2CQIA

Solution structure of the rna binding domain of nucleolysin tiar
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
103
structure length
103
Chain Sequence
b'GSSGSSGMMEDDGQPRTLYVGNLSRDVTEVLILQLFSQIGPCKSCKMITEHTSNDPYCFVEFYEHRDAAAALAAMNGRKILGKEVKVNWATTPSSQKSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Nucleolysin TIAR
publication title Solution structure of the RNA binding domain of Nucleolysin TIAR
rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 14
structure length 103
sequence length 103
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2cqiA00
2MSSA 1CVJA 2ADCA 1VC5A 3R1LA 2MMYA 2CPIA 2J8AA 2NLWA 1VQ6S 2KN4A 3H2VE 2QA4S 2DHSA 4W90B 1O0PA 3SDEA 5GAGU 2E44A 3NS5A 2KXHA 2RNEA 1KOOA 1JJ4A 1X4CA 5LJ5Y 2LXUA 2KXNB 2E5HA 4CQ1A 2LKZA 4TU9A 2CQIA 4IO9Q 2RRBA 2LMIA 4Z2XA 1U1QA 1UW4A 1OWXA 2M2BA 4IOCQ 3J7ZT 2EVZA 2KT5A 4ERDA 2MQOA 1U2FA 4CIOA 1JJ2R 3MXHP 2DGVA 3CCVS 2E5IA 2MKSA 2M88A 5DDOC 2B0GA 2I2YA 1P1TA 2MPUA 3CC4S 3G8TA 5MLCV 3UD4P 2M7SA 4OZ0A 5D77A 2KM8C 1VQ5S 2DNLA 1K73T 2QFJA 2RT3A 2BOPA 2DGXA 3P3DA 1KOHA 1WEZA 2SXLA 2MGZA 3CMAS 1AUDA 2PE8A 1WG1A 2XNQA 1ZZFA 2DH9A 3UD3P 1BY9A 1X5TA 3CUNA 3FEXB 1L3KA 2L08A 1YI2S 2NZ4A 3VAGA 1WG4A 2MKHA 3FEYB 3BEGB 5IQQA 1YJNS 2QEXS 1FXLA 1F9FA 1NO8A 2E5JA 2OSQA 3VAIA 2RS8A 4LJMA 1X4FA 1H6KX 1VQ9S 2D9PA 2CQ4A 2F3JA 2DISA 2MQNA 1FO1A 2OSRA 5IM0A 3CC7S 2L9WA 4YB1P 2YWKA 1D8ZA 2DIUA 1M5VC 2CQ0A 3P49B 5DETA 4TU8A 1SJQA 5LSOA 1H2TZ 1WEYA 2YH0A 3SMZA 1WI8A 2LYVA 3L3CA 3R1HA 2CPHA 2DK2A 2DNYA 2KU7A 1DHMA 2KG0A 1WWHA 2MXYA 1WHXA 1FJEB 3UCGA 2KM8B 1FNXH 2HYIB 1YJ9S 2M9KA 3THPA 3MUTP 1WHVA 4UY8T 2FC9A 2KH9A 4V19X 2N3OA 3CCES 3CCUS 3S6EA 2MKKA 1A7GE 3MURP 2FY1A 3CMES 2DNNA 1HD0A 4WFBQ 3MD3A 1NJIT 5LJ3Y 5GMKa 2AD9A 2OIHA 2AYMA 2EK1A 1VQKS 2K8GA 2DNOA 2AYBA 2HGMA 1VBZA 3G71S 3NNHA 2DNMA 3PIPQ 2CJKA 2JVOA 2F9DA 4ZKAA 3N9UC 2D9OA 1YITS 2MKCA 2I38A 2RQCA 1D9AA 3TP2A 3G96A 4PR6A 2LXIA 1URNA 4A8XA 1U1KA 4M5DB 3NMRA 3DLLQ 5CXTA 5LSLA 1KQSR 1NU4A 2XS2A 2DNRA 4C0OC 2CQPA 3VF0B 1U1RA 5D78A 2HZCA 2U2FA 2MZQA 5HL7Q 2RUGA 2XSFA 3CPWR 3P6YC 2AYEA 3CCQS 3H2UB 3NNCA 2DNGA 4EGLA 2LCWA 2RS2A 1X4BA 3EX7B 2LECA 1M90T 2LEBA 2X1GA 1X4EA 2MQMA 3VALA 3CF5Q 2J0SD 3NS6A 4U67Q 2LA6A 3G6ES 1X5SA 2KYXA 5DDPC 3IRWP 4WF9Q 4C7QA 3SDEB 4FXVA 3CCRS 2V94A 3S01A 1K9MT 2JVRA 2M52A 2CPFA 1WELA 3K0JA 4F25A 5LXYA 4LMZA 4ED5A 4TLQA 1A9NB 5GVQA 3S7RA 2HGNA 1YJWS 3VAMA 2ADBA 1U1LA 2M8HA 3U1LA 3J7YU 1K8AT 2JWNA 4WKRA 1HL6A 1ZH5A 2XS5A 2RRAA 3Q2SC 3ULHA 3VAJA 4FXWA 3I55S 2DGWA 1WHWA 1G2EA 5EN1A 4UQTA 2DNHA 1QVFR 5IFMA 1DRZA 2XS7A 2ZJQQ 2N82B 1UFWA 1N8RT 4QPTA 5BJRA 4BS2A 1IQTA 1ZZNA 2EK6A 5DM7Q 2CPJA 1WHYA 2KG1A 1Q81T 4IUFA 5LXRA 4IOAQ 1PGZA 2CQ2A 3CTRA 1Q86T 2F9JA 2DH7A 3U1MA 1M5PC 2DO4A 1FT8A 2DNPA 3EGZA 1X4GA 1X0FA 5JVGQ 2MGZB 1FJCA 1P27B 2L41A 1YHQS 5GAHU 3TYTA 2FC8A 5DM6Q 3CXCR 3ZZZA 2KXFA 3UWTA 1YIJS 2DGQA 2MQQA 3G8SA 4YOEA 1B7FA 2GHPA 3MD1A 1QVGR 4QU6A 2DH8A 2DNQA 2N3LA 5FJ4A 2MJUA 3EGNA 1X4AA 5IM0B 3BO2A 3CD6S 4CH1A 1SXLA 2MZTA 1U1OA 2G1DA 2RVJA 5CYJA 1WF2A 1Q7YT 2X1BA 3OW2R 1OIAA 1XN9A 3DXBA 1OPIA 3UCZP 2ERRA 1WG5A 2MZSA 2CPZA 1VQ4S 2JRSA 2PEHA 1VQOS 2JX2A 2BZ2A 2MY8A 3NNAA 2XB2D 3HHNB 3HI9A 3TO8A 2OTLS 2LEAA 2RU3A 3VAHA 5DDRC 2OTJS 3UCUP 4WFNQ 2CQCA 3S8SA 1SJFA 4QU7A 1VQLS 1RK8A 1WTBA 3G9CA 4PRFA 3BS9A 1OO0B 2UP1A 2DGOA 1VBXA 2YKAA 3Q2TC 1RKJA 2DHAA 2DHGA 1JMTA 4PKDB 2LA4A 4Y00A 3CC2S 1PO6A 2M4MA 4P6QA 3MI7X 3P5TL 4F02A 2GO9A 2MYFA 4J5OA 3VAKA 4C4WA 2M8DB 1U1PA 1YWXA 1H2UX 2DIVA 2MB0B 2CQ1A 2MZ1A 1N88A 2J76E 2AYGA 4QQBA 3US5A 4WIIA 2YH1A 1M5KC 1VQ8S 1HD1A 1WF0A 5CA5A 2VOPA 2CPEA 2D3OR 4W92B 4Y0FA 5ITHA 4CH0S 4YUDA 2DO0A 2OJ3A 1X5OA 2MSTA 1VQPS 2X1AA 4WFAQ 3BO3A 4LIRA 2RQ4A 3THTA 3CCSS 2KFYA 1U1NA 2KRRA 2E5GA 3B4MA 3G4SS 2CQDA 5GAEU 1U6FA 2VONA 2KRBA 4F26A 2M0GB 1VQNS 3MDFA 2G0CA 1UP1A 2CPYA 1Q82T 3UE2A 2DITA 2CQHA 2CPXA 1S79A 2DHXA 3IWNC 1H2VZ 1VBYA 4RU2A 5HO4A 2ZJPQ 2M70A 2HGLA 1M1KT 2X1FA 1W2BR 2CQBA 3BO4A 1HA1A 2DB1A 1N52B 1FJ7A 3LQVA 1FHTA 3R27A 1U6BA 1UAWA 2DGSA 4TU7A 3V4MA 1R8PA 3MUMP 1M5OC 2MQLA 2MZJA 4WCEQ 1SJRA 2MKJA 1X4DA 2K3KA 2MJNA 2YTCA 1N54B 2N7CA 1WF1A 3RW7A 5GADU 2MKIA 1X4HA 2HVZA 1WI6A 1JJHA 1KD1T 2MZRA 5JVHQ 1WEXA 2CQGA 3JB9k 2DNZA 1SJ3P 3B4DA 1S72S 3I56S 1R8HA 1X5PA 2MHNA 2KVIA 3LPYA 5H1SV 2A3JA 2FPHX 2KHCA 5DDQC 1SJ4P 3VAFA 2VODA 2O3DA 2MY7A 1VC0A 3SXLA 1VQMS 2WBRA 1DZ5A 2U1AA 2MQPA 1KC8T 2CPDA 3RW6A 1DBDA 2ZJRQ 2DNKA 2XNRA 3ZZYA 3MOJB 1VC6A 3CCJS 2J0QD 2G4BA 2KI2A 2DGTA 2FHOB 3D2WA 1YTYA 2VOOA 2LQ5A 2CQ3A 3CCLS 3CULA 3MUVP 2DGUA 1U1MA 3CCMS 4OZ1A 1VQ7S 3PIOQ 1QM9A 2Q79A
