB 4UQTA 1LKZA 3R6LB 4N8OA 3SYZA 4E2FB 4U67Q 5KG5A 1YLXA 2F9DA 3ZZ0A 1HNVB 3QT6A 1F5CA 4HT5A 1B0TA 5ETQA 2B5JA 1EP4B 1C2PA 3B4DA 5GVQA 1U02A 2MKJA 4G6VB 3KG0A 3IR6B 4RLEA 3HKWA 1DQ8A 2MY8A 2EG1A 1WF0A 1W26A 3CCUS 1KNZA 1WEYA 2CPXA 3SSRA 1IKXB 3A8JA 1BD6A 1M1KT 1X9MA 3SCKE 4DL4A 1VR6A 5KG6A 4LF4F 5E33A 3TA1A 2ZVIA 2JEFA 1T11A 3M9MB 5D78A 2H4YB 2E5JA 2A6OA 3CO0P 3GYXB 1RDRA 3CD5A 2WCXA 3FQKA 5ETNA 1GXLA 3OL7A 3T5KA 2PA8D 2DNLA 2YWHA 3A8EA 4BC9A 3BR8A 5HL7Q 1WJ9A 4FF4A 1KLMA 5HBMA 1I5OB 2WAQD 3PY8A 1L3TA 4ANDA 1NJWA 3VV2B 2PSZA 5KFWA 4PKDB 4UUWA 3C6TA 3N6NA 5I4MA 1KSPA 3NNAA 4RWWA 3BQ2A 2LA6A 3GP9A 3EPIA 4USVA 3OV7A 2MGZA 1U1OA 1OPZA 4XDDA 1DURA 4XDCA 4CO1A 2WVEA 1EKRA 3QIPB 2YKQA 4CNYA 2X1BA 1J5EF 3AXMA 2MHNA 5KFOA 1T9WA 1UJ6A 3MMAA 4WJBA 2P2CB 2FVPA 3DLGA 4JYAF 2QFIA 4IO9Q 3PEHA 4S0MA 3O44A 1Q16B 1D8ZA 3GILA 2VPWB 5D0GA 4PCQA 4OZ5A 2ASLA 1ZM4A 3QBCA 1RISA 3AQPA 3RZAA 4BWJA 4GC7A 1ULRA 3TI0A 3IRWP 4RW9B 2V2QA 3SDEB 2V2VA 1U6ZA 4FYVB 3M1VA 1N6QB 3HHKA 1RT2A 1Y5NB 4GVBB 2ADCA 1F60B 3WDOA 2B4VA 4CLYA 2QT7A 5A8RB 3CJ0A 3W65A 1NO8A 4B9NA 1KEKA 4PYDA 2C3UA 3M8YA 2VL1A 2BBEA 1GNKA 3FSYA 2V4JA 3QJLA 5K5MA 4IG3A 4Q43A 2WONB 2FHOB 1U7LA 3J7AN 3IBWA 2RILA 3HHLA 1FDAA 1PKUA 3BKFA 4LQ9A 3AB2B 3VF0B 2VJUA 2V5HG 3K7RA 3KLIA 2QRRA 1UCNA 2W2QP 4DX5A 2IA6A 3F56A 3T9ZA 1HYSA 3QWPA 2H3EB 1WOSA 2B5JB 3ZTOA 1RJJA 3G86A 1T05A 4TN2A 1RYSA 2ZNZA 2RB7A 3N4WA 4DR3F 4ECZA 4A8QA 5JUMA 4BHQA 1YTYA 1Q7LB 2DTJA 5DETA 2ZH8A 3AOBA 3F73A 4F3MA 4PWWA 3D28A 3B6BA 4R8UA 1NK6A 4N56A 5B0FA 2OKQA 1U2FA 3SCLE 3GR0A 3BGOP 3FMWA 3W62A 1NNDA 2V6AA 3PJ9A 2WB4A 1JLEA 4JV2A 4QQBA 3UW1A 4HTJA 3Q23A 4TY9A 1B7YB 1KLMB 5HBMB 2LU1A 3P8BB 3POTA 4ZIWA 2NXJA 1S6QA 