2CQHA

Solution structure of the rna binding domain of igf-ii mrna-binding protein 2
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
93
structure length
93
Chain Sequence
GSSGSSGMNKLYIGNLSPAVTADDLRQLFGDRKLPLAGQVLLKSGYAFVDYPDQNWAIRAIETLSGKVELHGKIMEVDYSVSKKLRSSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords IGF-II mRNA-binding protein 2 isoform a
publication title Solution structure of the RNA binding domain of IGF-II mRNA-binding protein 2
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 12
structure length 93
sequence length 93
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqhA00
3MOJB 4QU7A 1SJFA 2XNQA 3P5TL 1VQ9S 4A8XA 1S72S 2AYGA 3SDEA 2DNMA 1WF1A 2KU7A 3R27A 3VAIA 1M5PC 3P49B 2MMYA 2G0CA 2JX2A 1WG1A 2DGSA 2DGUA 4OZ0A 2MPUA 1WHXA 2CPFA 1YHQS 3SDEB 4ZKAA 1KD1T 1DRZA 2J76E 1RKJA 2CQGA 2KVIA 3PIPQ 3JB9k 1K8AT 2FY1A 1P1TA 2M52A 1X4BA 3BS9A 5EN1A 3R1LA 3MUMP 5CXTA 1YTYA 2D9OA 2CPYA 3MD1A 1OO0B 2MYFA 1M90T 2BOPA 2MKKA 2JVOA 1UW4A 2L08A 4LIRA 2LQ5A 1U1NA 1X5OA 1ZZFA 1M1KT 1WEXA 2CPHA 1WHVA 1SJ3P 3OW2R 2AYMA 2YH1A 1X5SA 5CA5A 2M70A 3VALA 2X1BA 2VONA 4QU6A 1N8RT 3CCRS 1K73T 1X5TA 4FXVA 4WFAQ 3LPYA 1A9NB 2M4MA 2J8AA 3UE2A 1W2BR 2RS2A 2CPEA 2G4BA 1X4HA 2F9JA 2MZTA 1VQPS 1YIJS 2LEBA 1DHMA 2KXNB 3J7YU 1FXLA 4P6QA 4Y00A 1U1MA 2DH8A 2LA6A 2E5JA 2MQMA 3IWNC 3S01A 1JJ4A 2VOPA 2MKCA 2DO4A 4WFBQ 3BO2A 3CCES 2KRRA 2MZJA 3THTA 2DNLA 2OIHA 2A3JA 1FO1A 2FC8A 2G1DA 1WEZA 3RW6A 5LSOA 3MI7X 2F9DA 2KHCA 5IQQA 1N52B 2CJKA 2KT5A 3P3DA 2CQ2A 4W90B 5D78A 3SXLA 2DNRA 2PE8A 3FEYB 4UY8T 5DDOC 4LMZA 4WFNQ 3UCZP 3CF5Q 1UP1A 1XN9A 1WF2A 4PRFA 4CH0S 1AUDA 3UWTA 4U67Q 4PR6A 2M0GB 3CCJS 1FHTA 2KXFA 2N3LA 2MKHA 2M7SA 2D9PA 2CPXA 2DISA 4QQBA 3CC4S 2YWKA 1X0FA 3CXCR 1S79A 4YOEA 1VQMS 1UFWA 2ZJRQ 2LCWA 3V4MA 4TU8A 3BO4A 5CYJA 2E5HA 2CQ0A 2MQLA 2L9WA 3CD6S 2Q79A 5BJRA 1CVJA 3CCUS 4LJMA 3CULA 2MSTA 3H2UB 2KG0A 2DNHA 1U6BA 1DZ5A 2CPJA 1WF0A 2DIVA 2MSSA 4C0OC 3CCMS 2QFJA 1X4CA 3MURP 1R8HA 5GAEU 2M8DB 2DGVA 1BY9A 1KQSR 4ED5A 3NMRA 3PIOQ 1DBDA 3G9CA 1U1RA 2DK2A 2ZJQQ 3MXHP 3NNAA 3I56S 2VODA 1PGZA 2MXYA 1WG5A 2HZCA 3CTRA 2LXIA 3G8SA 1VQLS 2K3KA 2DB1A 3CCVS 5ITHA 4TLQA 2RUGA 3IRWP 3VAFA 2I2YA 3ZZZA 3L3CA 1FJCA 2GO9A 2ZJPQ 2KM8B 3HHNB 1VBYA 2YH0A 2CQ1A 2DGXA 2M88A 2MJNA 1H2UX 4YUDA 2DH9A 1U1PA 1HA1A 3R1HA 1VC5A 1VBXA 3HI9A 1X5PA 3RW7A 4IUFA 3CCLS 1F9FA 2MGZB 4WKRA 1U2FA 2WBRA 1IQTA 2MY8A 3I55S 2K8GA 2V94A 2HVZA 3CCQS 3P6YC 3MD3A 4IOAQ 2DNKA 3Q2TC 2LEAA 2OSRA 2MZSA 3BO3A 1YJ9S 3VF0B 1VQ4S 4F02A 1QM9A 3LQVA 1VC0A 3CCSS 1M5OC 5DM6Q 2KRBA 2VOOA 5DDPC 2XNRA 5GMKa 2M8HA 5FJ4A 3CPWR 5DM7Q 3MUTP 4UQTA 3CUNA 4WIIA 1QVGR 1WI8A 2HGNA 5HL7Q 4CQ1A 2RRBA 1YITS 4EGLA 2RT3A 1OPIA 1G2EA 3S7RA 2LECA 4TU9A 1U1KA 5JVHQ 2RVJA 1U6FA 2AYBA 4C4WA 2NZ4A 2MJUA 2O3DA 1VBZA 1VQKS 2OTLS 1Q7YT 1JMTA 3VAJA 2DHGA 2QEXS 1FT8A 2XS5A 1SJRA 2MQQA 4ERDA 1URNA 1WI6A 3G71S 2KXHA 5HO4A 3TYTA 1NO8A 4WF9Q 1M5KC 2ERRA 3MDFA 1WEYA 2CPIA 2MZRA 2AD9A 4YB1P 1K9MT 4PKDB 2DNYA 2M2BA 2SXLA 4OZ1A 1H6KX 1H2VZ 3S6EA 5IM0B 1O0PA 1FJ7A 3UD3P 2X1AA 4WCEQ 1NU4A 2DNPA 1N88A 2CQ3A 3CC2S 2KYXA 2HGLA 3TO8A 2KFYA 3CC7S 3FEXB 1PO6A 5D77A 4J5OA 2E5GA 5LXYA 3UCGA 1ZH5A 2U1AA 2EVZA 3D2WA 4QPTA 1VQ7S 2DNOA 3UCUP 3ZZYA 2PEHA 2E5IA 1WELA 1X4EA 4CIOA 2DNZA 2CPDA 2RRAA 3BEGB 2RQCA 2N7CA 1HL6A 3THPA 2NLWA 4Y0FA 1WG4A 2RU3A 2DGTA 1QVFR 3U1MA 2I38A 2CQDA 1SJ4P 2EK1A 1N54B 4RU2A 2MGZA 1KC8T 3CMES 1SJQA 3EGNA 2XS7A 3NS6A 3G8TA 3N9UC 1JJ2R 3CMAS 3DXBA 5LJ3Y 1M5VC 1YJWS 2MZ1A 3J7ZT 5H1SV 3U1LA 1HD0A 2DHSA 1JJHA 2L41A 2RQ4A 2LKZA 1Q86T 2LYVA 1RK8A 2J0SD 2KN4A 2HYIB 3NNHA 2CQIA 2QA4S 3B4DA 1VQ5S 2MKSA 1OIAA 4FXWA 2AYEA 2JWNA 3G96A 4V19X 1H2TZ 2DITA 5GAGU 2XSFA 2DO0A 1R8PA 1VQOS 2D3OR 1X4FA 1VQ8S 4BS2A 2LMIA 2LXUA 4C7QA 3VAGA 2U2FA 2YTCA 2N3OA 3UD4P 1WTBA 2XB2D 1Q82T 1KOOA 1U1LA 4Z2XA 2DNGA 3G6ES 1HD1A 2MKIA 1P27B 2MQNA 2DIUA 1L3KA 4F25A 1U1QA 2X1GA 2MHNA 3EX7B 2CPZA 5LJ5Y 2KH9A 3VAMA 2KI2A 1X4DA 2FHOB 2FPHX 2RNEA 4M5DB 2DNQA 3EGZA 1YI2S 3Q2SC 2HGMA 2N82B 1YWXA 2CQPA 1ZZNA 1Q81T 5DDRC 1VQNS 1D9AA 5GAHU 2GHPA 1YJNS 2M9KA 1WHWA 1X4GA 1WWHA 4TU7A 5GVQA 2F3JA 2J0QD 4W92B 3NNCA 2OSQA 1FJEB 3H2VE 3MUVP 2LA4A 2DH7A 2FC9A 2YKAA 5IM0A 2CQ4A 2XS2A 2ADCA 2X1FA 1UAWA 2EK6A 4F26A 1FNXH 2CQBA 2E44A 4IOCQ 5DDQC 2ADBA 3SMZA 5LSLA 1WHYA 2OTJS 2RS8A 3US5A 2UP1A 2DNNA 1SXLA 2MQOA 1D8ZA 2JRSA 2MY7A 2MQPA 1U1OA 2MZQA 2DHAA 2DHXA 3DLLQ 4CH1A 1A7GE 2DGQA 2KG1A 4IO9Q 5MLCV 3NS5A 2OJ3A 3ULHA 2BZ2A 2B0GA 3VAKA 1OWXA 5JVGQ 5LXRA 5GADU 3TP2A 2CQCA 3S8SA 2CQHA 2JVRA 2KM8C 2MKJA 1VQ6S 2DGOA 5DETA 5IFMA 1B7FA 3VAHA 2MB0B 2DGWA 1KOHA 3G4SS 1VC6A 1NJIT 1X4AA 3K0JA 3B4MA
chains in the Genus database with same CATH superfamily