chains in the Genus database with same CATH superfamily
3SZ2A 4FS1A 3HFZB 2ZNZA 3H2VE 4Q0BA 3KK1B 2FJEB 2GAHC 3W9HA 1RI7A 4IOBA 2CJYB 2CFXA 4K0KF 2OPPA 2Y3YA 1Y10A 1PILA 1XMQJ 2J7KA 1TL7A 2CQIA 5F8NA 2XGPA 3MF5A 2VA3A 2MQOA 4DL0C 1U8WA 1NJYA 3SV4A 3MAQA 2HVHA 2MPUA 1JXLA 2M7SA 2JFKA 4LR9A 7FDRA 5J1EB 2SXLA 2C3OA 3AFGA 2O1PA 3NCPA 3V4IB 3FVYA 3GE9A 2K3IA 3QPIA 2K7JA 3M1VA 3F73A 3DHWC 3O5TB 4OIXA 2OSRA 2H54B 1QTNB 1M5VC 2IMOA 5KFCA 1X9WA 3UN2A 2CPHA 2DCUB 3I0SA 7AT1B 2NYHA 2FC9A 1FKPB 2ZWOA 4A8QA 2GQ2A 3WZ0A 4ZN1A 5DQHA 1KDNA 4C11B 4P71A 2Z0GA 3BDPA 5F8MA 2IDLA 2D9OA 2V67A 2MKCA 2R7XA 3NKYA 1CSJA 1FWKA 1MMNA 4C9DA 4F3MA 3HVAA 3DLLQ 3MECA 1KQSR 5KFYA 2DNRA 1OSCA 3CEDA 3CDBA 3T1AA 1H72C 3HT0A 2GJFA 2J9EA 1RTJA 2Q6CA 4DX5A 4K4YA 1S1XA 3CDAA 1YDLA 4ED4A 3UNGC 3G6ES 5L1JA 1OQ3A 3MMBA 3SDEB 4FXVA 2NXUA 2V94A 3AXMA 4NLOA 4NE9C 1VIXA 3J7A1 4I2QB 1TVRB 4EO8A 4QJVA 1PAEX 1IR0A 1T05B 2XS5A 4NX9A 3EZ5A 2YKMA 1VLYA 3MPVA 3BGFA 4ZPVR 1UVJA 1PAUB 2DNHA 3V5RA 1GX5A 1CPZA 4JV0A 3DLJA 3RR7A 1S48A 4OYIA 1B0TA 2V4JB 2ZHAA 3DLEB 1UPMB 4LR7A 1FX4A 4DJBA 3CTRA 2P9EA 3VQTA 5JVGQ 1FJCA 5A8KA 4OYOA 1MWZA 2J0WA 4RW4A 1JLBA 3TYTA 4DL4A 2QGFB 2OKQA 1NJXA 2DGQA 1EQ0A 2HAIA 3NGDA 2BJ7A 2NPIA 1WKJA 3V6HA 1J2VA 1MSWD 1FWLA 3OTOF 1M1HA 9RUBA 1VRQC 2G1DA 3L9ZA 2CXEA 1S1TA 4KJIA 1BE4A 4YY3F 3DRRB 2CAJA 3TEGA 1XN9A 2YWHA 3J81Y 3FRZA 4DR3F 3QT7A 5H9EJ 2Z2MA 3FC9A 3GYNA 3KMSA 2WZ1A 5HP1A 1NB7A 5ETPA 5I3QA 4PRFA 2AJQA 3QFHA 3KKFA 3UDEA 4URGA 4DFKA 2VG5A 1XR5A 1LW2A 1IWAA 3MI7X 1PYSB 2GO9A 5D8HB 3M4XA 3QSYB 5JJBA 2OI2A 3CB4A 5AXMA 1Z1ZA 1RTHA 4UY85 1KWMA 3P96A 4QW8A 5B7WA 4WFAQ 4MAKA 2EFOA 4RW8B 4J9LA 5CZXA 3OL6A 3KLEA 2RU9A 5L39A 4F8RA 1GMVA 3KHGA 3T9ZA 3VGTA 1RCOB 4E0DA 2E7WA 1Y3KA 4LQ9A 3G6VA 1W2BR 5E3RA 3LQVA 4EMDA 1U6BA 4UOFA 4DR7J 4MK7A 1MMDA 2ACYA 4ES3A 5KFWA 1FRLA 1OYEA 2ATCB 2WB1D 2QTWA 2WVFA 4BWMA 2VASA 5DRKA 5C24A 1XMQF 1L3TA 2XSJB 1X0PA 1C2PA 3EICA 1R8HA 3WIVA 2MLZA 3MM6A 1SJ4P 2OPQA 4H4KA 3THVA 2EW9A 1VMBA 1S9EA 4C6AA 3W61A 2G2OA 4OLPA 4UOCA 1HW8A 1DLOA 3BSCA 3LUYA 1T9YA 2DGTA 1VCTA 3PO5A 3CULA 3OTBA 2KZZA 4X62J 3W62A 4YMEA 2F5GA 3D7SB 5B0AA 1R8BA 5MAOA 2CPIA 2VFVA 3QO9A 4WTYA 1IBLJ 2D41A 4ID5B 3SCLE 3BBBA 2CWXA 3IN5A 1F5CA 5KG5A 2LQJA 2HHXA 4DHVA 5GAEI 4F4YA 2DR7A 4H4OB 2Y9HA 1ITPA 2RDDA 1T9XA 1UA0A 1A6LA 2GV1A 4ZPTR 2CVIA 1HYSA 2V5HG 3R6LB 1MMLA 2QFJA 2C1EB 4Q45A 4KPYA 1SIZA 1H73A 4DR5J 1L3KA 2WOMB 4HI1A 4ED7A 2ZHBA 3JSMA 3PX6A 4WP3A 2JSXA 1HWKA 1RSCA 2E5JA 1FFGB 3CWJA 3MAAA 3M2VB 3LGMA 2QX0A 2IRYA 2IVMA 5IZHA 1U02A 1HNIB 3MFIA 4RW9A 3J81j 2DNYA 2JEIA 3OTCA 4I7FA 3H5YA 2C3UA 3V6JA 2FQQB 4WBFA 1U26A 2FVQA 3A8IA 2ZE2A 2CDRB 4NWBA 3G71S 3DGVA 3PIPQ 3ZO7A 3FCVA 1EP4B 5F8JA 4KFBB 3K7RA 1MU2B 2A1BA 1BQNB 2R7QA 2XMKA 5KG4A 1U1KA 1VRTB 3O1LA 1S1UA 4LF4J 3D3BJ 3V81B 3UN3A 3OR1A 3KJVB 4MK9A 4F50A 2DKOB 4J9SA 3BR9A 2C42A 5JMNA 1X4EA 1NZ8A 1F2HA 5KFHA 4DSKA 1CJUA 1R8AA 1GNKA 3R3TA 1K9MT 2JVRA 4NI2A 4FKXA 3D6HB 5GVQA 4LSZB 3KLIB 2VQFJ 1U2CA 2M8HA 1ZM3A 2A2DA 4C8YA 4M5MA 2W8LA 2MHEA 4LRAA 1VS3A 3POTA 1QVFR 2HLTA 3S1TA 4EBEA 2ZEJA 5DM7Q 5GAHI 3M32B 5LXRA 2BKPA 3MOZA 3CCZA 1H7XA 3KG1A 4EYIB 4LVNP 1YHQS 2OMLA 2AGOA 2P8IA 3OUYB 5GAHU 3MTJA 4FXDA 3EYZA 1ZBTA 5FIIA 1YIJS 1YJVA 2G2ZA 3G8SA 5F8HA 3L95X 2H5EA 1QVGR 1LNQA 3H59A 2F4VJ 4OI2A 1RT2A 3TZXA 4JI6J 3UO0A 4Q44A 3P45B 2HLUA 2K1RA 3CDEA 2X1BA 4O4GB 5AT1B 3Q23A 5KT6A 3D4JA 2VD3A 2R8IA 1VQ4S 2JX2A 4I6AA 1NMEB 1NPRA 2HRYA 5L1LA 2VA2A 4YDDB 3CD7A 4J9UE 4DR7F 2B8QA 5CD4H 5IT9Y 4DN9A 3CE8A 3CC2S 3ZZPA 4C8OA 5DS7A 2FJVA 1N88A 4P2MA 1UWBA 1PBAA 1J5OB 1T03B 1VLOA 1VFJA 2FLNA 1I51B 4ZPDA 1LW0B 2X1AA 2IC3A 4LIRA 2RQ4A 3CCSS 3MPYA 4A4JA 1F5AA 2OPSB 1B0VA 4AT1B 1RA7A 1YZ7A 4CT8A 2GIQA 2V6AA 4TYAA 2WSCC 1VK3A 3HHLC 2VG7B 3HHEA 5HO4A 4X62F 4NYPA 3BO4A 2EEYA 5A8RB 2XMVA 1NK8A 1UAWA 2ZH1A 3UW1A 3HJFA 3MUMP 1UVMA 1IBLF 2R9LA 5D3GB 4B17A 2DEJA 1G4CA 1N54B 4HHHA 1WI6A 1R0AA 5JVHQ 1WSVA 5M2PA 3JB9k 1RHUB 4IR1A 3B4DA 1BLUA 5H1SV 4OQJA 2ZITA 4DX6A 5KG1A 3IC1A 2H4WB 4AXJA 3DDIA 1DBDA 2PN6A 4LFAJ 2DVIA 3DRPB 3Q8VA 1X60A 2ZBIA 4DR5F 2DHHA 3LGNA 2FGOA 2ZH6A 2EBGA 3CJKB 