1IJEB 2HQGA 5C2GA 2WBRA 2UV8A 3VCDA 1HNZJ 3C6TB 3QT7A 1LNQA 3ISNC 2ZC4A 1B0PA 4MKAA 4IUFA 3GYGA 1IUJA 4U8YA 4HLBA 3BSCA 1SC4B 3J7ZT 3C46A 1J5OA 4HHJA 2D9PA 4ZS6A 2M4MA 3GMGA 1PJ6A 1CPZA 4KH0B 3O3LA 1Z4UA 2E1RA 1RT1A 4GKJJ 1KFSA 2OLWA 4USIA 3MMAB 4X65J 3DLGB 1FTCA 2AP6A 3CMAS 4AE5A 3SSSA 3PX6A 1RWUA 1S9FA 3LPEA 3HO1A 1Q81T 1DAXA 4M95A 1FESA 5HLFA 4USTA 1NDPA 2KYXA 3NBPA 3C14A 3CWJA 1M0SA 2BE7D 2BRLA 2D3UA 3BEGB 3PFOA 1FTRA 1HNWF 4DL6A 5JVHQ 3M1VB 4YOEA 1XWLA 3RW6A 1RT2B 3R1LA 2UXCJ 3D3CJ 3PYEA 4LQ3A 3OR2A 5K8OA 1FJEB 5GADU 4Q5VA 1GMWA 4RJVA 4DV1F 2IDLA 1N48A 3OFEA 2LVWA 5HJXA 1G2EA 5DRKA 1V5IB 2V4JB 1B7FA 5AXNA 2G2ZA 4IG3B 2PMWA 4YY3J 5J1EA 1EETA 5KT6A 4RUAA 3HMJG 2JVOA 3HHLB 4DV6J 2C1EB 3CJSA 4NXNJ 3TAQA 1S1WA 4RBTA 5D3GA 2H4WB 3KLIB 1VIXA 4KBIA 4JP8A 5KFHA 4C11A 1HYSB 2DGVA 2BJ1A 5GADI 2DNKA 1UPPA 1T05B 3LWMA 4DV5J 3TVYA 4A8KA 2QIFA 1OY8A 4Y2KA 4X4RA 2IJRA 5D0RA 2Z2YB 4KSEB 4IRKA 4DCOB 5A8KA 4X62F 2RAQA 2HVIA 2CJBA 4TQSA 2ZC3A 1NXIA 2FVQA 4C7QA 5IC6B 5FLXY 3LTOA 2DGOA 1SH0A 1SQEA 2AEJA 4DR7F 3OXGA 4R8UB 4IOBA 1N34F 4Y28C 3M8QA 2ZBRA 3D5MA 1SI9A 5DG8A 2I8EA 4NZ7A 8ATCB 4X4TA 5BR8J 2BEFA 1JLEB 1RA6A 2MLXA 2BYCA 2OAUA 3AXKA 1YVFA 2HFVA 1OS5A 4M94A 3QJPA 4ES3A 1FFGB 1S6QB 2QYGA 3R5CA 3KLFA 1NHVA 1WF2A 5ITHA 1REVA 1P1TA 4GC6A 2HNZA 3TNVA 1LXJA 2MKSA 1DY3A 5LT5A 1X9WA 3ILOA 2IA0A 1HBNA 1P9QC 1XMOJ 1N8RT 1J5OB 1ZAXA 3MTJA 3DRRA 2D1CA 2JC0A 1KONA 3F0NA 2D69A 5M2RA 3HFVA 1RT1B 3EGNA 1WWHA 1RLDA 1TL5A 4CM2A 3JAMU 2EFOA 2AX1A 2A10A 2FTRA 3W8PA 4DFJA 1GH8A 2RUSA 4L74A 2ZBPA 5HLFB 2ILZA 3QWUA 3BM7A 3A3OB 3NBPB 3C14B 4F2RA 2ZVSA 4O3PA 4M5LA 3ONQA 3I82A 3EGVA 1FDNA 1HLWA 2ZUGA 2L9DA 3DRYA 3AY0A 4QU6A 2HHVA 4I7FA 4WP8A 