1IR1A 1HBMB 1IR0A 2OMLA 4DPYA 4FXDA 5CYMA 1SH2A 2V4JA 4NLGA 5HSPA 3C14B 3W9JA 2ZH3A 2V8VA 3HVAA 3IR6B 1N0UA 3D28A 1NDKA 3BS9A 1PJ6A 3F41A 4L3NA 4DWIA 4GVLA 4N7TA 2XSJB 1LNQA 3EYZA 1KR4A 2CPYA 3HO1A 3AFGA 2JVOA 1WC1A 1WEXA 4J9QA 2AYMA 3QIDA 5J2NA 2BRLA 3MCSA 1K73T 4KFBB 1VQYA 1FVSA 2H5JB 1X4HA 3PJWA 1PYTA 1VRUB 2FLLA 2DH8A 1RT5A 2E5JA 2HEKA 2DVIA 3SFUA 3IWNC 3QYYA 3VGTA 2MZJA 4DQPA 2JEGA 4USKA 3RW6A 3MI7X 1JLEA 1XIQA 2KT5A 4E2FB 2BQUA 3AXKA 1JLGB 4B3MJ 3L4BC 1F5BA 3ZZ0A 2YWWA 1TKXA 5CCLA 3PYFA 3CC4S 4B3SF 2LDIA 3IS9A 1QAYA 1JLQB 3GYGA 4QIWD 2G2YA 1CVJA 2HHPA 1HR0J 1FF2A 1DZ5A 3KJFB 4DPTA 1REVA 1RZMA 4S0MA 4U7UD 1OSCA 4C0BA 1U1RA 3GFZA 3LAKA 1Z1ZA 5HP1A 3W2WA 4E0DA 3QIPA 1VQLS 2PFFB 2XGPA 5ITHA 1T11A 3VAFA 3ISNC 1L3UA 2KM8B 3BPDA 3DRYA 2L9DA 4U96A 1MW7A 4OLOA 1GAOA 1RLDA 3A12A 4N5SA 3FK4A 3KNGA 3TQEA 1TVRA 2W9BB 3BO3A 3DRRB 1YVFA 1CJVA 1PYOB 1AT1B 5DDPC 2XNRA 4HT5A 2R8IA 3OTDA 1WI8A 4CZCA 4DZ6A 5THWA 2BW2A 4KHRA 2RT3A 2Y9HA 1R0AB 1TV6A 5CD4H 4RWXA 4JI8J 1IKXA 2AYBA 2HWHA 3EZUA 1XEZA 2OTLS 2M5YA 3I0RA 4DX5A 2QYGA 3J7AN 2OPSB 4ZCMA 1HNVB 2AQ4A 3MCMA 3OJUA 4B3RF 1YJTA 4ZHRA 4ILLA 2A18A 1WC5A 4DI6A 2JC0A 1N88A 4RNMA 2DRBA 3NGTA 2OPQA 4NLVA 3FEXB 4UUWA 3DNCA 4ZDNA 4WTOB 5KFYA 1YJVA 3ZTQA 1ACMB 4LF5F 4XTTA 1H72C 4FDFA 4PYAA 3RB4A 4RNOA 4LF6F 1S57A 4GC7A 2VKZG 2XCPA 2AX1A 1FRHA 2ALZA 5A8KB 3TEHB 3T1HJ 3SCLE 2FJDB 2B9XA 3OUYB 2VDHA 2C42A 2LYVA 2QC3A 3K5PA 4QR2A 4RUBA 3FCHA 3PFEA 3OPKA 1DAXA 2AYEA 1NKEA 1H2TZ 5CYMB 4KGXB 5D0EA 1Q82T 2FIUA 2DIUA 3NL0A 1U1QA 4DPUA 3PV8A 3BGRA 1ZA2B 3EX7B 5LJ5Y 2W8KA 2W7AA 4C97A 3CJKA 5FLXY 4QIVA 1FX2A 3MCNA 3PZPA 2BJEA 1IXKA 1Y11A 4LRDA 5J2NB 5C2CA 2IM2A 5A2QY 1S1WA 4M95A 2J6UA 2LA4A 5IM0A 1XERA 1RTHA 1JWWA 1T03A 5ETLA 4CO0A 2EK6A 4HH1A 4PG6A 1JLEB 3Q89A 3DLLQ 2MKYA 4JUZA 2OJ3A 3J7A1 1TKXB 3MM9A 3GSDA 4USHA 5JVGQ 3MHYA 3T5LA 1RAJA 2VUGA 3FUYA 2W25A 3DU5A 3K0JA 5GMEA 5F3ZA 4K8RA 3D6HB 5LMUF 2WVBA 4F4WA 4Q0BA 2ZE2A 1REVB 1FWPA 1RWMB 3BF4A 2KFZA 4P73A 2HVIA 1NB7A 1UVMA 5HP1B 8AT1B 1UWBA 1DJ0A 3PEHA 4CLFA 1RKJA 3QIPB 1MG7A 1OY9A 2R9LA 2F40A 1R8CA 5HQLA 1J5OA 1Y0HA 4OYAA 3IBCB 4ED0A 1BLUA 2LQ5A 1U1NA 3CCWA 4UOHA 3DOKA 5CA5A 4I6YA 5HROA 1VJQA 3C8YA 2J7UA 1TVRB 4ICLA 3PW7A 1G4CA 2F65A 1FXLA 3GB0A 4CM2A 3BZQA 2BW7A 1I3OB 1FWKA 1MMLA 2VBWA 3THTA 3LA0A 3GIMA 1FO1A 5IQQA 3RU0A 1NDPA 1WC3A 4IYQA 2BJ8A 2OFGX 1TV6B 1L3TA 1IKXB 2R7VA 3OXLA 2DISA 4ENOA 3HVTA 3DM2B 4M5NA 1VDHA 5B08A 1XR5A 1B0VA 3CO9A 3BO4A 1U0SA 4LJMA 3O6QA 2CJYB 4NZ7A 3U02A 5HLFA 2DIVA 2HS0A 2FLPA 5GAGI 1S0NA 2XMAA 1NJXA 2VG6A 1XMBA 5IC6B 3UDLA 1JNRB 3HFVA 3ZTPA 2YNGB 3D3BJ 3CB4A 4NCGB 1D3WA 2C1EB 2MJNA 4W4MA 2M88A 1H2UX 5BYRA 1HBOA 2JFKA 1T9YA 5ETKA 2NPIA 1B4SA 3Q23A 1RT3A 1AB8A 1WKLA 3W5YA 1HPZA 4ID8A 1LWFB 2Y3YA 4CLKA 4NXNJ 5ETVA 1SQEA 1XWLA 4IOAQ 1BQNA 3GLJA 3QLHB 1XMOF 3W66A 3T9ZA 4PYDA 1OY8A 2V2ZA 1YZ7A 1RAHB 3MEGA 5GMKa 1WKJA 3DRXA 2HGNA 3CSKA 4LR8A 2RRBA 3WBZA 2ZOMA 5KFKA 3C6TB 3MR5A 3KXDA 1Q5VA 5HJYA 5A6PA 3EGVA 4B3TF 4GKJF 3QGPA 2HVDA 4OI1A 1LK7A 1E6VA 1FTCA 4WXOA 1WEYA 3TR5A 5FLXU 2E1MC 1K9MT 4PKDB 4ZLLA 4B3OB 5IM0B 2GV1A 1RTHB 1I94F 1YBUA 2RDJA 1KDNA 1SL1A 3RRKA 4ZITA 5D77A 4J5OA 3N4WA 1KFSA 4UT4A 4O3PA 2EPIA 2DNOA 9ATCB 5AJ3J 2DR9A 4CIOA 3ZFVA 5AE3A 3Q8VA 1APSA 2L9NA 2B7CB 5AXNA 3ZC4A 3CJ8A 4EI2A 3PACA 3M9NB 1N54B 4QWAA 2ZKTA 3KG4A 3H5UA 2V69A 3WX8A 2AP6A 4HL9A 2ILZA 1OIAA 4DX6A 1RTDA 4Q0BB 2ZE2B 1PCAA 2G1HA 1NK6A 1VQ8S 4C7QA 4DV7F 1ULRA 1F3FA 2VKRA 3CJ2A 1KOOA 2XI3A 3DDKA 2DNGA 1UWBB 1FERA 2NXCA 1S12A 2BQ3A 4U95A 2X51A 2CPZA 3MEDA 2KI2A 1RQ0A 4C11B 2VDIA 2Q66A 4DN0A 1J5OB 4QW9A 1HNWF 1RTZA 2IC3A 3QRRA 1JXLA 1EHWA 5IXUA 5E3QA 4X4UA 3RAXA 2ZBRA 5F3TA 1RE1B 3EUNA 4FF4A 4OZJA 1U4BA 4ANEA 5HROB 2YKNB 2YKAA 4RUHA 2FC9A 3BSAA 1WKKA 2GMJA 3E01A 2ZHBA 2CJQA 4R0JA 3M8RA 1XNRF 2GS8A 5HJXA 4A8WA 2I8EA 3TAMB 3FRYA 3SMZA 3JYTB 5AE2A 3MR2A 3BN4A 3I4HX 4CH1A 5KG5A 2BXJA 4PG4A 2B0GA 1IKYA 2KYZA 2EG2A 5GADU 3HVTB 1ZA1B 3R5CA 2MB0B 1XR7A 1KN6A 1T0TV 1KOHA 4KO0A 4H54A 1NJIT 2WONA 1P6TA 2AGPA 5L39A 2V9KA 3MOJB 1NEEA 2HAFA 4C3LA 2B9WA 5HLFB 1N34J 4C3MA 3R27A 4OI3A 3ISND 2XZTB 4OZ0A 2VG6B 1HWKA 2ZFHA 3E3XA 3ILLA 4QOTA 2J76E 4U7UK 2HNDB 3OT9A 3UVJA 5EN1A 4DFKA 1FE0A 1JQGA 1OO0B 1M90T 4DR3F 2BOPA 2AV5A 3K2YA 2Q43A 1S7IA 2J8SA 1WC0A 4X62J 1RT3B 1HPZB 3EWGA 4DR4J 3V5RA 4OJ1A 4OI4A 1HMVB 3AT1B 2YNFA 1BQNB 3J7YU 2VG7B 2VIHA 1U1MA 1F3VA 3MMAA 3MEGB 2Z2ZA 1RWVB 1FEHA 1BQXA 2WW4A 2F9DA 4KE5A 5B0BA 4KTQA 1VK3A 3GIJA 1QLNA 1AUDA 3UWTA 2N3LA 3RR8A 4MT1A 1SUQB 4DL4A 4QYZK 4P2FA 1C0TB 4CLUA 2KB2A 3GFYA 4ZCLA 1UVJA 3PNIA 3WC0A 4EEYA 1U6BA 5EX3A 2QFJA 4FZVA 1FEEA 4KBIA 3PX4A 5CYQA 4JV5F 2HSEB 4MK8A 2E7VA 3C3LA 2WRMA 3QZ7A 4CI0B 2Z58B 1X60A 2VA3A 4EYHB 2E9TA 2FVSA 2B6AA 3QT5A 3CD5A 2CQ1A 3FJ2A 2BRKA 1HA1A 1UEVA 3H8YA 2DCLA 2X3GA 1PSDA 5I3UB 3KTQA 2A1BA 4CT8A 3AQPA 2DNKA 4C0HA 2UUBJ 1RTDB 2V2QA 4K7QA 4ZP9A 5ETQA 3GJQB 2BE2B 1ZOTA 4FKYA 3H25A 1KKHA 2M8HA 2P9EA 4XO0A 1RT4A 2R4FA 4DS4A 3E2EA 4J9PA 4OL8A 2PA8D 1U25A 3D67A 3IWLA 2QV6A 3D9BA 4C4WA 1JB0C 4ZS6A 3O1LA 1JMTA 2QEXS 1JKHA 4G1QA 4ELVA 2IC3B 3G71S 3BQ2A 1HFEL 4WP9A 3OQ2A 3GYNA 2R7OA 2SXLA 1S76D 1GMWA 4DMZA 4WCEQ 4P7VA 2CG8A 2P6SA 3KLEB 4ZVPB 9RUBA 2L3MA 1N32J 2UVVA 4ECXA 3UO0A 3BKFA 5J2MB 2AW0A 3HX9A 3C15A 3W9IA 1S9GA 3OTBA 3JXOA 1M5HA 3KLVA 1RABB 3A8JA 3VGUA 4USUA 1SBRA 3U1MA 2OHDA 3D6TB 2VFVA 4UOGA 1NK4A 1FCAA 3ELHA 4ZVGA 1NK7A 3KJQB 4OJ3A 1RT1B 2H48B 4KO0B 2WONB 4ZPAA 2VQEJ 4Q8EA 1U2RA 4CYUA 2YNHA 1NLKL 