4CNZA 3TJ9A 2WVBA 5C2CA 2Q79A 3Q8RB 4DR1J 1REVB 4ECUA 4DF4A 1SJ1A 3Q8PB 2PMZD 3PG9A 1XQIA 1UL3A 2K06A 4CQ1A 1JKHB 3QYYA 3M2RB 3QJJA 1EKSA 3G6YA 1B70B 2XMWA 9ATCB 4MYUA 1NSPA 4KH0B 2HQFA 1NK4A 2VG6B 2KM8C 2HAFA 2UV8A 4JYAJ 2GCFA 2MGZA 4M5NA 1UZDA 3CDUA 1TV6A 2L08A 1ZPWX 2VB6A 4ZVEA 4B3RJ 3AOCA 3DFEA 2BE9B 4JP8A 2HNYA 3VAIA 1LV5A 1RCXB 1X4FA 3GIRA 2QA4G 5J2NB 3KOAA 1RGVA 2F3JA 4LF4F 2QYGA 1LKZA 3HZGA 3BZQA 4UTGA 2YWKA 3MMAA 4WZMA 3E3XA 4CI0B 4BDPA 3M05A 2YH0A 5ETNA 2FHMA 4GO7X 2OPRB 1WHXA 1MG7A 3DNCA 3UCGA 3MUTP 1MROA 1FVSA 2CNOB 5DZ7A 1RWPB 2HK2A 3DOLB 3D68A 2VQFF 5LMNJ 1DURA 2XWYA 3T1YF 3WC0A 3MM9B 4ECVA 2OMOA 3VGVA 4ANCA 3K5LA 3PFOA 1S99A 3NY0A 4PR6A 5J2PA 1HNVB 5HROB 2UZAA 4A8XA 4NMLA 2D3UA 4P7VA 1T9UA 2XS2A 2QRRA 4M8LA 2YWEA 3FEZA 4GMKA 4CH7A 4R0EA 4K59A 4ILMA 3HULA 1WDTA 2W01A 1U45A 1H74A 2C2KB 3EMTA 3M2UA 3BF4A 4KPCA 5I4MA 4JI6F 5B0DA 1G7CB 2ADBA 3N6NA 4DZDA 1IJFB 5KFDA 3TX8A 1RT3A 2OUGA 2HRUA 1U4BA 1R0CB 1CJKA 3R9LA 3QBCA 1YJ7A 1PC5A 4I1TA 2F9JA 1NK9A 3CNQP 3QAEA 5KFKA 3PY8A 1CJVB 4L3KA 1Q16B 2L48A 3SCJE 2LQBA 3OHBA 4CO2A 4PPZA 1R89A 2KXFA 4ANDA 3NBPA 1HBNA 4TQRA 1VYAA 2E7XA 3MD1A 3QGIA 1FKAF 4ZITA 1CC7A 4LFCJ 2PI5A 2IRXA 1U8SA 4WTOB 4P75A 4PZVA 4BWJA 1U1OA 1NHVA 3ZTRA 4PWWA 1RUSA 4ZOSA 4PCQA 5HMXA 2BQRA 2PIIA 4P74A 4KGMA 3KK1A 4K5RA 3ENAA 4EZ9A 2HS0A 1GMUA 4IG0B 4CLSA 2DJWA 5DDRC 2K2PA 4RWXA 4QU7A 1KKHA 1TQLA 4FF4A 2CNNB 1S6OA 1RKJA 3GP9A 4C8LA 3IBCB 5KFXA 2ZH4A 4M1KA 5HANA 2J76E 2HHHJ 5J1EA 3C8YA 2HKEA 4DZ6A 4J9QA 1HIYA 5AE2A 3V4IA 3MEKA 2GO8A 2IBKA 2H3EB 4HACB 3MR6A 1HNWJ 2V2KA 2QA2A 4HEA9 5HQLA 4QOTA 2XLKA 4P2FA 2UUAJ 3QGHA 4LFAF 1EARA 2G0CA 3OXLA 1FDNA 1URRA 2JFDA 2RH3A 1S5ZA 3CJQA 1H2VZ 2ZOGA 3EDQB 2O5DA 5K20B 2DD8S 4DR1F 1FKPA 1NPPA 2GQQA 4RUBA 2B4OA 1KP6A 3EPGA 2YKNB 4MMOA 2DRDA 3ILJA 4C11A 1WEXA 4OHYA 2YX1A 3TW0A 4B9VA 1RE1B 3IWXA 2VQEJ 3KJQB 3AA8A 4USUA 2OFGX 2U1AA 4U7UK 2GQCA 4JYAF 3I5AA 4W4MA 1BWEA 1IKXB 5IC4B 3WIUA 2HURA 4WP8A 2YY3A 2CQ3A 2RAQA 4B3RF 2V9KA 1E6YB 3UN5A 4DQIA 4M63A 2J8AA 4PAAA 3BB5A 3SDEA 1FDDA 2XY7A 4DG1B 1S9GB 2VUGA 4JOUA 4I2QA 1TVRA 2C3YA 2LXUA 3A12A 4Y65A 3ZXWA 2E5HA 3CJTA 1T05A 1U1QA 5H9FJ 3MCOA 3N0VA 4OYBA 4WK1A 3CCVS 1HARA 2B0GA 2V4JA 3DLEA 3GPAA 5LMNF 4HTJA 2HVIA 2DGXA 4KE5A 1N5VA 2HZVA 4ZPWR 4PYAA 1BY9A 4LT6A 1HNZF 3DDKA 1NO8A 3SIPB 1S6PB 2RS8A 2XM3A 4I68A 2DISA 1RU2A 1Y5IB 4EYHB 2G13A 3QGPA 1FTCA 1GFWB 2CQ0A 4JI5J 3VCDA 1WI8A 2LYVA 2DK2A 1S49A 3R8YA 3DRRA 6FDRA 1IR1A 3EVWA 4PQUB 3GCXP 4OHWA 3RTVA 3OFHA 2P6TA 3EE3A 3R2CJ 2V8PA 3C6TB 3L7PA 5GMKa 1RHKB 4OX6A 5C7PA 1QUVA 1ZAVA 3GV5B 5DG9A 2DNMA 4ECQA 4DSJA 2NPFA 1E6VB 4V19J 3T5JA 2YNHB 4AYBD 3KTQA 3BYRA 1B0PA 4QZVB 3UI3A 5KFLA 1SBRA 3TR5A 4DUTA 3CCWA 5HATA 3HSJA 2MTLA 3SSSA 2P5VA 1SKRA 4RW8A 2J0SD 4LFCF 1G3OA 3TRGA 4WXWA 2COLA 2RUSA 5LXYA 4M5KA 2VL1A 2G0JA 4QIEA 1I1GA 4DQSA 3MPDA 4UQTA 2HVDA 2ZC4A 4WYWA 1S57A 5LT5A 2I8EA 2AJ0A 3V6DB 4IUFA 3A3OB 2XSJA 1CJTB 3T5LA 3W66A 1X0FA 2FZCB 3UWTA 2EXUA 4C3LA 2HQIA 2HHHF 4JV1A 2CUYA 2BW2A 1ACMB 1WF2A 4K2JA 1HNWF 3FGVA 2JLGA 1MN9A 1H98A 3RR8A 2UUAF 1WG5A 5F3ZA 5EGYA 1L3VA 2RF2B 2V4RA 2BV3A 2FLOA 4ID5A 3P8BB 4ZP7A 4EEYA 4JI1J 3TQEA 4ZLPA 5IV3A 4LIWA 4H4OA 4RZRA 4LRCA 1PJ7A 3CSKA 4F4KA 1KVKA 1BQMB 2ASYA 1AUSL 2MB0B 2CQ1A 2MZ1A 2IM1A 2OEMA 4OI0A 3C19A 2AYGA 5T7LB 3D0IE 2D3OR 4W92B 2VQEF 3TAMB 3X1LB 2WOMA 4YUDA 1L3SA 5KAKA 4KHPJ 2MSTA 2V34A 4YB7A 5KFIA 4WU2A 3FNNA 2CQDA 2NQPA 2LEPA 3M2VA 2F4FA 4ZJQA 3QT5A 3MDFA 4HH1A 4KYZA 3BQ2A 2QL5B 1FDBA 2CPXA 3IWNC 3X3UA 5B08A 4ECTA 3QWPA 1HNIA 3PYDA 3MM5B 2B9YA 4XDCA 3TZYA 3JSRA 2PMWA 1R8PA 2MQLA 4X2BA 2MKJA 4OZJA 4DL3A 4PXEA 3N79A 1YJUA 4F4WA 3SFUA 3TUIC 1N6QB 1NPKA 5BYQA 1EP4A 1BHNA 5J2MB 4KFBA 2EC0A 1MU2A 2N4DA 1BQNA 4I69A 2IY5B 3AD7C 2CZVC 3L4BC 1DY3A 2HQDA 1VRTA 4RJVA 4CO4A 1YRTA 2UUTA 3V81A 4O3PA 2J0QD 1NLKL 2LQ5A 3KJVA 3HK2A 4OZ1A 4NASA 4PYDA 1VC5A 3E2EA 2ROEA 2HNZB 1HI0P 3BQ1A 4M5LA 1CQNA 4ZN3A 5GMDA 4JI5F 1X4CA 3KLIA 1UFKA 5CCMA 5LJ5Y 5I42B 4DV1J 4DV7J 5KFUA 4TU9A 3GG0A 2OAUA 1IR2A 2BA9A 5A8WB 1FE0A 4X4SA 3EWGA 1UVKA 2CWKA 4OZ2A 4F36A 1JJ2R 3HSGA 1EETB 3M32A 1UKUA 4QYRA 3FQLA 1TU0B 1H38A 2DBBA 1JLFB 2XNQA 3OUYA 3JYTB 3ZZRA 1JNZB 3GILA 4DPYA 3FEYB 3R7SB 4LQ3A 2AEJA 3GTYX 1H6KX 3BREA 3KDNA 5CCLA 2D9PA 2Y8YA 4YS2A 1D9FA 2HNDB 4PG8A 4O4GA 1QSYA 3O2IA 3M9NB 1HPZB 4WP9A 2VBZA 5L38A 4ZPCA 2A6MA 3N4WA 5E33A 4P7TA 