3OR2B 1WEZA 4KC5A 2PMZD 4KT0C 5HN0A 5D4NA 1NK8A 4X4SA 1NDCA 2JFKA 4NRUA 2W2OP 3OTOJ 3VAGA 4IG0A 2VQFF 1ZH5A 5J1EB 7AT1B 1Y5IB 4LIRA 4P73A 2VG7A 3M6UA 4AXIA 1U0SA 2JEJA 2E7VA 2BABA 1S1WB 2KG0A 1FWKA 4DZDA 5D3GB 1PAEX 3QPIA 4JUZA 5D77A 4EBEA 2C2ZB 3ISZA 1QAYA 1T9YA 1NK7A 3ZZYA 2L41A 4C11B 1S76D 2AJ1A 1WUUA 3TYTA 1N0UA 1SJ1A 2CIMA 3KKFA 3QNWB 2IDEA 2MKKA 3G6XA 4ETZA 1S7HA 4YS2A 1NCLA 5A8KB 1VC6A 2C3MA 4DQPA 3CCRS 4O4GA 1EJ7L 5D15A 1RAIB 3Q89A 2AYBA 3KJNB 4HR2A 2QSWA 2G0JA 2RF2A 3GQCA 4MTPA 3GCXP 3M8QB 4DUYF 4N76A 3TWZA 2QJ3A 3BO4A 3AOAA 3L9ZA 4NLPA 3IS9A 3IXQA 1FD8A 1NAQA 1HI8A 3TZZA 2QA4S 1N5VA 2FLOA 3DNCA 1NU4A 2OEJA 4CLUA 1FKOA 3KLHA 2OPQA 3KLFB 5A76A 4DSIA 4V19J 1REVB 2VDHA 1N33J 3VAKA 2I2YA 2HNZB 3EM1A 1WC5A 1HBNB 4K0KJ 1TAQA 1Q78A 4ITSA 1PGZA 3M2UA 3HJVA 2H65B 2FIUA 2JEIA 1TK0A 2LYVA 2VQEF 2RMLA 5K8MA 4DFPA 3LP2B 4IKAA 2DIVA 4GVLA 1VFJA 4OZ1A 2N3OA 2HFUA 3AA9A 4B17A 4RZRA 2ADBA 1VCTA 2HZCA 1KQSR 4J9OA 3UDVA 4FS2A 3TA2A 5CZXA 1OY6A 2EC0A 4B9MA 4B9SA 5HO4A 4DV0J 4OZ2A 5KT4A 1RT3A 1VQLS 5T41A 1YK9A 4CT9A 3PNIA 1VDHA 3EZOA 2YX1A 2KRRA 4OYAA 1RHUB 2JH3A 2QSFA 4WFZA 3PRDA 1LFPA 2W4DA 2HWTA 3CCTA 2GHPA 3IWLA 1HNXF 4USKA 1RAFB 2MKYA 3TARA 3R7SB 4PEOA 2AYMA 1WSRA 4JV5J 4WTYA 1U8SA 5LMUF 2DR5A 2VG7B 4QIEA 3W5ZA 2RSQA 1BQNB 2HLTA 4XPCA 3D4JA 3H98A 1TUWA 3R3TA 3IR5B 2MQMA 2CG4A 5MLCV 1DQAA 5KFSA 4DL0C 1LFWA 3E3XA 1K0VA 4WFAQ 4ECSA 2UU9J 2UUBJ 4KQZA 1PJ5A 1T02A 2HVHA 3LGHA 1XNQF 1S99A 5J2NA 3SQGA 3CCWA 1BLUA 1RAGB 3OD2A 3TQ1A 4JI7F 2UXDJ 4O4GB 2ALYB 5U47A 3RB3A 1H6KX 4ZVHA 6AT1B 2MDAA 3Q8QB 1NUEA 3AODA 2RF2B 2W2PP 2MLYA 8AT1B 5DM7Q 4M63A 1U1KA 3H8YA 1LK7A 3BDEA 2V4RA 1GFWB 3R5AA 3IS9B 2CPZA 1QD1A 4NMXA 3EJMA 2HWIA 