4NL5A 4RLEA 2D3OR 2HLUA 1WORA 2E1PA 3UDCA 5KFCA 2J6SA 2HZAA 3GYXB 2YWFA 2YQ3A 1Y3JA 3QJPA 4LF8F 3VAMA 1SKWA 4ZPVR 5D0HA 3EVWA 1TZ0A 2ACMA 1YWXA 1YSJA 1VMBA 4JI5F 5DGAA 1U26A 2UVWA 3GIKA 4IG0A 3MWBA 1REGX 3EE3A 1UZHA 4L3KA 4FYXB 1TKTA 3M8ZA 2B7BB 5KT7A 3SFGA 2E44A 3H5SA 5D15A 3MMAB 3HD2A 2UZAA 2OTJS 1GXUA 2RS8A 3US5A 3BPSP 2BKOA 3HKWA 4NEYA 4TQRA 4F36A 1RYRA 5MLCV 3CDEA 1RT6A 3NS5A 4NI2A 1QUPA 2OELA 3DYAA 4DL0C 2VPWB 5HQ8A 1RAEB 1VQ6S 1SC3B 2EFOA 4ZJQA 5L1KA 1HLWA 2O1PA 4QU7A 3KHGA 3DLJA 3DC2A 2CWXA 4F0MA 2BABA 5D3GB 3VAIA 2HS3A 3CJ5A 3DLKA 1WG1A 5CYQB 1TK5A 2J7WA 3PYEA 1LWEB 1YHQS 3N5FA 1DRZA 2IVFB 3W2VA 1P1LA 1QSYA 2D7SA 1P1TA 4YEAA 1KQFB 3L7UA 5CXTA 3LP0B 2AJQA 4TYBA 2MYFA 2XY7A 1UW4A 3MGJA 2D1CA 4OV1A 2PSZA 2KJVA 1X5TA 4L75A 1VQPS 3MMBA 1YIJS 3PO4A 1DQ9A 1P9YA 1OMSA 1ZS6A 2MQMA 2DO4A 3I5BA 2KRRA 3OTEA 1RT4B 1I1GA 5C42A 1FJGF 5DQIA 2V68A 3BH6B 2HMIA 2HNYB 3P5BP 4A8OA 4RW7A 4JI3J 2M0GB 3BDPA 4BDPA 2D9PA 4QQBA 2HLTA 1C1CA 1EQMA 4G1QB 1RHJB 3RGIA 2XTJP 2LCWA 4RL1A 1Q16B 3NOGA 5BJRA 4P2MA 4NLOA 2JEJA 1IJEB 3BM7A 2DNHA 1N5SA 1EX8A 4LBHA 4UOFA 1S99A 4DV6J 1GXLA 2DK2A 3I56S 4OX6A 2HZCA 2IM3A 3CTRA 4KKOA 1S9GB 1DLOB 2EFVA 2G0JA 2HQFA 4RNNA 1FJCA 3WIVA 1R89A 3TAPA 2IM0A 4NCBA 3OVAA 4DSKA 2ZBIA 4KH1B 2RDIA 4HDGA 1X5PA 4EU0A 4RNFA 2MY8A 3H42A 2V94A 3M9MB 3M2RB 3IM8A 4DV3J 1ZBTA 2H5IB 2ZH6A 2OSRA 4P10A 4ZJOA 1VQ4S 1NPKA 1JJCB 2AU0A 5KG1A 1TU0B 3KLHA 3I96A 3PR4A 3R2DJ 4F4YA 2W4CA 5HL7Q 3PKYA 4LREA 2COLA 4KHPF 1NZ8A 4P75A 3CEDA 3MF5A 3VGSA 2C2MB 2DRDA 2XS5A 4N56A 5GADI 2L48A 4IDKA 4RW4B 4F0KA 4RBVA 1GK8A 4IG0B 4DPOA 3MECA 1QSLA 2MZRA 4E8UA 2HURA 2DNYA 2HHXA 3KDOA 2QL9B 1H6KX 1FJ7A 3LO3A 2ZH1A 4IRDA 2XMJA 2ROEA 4ELTA 3R5GA 4PWUA 3HD1A 2ZBPA 2XMWA 2N7CA 1HL6A 1MU2A 1CJKB 3PY8A 4NI2B 2MQ8A 3DYAB 2QIFA 5AXKA 2V4RA 3PHTA 2G0IA 3M2UA 2FZKB 2P2CB 1EP4A 4OHWA 4JBCA 2BE9B 4CO5A 5KFJA 2LVWA 5A8RB 2LKZA 1Q86T 2BOAA 4F2RA 4TNOA 2HYIB 3EICA 3TRGA 4ECQA 2VQFF 2DITA 5F41A 3M32B 3R2CJ 3TAQA 5HATA 2VB6A 3W2VB 2CKWA 1WOPA 3N0VA 4JI6F 4WE1A 4F7VA 2GA7A 3QGHA 1QJHA 1DY3A 5DO2A 2Z4PA 2DNQA 4NXMF 3M8PB 2E1RA 1ZZNA 1EJ7L 5KOXA 2C2ZB 1TFWA 2GHPA 1X4GA 2DD8S 3T1YF 2BA9A 1SQGA 3TARA 1CC8A 1N5YB 2C3OA 3MUVP 1KVJA 4ECZA 3GCWP 2FGOA 4UF4A 4OIXA 4BWJA 2FGCA 3OSNA 1S6QA 3TUJC 1WOSA 3G87A 2UP1A 3R9LA 1AYEA 5C42B 1U1OA 2AF6A 1F9HA 5EHHA 2NZCA 3G86A 5LOQA 2KG1A 1LFWA 4LFCJ 2HMIB 4J9NA 3LP2A 3FEZA 1FDNA 3WHIA 3R5DA 2JVRA 4F0HA 1T02A 1H38A 3C16B 4DZDA 2V63A 1C1BB 4JYAF 1JNZB 4X4VA 1HI1A 3M1VA 1U47A 4I67A 3KG1A 4JI2J 4EZ9A 1BXNA 2DGUA 5J2QB 1KD1T 1X0PA 1HNIA 2GQ2A 1HNXJ 2F4VJ 4C8MA 4HTIA 3FBEA 1UTAA 4P72A 2W2NP 4DQRA 2YPZA 4QWDA 2HHQA 2CG4A 3FDSA 4QYRA 1FFWB 2J9CA 3L09A 2FHJA 2Y1LB 2VONA 2PO4A 4OI6A 5KOWA 5EWFA 4KHMA 4HYKA 4I64A 3TVYA 2DY9A 2ASDA 1NSPA 1SC6A 5EUHA 3SSSA 4RO0A 3SQGA 4O4GA 4L74A 2CNLB 4WK1A 2RKIA 4O0NA 1QE1A 2VBXA 3J80Y 4AXIA 3CXCR 2ABYA 4G3IA 5DZ6A 4WZMA 3MECB 5K8OA 1B0TA 5ETTA 1XJWB 5K5MA 4LVOP 3AJ2A 3HP6A 3FQLA 1HARA 1FK9A 2MSSA 1R8HA 5GAEU 1I6JA 4LRFA 2I6WA 3UN3A 4CO1A 2AIRB 1HYSA 2WZ1A 2R7XA 3I0SA 4PAAA 4DV1F 2WB4A 2XY5A 1TUGB 4UY85 2BANA 3ITHA 4YUDA 4ZVTB 1IM4A 1NH7A 8RUCA 4DJBA 4X64F 2JLGA 1EP4B 2YX4A 2Z56B 4DV2J 1RAFB 3KOAA 4LR9A 3QO9B 3R6GB 2MZSA 2F1FA 3POTA 4K0KF 2FVQA 4DSIA 3UR3C 4DEZA 3CCSS 3D54A 5U47A 4BHQA 2VV5A 1QY7A 2O67A 2A2CA 2B5JA 1KVKA 3R7BB 1VISA 1U6FA 2RD5C 3M9OB 2WVFA 1RADB 2GNKA 2OEMA 4OX7A 1R0CB 4XDCA 1URNA 1IM6A 1D1UA 1SKRA 5B0EA 1UETA 4DX7A 3MDFA 4JV0A 4I68A 1SB6A 4N8NA 3DOLA 2M2BA 2UUBF 3L95X 4OJHA 2Z2LA 3IO1A 3EPGA 2FLNA 1NU4A 2VH7A 4YN3B 4I6AA 2KYXA 3CO0P 3TO8A 1T05A 4WXWA 1S6QB 4P7TA 2BQRA 2ASLA 4OYZA 2WAQD 2NLWA 2RU3A 3RBDA 1QVFR 2XMKA 1ZPWX 3MM5A 3CJ3A 2JJ4D 3NS6A 4L76A 2C2KB 1HD0A 3R5JB 2R8GA 2BV3A 2YX7A 3M1VB 1DQ8A 2CQIA 4GVBB 1UFLA 4V19X 1IQZA 2LLZA 4O3SA 1UW9A 4GC6A 2XO6A 4K5SA 3SBMA 2XB2D 3MMJA 4CO4A 1IUJA 1HNIB 3KMQA 1Y9OA 2XWYA 4CLTA 3DLGB 4M1KA 4ZMMA 4EO6A 4B3SJ 3TUZC 3KK3A 1RAOA 2IVYA 2ZKUA 3MZIA 2QLXA 1Q81T 2EFPA 3QBCA 1FJEB 4P2XA 4TYAA 2ZOGA 5FD1A 3W60A 2QMXA 1MN9A 3BR8A 3GP9A 1K44A 3R6LB 1UAWA 3FSYA 1FNXH 4PWDB 4K4ZA 3SQGB 3DLEA 4O4GB 3R5BA 5G0RA 2J6TA 2DHAA 4K2JA 3V6DB 1S10A 1EZZB 3ULHA 2BZ2A 3VAKA 2NYIA 5ETSA 3MAHA 1T9VA 1LK5A 3A8KA 2UV8G 4B02A 1S9FA 1HQ2A 2RILA 2MLYA 1NPPA 1FK9B 4ANCA 4QWEA 3P49B 1B0PA 2G0CA 4PG7A 4GO7X 1HYSB 3SDEB 4WKYA 1FTRA 2RQKA 1VIOA 4X84A 2DKOB 3IM9A 1RYSA 2D9OA 4HTJA 3ITHB 4CTAA 5G4DA 2VFTA 2XYGB 4TLRA 1NJYA 5C25A 4B3RJ 4I7FA 3PX0A 1ZZFA 4WU2A 4QIGA 2P9CA 2BJ3A 2X1BA 4ZVQB 1N8RT 3UDEA 4YR2A 2ZH5A 1CJUB 4QJVA 2G4BA 2P9GA 2EFGA 2MLZA 5CZVA 2J0WA 4Y00A 3GIRA 5J1EA 1JJ4A 4OYIA 2MKCA 4LF5J 2E9ZA 4MYTA 2XLIA 2A3JA 4P52A 1YG0A 3K59A 4LF6J 4W90B 2DNRA 5CD4A 5DS7A 2V34A 1LXNA 4NYOA 1LW0A 4OZ2A 1AZSA 3HLUA 1UP1A 2B5JB 3QNWB 3RTVA 4U67Q 1FHTA 2IM1A 1RT7B 3RRHA 1TFYA 1Y5NB 3R3TA 5CYJA 2GVZA 1HWUA 2QSWA 2B9EA 1H73A 1V3ZA 1RBOB 2OEJA 2NXUA 3CCMS 4AD6A 3DDIA 2E29A 2V2KA 1NB2A 1T05B 5CH7B 3LOUA 3TX0A 1S1UA 1WG5A 1J5EF 4FKXA 4ZLNA 4C8OA 2IAJA 3IAM9 1WDTA 3ONQA 1VBYA 1RA6A 1PBAA 5B0DA 1S4FA 3H98A 5EWEA 1VBXA 4KSEB 5F8IA 1S48A 