3DN9A 3B6BA 2AD9A 2LDYA 5KFTA 2DPJA 3M8PB 2AYMA 4TXSA 4A47A 2EFNA 1RXOB 2A0FB 1JB0C 3OLAA 2AYBA 2QT7A 4ZJLA 4F3OA 1VBZA 4EU0A 2FJDB 4L75A 2QG9B 3UD5A 2CIMA 2JZ5A 4DQPA 4NLVA 2P9GA 1LWFB 2RRNA 3K57A 1URNA 4XO0A 5C5JA 2XULA 1H0HB 1J5OA 1T03A 1GXUA 4C0OC 1OJ4A 2U2FA 3JAMY 4PWDB 3CPWR 5KOWA 1IKVB 1LW0A 4GRSA 4O3SA 1C1BB 2OPSA 2KYZA 3CF5Q 2NUHA 3FRYA 4XIUA 2I0XA 3H5SA 3D0GE 4USTA 3JTPA 8AT1B 3PM9A 3S7RA 2VG7A 2E1PA 4LRBA 4Q2MA 2HPUA 2V63A 1K8AT 2QFIA 5A8RA 1MWQA 1S6QB 3HHKA 5LM7E 2YQ1A 1DRZA 3R97A 1LWXA 4LBPA 5D3GA 2C2OB 3M8WA 4CO0A 4XPEA 4JI1F 4DPWA 1PGZA 3C16B 2DH7A 4O44B 3U1MA 1NKCA 3PJWA 4F04B 2XGQA 1LWEB 2RDJA 1H3DA 1I94J 3VQSA 2W2OP 2ROPA 2AJ2A 5CHCB 4QBUA 2G2YA 2DH8A 2G9OA 1U47A 3BKTA 1RISA 3I4HX 5FJ4A 4UOHA 4C8ZA 3N6MA 3DRPA 3TARA 1GH8A 3QJPA 2C2ZB 2GAGC 4Q8EA 4NCGB 4DQQA 1P1LA 3ZZOA 1RT1B 3CJKA 4DV2J 1Q7YT 3HX9A 1ZPVA 1REVA 4X66J 2RKIB 3PYEA 2V69A 2HWTA 2NREA 4ETZA 4RNFA 4OV6A 3KK2B 1NK5A 3TOQA 2E29A 3S8SA 1WTBA 1CC8A 4ZCMA 1JKHA 3M2RA 1VISA 3T3FA 4FF1A 3OFGA 2DGOA 3UR3C 1K0TA 4B3SJ 4QR2A 1IQZA 5DGBA 2H65B 1JMTA 4J5OA 2XTJP 1AA1B 4DPUA 1HBUB 2VG6A 3PXGa 3T6JA 2ZH8A 2UXCJ 3BBCA 4O3OA 2YPYA 5A6WA 2OFHX 2ZBCA 4QR0A 3H8YA 5A2QY 4TY9A 2ZKUA 1UJ6A 2VONA 5J2NA 2WSFC 2NXCA 1RAOA 2H48B 4RU2A 2B4UA 3GJQB 3ITHB 2X3DA 2A18A 2OPRA 1HA1A 3W65A 3BV8A 3R27A 3QRQA 1RTDB 4CLKA 4TU7A 5K14B 3VZHA 5F9NA 4QIGA 2NXNA 2MZJA 1NK6A 2K3KA 3DOLA 4D3HA 4DV1F 4DV7F 3MM9A 1V5IB 4ECWA 5CD4A 4FN5A 2IM3A 2FPHX 5DDQC 4EO6A 4IKAA 1VQMS 5L1IA 1HNVA 5HROA 2AHOB 1F3VA 4HT5A 4JV2A 2YNIB 3ENWA 3GIMA 3M8ZA 3VGUA 2FTRA 4M5GA 1UVNA 1UEUA 2CJQA 3QJLA 4O0IA 3M30B 2KN4A 4DU8A 3I87A 3NS5A 2EKNA 2GMHA 3HT3A 4YR2A 1T3NA 1AFIA 4UQGA 3KK3B 2GIFA 3RU0A 3RRKA 1DAXA 3W3SA 1Z4UA 1RBOB 5M2RA 3MPWA 4Z2XA 1KQGB 1UW4A 4NLSA 3OVSA 2MKSA 2M88A 4X4NA 1OY8A 5I3PA 5HQ8A 3SSRA 1Y7PA 2AX1A 2DNLA 2KFNA 3J80U 4HLBA 2YQ3A 5IT4A 1UW9A 1CJVA 4FKYA 3MFHA 1FK9B 3PDNA 2IVYA 1KONA 1TKTB 4F67A 1SC6A 1FO1A 4DL5A 3BDEA 4OX8A 4A48A 2R2SA 2BQ3A 2HFOA 2OD6A 3NP5A 2AT1B 2W8KA 3RG6A 4X65J 3L3CA 1KSPA 2KU7A 1DHMA 2EKYA 4PQAA 4R25A 1IM6A 1S4EA 3NCQA 4UY8T 4OYMA 1FESA 2C3MA 3QAUA 3Q83A 4PPDA 4IG0A 2CA9A 1M1GA 2EK1A 4RU9A 1FDAA 2HGMA 5E41A 3CW2C 5CAAA 4C97A 4ZKAA 3FBFA 2L9NA 4PG5A 4M5JA 1RKIA 3OT9A 2LXIA 3WDOA 5KG6A 3FSIA 4DQRA 4J7CA 3SCIE 3LA0A 4M5DB 3TZWA 3K5NA 4Z37A 2K7KA 1Q5YA 2PMHA 4KB7A 2HS3A 3ONQA 4GC6A 2I1RA 1I94F 5A76A 3D6TB 2XSFA 3HMJG 4HACA 4WKYA 2I6WA 3GZ7A 3VALA 2UXBJ 4DF8A 3Q8QB 2Z30B 2ZKTA 4LFBJ 4BC9A 3KHRA 5KFEA 4LRDA 3RUBL 1OS5A 3NLCA 5D4OA 3KFWX 1S97A 2HGNA 1YJWS 3KLGB 4DV2F 1GAOA 4C98A 2DY1A 4X66F 1M5SA 3BR8A 1ZAWA 1LOUA 1Q0NA 2GC8A 2V8VA 4H4MA 4CWBA 2ZJQQ 2DCLA 3JS9A 1UFWA 4KRWA 4L72B 2YNFB 2YKNA 5BYSA 2LVWA 5B0CA 4C2MA 3EGZA 3NXZA 2VC1A 4B3SF 2BRLA 3KHLA 1K1QA 2W2QP 5KFMA 2FLLA 4QU6A 1EKRA 3I32A 3IP0A 1NUEA 2N3LA 1IKXA 1AB8A 2UXCF 5IM0B 4CLLA 2IYGA 4OJ3A 1GTHA 3MM7B 4B9TA 2J7UA 4YR0A 5CYJA 1E6YA 2HIYA 4F7VA 2VPXB 3OW2R 4OLOA 3QRRA 3EXCX 1APSA 5KFAA 4NLXA 3HI9A 4DG1A 1S9GA 2RU3A 3VAHA 2ZDPA 1TAUA 2WTFA 2R7UA 2EBEA 2F8EX 2DR6A 2FVRA 3FBCA 1U49A 3TAPA 1TK0A 1YWXA 4TNOA 3E01B 3IM9A 3J7YI 2Y1RI 1GMWD 4Y0FA 4F0KA 3MGJA 2XI3A 3BYPA 1S6PA 3G4SS 1ZS6A 4Y2KA 1X31C 3A4TA 4LRFA 2RIJA 3RYLA 3UE2A 3QIDA 1D09B 1TL3B 4AE5A 3PRDA 2QN6B 1KLMB 5KFOA 1M1KT 4I67A 3U27A 2CQBA 1JQGA 4PQUA 3D1HA 4Q7AA 1FJ7A 4OMFG 2B9XA 3C6TA 1QAJA 1FFWB 5D4PA 2GZOA 2MLXA 2MZRA 1S72S 1F5BA 3M8YA 1E6VA 2YNHA 2MY7A 1RAJA 2HFVA 3SXLA 4CP5A 1DZ5A 1R27B 4JI7J 2DYAA 2I9SA 2CPDA 4DU7A 2PFFB 2VOOA 3M6WA 3Q86A 4P52A 3OPKA 4MKBA 2B8PA 1TKZB 5KFZA 3VV2B 5HSPA 4IDKB 2RE1A 5KT3A 3PX0A 1T3OA 3LANA 5LMUJ 3W2WB 5HK4A 3OXFA 3DXSX 4X65F 2QL7B 1IM4A 4DLEA 4RBUA 1PYOB 4KH1B 3TQ1A 1BD6A 2C2MB 1SL0A 4BHQA 4DR4J 1NCLA 1U2FA 2NXJA 4RUAA 2E5IA 2XZWA 1T9WA 1N0VC 3C46A 3V6DA 2UUBJ 3KNGA 4XTTA 1CJTA 1ZZFA 1VRUB 2DH9A 4IRDA 4CTAB 3K2YA 3CUNA 1GK8A 3EM1A 2C2RA 4ES2A 3VAGA 1WG4A 3E8OA 5IT0A 5GADI 5L1KA 3EGWB 3HVWA 3JTNA 4NLTA 4OJGA 3HO1A 2BXJA 3ET6B 1UTAA 1NHKL 4G6VB 4KGVB 1R7IA 1FJEB 2HYIB 2UXBF 2BEFA 3DRXA 5IOLA 2RF2A 4CRJA 4LFBF 3MD3A 4RPFA 5ETRA 4N41A 5KFRA 4MKAA 3PKMA 8RUCA 3NMAA 1CLFA 4K4ZA 3W8GA 1Y11A 5IC6B 3HKWA 4QIWD 3GSIA 2RD5C 1BQMA 4DPXA 3MHYA 1RWWB 1RQ0A 4RBVA 1N33J 5T7LA 3B78A 5KG0A 1HWIA 2HZCA 2W2PP 3GIJA 3TAMA 5EWEA 1K0VA 4Y28C 4WE1B 4V1Ak 4EBDA 1FWPA 4LVOP 3WBZA 2KL8A 1YJTA 4WU3A 2GFFA 4C7QA 