1I94F 3UR0A 2BQRA 2V8PA 4FBTA 2YH0A 3KLHB 1FKOB 2OPQB 1K44A 2D3OR 4U8VA 2C42A 2XMWA 1RQ0A 1FF2A 4F7VA 1WHYA 1UETA 2DR8A 2FGOA 4GKKJ 1DZ5A 4KGKA 4JI5F 4JI6J 3M2UB 1U47A 3UI3A 1EHWA 1LOUA 4Y34A 3MF5A 2B0GA 2ZD1A 1KD1T 1U2CA 2ZH9A 1YJ9S 4OZJA 2AHOB 1IBKJ 3AJ1A 1DTTA 4OMFG 4Q2LA 1UFWA 4OZLA 4ZJOA 4C8KA 4LR7A 1JLAA 1DTQA 2YKAA 1NPKA 5HQ8A 1NJYA 3ENQA 2NZCA 3ILIA 2F4VF 1NJZA 4OYOA
chains in the Genus database with same CATH topology
4KIAA 1HWLA 2X51A 2XSJB 2KXNB 5KG3A 4J9RA 3FGVA 1UVKA 2CQ0A 2UUTA 2EFNA 3ZZZA 3JB9k 4CO2A 1T3NA 1P8GA 2CVEA 3ZZRA 2XMVA 1O8BA 5G0RA 1TVRB 1R0AA 3GFYA 1TKXA 4Z37A 1RT3B 2HS0A 2JZ5A 3CMES 2APOA 3N0VA 4J5OA 3E2EA 4H4OA 1TKZA 3H25A 3JSYA 5AXLA 3G8TA 4J9KA 4K4VA 1Y00A 1AXQA 4NOHA 4TNOA 4ZPCA 1R27B 4ED2A 2KO1A 4WFBQ 2HNDA 3UFCX 4DR6F 2EG2A 4A8YA 4O3QA 2C2DA 4IH5A 5E41A 1RT6A 4LF7F 3B8HA 4USJC 3M8SA 1Q8IA 3OPKA 2MZ1A 1RT5A 2UVUA 1P6TA 1JJHA 1OSDA 3TVZA 4DBQA 2XMKA 4I1TA 5CQGA 2XG8A 1SJ3P 4B3OA 1CEZA 4QR1A 2E1AA 2V0NA 2OPPA 4NCAA 3W7BA 1KHVA 2KG1A 4K2XA 2KXHA 1VC5A 3BS9A 1T94A 2DNPA 2IHR1 4Y0FA 5L1LA 3UNGC 4EBCA 2LA4A 6FD1A 3PO5A 1FDDA 3CULA 1S9GA 4QU7A 3HVRA 4MAKA 2BANB 2W7PA 3AB4B 1HI1A 5F3ZA 1UVNA 2DNRA 2ZKTA 4DV4F 2VBXA 2GW8A 4WCEQ 3H2UB 6FDRA 2J6SA 2M52A 2YKMA 4ZDNA 1N5YB 3C6UA 3CT9A 1UA0A 2PEHA 4OI2A 2V4QA 4OJ3A 2W4PA 4URGA 2XO7A 1JWWA 5EX3A 5F9LA 1JXLA 4PPZA 4YY3F 4YFUA 2Q3PA 2JL9A 4L6V3 2D3ZA 1XMQF 2MQLA 2YNGB 2I38A 1VOMA 5B0GA 3ZZOA 4RW6B 4DWIA 3IRXB 4FP9A 4H4KA 5H9EJ 1BQMA 4MK9A 2ZH7A 4DV6F 2NZ4A 1ZAVA 4KKOA 4OX9F 3W2WA 1C4AA 3RTVA 4A47A 4ZCIA 2VBYA 3L7OA 2H9ZA 2ROEA 2GCFA 2DGWA 2DISA 3R27A 3DHXA 1X4GA 3ITHA 4U9RA 3WC0A 5F8MA 1TL3A 3VZHA 4ILRA 1OO0B 2OPRA 5C24A 2NXUA 3BGRB 1NRKA 