4C2MA 1F9FA 3P6YC 2ZNZA 2FUG9 1YJRA 3BJYA 4PUOA 1HBNB 2C28A 3VF0B 4FBTA 4C8YA 2IJNA 5DM6Q 1SH3A 6FD1A 2ZH2A 1IBLF 4OZ5A 2VICA 2KKHA 3TW0A 4B9TA 2H4YB 2CA9A 2QT7A 1O6XA 5J2PB 3S7RA 1U1KA 3K17A 3ZZOA 3KK3B 2IFXA 4AXJA 2DHGA 3GCXP 3HSDA 1V3RA 2MQQA 3GONA 4J7CA 3P45B 5LMUJ 3HJVA 1Q8KA 4FP9A 1O0PA 5DG9A 2YNIB 4LQ3A 4HACB 3BQ1A 2DXDA 2FZCB 1DFDA 4DUZF 2Z2MA 4X65F 2RRAA 4USVA 2YWEA 1N6QA 2HFUA 1LW2B 3ETOA 3IRXA 2ZHOA 3ZNUA 3NCPA 2JSXA 1VRQC 5I42A 4WFYA 3SEOA 1HNZF 3MM7A 4K4UA 3L7PA 4N41A 3OVBA 2I5JB 2RH3A 4DV4J 2XSFA 1V5IB 2QA2A 2EC0A 4OYOA 1YBTA 4F3MA 3M2VB 3F44A 3T5HA 4FF2A 4ED1A 2NPFA 3JSMA 2K06A 1SIZA 4WWSA 1YJUA 5DRKA 1M1HA 3EGZA 4CTAB 4CM0A 1C0UB 4ELUA 5C25B 4I7FB 3QAUA 4H4OA 5JXSA 1C2PA 1M1GA 1QDUB 1ZTWA 1IWAA 4F26A 4DSJA 3CGIA 4ECSA 3QJJA 4KC5A 2Q6BA 2QYCA 1GX5A 4I4BA 3TQ1A 4ZP8A 4KPCA 4ZN1A 4XPCA 5B09A 5BYSA 2OUGA 5DJBA 4MKBA 3HFKA 3K5MA 4A4JA 4ED4A 2A6MA 3LALA 2E5LF 1B7FA 1UA1A 3G4SS 1XMOJ 2GVZB 4O3RA 3BYPA 1WD6A 3MAQA 4C9DA 1UVNA 4OZNA 3P5TL 1KWMA 3NMAA 1LFPA 2FJBB 1S1TB 3WX4A 4X4SA 1F5AA 1S1UB 3MTJA 4LF1A 5AXLA 2CQGA 2BYCA 2DEJA 1U48A 2QO3A 4HEA9 4B3TJ 4GKJJ 3V4IB 2IAJB 3D1OA 4FPRA 2PC6A 1EKSA 3D4JA 2F8MA 3GR0A 5B0GA 3FGVA 1I94J 3M30B 2ZWPA 4PUOB 2LEBA 1IKWA 2GZOA 4P6QA 1Z2ZA 4ATNA 2LFVA 2BR0A 1D09B 1Q1KA 1Q79A 1WSRA 2MEWA 1GQEA 1F60B 2DNLA 3SSQA 3NRBA 1X7VA 2FD2A 3P3DA 3SXLA 3N6NA 1KS2A 2VG5A 2PE8A 1VRTA 3IR5B 1F2GA 4AE5A 1XN9A 1GXTA 1EETA 1E6YB 4A8KA 5C24B 2J7KA 1FFGB 3D0HE 2PD1A 5B0CA 3MAAA 3CDWA 3CCUS 2XHWA 1NSAA 1FKPA 2K7JA 4ECRA 1S9EA 4CDIA 4OZLA 3WQPA 2ZJQQ 3NNAA 2DY1A 2B43A 4B08A 3HXMA 3O2IA 5C2GA 2CVEA 4BWMA 1HNWJ 3IRWP 2JH3A 3T6JA 3AOAA 1N6QB 4XAKA 3HHNB 2G13A 1UPPA 5M2PA 3AH6A 1U02A 4IH5A 2V8HA 4I0WA 3LW5C 1YDLA 5I42B 4NA2A 3AJ1A 2W9BA 1AW0A 3MM7B 4MH8A 4YB5A 3DRRA 4IH7A 4JI4F 3Q22A 1XNRJ 5IQ6A 3JSYA 2IMWP 3BH7B 2UUAF 2LXFA 4MKAA 1RWOB 3CE8A 1RDRA 5F8HA 1QVGR 4UQTA 2OEKA 3I32A 4K4WA 3JTPA 3JAMY 1T9UA 1YITS 1CPZA 3B78A 3DGVA 3H59A 4TU9A 1HNVA 2GIQA 2OMOA 4ERDA 1KFDA 1WI6A 1VHIA 4UZCA 4WBFA 4DQSA 4CLWA 2CPIA 3WIUA 2QLBB 1N56A 4OZ1A 1QSSA 5B0AA 3UD3P 4LSNA 3K5LA 2HAIA 3I5CA 3DLHA 3KJNB 3M6UA 2HGLA 2MLXA 1SPBP 4DV0F 1IBMF 2R42A 2IA0A 4RWWA 2JOQA 1MROA 1HQUA 5LSRA 4QPTA 2FJAB 1BQMA 2PEHA 3FZBA 5AXMA 4G1PA 1XMQF 1WELA 2CPDA 3HMJG 2EBGA 4DR3J 2GC8A 5BR8J 2DGTA 3ZTSA 2FHMA 3GR1A 3H4BA 4LQ9A 3OUYA 2AT1B 2F7VA 2HK3A 4NLRA 1VFJA 4Z37A 3CMES 2P8IA 3D3CJ 1O8BA 2RQ4A 1G3OA 1D9DA 1R27B 1HWIA 3NNHA 3B4DA 1SKSA 3BREA 1S7HA 2LMIA 1PJ7A 1YZ6A 1PJ5A 1QTMA 3OL7A 5JMNA 2E1CA 1RU2A 1YK9A 1IBKF 5DGBA 3NEKA 1JLFA 3RB6A 1NHUA 2V2VA 4CT9A 3Q2SC 5CQGA 2AKWB 1Y4ZB 4J9MA 4PQAA 3ICLA 1LQ9A 3IBWA 4Y28C 2N4DA 5HBMB 3CVKA 2J9EA 3DFEA 4JV5J 1IKWB 4M5LA 2B4UA 2BE7D 5F8MA 2CQBA 2K1RB 1U09A 5K8MA 4ZVUB 1Q95G 2R8JA 3M05A 2DNNA 2PMZD 2W8LA 3QFWA 1L3VA 1MN7A 1NM2A 3EMTA 2VG5B 1VRTB 2DJWA 3NWRA 1EETB 3AQOA 2ZH7A 4JV1A 3S8SA 1URRA 1BE4A 3VAHA 1CJTB 2IPOB 1TL1B 4GMKA 3MAAB 4DS5A 2KFNA 5IT9U 1FKPB 2V8PA 3QGGA 1GMVA 3ZTOA 4QYZJ 1TK0A 1S9EB 1BMQB 2DNMA 2NUUG 3HVWA 2JNJA 2YQ0A 1M5PC 2JX2A 3CW2C 2J9DE 4M5GA 1RACB 4MIWA 4PABA 4YY3F 1FKOA 3T1AA 1TR0A 5KFIA 4HR2A 2DBBA 4Q8FA 1UJ5A 4DR2F 1EKRA 2M52A 1YBAA 3MFIA 4ILMA 3AA8A 4PQUA 3Q83A 2IVMA 5E7OB 4IFVB 3UNGC 3TZXA 3D5MA 3W8PA 4ZA1A 1CC7A 5F8LA 3OW2R 4QU6A 4NLYA 3RYLA 4FXVA 3FSXA 3UE2A 4J90A 2JZ5A 2B8PA 4ZPCA 1S6PB 3NWGA 3KLGA 2VOPA 3RRGA 1WEZA 4ES1A 2ZZTA 3AD9C 3CCZA 3DM2A 4WFNQ 1SQFA 4KYZA 2P6TA 1HHSA 3KK1A 2HFOA 2W4PA 4K4XA 3JAMU 1K0VA 4DR5F 1VQMS 4X66F 2E5HA 4KJIA 4MK9A 1TL3A 2C2DA 1KP6A 3H2UB 4EUVA 2X7IA 1SJ1A 2CPJA 3H20A 5IT4A 2AJ2A 4LSNB 1X4CA 2XLKA 3I82A 1KQSR 2YNGA 3ZTRA 4LF8J 3IWXA 1ELOA 4NCGA 1F9EB 4CO3A 1J2VA 1MROB 1HQUB 1X9SA 1B70B 1BQMB 2V67A 2OI2A 1N36F 2QL5B 1N5TA 2RUGA 4DV5F 4JI5J 4BLGA 4ETZA 1LWFA 2BKNA 3PXGa 2H65B 2ZZNA 5L1JA 5CZXA 3QLHA 4R8UA 3I55S 2HVZA 1KSPA 3W62A 2QSFA 2YXLA 2IJRA 2UXCJ 2ZVIA 2XYPB 1CS4B 4C8LA 2UV8A 3V2UC 3C6TA 3J81Y 2UXBJ 3NKYA 4WZQA 1B64A 1X9WA 4RR5A 1I51B 1JLFB 5JVHQ 1JLCA 1N0VC 2JEIA 2KL8A 3V6KA 4B3OA 3W9HA 1RHQB 3TYTA 2MHEA 4DSEA 1S49A 3SCKE 1JXEA 2ASJA 1D8YA 1NSKL 3ILOA 3PR5B 5BXIA 4HI1A 4QR1A 1AA1B 2J5AA 1QD1A 3G6XA 3UCUP 1K1SA 2CNOB 4YDDB 2C3PA 3THPA 2MTLA 1SKUB 4J37A 4DL2A 2GAGC 3B8HA 4ZVOB 1UEKA 4M5HA 1VHFA 4EBEA 2Q1LA 3G8TA 3N9UC 1M5VC 1JJHA 2J0SD 5ETOA 2ALYB 3NGSA 3A13A 1WSVA 2JWNA 4FYYB 1BHNA 3HZEA 4IRCA 3R7SB 1FJGJ 4M5MA 4NRTA 2U2FA 5D0RA 1TELA 1SL0A 4C11A 1FKOB 4OZ3A 4ZVEA 4ALZA 4I56A 1RT2B 4X4RA 4PQUB 1XTZA 1OQ6A 4M5DB 1K0TA 5CABA 3FRZA 2ROPA 5T7LB 3W65A 1VQNS 1Y7PA 2YKNA 1S1VB 2M9KA 3RZAA 5GVQA 3VCDA 4W92B 3H2VE 1BC6A 1UMJA 1O5JA 4FNHA 3TAMA 4NLXA 2CQ4A 1XQIA 3LANA 4DV4F 1HBUB 3JYTA 1UPMB 3KLGB 1RGVA 1WHYA 3AAWB 5FIIA 2UUCF 2NR0A 2C3MA 4WIQA 2MZQA 2AHOB 3GFHA 5KFHA 4Y34A 1KONA 3HHLD 4O4RA 4I2QA 3KK2A 3SYZA 3OXGA 3PM9A 3H5XA 2YKMA 1EQ0A 3KK1B 2CQHA 1KLNA 2DGWA 4I69A 4DSFA 3B4MA 1TL3B 4JV2A 2EFQA 4X4PA 4F04B 3IG1B 4DL6A 1TAUA 2KU7A 4DFPA 4NMXA 2HNDA 5KFFA 4KHPJ 2HVHA 4MTPA 2O66A 2IJFA 2JEFA 3QSIA 4Y2AA 3TA2A 2KVIA 3JB9k 2BJ9A 4NLSA 3I9ZA 1RWKB 2DHHA 4NEZA 4NA1A 2OD6A 4DDFA 5K8PA 