5DG8A 3RBEA 2V2QA 4XK8C 3IA0A 3K0JA 1RWKB 2XEXA 1PJ6A 3MM5A 4ZVTB 2V9WA 2ILZA 1S0NA 1N8RT 3H0PA 1IQTA 2KJWA 1F1BB 3DI6A 2CVEA 2WK4A 3Q8UA 2WRMA 4NZ6A 3KNAA 3W5ZA 4ETXA 1SKWA 2R8JA 1N6QA 3SYZA 3D9BA 4I6WA 5E5NA 3ZZZA 5J2MA 5B0FA 3TANA 1I6JA 1IJEB 4NRUA 4B3OB 2LXFA 1RAGB 2XY6A 5EUHA 2CKWA 3J7Z5 2D69A 2HZAA 3QATA 1FEEA 1RACB 3GMGA 2BKOA 4ZLJA 1RZMA 4NPOA 2ERRA 2XZTB 2HNZA 4M5HA 4X4TA 2DRAA 4DFJA 1TK5A 2IJRA 1YBTA 1F3FA 3QIPB 5I42A 3NCRA 4OFZA 1RK8A 1UVLA 5DO2A 1EQMA 5T14A 1TL5A 2BM1A 5A8WA 2JOQA 1Q1KA 1FA0A 1PC4A 2MYFA 2M8DB 1EETA 3RGIA 3D1QA 4DSIA 4ER8A 2MDAA 1JLFA 2JC0A 3GJRB 3JYTA 3NG8A 3W9JA 2PEBA 5B0GA 1MWYA 2VV5A 3NGRA 1IKWB 1FD8A 2KRRA 4JI7F 2E5GA 4DN0A 1WC5A 4F26A 2CQHA 1S79A 3M7VA 1S1VB 2HHWA 4NCBA 2HNDA 4DS5A 2FY8A 1XR7A 2DB1A 3RZAA 2W4DA 1HPZA 3QZ7A 2FVSA 4IFVB 5ETSA 5LMUF 2KTQA 1RT5B 3FFIB 1M5OC 1RLDA 5LL6d 4WCEQ 1WJ9A 3M8PA 1ZTWA 2A2CA 4ED8A 2HVZA 1JJHA 1TP7A 2AU0A 4YHHJ 2AJ4A 2IA0A 3VZIA 4DR4F 1SIWB 4ZS6A 1VC0A 1LWFA 3M8QB 1HQEB 1RADB 2UUBF 2E66A 1VC6A 4PWDA 4RNNA 1YTYA 4B02A 3MPUB 1IKVA 2ZBRA 4HTIA 1C1BA 2ADCA 2BOAA 2NLWA 1DQAA 2O66A 3TA1A 4J9VA 3ZC4A 3PYFA 4KHMA 4EWTA 1YLXA 1UETA 4J37A 3KLHB 1OWXA 1S6QA 1T9TA 2EVZA 2J0XA 1FEHA 4S0MA 2D7SA 2JC1A 1S10A 4RNHA 2YWFA 3ILIA 4NRTA 5MLCV 1QD1A 5D77A 1S12A 4DV6F 1UJ4A 3C16A 4O44A 1LWEA 1IXKA 2PE8A 3MR2A 2ZBPA 2VBXA 3PVXA 3RBDA 3OFFA 1C0TB 1N33F 1G6BA 2XMUA 5KT7A 4ANEA 2MQNA 3ZZ0A 3A13A 4NCGA 5DZ6A 4OZ3A 1WDDA 1RT1A 3BPDA 3B54A 4ELUA 2JNJA 1SL1A 2RKIA 2P6SA 1KFSA 1PSDA 4OI1A 2N3OA 2FY1A 2R7VA 1NJIT 3DC2A 3KK2A 3H5XA 4GKKJ 4QPXA 2P9CA 4XDDA 3KUEA 1M0SA 1NDPA 1GXTA 3PFEA 1Y0HA 5F8LA 3N9UC 5KFQA 5G4DA 1IBKJ 4C0BA 3HCXA 2RQCA 4CNYA 1REGX 5ADZA 5L8RC 1HBUA 5B0BA 4DUYJ 2UVVA 1YBUA 3VF0B 3PV8A 2BJDA 3EXYA 4U8VA 4LBHA 4RW6B 3P6YC 4FVCA 2BABA 2DNGA 2LECA 2X1GA 5C2GA 3W64A 5DDPC 2XG8A 3ZZUA 2H9ZA 3VAMA 3CO9A 1DQ9A 2LLZA 2JWNA 4LF9J 3EZUA 4QYZJ 3BGOP 2XLJA 4K4TA 1RTDA 1G2EA 3PW7A 5K14A 4HL9A 3MCMA 5K9FA 5HJXA 1JLEB 2N82B 4ZJOA 3OR2B 5AXKA 2MLYA 1RWOB 1WHYA 5FDLB 2QL9B 3KUGA 2F65A 4WFYA 4AL6A 3R5GA 4ALZA 3D28A 3N28A 1SI9A 4JV5J 4B9NA 1B7FA 1LWCB 2VF3A 2UXDJ 2BKNA 2DNQA 5F0WA 2DRBA 2YWGA 2YNIA 2IIHA 4K7QA 4CH1A 4KTQA 5H9EK 5L9XA 2IPOB 3PRBA 1WSRA 3QSIA 3G2XA 3DXBA 3UCZP 1R8CA 4OI3A 3M30A 2AEFA 2JRSA 3OBIA 2VKZG 2UV8G 2IHR1 4DR2J 1AROP 2FJBB 2HHTA 3TO8A 1VR6A 2ASLA 3KK3A 4F2RA 1SJFA 2JJ4D 1K44A 3SQGB 2AW0A 3BS9A 3O6QA 1C0UB 3H4DA 3VVTA 4QW9A 2EG2A 3IS9B 2AGPA 2AZ3A 2PGCA 1S7HA 3ZZTA 2LQ9A 2LU2A 2POKA 4RL1A 5DJBA 1DTQB 3K17A 2ABYA 1W7WA 1XMOJ 1H2UX 4E98A 1SH3A 5DG7A 3SI8A 2W7OA 3FBEA 2O01C 2Y1JA 4YHHF 4K4VA 4M5IA 4DCJB 2AX0A 4Z7CA 4ZA1A 1FK9A 2WVCA 4OYZA 4I2PA 5GAEU 1TKTA 4LF1A 2XY5A 5KT5A 4NYZA 1Q82T 4N76A 5KG7A 4Y2AA 3I0RB 4OYWA 2XHWA 4QWEA 1T94A 3NEKA 4RNOA 2B9EA 1YSJA 4G1QB 4E8UA 3UR0A 1P8GA 2WHOA 3V4MA 3SSQA 4FDFA 2J6SA 4ZLLA 1V6HA 2VZ9A 1XERA 4DX8H 1WF1A 4F0HA 3D0HE 3GR1A 2CQGA 3WHIA 4ECRA 1TFYA 1IN0A 3N5BA 5GMEA 3VAFA 1UA1A 4L74A 1U2RA 4KKOB 3MMCB 4M5DA 2VJVA 5IQ6A 1SV5B 4UZBA 3IRXB 1ZA1B 1WUUA 3TJ8A 2J9CA 2MEWA 3RB4A 2HMIB 2BW7A 3KJFB 5DQIA 4PG4A 3CCMS 3NGTA 1V3ZA 1YRUA 3O44A 4ZVPB 3R1LA 1NJZA 1N36J 2JDJA 2GW8A 3MMJA 2GX8A 4LF7J 4OHXA 3KLGA 1F6TA 1RAEB 3R2DJ 4USVA 3R5DA 3ADAC 4IRCA 1O6XA 3A8EA 2R7SA 1GMWA 2XQCA 3O3LA 1N32J 2IDEA 1L5UA 4GKKF 3BSAA 2YNFA 3UD4P 4CLPA 1YQHA 2VFRA 2VICA 3MTKA 1VQ5S 3HD2A 2R3VA 1K73T 2GA7A 3PKYA 3T1YJ 2B3TB 4HT7A 1AUDA 4L6V3 4USIA 1X5TA 1IBKF 2MKHA 1R0BG 4ZVRB 3JTOA 5IQQA 4ED6A 1FXLA 2OSQA 1DJ0A 3QT6A 4DUYF 4FYWB 2NXEA 5IM0A 1HHTP 4OHVA 3CJ0A 3MM7A 1QY7A 4PXBA 4B9SA 1SJQA 2YVSA 2C28A 2JHEA 2ROGA 3CIMA 5KFBA 5KTQA 1WWHA 3DLGB 2PFDA 4L3NA 1NNDA 2ZD1B 4BBYA 3THPA 2V2VA 2UU9J 3R5BA 2HRTA 3SFGA 3R7NB 3CDWA 1P6TA 4URQU 3I9V9 4DFPA 3T6BA 1VQKS 2ZHOA 2MKYA 4IH6A 4LF9F 1QE1B 2R7TA 3OJUA 3R7BB 4YFUA 2CJKA 2PT0A 5GAGI 1MW7A 2V50A 4WYLA 2NCKL 3E01A 5ETQA 2DT9A 3PTWA 3GYXB 3OV7A 2PA3A 5E2QA 4Y34A 1ZM9A 2YKPA 1UCNA 4YR3A 3EUNA 4JV5F 3F0NA 3EX7B 4NOHA 2Q6BA 2LEBA 2UXDF 3BGLA 1FD2A 3NS6A 2FDNA 4ZVSB 2FZGB 1TL3A 3FZBA 4F25A 1KLMA 4IQXA 4CO1A 5L46A 2R7RA 2E7VA 3T9NA 3SV3A 2RRAA 3M6UA 2Y0SD 1JK9B 4DR2F 2XMTA 3BM7A 4WIQA 3BKUA 3NOCA 1VI7A 3HP6A 1ZZNA 1RJJA 3C3LA 1OPZA 1FT8A 1EZZB 3HFKA 4J9NA 4FVMA 2Z57B 4K5SA 4JI4J 1XMOF 3NAIA 2LFVA 1U48A 1FRMA 2CDQA 1BWVA 2ZUGA 3C6UB 2B7CB 2VFUA 3E51A 3JSYA 3EDRB 1C4CA 1TKZA 3ZNUA 4JI2J 