4QWBA 5E2QA 5KFPA 1RAJA 2J9EA 1HBMA 3O5TB 3IR7B 1UFLA 1T7PA 2HS4A 3THVA 5CZVA 4K4XA 4ZKAA 5J2NB 2JVRA 3SQGB 4I6AA 3H2LA 3LUYA 5SZTA 3JYTB 1MW7A 3BQ1A 1FXRA 4MYUA 1W2IA 3PW7A 3DRPB 1Y7PA 2KH9A 3MM9B 4RWXA 1EETB 3N9UC 5EGYA 4DL3A 2XY6A 2J0SD 4DV5F 5EN1A 3Q8SB 1M5OC 4ECWA 5JJBA 5KG2A 3DI6B 4FYDA 4ECRA 3DOKB 3OXLA 1KR4A 1UWBA 3CD7A 4L3NA 3UDLA 7FD1A 1OQ3A 2ZH6A 3OTEA 2LXUA 1O51A 4XK8C 1GQEA 4DDFA 4IOCQ 4ZLPA 3DOMA 4LJMA 5LSLA 1Q86T 3K5MA 5CH7B 3TW0A 1QM9A 1ZTTA 2LQ9A 3M32A 2XB2D 3DN9A 4NLWA 3DRSB 5F41A 1JX4A 1BGXT 4U7UK 2R2SA 2R7UA 2EBGA 1JJ2R 4IYQA 1ZOTA 3I5BA 3NMRA 1LWFA 5KFLA 5CD4H 1QAJA 2DT9A 3GE9A 1SH2A 3E01B 1FE4A 1X5OA 1XMBA 3D54A 1ZPVA 2IYIA 3ENWA 3PRBA 5FIIA 3KK3A 2BDPA 4CTAA 4BS2A 3DU6A 4J9SA 3Q2TC 4AL6A 3MMBB 2HHSA 2R2RA 2Y0SD 3BSOA 1ZBTA 2JLFA 3MPVA 3W2VA 3Q8PB 3LAKA 2J5AA 2C2RA 2WOMB 4M5DB 4WIIA 1TAUA 3CC2S 1GX6A 2DGXA 4ZA1A 3KK2A 3BREA 5IT0A 2N7YA 2VPXB 4LSLB 2U1AA 2RD5C 4FVMA 2C3PA 4HI1A 3I0RB 3DLHA 2EFPA 4RNNA 1Q4RA 2YNIB 5BR8F 2B6AA 1VI7A 4DOZA 1KQFB 3MEKA 4EU0A 3MMJA 3K5NA 5FDLA 3P6YC 3DLEA 1HPZA 3LANA 4ID5A 5A8WB 2HHXA 2HGNA 2XC9A 4ED8A 3KMSA 2FJAB 4AFFA 2ZOMA 5DS7A 4X4NA 5IFMA 1RKJA 4QWAA 3DU5A 1PILA 1RA7A 3T1AA 4DL2A 5CCLA 4H54A 1X8DA 4F67A 5KG0A 2EK1A 1QJHA 3I4PA 3O8WA 3V4MA 2IAJA 1PSDA 5E3CA 4LF8F 3FMBA 5FJ4A 2OJ3A 3UR3C 4KRWA 1HQEA 2E9TA 1KN6A 2VPZB 4PXDA 3RAMA 2R8GA 2JC1A 2PGCA 4Y2AA 1WG5A 3O6QA 2HHUA 2K1RB 3V4IA 4LSNA 2RQCA 1H0HB 2XS7A 4J9PA 4LF6F 4K4SA 4Q45A 2W9CA 4MH8A 4A8MP 1N88A 4ICLB 4ZPVR 3LPYA 2LEAA 1DBDA 2KYZA 4KR0B 3Q22A 1TQLA 4B9VA 3LP0B 1IXKA 2M8HA 2YWEA 1F5AA 2YKNB 1SJ4P 2NR0A 2ZD1B 1WACA 2GMHA 4URSA 2AJFE 3CC7S 5I3PA 3MGJA 4DG1A 3MM5B 4PXCA 1XMOF 1UP1A 4ERDA 2KRBA 2WRMA 1DTTB 