4Y2KA 4MKVA 2GVDA 4ZPWR 4EBCA 2L08A 1HMVA 4H4KC 4DF4A 1BD6A 4R8UB 4CLLA 1ZAXA 2VG7A 4M63A 1H0HB 3MPWA 1SL2A 4AL5A 4CLSA 4LUBA 4DOZA 3DMJB 4U8YA 4K4YA 4EFAC 2AWZA 1XC9A 1N52B 2PEBA 2CQ2A 2K7KA 3N28A 1SUQA 2KJWA 1C0TA 4CH0S 2WVCA 1AFJA 1JLCB 1PYSB 1YLXA 1Y00A 4KAIA 4IG3B 4ETXA 1SI9A 1GTEA 2ZJRQ 2BX6A 2E7WA 2FVPA 1UEUA 3KLFA 3M8QA 4WYLA 2VQFJ 3L9ZA 4QIFA 3CMQA 1T3OA 2XLJA 5A2QU 4D3HA 2FYXA 1FA0A 2W9CA 2EKYA 1DBDA 3AB4B 2VODA 4JI6J 4ZPBA 1O51A 2RAQA 3OV7A 1UJ6A 5DLGA 3CCVS 2F5GA 4NXMJ 3ZZZA 3N6LA 4QWBA 1NKBA 2RQMA 4IFYA 5I3UA 2DH9A 1N5VA 3T1YJ 4IR9A 4F4ZA 1P8GA 3ZZRA 4Q44A 2BE2A 1U45A 1GT8A 3UI3A 2DYAA 3DGPA 2QGFB 3JTOA 3UNYA 4AT1B 3PW5A 4JP8A 2I0XA 3OHBA 1PKUA 2V50A 3OLBA 1F6TA 2ZH4A 5KG2A 1TK8A 2CYYA 1C4CA 1BGXT 1FXDA 3G6YA 1SJRA 4M94A 4JYAJ 3J81j 5HO4A 3JQKA 3VHQA 1NSQA 4M5KA 3G6VA 3IN5A 3KLEA 2ZUGA 1H2VZ 5L46A 4Q43A 5J2MA 5KFVA 2Z30B 2RHSB 4B9SA 2KFYA 3CC7S 4H4MA 3T9NA 1PO6A 1FWLA 3V81B 5LXYA 1SC1B 2V6AA 3D2WA 5D4PA 2NUHA 4YQWA 1QAIA 2OPRB 2DXEA 5ETMA 1RT1A 4I2QB 3KK2B 2Z57B 1FRMA 2YKMB 4DFMA 1F1BB 2FVCA 3IFEA 1KC8T 1YQHA 1W2IA 1VGYA 1CBKA 4DUYF 1JJ2R 3J7ZT 3U1LA 2DR5A 4PWWA 5L1IA 3G2XA 1MMDA 2EI5A 4KGVB 2LXUA 3AODA 3MM8A 1H74A 1X31C 1U1LA 3HSZA 2ZH8A 2OP5A 2QX0A 1P27B 2MQNA 1K47A 1L3KA 2QL7B 5BR8F 2HFVA 2V9WA 2R7RA 3CJTA 4DLGA 2AGOA 4Q7AA 4ED8A 2FPHX 4DCJB 2RNEA 2GVDB 4FVMA 4M8LA 4RUAA 5KFZA 2UU9F 3OFFA 4TU7A 2YVSA 1LEOA 2N7YA 1W25A 3H2LA 3LF0A 1R3NA 3GG0A 1MMNA 1TKZB 3QGIA 3EZOA 3VVTA 1MSWD 4QCLA 3D68A 4DV1J 3MTKA 2QFIA 3CJQA 5E3CA 4NASA 3K5NA 3QT6A 3UR0A 1IBCB 1XK8A 2UVRA 5KFLA 3FNNA 5LXRA 4X64J 4X2BA 5CAAA 5KFQA 5F9NA 5K9FA 3D6FB 1U8WA 3ENQA 2B51A 3KLFB 5D3GA 3M8QB 2H4WB 4WP3A 1ITPA 3GFXA 1SJFA 3A4TA 4K0KJ 4ECWA 1LKZA 1VQ9S 1KNZA 4A8XA 1LWEA 2WHOA 2CIMA 4NX9A 4LFBF 4AL6A 1RAAB 1FE4A 3AOCA 4K4VA 2W9CB 4OX9F 3O3LA 1JLBA 3LP0A 3QMQA 4EK2A 1Z4UA 4MJKA 4F8RA 2IYIA 4WTYA 3MUMP 3Q8UA 4IFYB 3C6UB 4Y65A 2H1YA 2WCXA 2PT0A 5L38A 1VCTA 1WHVA 4KY3A 5SZTA 2YKPA 3DRSA 1TL4A 3DKDA 1DHMA 2VPXB 3J7Z5 4O0IA 4HVZA 3DGPB 3KUGA 4WFBQ 1NK0A 1RHMB 3VZHA 2HHHF 2HNYA 2CJKA 1CG2A 1RP5A 3A8IA 3MPDA 5KFBA 2BEFA 2CZ9A 5H9FK 4OYXA 3KNAA 4ZLJA 2LQ9A 2PDAA 2MKHA 2CRLA 4OYPA 3CD0A 2AZ3A 2BJ7A 3O5TB 3IR7B 1UFWA 5KAKA 1G7CB 2Q79A 4HH0A 4CO2A 4HT7A 3WZ0A 3GILA 1X8DA 4C0OC 5AE1A 3MURP 1BY9A 2XQCA 3NMRA 1DLOA 4H4MB 3G9CA 2XI2A 3MXHP 4C98A 4A8YA 3QPIA 4ZVSB 5KG7A 2PI4A 3HDSA 1RUSA 2HBRB 1TAQA 4PPDA 3TZZA 3RBEA 1TQLA 3TANA 3G82B 2DGXA 3M2RA 3R1HA 1A6LA 4WKRA 2B56A 2V8DA 2WBRA 2DTJA 5I4MA 3FQKA 3VWSA 2R2RA 1CEZA 5A6WA 2OKQA 4O44B 2OGUA 2GQQA 4CP5A 5D4NA 3IAS9 1RB0A 3ILIA 4LF9F 2VOOA 2VPYB 3MM8B 2XMTA 2IA6A 2CUYA 4EGLA 2XGQA 4LSLA 2LECA 4RW4A 2OPPA 4RW9B 3IMQJ 2RF2B 3GMGA 1A0OB 2XMVA 3FKBA 4CLZA 5K8NA 4IR1A 3ENAA 1MWZA 1Y5LB 1G6BA 2UXCF 3HPOA 1NDCA 2A0FB 2DNPA 4OHYA 1ZM9A 2CQ3A 3CC2S 2RU9A 2HQIA 2UXBF 1RHUB 5LMNF 2ATLA 2FVRA 3O44A 1CJKA 2OFHX 3AOBA 4XPEA 5KFRA 2VZ9A 1VI7A 3ZZYA 3D0GE 4YR0A 3BEGB 4E98A 1OQ3A 3Q8YA 3BN7A 5HN0A 4LFAF 1LWCB 1VIXA 3PW2A 5A8RA 2EK1A 2KDOA 2MDAA 4CCHA 1SJQA 2BUNA 3NS7B 2AJFE 3GV7B 3M32A 5KFTA 2HPUA 4DU7A 4NLQA 4ID5B 1N5QA 4ZVFA 3CIMA 3H40A 3SZ2A 2DO0A 2KVQE 2R7UA 1AUSL 4USJC 2IDEA 2YTCA 3JQMA 1JLBB 3M8PA 4DR1F 3QT8A 1L5UA 4OYBA 4FYWB 1JLAB 1CQNA 1NDLA 4H4KA 1GEHA 2VASA 2ZC4A 1PAUB 4ED3A 1N5YA 1TKDA 1WWHA 2W9AA 4B9MA 7AT1B 1TTHB 8ATCB 2R2UA 4EZ6A 4GO5X 3DRSB 2ZDOA 3HF5A 2XS2A 2K2PA 2ADCA 2X1FA 3ET6B 3EDQB 5IZHA 2NXJA 2IDLA 1J5EJ 4USIA 1BUXA 3PKMA 4AFFA 5B0FA 2HWIA 1HW9A 4LSZB 4U6PA 4IQMA 2W2OP 5E3AA 1SH0A 4HHJA 4X4QA 3C16A 2RDDA 4OLPA 3KLIB 1C1BA 1U7LA 2P5VA 3GJRB 3GJTB 4J91A 4Y2IA 4OQJA 2V8GA 4WFXA 4QIEA 1HW8A 3MFHA 3K89A 3TEGA 4QR0A 3D0IE 1S72S 5J2QA 1XNQF 4DG1B 1IBLJ 1KLMB 2CVIA 2VD3A 2F8HA 1RHKB 3SIPB 4NRUA 4G1IA 4EO8A 4FS1A 1DQAA 2KZZA 1EAYC 4OX8A 3A8EA 5BYQA 2V4JB 5D4LA 5E33A 1N33F 1YTYA 5C5JA 3MD1A 3JSBA 5A8WA 4DF8A 4IRKA 2D3O1 4CRJA 3AB2B 5E3PA 4USWA 4LIRA 4Y2CA 1ZPVA 3LTOA 4TQSA 5L1LA 2CPHA 5I3PA 2R2TA 2M70A 2GMLA 1YRTA 3LUYA 3LPYA 3T41A 2MZTA 2Z8QA 3B82A 3AD7C 3QWUA 4DUZJ 4LF4F 4C6AA 2N4CA 3X1LB 3VR1A 4X65J 4Q2LA 5HI7A 1RT5B 3TA0A 5L9XA 3AA9A 3MMCA 4W98A 1ZTTA 4MMOA 3H5YA 4LSLB 2R7SA 1WF2A 4PRFA 4HHHA 2OPPB 1R7IA 2IBKA 4PR6A 2QLWA 1HNZJ 1RI7A 3RJMB 1X0FA 4N47A 5E0OA 5KT2A 2DR7A 2GCFA 3IS9B 1FD8A 4ZPDA 2NYHA 3DHWC 3H0PA 2DGVA 4ED5A 3FBCA 2XCAA 1NPRA 4CLPA 2Y8WA 1PGZA 5HVHA 2AMCB 1HWJA 2LXIA 4OHXA 4R0EA 3BDEA 3MR6A 2LEPA 4LRAA 4URGA 3PX6A 2QN6B 2E1AA 2I2YA 3L3CA 1VOMA 3W2WB 4WFZA 3C66A 4NWBA 2VFRA 2H54B 2BMBA 2HBZB 1VC5A 3MPVA 3TWZA 3RW7A 2XY6A 4AQYF 1VK8A 4P74A 1IQTA 5H9EK 3JQJA 3QO9A 4UTGA 4ECUA 3CCQS 4P9SA 1H7WA 2DRAA 3QSYB 3UPFA 2POKA 4DL3A 3CDAA 3PVXA 2FJVA 5F0UA 4KRWA 4FBUA 3BKTA 5CHCB 2D41A 1VC0A 2PI5A 2CJAA 1M5OC 3D6MB 4JI1J 4DR6F 5FJ4A 3PW0A 3T5KA 3CUNA 1SVDA 1R43A 1N4LA 4OYMA 1CJVB 1Q8LA 4ZPTR 3ZZTA 3TI0A 2E9RX 2E5LJ 1Q7YT 1FT8A 4V19J 2HQGA 4K2XA 2DR8A 1WOOA 3MR7A 1M5KC 3AJDA 2QJ3A 3GTYX 4LF7F 2PMWA 1F0XA 4TY8A 4QW8A 3I0RB 2AZ1A 5EDWA 3TJ8A 2F8EX 3BGOP 1NHKL 2EWHA 2F63A 3UW1A 4ZHRB 2CZ4A 2E5GA 5KFEA 3FFIA 3UCGA 1VQ7S 2OPQB 2E5IA 2DNZA 3M6XA 