2NUUG 5M2UA 5C25B 1IVZA 4IDKA 1IKYB 4FPIA 4UW2A 1FX2A 2PEHA 1VQOS 3BPSP 3W2WA 4NLRA 5SZTA 4BCAA 3JQJA 1KN6A 1VDHA 3OVBA 4ZVFA 3IR7B 4K8RA 4OYAA 1CQMA 3DRSB 2M4MA 3PYGA 1WTFA 1EHWA 5AJ3J 2ZH7A 1IBMF 2UUWA 4WFZA 1VRUA 4CTAA 5ITHA 4ZK7M 4WPAA 1VQPS 3QT8A 3A3PB 2KFYA 2XLIA 3B4MA 4LF5J 3AQPA 2KRBA 1D3WA 1VQNS 1NHUA 4FNIA 2CJ9A 4UF4A 2WVEA 3ET6A 4GC7A 4I6YA 3C14B 1PCAA 4ZCLA 4RKUC 3U1NA 1Q8BA 5B0EA 2ZJPQ 4CT9A 3H25A 4L73A 1V9OA 4A8KA 3H98A 1N36F 4G65A 1X8DA 5ETVA 1I3OB 3LAKA 1SUQB 4LF7F 1IUJA 1PBUA 2YBVA 1X4DA 1HQUB 2N7CA 4GKJF 4PEOA 1KD1T 5KFFA 4NZ7A 1N32F 2KVIA 2C2DA 2BMBA 1PG5B 1Q8KA 2O3DA 3KUHA 4DUZJ 2YNGB 4Y2IA 4PG6A 1KC8T 3RW6A 4FF2A 4DCPB 2J8SA 3D2WA 1OMSA 4NXMJ 4AL5A 4KV8B 4WE1A 3L7UA 1KEKA 5DLFA 1I5OB 1HNZJ 4KT0C 3AQOA 4IQMA 2X51A 1KOOA 2HWIA 3JQKA 3TVYA 3K5PA 1S0OA 4DPTA 2DXFA 2HSEB 4YB6A 2UU9F 5E0OA 1DFDA 1TUVA 3LWLA 2DGVA 3UPFA 3H4BA 3G8TA 3NWGA 4ZCKA 3W1YC 1PJ5A 4CM2A 1WEZA 3UD3P 3FEXB 3OFEA 1B7YB 1YI2S 1FERA 4N7TA 4JBCA 3W2VB 4B3OA 3ISZA 4A8YA 1F0XA 1Q53A 3RBXA 3JXOA 5KFNA 2GS8A 5ETTA 1Q5VA 1VBKA 4TKTA 2OELA 1WOPA 2Z2LA 4DV4J 1NSKL 1YJ9S 3BH7B 3R5JB 2P2CB 2DNNA 3MEDB 3PJ9A 2OH2A 1NB2A 1QSLA 3AJ1A 5LJ3Y 1JIHA 2B4VA 2ZH3A 3QIPA 2OIHA 2FVCA 2FHJA 4TN2A 3M6VA 4RNMA 3Q8YA 3U7JA 4TY8B 2F8MA 1D9AA 3G96A 3GJTB 4I4BA 1PKUA 3CGIA 5THWA 5CXTA 4MYTA 1XNRJ 4OJ1A 3W7BA 1D0EA 4JI4F 3NNCA 3IGNA 2ATLA 2HIQA 1IKWA 2YX4A 3KLFB 4U67Q 3J81U 2HBZB 4WF9Q 2HQCA 1S1VA 4TLQA 1T8EA 1U0HB 1F2GA 3I5CA 4JI2F 1KVIA 3FKBA 3OJSA 4N56A 4MH8A 1RT7B 2ZNYA 4IFVA 4N47A 3BGRB 2Y8WA 5IFMA 1RT5A 3DM2B 3FFIA 1TUWA 5HBMB 5D0RA 3OHAA 2VBWA 1YKWA 2B51A 2ZC3A 4Y6IA 4JI3J 1NKBA 2DNPA 1BMQB 1X4GA 5AXNA 3LWMA 3LOUA 4CLFA 2MQQA 4AQYJ 4QCLA 2B5JB 1RT6B 3M8QA 1HQEA 3QWUA 5AJ3F 3LH2S 3PZPA 4CCHA 5K5MA 2DR8A 2RVJA 4L76A 2CG8A 4LF5F 1TMJA 3MEEB 2J7WA 4OZLA 1Q4RA 2AGQA 4AUKA 4QWCA 2IJNA 1VJWA 4DWIA 2V68A 3ZTPA 4HHJA 3KLHA 4WWSA 4NLDA 4QWBA 4B9UA 4CLUA 1VBXA 1ICEB 1RAHB 1T11A 1PO6A 1J5EJ 2I5JB 4C4WA 3ETMA 5KT2A 1M5KC 3TVKA 3LW5C 4X4QA 4CYUB 4A8SA 4IYQA 4W98A 3NL0A 4WXOA 3TVZA 3T41A 4TYBA 4DUZF 3RJMB 1NH7A 2GNKA 1C0TA 1HWJA 3LAMA 3IO1A 3PEJA 5F8IA 4DLGA 4NXMF 3HJVA 4P72A 1FFSB 1RT4B 4ATNA 3F44A 1UPPA 3MM8B 1BGXT 4ZIVA 4B08A 3ILLA 4DX7A 4NLGA 2ILYA 4TQSA 2AP6A 4H4KC 4DMZA 4NXNJ 2DNZA 3I56S 1K1SA 5D4LA 5J2QB 2VC0A 1JLGB 4PWUA 3UVJB 4C48A 3GCWP 4DV5J 2KI2A 3WQPA 4F4ZA 4RW6A 2HFUA 2DGUA 3MUVP 3RBZA 3CJ8A 1HQ2A 2X3GA 4P73A 3IM8A 4C3MA 5AE3A 2MSSA 5EHHA 1FRJA 3BSNA 4EFAC 4A8FA 1VIOA 2HBQB 3Q8SB 2WONB 5H9FK 4UOGA 1RWUA 3AOAA 1B4SA 4F0MA 3KDOA 4DV4F 3QGGA 2KXNB 1AZSB 4KIAA 1Q7LB 2CZ9A 4IO9Q 2VU5A 1Q8IA 4U7UD 3PCOB 3NOGA 4ERDA 1JLEA 4ZVUB 1Y5NB 2W9AA 4Q8FA 3OR2A 3PJXA 3CC4S 4OZ0A 5FDLA 5C42B 3P3DA 4CLZA 1LEOA 4KO0B 4M94A 1FRXA 5JXSA 3ENVA 1RBLA 4PXCA 4YP3A 4NEYA 5HVGA 6AT1B 1LWCA 1VGYA 2VBYA 3GG1A 2FD2A 4ZP9A 1XNRF 1XJWB 1QLNA 2GGPB 2EG1A 4YB1P 1D8ZA 2DIUA 3SEOA 2FJXA 1JX4A 4Q43A 2ZVIA 3LGHA 2MXYA 5RUBA 3FMBA 1HBMB 2HHPA 4O3RA 1NKEA 1XIQA 3AB2B 2WW4A 1A7GE 3MURP 2AQ4A 3MR3A 5K8NA 2FHKA 2E1MC 4B3TJ 4MT1A 3SQGA 2DNOA 1C0UA 3IS9A 2CJXB 1Y5LB 2C22A 1AT1B 2I38A 4HYKA 4M95A 3AT1B 3TP2A 4IG3B 1DTQA 4Q2LA 3AY0A 3TAQA 4R8UB 4JI3F 2RMLA 1NU4A 2IJFA 1SCJB 2RUGA 1N34J 3A8KA 1Z2LA 3CCQS 2QLFB 4AQYF 4EGLA 3EPIA 4J90A 2KT2A 1KHWA 1NDLA 2CJAA 1RBAA 2MQMA 1SC1B 2HG4A 3L7OA 4DBQA 2BBEA 2KYXA 2NYIA 2BUNA 5IXUA 1OSDA 2XHCA 2CPFA 2BVZA 1WELA 3I31A 3I0RA 2W7PA 4KBIA 4CDIA 4G1QA 1QAIA 1FJGJ 4R5PB 3G6XA 1OY9A 3I55S 2DGWA 1WHWA 2ZOMA 4ZLNA 5D0HA 5IT9U 1VQYA 3RB6A 3DYAB 2KG1A 1Q81T 2XI2A 1FRHA 1XMBA 1M5PC 2DO4A 5G0RB 4EZ6A 4N77A 2H5JB 4O3QA 2FC8A 5DM6Q 3TI0A 3UNYA 2DR9A 1NZAA 1J5EF 3H40A 4KKOA 3MMCA 3LP2B 1SV5A 3HZEA 3H5UA 3IRXA 2W2MP 3LTOA 3RAQA 5L9NA 3GFHA 2HMIA 3TUZC 3G8QA 1V3RA 1RDRA 2YWWA 1OIAA 4X4OA 1OPIA 1SQFA 2MZSA 1SC4B 2ASJA 2MY8A 1G1XA 3H2LA 3KHHA 3DLHA 2R7OA 3HFVA 3NRBA 4RO0A 4RW7B 3IWLA 3G86A 1OO0B 4HDHA 4N5SA 1R43A 3W5XA 2RILA 1RAAB 3AH6A 3A3NB 4NXNF 1TL1B 3N5FA 2CPEA 3M8SA 2E1AA 3KG0A 5DQGA 2BE7D 3VR1A 3THTA 1XBWA 1U6FA 2M0GB 1Q79A 4ZVHA 4DV5F 2E9RX 2IA6A 3RAMA 3P4UB 3MWBA 3D1OA 4FPRA 4DR6J 2M70A 1F9HA 3DLGA 2ZD1A 1EJ7L 1BXNA 5HJYA 3W8PA 2KJVA 1M5HA 3KG4A 1DTTB 5D6GA 1X4HA 2E9ZA 1SL2A 1QE1A 2IYIA 5HLFB 1U24A 4LUBA 2XCAA 4DSFA 2BRKA 5IWAJ 1KNZA 4P2XA 2GIRA 2QE5A 3PO4A 2B43A 4NA2A 1W26A 4LF2A 3EJMA 1RYSA 1CEZA 5CYQB 3FZ2A 3W9IA 3OL9A 2XNRA 3ZZYA 