4DL7A 2R7RA 3QLHB 4EYIB 2XCPA 4I6WA 4NLOA 1GX5A 4A46A 2JOQA 2FJBB 5HI7A 1VQ6S 3DCAA 4F4YA 2FUG9 4XO0A 1N5QA 1JLAB 1DTQB 1Y3JA 3MD1A 5KFMA 2G13A 4PWDA 3RW7A 1FJ7A 1YWXA 3MURP 2MJNA 4B3RF 4HT7A 2IVFB 1S6PA 1Y9OA 4JI8F 5F8IA 1RT4B 4PPDA 1ZM3A 1Z2ZA 4BC7A 3PIPQ 2E66A 3GV7B 3M2RB 2FVRA 2RT3A 2MJUA 2YX4A 1YIJS 4W90B 5LL6d 3K58A 5L38A 2VASA 3C8YA 3FJ2A 1JKHB 2UVWA 2A2CA 4DSLA 2DGSA 2QLWA 5KFKA 1QTMA 5ADZA 5DQHA 3R5BA 3PKMA 3DRRB 3F44A 2FHJA 4N41A 2FGCA 3NP5A 2ASJA 2HLUA 5DDOC 2W4CA 2HQ3A 3IAS9 4PR6A 5G0RB 3MWBA 1JMTA 4B02A 3UQSA 1R0AB 4B3MF 3HHNB 1TKXB 2GV1A 4P6QA 3FEZA 3J81Y 5DLFA 1HNVA 2QYCA 4H4OB 1TKZB 2AF6A 4N8NA 2LXIA 4EFAC 2EWHA 3PX0A 2FJVA 1HWUA 2DGQA 3HM9A 1W25A 1OWXA 2FLPA 2N7CA 5EWFA 1CVJA 2HNDB 4NLSA 1EP4A 3N5FA 2LEPA 3DXBA 3JTOA 4EO6A 1RT6B 2WB1D 4I0WA 4PXBA 2DR7A 3HFKA 3M6XA 1RT5B 4ELUA 4OIXA 4UY85 2E9RX 2OMLA 2G1DA 4B3OB 2CQGA 2OSQA 3I4HX 4WFYA 1RTDA 2PD1A 1UJ5A 2OPPB 2DRBA 4WK3A 1KTQA 1DJ0A 2PI4A 4OHWA 3MAQA 5IT9Y 3H20A 4DLGA 2IYGA 1IKXA 2V8HA 3HDSA 4ED1A 3ICLA 3MD3A 4IH6A 4OHZA 2G9OA 4PXEA 3IWNC 3KHRA 1S9GB 1UEUA 2B56A 3IN5A 5LJ5Y 4ELTA 2CZVC 3G96A 2HHWA 3PXGa 2C3YA 3V6HA 5DDPC 1IBMF 3KK1A 4DSFA 3DFEA 2JWNA 5KFJA 3QZ7A 3N01A 2ZH4A 1S1TA 3TO8A 1NK0A 4JBCA 3M8PA 4QPTA 1N36F 2WSEC 3RB0A 1KTVA 2YKMB 3C6UB 1HR0F 3OTOF 5CXTA 1HW9A 5KFNA 1Q7YT 4X4PA 2VKRA 1T95A 2IJNA 2CPFA 2GQCA 3KG4A 1KVIA 1S6OA 2HRUA 1X0FA 4WYLA 4YQWA 1BQMB 1X4AA 4KKOB 2HQIA 3OJSA 1Y4ZB 3W2WB 4I7FB 4NWBA 3OHAA 1KRPA 3RRKA 2Y1JA 4Y65A 5CYQA 4HTIA 2JSXA 3ITHB 3DLKA 4QR0A 2BM0A 1TL3B 2OMOA 2V8GA 3P3DA 1FKAF 1Q1KA 1UKUA 2OPRB 4PG5A 5AXMA 2GO8A 2W24A 5C24B 1SKSA 2FC9A 1FXLA 3H4BA 3BN7A 1HBMB 4NZ0A 1TKTA 1JLGA 4LFAF 4OJHA 1YBAA 2F8EX 2M70A