1C4AA 1RA7A 4ED6A 5JJBA 1UJ4A 4Z7YA 1SJ4P 1S97A 2BKPA 4RU2A 2MGZA 2HHUA 4GVBA 2APOA 2EW9A 2CJXB 4U8VA 3A3NB 4J9OA 2FJXA 1W26A 1VQ5S 5F8JA 3HT0A 5GAHI 3G96A 4DL7A 1VBKA 4YP3A 2VBYA 2ZM6F 3QWPA 4LVNP 5HMYA 3DLGA 1PBUA 3BSOA 2QA1A 3DXSX 2YWGA 1Q5YA 4F25A 2X1GA 2MHNA 3DU6A 3HHDA 4ZVHA 2VC0A 2FHOB 4JI0F 2KTQA 3M8YA 3ZO7A 1YI2S 5A8WB 2N82B 3BGRB 5J1PA 2DPJA 4P2SA 2HHVA 1WJ9A 1JXVA 3CJKB 1TMMA 3I4PA 3NNCA 2J9DA 3W5ZA 4PWDA 3N79A 2H5EA 2AEMA 2HHTA 2VU5A 3DLBA 4GKKF 2BM0A 1R6YA 3WDOA 1S1WB 2UXDF 3V6DA 5DDQC 1UCNA 4PXDA 1T03B 4HKQA 1ICEB 3DI6A 5I3QA 1QTNB 3MMCB 4NLPA 4DSLA 3TP2A 2Y1JA 2D74B 2GX8A 3EVOA 3S1TA 2J0XA 2MKJA 4BBYA 1Q7LB 1NK8A 2HHWA 3MM9B 4JI4J 1OS5A 3OTCA 2WSEC 1NJZA 3OR2A 1M5SA 3SV4A 2UUAJ 5D8HB 4ZCKA 3EGWB 4O23A 3SDEA 4UOCA 3D7SB 3MPYA 1RAGB 2DXFA 5E3RA 3PEJA 2ZUAA 3W8GA 1XR6A 4KGKA 1X4BA 4NLWA 1VR6A 4K5RA 5DQGA 1Q0NA 4Y2MA 5IWAF 2BM1A 2MKKA 3PRDA 4DR7F 1X5OA 3RUBL 3HCXA 1CJUA 3TZWA 4XDDA 2LU1A 2YH1A 3AD8C 4JOUA 1WTFA 2HKEA 1S0MA 3K58A 1U6ZA 3OVSA 2RS2A 2F9JA 3FCVA 3OTOF 1RTJA 2KXNB 5DG8A 3DOKB 2IRUA 4C8KA 4DV0J 1IBMJ 2DT9A 2O01C 3BO2A 3CCES 1XMQJ 4F2SA 4ICLB 5LSOA 1NBEB 3EJMA 1RT7A 3R97A 3RG6A 2IIHA 3ETMA 3CF5Q 1OY6A 4DFJA 3W5XA 4RW6A 2NREA 4PG5A 5T14A 2NXNA 3EZ5A 4TU8A 4KGZB 4TY8B 3CULA 3JTNA 1WF0A 4NA3A 4J9VA 3GSIA 1EARA 3K57A 5ETRA 2WSFC 2B9YA 3M4XA 3FBBA 1V5VA 4MAKA 1UWAA 1R6VA 3FFIB 1IBKJ 4JI7F 4KT0C 3P8BB 4B9NA 5M2RA 1PG5B 3NBPA 5DG7A 2H9ZA 2W7OA 2YH0A 1U1PA 1U49A 3M7VA 4B9VA 3HI9A 5HMWA 3PTWA 1W7WA 4IUFA 2MGZB 3RAQA 4YHHF 2XG8A 2A10A 1HBNA 5KG4A 3TOQA 5LL6d 3PFOA 3W63A 1KBRA 1HBOB 2XBPA 5AT1B 3MD3A 2FY8A 5M2UA 4J9KA 5KFOA 4ZP6A 1KHVA 2XZDB 1QM9A 1N48A 5DM7Q 5J2PA 3KJVA 4KGMA 2FZGB 1NH8A 3D1QA 3BV8A 4OMFG 3E51A 2HWTA 4KB7A 3UDVA 1VBZA 3GWCA 4ANDA 1WC6A 2B4VA 3HZGA 3DCAA 2W4DA 2YPYA 3AY0A 2RRNA 2YNIA 1NCLA 5KG6A 5DZ7A 1PC5A 3SCIE 2GGPA 2Q3PA 2Y1RI 4HACA 3OFGA 4LBIA 1H3DA 1XBWA 1E6VB 5J1NA 2QLJB 4YY3J 1FD2A 2UUTA 3U27A 4DR2J 2K3IA 4K59A 2U1AA 3EDRB 4CWBA 4WYWA 1LW2A 3DI6B 2QTWA 3PJ9A 4ECVA 1GNKA 4KPYA 3TUPA 2JC1A 4B3MF 4RW8A 5K14A 5KT6A 1GFWB 1BWEA 3BSCA 3J80U 2XS7A 2I5JA 3CMAS 2CDQA 2MZ1A 3OR2B 2L41A 1R8AA 2GIFA 2MKSA 5DLFA 1HR0F 3M2VA 2H51B 2HVEA 6AT1B 3QRPA 1FRLA 2IYGA 4WPAA 1FVQA 5KFXA 3UD4P 2EG1A 4PG8A 2CXEA 1C0UA 4CNZA 1T9XA 4TVAB 4TY9A 1PILA 3QRQA 4DR5J 1MWYA 1FDDA 4X66J 3MEDB 4Y3CA 1D9AA 1NK5A 2AJ0A 2ZITA 3X3UA 4HHUA 1RKIA 3R7NB 2XEXA 4PEOA 4EBDA 3Q8RB 3QQCD 4A8SA 2ZBQA 4F4KA 2IRXA 1RTJB 1GMWD 5HK4A 2JLEA 5ETPA 2BJDA 3QAEA 1HI8A 2ADBA 3E01B 1N36J 2NQPA 2ZEJA 4DV5J 2JRSA 2MY7A 2HRTA 3EM1A 2HZVA 1A7GE 2ILYA 3TX8A 3BGFA 4RW6B 4JI8F 2XHCA 1IKYB 4IOBA 2JDJA 3TA1A 3SQOP 4UQGA 1UKUA 3BYRA 3I5AA 4ZIVA 1VC6A 2Q6CA 3H4DA 1S1TA 2CAJA 1V3SA 1KTVA 1RHRB 2H3EB 4MK7A 2DGSA 2KHDA 2JLFA 3EVMA 3HFZB 2ROGA 3PHEA 3V4IA 4RU9A 1SCJB 3GV5B 3QZ8A 3R1LA 1IWGA 3NBPB 3OSPA 5ADZA 3Q86A 2B4OA 2VBZA 2HK2A 4DQIA 3UVJB 3OL8A 3M30A 4PXEA 3PYDA 1SJ3P 4OHVA 1X5SA 1U0HA 1SC4B 2R2SA 3T1HF 4M5IA 2QRRA 3C46A 2B4PA 3G8QA 3LGNA 2CWKA 1TMJA 3S01A 2YNFB 3VTIA 1VJWA 5A0YA 3ZZUA 3T5JA 2OIHA 3C2PA 3KJVB 1E6YA 4V1Ak 2YX1A 2ASYA 5C24A 2ZWOA 3UN5A 3UCZP 4TKTA 2HBQB 5KFGA 3I6PA 2IRYA 4EYIB 2B3TB 2M7SA 2XULA 2CPXA 3PJXA 3M6WA 4ES3A 2RUSA 4C8NA 4YOEA 4NCAA 1QAXA 5C7PA 3LWLA 2CNKB 2GGPB 4NYPA 2M8DB 3TVZA 1RSCA 4DPXA 1FX4A 1YKWA 3I31A 4L73A 1Y3KA 4OV6A 4NLUA 1IVZA 1MLAA 2GJ2A 4DPWA 3CNQP 3MPUB 2K3KA 3N01A 4FYDA 3GG1A 4YR3A 4TLQA 1ZM3A 2ZJPQ 4UW2A 4RW8B 5K14B 5SUHA 3CCLS 2B6AB 1U2FA 5MAOA 4ED2A 1NUEA 1IKVA 2Y0BB 3PO5A 2NXEA 2DEIA 2BVZA 2FJEB 1FRIA 1FRKA 1S5ZA 2GJIA 3Q2TC 3L7OA 5F9LA 3QT7A 2LEAA 1RBAA 1YJ9S 4I1TA 2UUCJ 1RCOB 2KRBA 3R5AA 2VF3A 4CQ1A 5KFNA 2XMUA 2JHEA 2O3DA 2FQQB 3IGVA 4D3GA 5E5NA 4KR0B 3MEEA 1VYAA 1TL5A 1JKHB 3Q8PB 3HJFA 4N77A 4YB7A 3FC9A 2EXUA 1IR2A 4PZVA 4JI1F 2I9SA 3T6BA 1LWXA 1KHWA 1RJJA 2F4FA 1T9TA 2IY5B 3C15B 5IV4A 3MM6A 4YB6A 2NSBA 5HMXA 2R3VA 1FI4A 4RJVA 3EGNA 2WW8A 2DHSA 3D1HA 2YKQA 1JK9B 3CWJA 1UVKA 3BR9A 4ER8A 2W7PA 4BS2A 1LXJA 2GMHA 3TJAA 4CYUB 2YNHB 2UVUA 2N3OA 2A6OA 3LGHA 2KH9A 4OHZA 3QATA 4FNIA 2HGMA 2GFFA 1EIYB 2CZVC 5KT5A 4LR7A 2HW3A 5HBMA 2UUWA 1YJNS 1U0HB 1CLFA 1KQKA 4PCQA 2EEYA 3JSRA 2K1RA 4OFZA 4NXNF 2WBMA 3I87A 4IQXA 5F0WA 3K7RA 1TKTB 1SV5A 1RWNB 5A0YB 3W1YC 4B9LA 2AGQA 1SXLA 2MQOA 3PW4A 3VVUA 3N5BA 3OR1A 3RBZA 1ZM2A 2W01A 2W2MP 4HI2A 3TZYA 1HKAA 3Q8SB 4BC9A 1RWUA 4RZRA 1CJTA 4RNHA 2KT3A 3HHLC 3KUHA 1TL1A 2JFDA 1RAIB 5DETA 1RT6B 3PDNA 2EFNA 1HWLA 3NCQA 4OI2A 4CH7A 1NAQA 2CFXA 3LP1A 4RBTA 5K20B 1RWPB 1GTHA 3HVRA 2AYGA 1WF1A 2MMYA 4DX8H 2KZMA 1FRXA 2MPUA 2HRUA 2CPFA 2HBYB 4DBQA 3J7YI 3DLKB 2DPIA 4IFVA 4DCOB 1UVIA 2GQCA 5IT0A 5KFMA 5AJ3F 2Y0SD 3CJ0A 1ZAVA 2C2EA 3W3SA 1M1KT 3GQCA 1IKVB 2QLFB 3VALA 1LV5A 1S6PA 3CCRS 3AHPA 1AROP 4LRBA 2RJZA 1IJFB 2M4MA 1TUWA 5KG3A 2R8HA 2HIYA 4K4TA 3MMBB 3PRBA 2OD4A 2FC8A 1FFSB 3GJSB 1Q4RA 4UY8T 1DTTA 1NJWA 3IP0A 3OL6A 2FLOA 4WJBA 1U2CA 5T41A 3CCJS 1FNOA 2NS1B 4DUYJ 1S79A 3DRPA 4RW7B 4AL7A 1KVIA 4RX6A 3ZXWA 3MEEB 4XIUA 3HSGA 1C1CB 3ENWA 2R7WA 2KG0A 4F3QA 1F5CA 3KHHA 3NCRA 2ZVSA 1BWVA 1UVLA 4ZK7M 3PIOQ 4CLYA 4PXCA 4F4AA 