1TZ0A 1T02A 2B4PA 2DEIA 2FJAB 2IFXA 4IH5A 3DOKB 4LSLB 3OTDA 3MR7A 4ECZA 4C0HA 4IR9A 1S6UA 3Q89A 4ED2A 1WD6A 5KFGA 1RWNB 4EBCA 3DOMB 1ZAXA 1ZM4A 4OYXA 4KGXB 4URSA 4KY3A 4OX7A 3ENQA 2FIUA 2ZH5A 3ETOA 2QZ8A 4IH7A 4ID8A 2RRBA 1WORA 4K2XA 1SH2A 4MKYA 3J7ZT 3KLVA 2DXDA 2IM2A 3IFEA 4CIOA 3DLKB 4HVZA 2E1CA 2AWZA 4WJBA 2H5IB 2AIRB 1B64A 1JNRB 4B3TF 3TX0A 3MCNA 2W2NP 1JXVA 3CMAS 1SKSA 1HBOB 4X4RA 3GFYA 2AZ1A 4OHZA 4ELVA 4LJMA 2FB0A 1VQ9S 2EI5A 2HQ3A 4NA1A 4ZVQB 4YQWA 1N34F 3I82A 3C6UA 3SMZA 4XAKA 2CYYA 2YX7A 4HH0A 5C25A 1WKKA 3FUYA 1IKYA 3A1YG 2XC9A 3ISND 4ZP8A 3CCUS 1VOMA 2MKKA 2AJFE 2EFPA 4RLEA 1LQ9A 3ZNJ1 1MN7A 1Y4ZB 1RWMB 2GVDB 1IWGA 3PHEA 1FJGF 4U8YA 3UDVA 2JVOA 2PDAA 1YITS 4DEZA 3DRSA 2KFZA 2W9CB 4TLRA 4XPCA 1TELA 4NL5A 3HM9A 2VIHA 1WKLA 3TA2A 2OO4A 2HHUA 3JQMA 5F0UA 3GQCA 3BN7A 1HNXJ 3TUPA 4IFYB 3IAS9 3FCHA 7FD1A 3CT9A 2QIFA 2EWHA 4ES1A 2LA6A 3IRWP 3FCWA 4H54A 5CZVA 3CCRS 3S01A 3C14A 4KSEB 1HL6A 3Q2SC 1F60B 1RLCL 5J1NA 2XS7A 1SUQA 1NSQA 2GMJA 4K4XA 3G87A 1HQUA 3DCAA 2NR0A 2WCXA 3K5MA 2D74B 3TWZA 1CG2A 1P27B 2L41A 3O8WA 3CJ4A 1DQ8A 3N6LA 2A10A 1HHSA 2WW8A 4DOZA 2YNGA 1C1CB 2QO3A 1X4AA 2UUCJ 2CZ4A 3BO2A 3BGUA 4KV8A 1K47A 2GMLA 3DMJB 1FXRA 1CULB 1OYDA 4UZCA 2OD4A 4Y3CA 3MEGB 3MCSA 4OJHA 1OY6A 1Q78A 1ZYQA 2IRUA 2F1FA 3HVTB 2HBRB 1FTRA 4DR6F 5D0GA 1KBRA 1FRKA 1VQLS 1RABB 2Q66A 2HFSA 3DKDA 3WC2A 4FYXB 1RP5A 2YKAA 2AV5A 3Q2TC 1N5SA 3CIZA 4RUCA 1N5QA 4P6QA 4DV3J 2F4VF 3VAKA 2W7AA 5HAOA 1U1PA 1KR4A 2QJ3A 1JWWA 4RR5A 4WIIA 4NCAA 4ZVGA 3GFZA 3HSDA 1N5YB 3DU6A 1B3TA 4LSNB 5IWAF 2R2UA 2D3O1 2BR0A 1HW9A 3LALA 2YPZA 1AW0A 3BO3A 1U09A 4A8MP 5A0YB 3W2VA 2OP5A 5CQGA 4IO1A 3NGSA 4MKVA 1R31A 2W9BB 1UP1A 3R5AA 4GO5X 2DHXA 2BE2B 3UDCA 3NGUA 2Z4PA 2X1FA 1FNOA 1UMJA 4J9OA 2HHSA 2DGSA 2NSCA 2DXEA 2QMWA 4USMA 1RTIB 2BANB 2VFTA 1FVQA 5KFJA 3MEDA 1BC6A 5FLXU 3IAM9 1LK7A 1MNEA 3RW7A 2E9TA 3OL7A 1S59A 4J9KA 1TKXB 3TZZA 2HS4A 4TY8A 4EK2A 3B8HA 1NM2A 2GVZB 2BJ3A 2QLJB 3U02A 3OQ2A 2ZJRQ 4CO3A 2DNKA 4YDXA 5I3UB 1QUPA 3MR5A 3NGKA 1KS2A 2QMXA 3G82B 4J9RA 3KLFA 1WACA 2QSWA 2MMYA 4DL2A 4CM0A 2QA4S 2B6AB 2G1HA 4WFXA 2Y1LB 1U0HA 3OTEA 3KYLA 1HMVB 3DGPB 1Q95G 2V8DA 2LMIA 2M2BA 1RT7A 3BGRA 3DM2A 4ENOA 5HBMA 2I2YA 1T9VA 1P1TA 5HMZA 2R2RA 3LO3A 1W25A 1KRPA 1KOHA 4F4AA 5F9LA 3GJSB 1S4FA 1R3NA 1PYTA 2KVQE 3BKFA 2Z8QA 2HHVA 5KFSA 2B5JA 1RT6A 3AJDA 3C66A 3RB0A 3DDNA 4H4MB 1TR0A 1YRXA 1HNXF 4WK3A 3K8VA 3R6GB 4X4VA 4ELTA 2XO6A 1FNXH 3MEEA 2KH9A 4B9LA 3CCES 1HD0A 2HHQA 4WFBQ 4U9RA 4QWAA 2QC3A 2VH7A 4LBIA 4NEZA 2HVEA 3JSBA 1S0MA 3KMQA 1BQXA 1TL4A 2I5JA 1YJRA 3J80Y 3VTIA 4CYUA 2JL9A 3RB3A 1UEVA 2RHQB 2IAJB 2RS2A 1AYEA 1AFJA 6FD1A 3D6MB 3AD8C 1M90T 2ALYB 5FLXY 2J6TA 1X5SA 2UUCF 2JLFA 5AXLA 4USWA 3I9ZA 2M52A 1QAXA 2IVFB 4ED5A 4MFBB 1RT4A 3AOBA 2VKRA 3M6XA 3L09A 3J7YU 3MM8A 3QFWA 1ZH5A 4HHUA 1JLQB 3QRPA 4USHA 2BX6A 5BJRA 4USKA 4BS2A 1U25A 2HBYB 2CQ2A 1Q86T 1FXDA 2F8HA 1FKOB 2FZKB 2BJEA 4NLUA 1VJQA 5J2QA 1JLGA 4DV3F 4KC5A 3UVJA 2KDOA 2ZZNA 3HF5A 4ED1A 4U7CA 3V2UC 2MJUA 2V0NA 1ZTTA 1TMMA 1RHQB 2J5AA 3CD6S 1SXLA 1CS4B 1RAIB 1O5JA 2QLBB 1R6VA 3D5MA 4DL7A 4C8NA 5HMWA 2W24A 2CPZA 1EIYB 2HQGA 4JI8J 4FZVA 1XWLA 4AFFA 3QLHB 2WONA 1WC4A 4PABA 1KTVA 2CADA 1AZSA 3D67A 1L3UA 2R4FA 2UP1A 3CJ2A 4ED3A 2F63A 3LP0B 3DLBA 2LA4A 1TK8A 4F02A 3P5TL 4Y2CA 4U6PA 1WOOA 5C42A 3HPOA 4QQBA 3US5A 5CA5A 1TUGB 4KO0A 2WVDA 2F7VA 3T5KA 3K5OA 4OYPA 1XR6A 2DO0A 2OLWA 1X5OA 3Q0AA 1RHJB 1ZETA 1UVIA 1ULRA 3K58A 4JB8B 4NMXA 4PUOB 4ITSA 1KLNA 2GGPA 2QSFA 4U96A 2XMJA 3FMWA 2BQUA 1HBMA 2ZVSA 4J9PA 4F2SA 4ECXA 3IR6B 1J27A 1TKDA 4QIFA 1MLAA 2NZCA 1V5VA 1TFWA 5GADU 3HLUA 1SJ3P 4GVBB 3OVAA 1XC9A 2KT3A 5CYMB 1N56A 2ZH2A 4IG3A 2WBRA 5T41A 3HHLB 4DDFA 4R8UA 4MJKA 3K89A 4RX6A 5J1PA 1EX8A 4YB5A 1ROFA 4DV6J 3QZ8A 4I64A 2V2ZA 3CCTA 2Q3PA 2CJBA 4QR1A 2E5LJ 5BR8J 1KVJA 5KG3A 1H7WA 4DI6A 1D9DA 3QMQA 1VQ6S 1JLAB 2ALZA 2DHSA 2Q1LA 4W90B 2QA1A 1O0PA 2YKQA 4Q5VA 5D0EA 4FF3A 2RNEA 4HI2A 2R8GA 4HKQA 2OEJA 2D1CA 2LQ8A 5ETMA 3EGVA 2W25A 2J6UA 4R5PA 1CBKA 3IR5B 3VWSA 4IOCQ 4FBTA 4ZHRB 2H1YA 3IG1B 2NSBA 5DDOC 3DYAA 1O8BA 4ICLB 4OI6A 2RT3A 2BOPA 2IM0A 3FDSA 1SPBP 5G0RA 3GB0A 5JUMA 3JAMU 3LP1B 2CNKB 3BEGB 3W5YA 2M3DA 2QEXS 1F9FA 4C3KA 5CABA 1Z2ZA 5F3TA 2R7WA 3LP2A 2HWHA 1ZM2A 5ETKA 4OL8A 4O4RA 3N01A 3DI6B 3OD2A 4OX9J 1H2TZ 1WEYA 3R1HA 1RWXB 3DHXA 2UVWA 2KM8B 3HHLD 1S1WB 1WHVA 1XNQJ 3KWMA 1YX2A 4ECYA 