1RWXB 1T9WA 2V0NA 2MXYA 3NGKA 4U9RA 3PCOB 1NHVA 1WUUA 2OO4A 3P4UB 3UFCX 3MM6B 4J9UE 4KKOB 2UU9J 3MR3A 3F56A 1D0EA 3K8WA 4X4OA 4MYUA 2HHSA 1VLOA 1CS4A 2K8GA 2VHGA 1YX2A 2FHJD 2DCUB 4K4SA 5IV3A 2CNNB 2C3YA 4M5JA 4BC7A 1RWWB 3SI8A 4F02A 5HAOA 1GH8A 4FF1A 1N34F 2C2OB 3CCTA 4DL5A 4WU3A 1PAEX 4WIIA 1T7PA 1FESA 3E8OA 3KLHB 2R7QA 4MIAA 1OPIA 1G2EA 2ZBCA 2RVJA 1VS3A 2V4QA 3SCJE 4C48A 5KFPA 1T94A 5KFSA 5ETNA 2ZDPA 1UA0A 2KXHA 4CNYA 4URQU 4OYWA 4NZ6A 4X62F 4LFBJ 3A1YG 4IDKB 5KFAA 5KTQA 4DR4F 3NGDA 4OX9J 4NYZA 4FVCA 4AYBD 4KV8A 4P71A 2R8KA 2D69A 1ZYQA 3HHEA 5CCMA 1SV5B 2EVZA 2QMUB 4I2PA 1FKAF 4RUCA 4DQQA 3LWMA 1X4EA 1KQGB 2YY3A 3OR1B 4NLDA 3ENVA 4XK8C 4IO1A 4FPIA 2EC2A 2RSQA 5KFDA 1MU2B 3MCOA 2LQ8A 1YJWS 2HQ3A 4A47A 1WDDA 3M2UB 4UZBA 2QA4G 3LP1B 3W61A 3BGLA 2QA4S 4FXWA 1HQEA 3B54A 1NK9A 1S77D 2HHHJ 3OJSA 4KH0B 5LT5A 3LGMA 1X4FA 4RKUC 7FD1A 1RCXB 3RBXA 2GO8A 1NNDA 4QBUA 1WTBA 1RT2A 4Z2XA 2AJ4A 2MKIA 4M5DA 3CD7A 1T8EA 1RISA 2W2QP 3JS9A 5T7LA 2ZC3A 3IGNA 2CADA 1JIHA 2GAHC 1S1VA 2WTFA 7FDRA 3TVKA 1CQMA 4WE1B 5E2QA 5DDRC 3K5OA 4FS2A 1U24A 3Q0AA 2ZD1A 2Z0GA 1HBUA 2OSQA 3U7JA 1KTQA 1GX6A 2R7TA 2DH7A 4ZN3A 3U1NA 3FZ2A 4YDXA 3IA0A 3RB0A 4N76A 2WB1D 3V6JA 3DN9A 1Z2LA 2BBEA 3VZIA 1CSJA 3FVYA 5IS2A 2DGQA 1VLYA 1DTTB 4IO9Q 1S6UA 2IHR1 4A8QA 2ZHAA 1T95A 2CQCA 2KM8C 2HQCA 2WVEA 3BSNA 3LP2B 3DRPB 3IG1A 4LBPA 3LPEA 5H9FJ 1DURA 2M3DA 1SIWB 3FBFA 1DTQA 2HS4A 4MKYA 4LF9J 2RMLA 3BBCA 4A48A 2XYHB 4I6WA 4YMEA 2FDNA 4URSA 3OBIA 1WHXA 1N32F 2WOMA 1Y5IB 3PIPQ 1YRUA 4QZVB 4R5PA 4LF2A 1Q53A 4BCAA 2C2NA 2HFNA 3DOMA 3TNVA 4FN5A 3CJRA 1R8BA 2E7XA 3UD5A 4DUTA 2KO1A 2CPEA 3DMJA 4MFBA 2VQEF 5LMNJ 1QAJA 4J9SA 2Z2YB 4NE9C 3M6VA 1R0BG 3UN2A 2LA6A 2HFSA 1PIEA 1NZAA 4GRSA 2JL9A 2LDYA 3NY0A 3LH2S 5D78A 4WP8A 1GMUA 3FEYB 4LFAJ 1TP7A 3B6BA 5DDOC 4LMZA 4IG3A 2VFUA 4ITSA 2KXFA 4J9RA 2RKIB 1RU1A 2YWKA 2W1BA 3M8SA 3NG8A 1QE1B 3THVA 2CQ0A 2MQLA 3CD6S 4DCPB 2MSTA 2FB0A 4ECTA 1B7YB 4KV8B 3WC2A 3GE9A 4NMLA 4B9UA 4DR1J 4I2PB 4KQZA 2ACYA 2HIQA 3G8SA 4ZCIA 1MWQA 4LIWA 2GO9A 3KYLA 4F4XA 3I0SB 4Z7CA 3H7HB 3FMBA 3DDNA 3O8WA 3A3PB 1Q8IA 2YKOA 2CJBA 2BANB 3OFHA 1TL7A 2BJ1A 3TUIC 2QE5A 2VL1A 3EPIA 3KHRA 3C19A 1S4EA 1HQEB 4NOHA 3ISZA 3I9V9 2PFDA 3GV8B 1CULA 2C2RA 3CPWR 4PPZA 3MUTP 3POTB 3CDBA 1PC4A 1G1XA 4U7CA 1H7XA 4RPFA 2X3DA 2ZH9A 2MJUA 1VQKS 3PYGA 2AX0A 3HSJA 5HQMA 3NGUA 1FXRA 1NO8A 2V5HG 4WF9Q 2ZD1B 2ERRA 1B99A 3EXYA 4C3KA 2AD9A 3W64A 1XNQJ 1D9FA 4ZP7A 1S59A 3M8WA 3V81A 2XC9A 1IN0A 2X1AA 2B8QA 4A8MP 2AEFA 2XO7A 3DOLB 2D3UA 3FSIA 4FYVB 2OPRA 3NP5A 1ZH5A 5FDLA 2WVDA 3ILJA 3Q24A 4USTA 4L6V3 1N33J 1WNEA 3HHLA 2RE1A 2LQBA 2IMOA 4EMDA 2I1RA 1UZDA 2CQDA 5B7WA 1UL3A 4NLTA 1TUVA 4JI3F 4AUKA 1T3NA 3GZ7A 1S0OA 3QFHA 3DXBA 5LJ3Y 3CDUA 3MM5B 5E41A 4DU8A 1RK8A 2KN4A 1DTQB 1AXQA 4LF4J 3BB5A 3A3OB 4O3QA 6FDRA 3KKFA 1LOUA 1VQOS 1OYEA 3HK2A 5D4OA 5RUBA 4DV6F 2WOMB 1HD1A 3KMSA 2IBOA 3RB3A 1X4DA 4R5PB 4ED7A 1ROFA 2PIIA 2CQPA 3DOMB 3HHKA 5A76A 4Y6IA 3NGRA 2LQJA 1WHWA 2F3JA 4IH6A 1TKZA 5HANA 2J0QD 4X4NA 2HQDA 2VJUA 4EWTA 4MFBB 5LM7E 4HLBA 3D66A 4DV3F 1U8SA 2ZZMA 3AXMA 2GHWA 4IOCQ 4X4TA 2HG4A 5LSLA 2C22A 3J81U 2MQPA 3DLEB 2DHXA 4USMA 2YBVA 1NXIA 5G0RB 2QG9B 3VGVA 4AQYJ 2O5DA 3IXQA 3W7BA 2DGOA 5IFMA 3PG9A 4Q45A 4YFUA 1HHTP 3CT9A 2W24A 2XNQA 3T3FA 2GJFA 5KT3A 2Y8YA 2HNZA 4DR6J 3FCWA 2VJVA 1HIYA 2D3ZA 2G9OA 4UUXA 4DLEA 1RLCL 4ZKAA 2HFZA 1H98A 4IKAA 3C6UA 1RTIA 2FY1A 1K8AT 1HHQA 3UQSA 5KFUA 4KIAA 2FTRA 4JB8B 3NAHA 4G65A 4F67A 4ZOSA 4ZJLA 4LF7J 3IC1A 1EB0A 2A2DA 4K50A 2XMMA 5IOLA 1TL7B 1RBLA 2LP4A 2QMWA 3N6MA 4MIBA 2VA2A 4WK3A 4WFAQ 1KEKA 1A9NB 2J8AA 1W2BR 1M0SA 5DQHA 2NSCA 3KWMA 5H9EJ 4NZ0A 3NOCA 1AFIA 5HVGA 1OPZA 1CULB 1S6OA 1NRKA 3BKUA 2HRYA 4G6VB 4QPXA 5EGYA 2G1DA 2E66A 2KHCA 5J1EB 2W2PP 5GAEI 5JUMA 1ZAWA 4Q2MA 3TJ9A 5D0GA 5HMZA 4OI0A 2LU2A 1FRJA 1S1XA 2C3UA 1LW0B 1AZSB 5EX0A 2EKNA 3V4MA 3DHXA 3OXFA 2PN6A 2L9WA 3V6HA 1HBMA 4N8OA 2ZM6J 3OL9A 2OH2A 3CJ4A 2RB7A 4F50A 1V6HA 3GU0A 4OJGA 5KFWA 3KUEA 3EXCX 1S0VA 2FJWA 5FDLB 1ZETA 3C14A 3G82A 3NLCA 3OFEA 2DB1A 4JI0J 2RHQB 4O3NA 3HHLB 3H90A 5KG0A 2G2ZA 2XSJA 5KT4A 4LFCF 2VC1A 4R25A 2ZOFA 2VPZB 4QWCA 3SSRA 4O44A 4KFBA 4A8FA 3PRVA 4GKKJ 2BACA 3OHAA 2KT2A 3F73A 2UXDJ 1VRUA 4YS2A 1I5OB 1MNEA 3BQ0A 3LQVA 4DXLA 3LAMA 4DN9A 3NAIA 1DARA 4JI2F 4Q5VA 4RW9A 3GPAA 1YGYA 4DHVA 2RF2A 4TN2A 1JLGA 1V9OA 1HNXF 2F4VF 2PMHA 1VQSA 5L9NA 2NZ4A 3ZNJ1 3VAJA 2XZWA 1FNMA 1JLQA 4O3OA 3CJSA 4ECYA 5D6GA 5IT9Y 3VQTA 1Q8BA 3K8VA 4YB1P 3KDNA 3S6EA 2GHVC 3F0NA 3MEKA 1JX4A 5GMDA 5F8GA 4B17A 2GW8A 2AEJA 3HT3A 1J27A 4C8ZA 2RIJA 4PXBA 4DV7J 1NKCA 3HM9A 5IWAJ 3BGUA 1LWCA 2AJ1A 2FHKA 1L3SA 5L8RC 2RQCA 4Y0FA 1WG4A 4ZIWA 4TXSA 3RAMA 4DR7J 3RR7A 1YRXA 2I38A 3BBFA 4J9LA 4LRCA 5F8NA 2WK4A 1YJ7A 3QJLA 1WACA 4ID5A 3SV3A 5HVFA 5H1SV 3OTOJ 3ADAC 3VQSA 3IRXB 2XM3A 4FF3A 2YWHA 2PGCA 3IBFB 3OD2A 4ZVRB 1WC4A 1HI0P 2CDRB 2HNZB 3R8YA 5GAGU 3T19A 1R8PA 1NMEB 3Q8QB 1KRPA 3VAGA 3HKZD 1Y10A 1OJ4A 2ATCB 3BBBA 3ZZPA 1JLAA 3G6ES 2ZNYA 2OAUA 2EBEA 1RTIB 2BDPA 5EWGA 2WSCC 1R0AA 1ZM4A 1RXOB 1B3TA 2VFSA 3HULA 1OYDA 3JSMB 1X9MA 3VV2B 2XWXA 5GAHU 4LT6A 5IC4B 2OPSA 2DR6A 3KFWX 4ZLPA 3ET6A 3CIZA 4HDHA 4ILRA 1QUVA 2G2OA 4DV2F 4H4OB 3GIIA 1Q78A 2GIRA 4JI7J 1F2HA 4ES2A 2NCKL 2PA3A 4NPOA 2YQ1A 1K1QA 1D8ZA 1UFKA 2QZ8A 3NXZA 4F3OA 3KLIA 4A46A 2CJ9A 2Y1IA 1P9QC 3OLAA 1OWXA 4YHHJ 1S1XB 4L72B 2OLWA 3KHLA 3P96A 3MOZA 3KG0A 5A8KA 1FDBA 1R31A 1OSDA 1X4AA 1FDAA 4DG1A 1KLMA 4RBUA 3FMWA
chains in the Genus database with same CATH topology
4JV2A 3H4DA 4X4VA 1HBMB 1HI1A 2EFQA 3M1VA 1S1TA 4X4PA 1IR0A 2OMLA 1V3SA 3IG1B 1U47A 1KTVA 4I67A 4DL6A 1TAUA 2KU7A 4FXDA 4DFPA 5CYMA 4MK7A 1SH2A 3KG1A 2HNDA 2V4JA 4EZ9A 2DGSA 4NLGA 5KFFA 2KHDA 2JLFA 2DGUA 4MTPA 2HVHA 2O66A 2IJFA 2JEFA 5J2QB 2ROGA 3PHEA 4Y2AA 3V4IA 4RU9A 2ZH3A 3TA2A 1KD1T 2V8VA 1X0PA 1HNIA 2GQ2A 3HVAA 4C8MA 3GV5B 2KVIA 3JB9k 3IR6B 1N0UA 3D28A 3I9ZA 4NLSA 3QZ8A 3BS9A 4HTIA 4NA1A 3R1LA 2OD6A 3F41A 4L3NA 4DWIA 3NBPB 4DDFA 5K8PA 4Y2KA 2XSJB 3OSPA 5ADZA 3EYZA 2B4OA 2VBZA 1KR4A 2CPYA 3HO1A 4ZPWR 4DQRA 4DQIA 4QWDA 4EBCA 2HHQA 2JVOA 2L08A 2CG4A 1HMVA 4H4KC 3OL8A 3M30A 1WEXA 3FDSA 4QYRA 4J9QA 1BD6A 4DF4A 4PXEA 2J9CA 3L09A 4R8UB 1SJ3P 2AYMA 2FHJA 4OHVA 1ZAXA 1X5SA 3QIDA 2VONA 5J2NA 2BRLA 2VG7A 2PO4A 3MCSA 4KFBB 4OI6A 1K73T 5KOWA 5EWFA 1VQYA 4KHMA 2R2SA 4HYKA 3T1HF 1FVSA 4M63A 4I64A 1X4HA 3PJWA 2QRRA 3TVYA 1H0HB 3MPWA 3C46A 2B4PA 3G8QA 1SL2A 1VRUB 3LGNA 2ASDA 1SC6A 2FLLA 5EUHA 3SSSA 2DH8A 4AL5A 1RT5A 3SQGA 2E5JA 4O4GA 2DVIA 4LUBA 3S01A 3SFUA 2YNFB 4DOZA 3DMJB 3QYYA 3IWNC 3VTIA 1VJWA 5A0YA 4K4YA 2MZJA 4DQPA 4EFAC 3ZZUA 3T5JA 2OIHA 2JEGA 2AWZA 3C2PA 3RW6A 3MI7X 1XC9A 1JLEA 1N52B 3KJVB 1E6YA 2KT5A 2CQ2A 2K7KA 2BQUA 2YX1A 2ASYA 4WK1A 5C24A 2RKIA 1JLGB 3N28A 1SUQA 3UCZP 2KJWA 1C0TA 1F5BA 4TKTA 3ZZ0A 1TKXA 4CH0S 5CCLA 5KFGA 3I6PA 2IRYA 4EYIB 1AFJA 1JLCB 2B3TB 2M7SA 2XULA 1QE1A 2CPXA 1Y00A 3PJXA 2VBXA 3CC4S 3M6WA 4ES3A 4B3SF 3J80Y 4AXIA 2LDIA 3IS9A 4KAIA 4IG3B 3CXCR 1QAYA 4ETXA 1SI9A 1GTEA 2ABYA 4C8NA 4YOEA 4G3IA 1JLQB 2ZJRQ 2E7WA 2FVPA 1UEUA 4QIWD 3KLFA 4WZMA 4NCAA 3M8QA 1QAXA 3MECB 3LWLA 4WYLA 5K8OA 1B0TA 1CVJA 4QIFA 2HHPA 5K5MA 4LVOP 3AJ2A 2GGPB 1FF2A 1T3OA 2XLJA 3HP6A 3FQLA 1DZ5A 1HARA 4NYPA 1FK9A 2MSSA 1REVA 4D3HA 1R8HA 5GAEU 1I6JA 2M8DB 3TVZA 1FA0A 2W9CA 4CO1A 1OSCA 4C0BA 2EKYA 1DBDA 3I31A 1U1RA 3GFZA 3AB4B 1Y3KA 3LAKA 1Z1ZA 5HP1A 2VODA 1HYSA 3W2WA 2R7XA 4NLUA 4E0DA 4ZPBA 1O51A 3QIPA 3I0SA 2GJ2A 3OV7A 1UJ6A 1VQLS 2K3KA 3N01A 5DLGA 4DV1F 4FYDA 2PFFB 2WB4A 2XGPA 3CCVS 5ITHA 3GG1A 4YR3A 4TLQA 2XY5A 1ZM3A 3VAFA 3ISNC 3ZZZA 1L3UA 4UY85 3N6LA 2ZJPQ 2KM8B 4QWBA 1NKBA 2RQMA 4IFYA 5I3UA 3DRYA 2BANA 3ITHA 4YUDA 2DH9A 4UW2A 1IM4A 4RW8B 1NH7A 2L9DA 1N5VA 5K14B 5SUHA 4DJBA 3CCLS 1MW7A 2B6AB 4OLOA 1U2FA 5MAOA 4X64F 4ED2A 2JLGA 1EP4B 1GAOA 4IR9A 2YX4A 4F4ZA 1IKVA 3PO5A 1P8GA 3ZZRA 4Q44A 2BE2A 2BVZA 2FJEB 4N5SA 1FRIA 1FRKA 3KNGA 1U45A 2GJIA 3Q2TC 1TVRA 3KOAA 3L7OA 5F9LA 2W9BB 3QO9B 2LEAA 2MZSA 3BO3A 2F1FA 1YJ9S 1GT8A 3POTA 4I1TA 3DRRB 3UI3A 4K0KF 2FVQA 4DSIA 3UR3C 4DEZA 1YVFA 3CCSS 3D54A 2KRBA 3DGPA 3JTOA 5DDPC 5U47A 2XNRA 4HT5A 2R8IA 4BHQA 3PW5A 3OTDA 3R5AA 2VV5A 1WI8A 4CZCA 1QY7A 4CQ1A 5THWA 2BW2A 5KFNA 2XMUA 2O67A 2I0XA 4KHRA 3OHBA 2A2CA 2RT3A 1R0AB 1TV6A 5CD4H 2JHEA 3OLBA 2B5JA 4RWXA 2ZH4A 5KG2A 1IKXA 2AYBA 1U6FA 2HWHA 3EZUA 2O3DA 1XEZA 2RD5C 2CYYA 3M9OB 1TK8A 2OTLS 1C4CA 1BGXT 1FXDA 3IGVA 2M5YA 3G6YA 1SJRA 2GNKA 3I0RA 4M94A 4OX7A 4XDCA 1URNA 5HO4A 4D3GA 2OPSB 4ZCMA 1D1UA 1HNVB 5E5NA 2AQ4A 4KR0B 5B0EA 1SKRA 1UETA 3MEEA 3OJUA 1TL5A 3MDFA 4JV0A 1JKHB 4I68A 3G6VA 4B3RF 3Q8PB 1SB6A 3IN5A 3KLEA 4N8NA 3DOLA 1YJTA 4ZHRA 2M2BA 2ZUGA 3L95X 2UUBF 4ILLA 3HJFA 1H2VZ 2A18A 4OJHA 4N77A 4YB7A 4Q43A 2Z2LA 3IO1A 3EPGA 2FLNA 5J2MA 1NU4A 2VH7A 2JC0A 1N88A 5KFVA 4RNMA 4I6AA 2DRBA 2KYXA 2OPQA 4B9SA 3TO8A 4NLVA 4H4MA 2KFYA 2I9SA 3FEXB 1T05A 3CC7S 4WXWA 1S6QB 3T9NA 3T6BA 4UUWA 1KHWA 3DNCA 1PO6A 4ZDNA 3V81B 5LXYA 1RJJA 3D2WA 5KFYA 1YJVA 4P7TA 5D4PA 4LF5F 2NUHA 2BQRA 2ASLA 4YQWA 2WAQD 1QAIA 2OPRB 3RB4A 4RNOA 2NLWA 2RU3A 3RBDA 4LF6F 3MM6A 1RT1A 4GC7A 1QVFR 4I2QB 2XMKA 3KK2B 2VKZG 4YB6A 1FRMA 2YKMB 2NSBA 5HMXA 2XCPA 1ZPWX 2AX1A 4DFMA 1FRHA 3MM5A 2ALZA 3CJ3A 2FVCA 2JJ4D 3IFEA 1KC8T 1YQHA 5A8KB 1W2IA 1VGYA 3EGNA 3SCLE 2FJDB 3NS6A 2B9XA 2WW8A 4DUYF 1JJ2R 3J7ZT 3OUYB 3U1LA 1HD0A 2DHSA 3D1HA 2R8GA 2YKQA 2DR5A 2C42A 2LYVA 3K5PA 1JK9B 4QR2A 2BV3A 3FCHA 3PFEA 2YX7A 3M1VB 1DQ8A 2CQIA 5L1IA 3OPKA 1DAXA 2AYEA 1UFLA 3CWJA 1UVKA 4V19X 1IQZA 1MMDA 2LLZA 1NKEA 1H2TZ 4O3SA 3BR9A 5CYMB 2EI5A 4GC6A 2W7PA 4BS2A 1LXJA 4K5SA 2LXUA 2GMHA 2YNHB 3MM8A 2UVUA 2N3OA 2XB2D 1Q82T 1U1LA 3MMJA 2FIUA 4CO4A 1IUJA 2ZH8A 2OP5A 1P27B 1HNIB 2MQNA 2DIUA 1Y9OA 2XWYA 1L3KA 3KMQA 3NL0A 1U1QA 3PV8A 3BGRA 3DLGB 4M1KA 3EX7B 5BR8F 5LJ5Y 2W8KA 2V9WA 2KH9A 2R7RA 2W7AA 4ZMMA 4DLGA 4EO6A 4C97A 2AGOA 4Q7AA 3TUZC 3KK3A 2FPHX 4OHZA 4ED8A 3CJKA 5FLXY 2RNEA 4FNIA 2IVYA 2ZKUA 3MZIA 2HGMA 2QLXA 2GFFA 2CZVC 4FVMA 5KT5A 4M8LA 4RUAA 1Q81T 5KFZA 2HW3A 5HBMA 4QIVA 2UUWA 2UU9F 1YJNS 2EFPA 3PZPA 3OFFA 2BJEA 4TU7A 1IXKA 2YVSA 2N7YA 1CLFA 5J2NB 1KQKA 4PCQA 1FJEB 1W25A 3JSRA 2IM2A 3H2LA 2K1RA 5A2QY 3LF0A 4OFZA 4TYAA 1S1WA 4M95A 2J6UA 1R3NA 2LA4A 2ZOGA 5FD1A 2QMXA 5IM0A 1XERA 3BR8A 1RTHA