4V19X 3S6EA 2EPIA 1FI4A 2Q43A 2B56A 2KKHA 5K8OA 2K8GA 3C15B 4RW7A 1C4AA 2BDPA 2QLWA 2AMCB 3NNHA 4B9MA 2F9DA 1HHQA 4FNHA 3SBMA 2LP4A 1SQGA 3ILOA 4MIAA 2X7IA 1GXLA 5KOXA 2ASDA 3NMRA 5LSLA 1TL1A 1NXIA 1U0SA 1GT8A 1U1RA 3OL8A 3RAXA 1OQ6A 2PSZA 4ILRA 1SQEA 2BM0A 1JLCB 1YBAA 1HWLA 3AB4B 4JI0J 2V8HA 5E3AA 4Q0BB 1EB0A 4WZQA 4FYYB 1Y3JA 3I4PA 4ZMMA 1FNMA 1NAQA 2OPPB 1U1LA 1HI8A 4NLPA 1LXNA 4AD6A 5HQMA 3IMQJ 1TL7B 5U47A 4FXWA 4KHRA 1IBCB 1FE4A 2AEMA 4PG7A 4JI8F 4ZPBA 2YKOA 4EI2A 3TUJC 3D54A 4QPTA 3HVRA 2EK6A 4P2SA 1DTTA 2CPJA 3H90A 5HLFA 2ZZTA 3EVMA 2HFZA 1QSSA 1D1UA 2AF6A 3NS7B 2W4CA 1JXEA 4NA3A 1T95A 5A2QU 3M1VB 5CYQA 5D15A 4HDGA 3PACA 2MZTA 3DOKA 4LSLA 4DSEA 3GFXA 2M5YA 2C3PA 1UFLA 2VFSA 2BJ8A 3R5CA 3I0SB 2AJ1A 4RBTA 3DOMA 1XEZA 4ECSA 2FHJD 3HHNB 4QWDA 1NDCA 3MZIA 3I5BA 1ZA2B 3NAHA 4I56A 2H4YB 2JLEA 3AJ2A 4NYOA 3DLKA 1V3SA 2DIVA 2XMAA 5LOQA 1QDUB 2ZZMA 3MECB 1S9FA 3AA9A 1HBOA 4QIVA 4X64J 5ETOA 4CH0S 1QTMA 3HSZA 4IRKA 3QNWB 3I6PA 4LF6J 1RTJB 4UUWA 3W63A 2ZM6J 5A6PA 3LPEA 1S1XB 3H7HB 5EDWA 4OI4A 1PIEA 3MMBB 2CPYA 3UQSA 2DITA 1GX6A 4FS2A 2FUG9 4MTPA 2E5LF 1YZ6A 5BR8F 1S7IA 1S0VA 2YQ0A 1N52B 2YKMB 5K8PA 4JUZA 2ZH9A 1W2IA 4FYDA 1LXJA 1LFWA 1SJRA 4OZ5A 1KHVA 4DL6A 2GVDA 5EWFA 1D8YA 2MKIA 3FJ2A 1VHIA 4N8OA 5A8KB 3GSDA 4KHPF 3IBWA 2MHNA 3LPYA 4RW4B 1JLBB 2A3JA 5B09A 2KHCA 1RTZA 2VDIA 2W9CA 2E1RA 1QAYA 4UUXA 2MQPA 5BXIA 3IGVA 3FK4A 5HVFA 2XZDB 2FHOB 1T7PA 2OEKA 3CJ3A 3D3CJ 2APOA 1S1TB 1VQ7S 4FP9A 4IFYA 2CG4A 1T0TV 4FBUA 4DFMA 4KAIA 5BYRA 1NJWA 4OV1A 4Y2MA 2KHDA 1U7LA 1FF2A 1NH8A 4OX9F 1JJ4A 5HP1B 3ICLA 2QLXA 1XNQF 1X9SA 5SUHA 3SCKE 2KT5A 2VG5B 4DXLA 4Z7YA 3PEHA 1LW2B 2RQKA 2RDIA 3KXDA 1TAQA 2JH3A 1RTHB 3ITHA 1NDKA 5K8MA 4ED0A 5E3QA 2NZ4A 4ZDNA 3PR4A 4F3QA 2HW3A 1ELOA 4NLQA 2B7BB 1C1CA 2GJ2A 3KLEB 4NZ0A 1VQSA 4X4PA 2D3ZA 3P49B 3BJYA 4E2FB 3DMJA 3FSYA 1CULA 3PW0A 2W1BA 3MEGA 2CRLA 5FD1A 4NLYA 4JI0F 3HVTA 3D6FB 1HR0J 3CMES 2XYPB 2F40A 2W4PA 1NK7A 5C24B 4EUVA 3BBFA 3CJRA 4DV0J 3MM6B 2J9DA 1X7VA 2H51B 2OPQB 3T1HJ 1S9EB 2VJUA 4P10A 2RQMA 2WAQD 1DLOB 4B3MJ 1P9QC 1YG0A 1N5YA 5D78A 5HL7Q 3M8RA 4LSNA 4ZPAA 2DY9A 2YXLA 2ACMA 4K4WA 4J91A 4D3GA 5A0YA 4OZNA 3C2PA 1X9MA 2W9BA 1HFEL 4QYZK 3QO9B 5IS2A 2BE2A 2VHGA 2Y1IA 1A9NB 2UVUA 2Z2YB 4C8MA 4P9SA 4WKRA 3TEHB 5HMYA 1LFPA 2FJWA 3ULHA 4AL7A 5EN1A 1RTIA 2BANA 1B99A 3PW2A 5HVHA 4I2PB 3MAHA 2LDIA 1HYSB 3ZTQA 3HD1A 2C2NA 3W60A 4O3NA 1Y9OA 4IOAQ 2HK3A 3CJSA 1TKXA 5E3CA 3ELHA 3GV7B 2EFGA 1VK8A 1AXQA 1SKUB 2RB7A 4MK8A 4ZP6A 3CXCR 2GVZA 3AODA 4PXDA 3JSMB 4ILLA 4YOEA 2GHPA 4LR8A 3F41A 2FVPA 2Y0BB 3MAAB 3EGNA 1IBMJ 2PD1A 5I3UA 2WBMA 1RU1A 4X64F 5KFPA 3LF0A 2GJIA 3G82A 4BLGA 4G3IA 4R0JA 3TA0A 4RW9B 4LF6F 4I7FB 2ZM6F 2PC6A 3D66A 1WC0A 2B6AA 1A0OB 3AD9C 2L9DA 1UWAA 2XYHB 2MQ8A 2OTLS 3AHPA 2ZE2B 4MIWA 2OTJS 2ZOFA 2PA8D 1HMVA 3DGPA 1LK5A 3G9CA 3RRGA 3PRVA 2DPIA 4A8WA 3WX8A 2KZMA 3GYGA 1WOSA 2DHAA 2DHGA 3PW4A 4PKDB 4Y00A 2BYCA 4LREA 1N0UA 4LF8J 3GIKA 1RB0A 1XK8A 2A6OA 2ZFHA 4NLWA 2VPWB 1Q8LA 1VQ8S 1WF0A 1S1UB 4GKJJ 4YEAA 5CH7B 3WX4A 1R6YA 5AE1A 3OR1B 2AKWB 1U1NA 2BACA 3GIIA 2XO7A 1CJUB 3RRHA 4KGZB 4NI2B 1VBYA 2WB4A 1FRIA 2Z56B 1WNEA 4K4UA 4G1PA 3BH6B 2C2EA 3POTB 2PI4A 5ETLA 3FQKA 4RWWA 1S77D 1QJHA 5HI7A 2MJNA 2YTCA 3ZFVA 5F8GA 3EVOA 5F41A 1X5PA 1RHMB 2R2TA 2KO1A 5KFVA 3HHDA 1N4LA 5LSRA 1NK0A 1RT2B 1RA6A 2IAJA 3H42A 3Q22A 3PIOQ 2K1RB 1QM9A 2PO4A 1RYRA 1CVJA 3CMQA 2XYGB 1P9YA 2HEKA 3UDLA 5GAGU 2ZBQA 4DSLA 2E44A 2KXHA 5E7OB 3I96A 3M9MB 3PW5A 4MFBA 1GQEA 1SB6A 2Z58B 3CD5A 2KB2A 4U95A 2LKZA 3BN4A 1JLQA 3FSXA 3ZTSA 4A8OA 4DS4A 4HR2A 2FGCA 2Z2ZA 3HKZD 1HR0F 1KQFB 2GHVC 3MXHP 1KFDA 3A8JA 2V4QA 3NWRA 4RUHA 4GVLA 1N5TA 3HDSA 2G0IA 2WSEC 1UWBB 1YK9A 3OSPA 4DCOB 4DV0F 1FKOA 3IBFB 4ZIWA 3TJAA 1WG1A 3T5HA 1O51A 4A46A 3AXKA 4I0WA 4J9MA 5DLGA 2IC3B 3T1HF 1YJNS 3T19A 1HI1A 4ZVOB 3QQCD 3PR5B 4FYVB 2O67A 4B3MF 3OXGA 2CQ4A 3GLJA 3CC7S 3GONA 2L9WA 3K59A 1UZHA 3GWCA 1CS4A 5DETA 4TU8A 5LSOA 8ATCB 1WC6A 4K0KJ 2UVRA 5HN0A 2QYCA 2KG0A 2M9KA 1KTQA 4O23A 3HXMA 1UJ5A 2QV6A 3QLHA 3P5BP 1U6ZA 2XMMA 1S76D 2B9WA 1R0AB 4KQZA 2ZDOA 3B82A 3SQOP 2QMUB 3LP0A 1NBEB 2EFVA 4F4XA 3VVUA 4X84A 1HKAA 2VDHA 4KR0B 3PX4A 2CQPA 2MZQA 3CO0P 2NS1B 1WC1A 1GEHA 2FLPA 2AYEA 3H2UB 2LCWA 1X4BA 4CZCA 2JEFA 4PUOA 4CLWA 3K8WA 2IBOA 2J9DE 4LMZA 3PNIA 2DTJA 3U1LA 4K50A 3FBBA 3VAJA 3VHQA 3H20A 2XWXA 1FCAA 3M9OB 1SH0A 2MGZB 4GVBA 1TV6B 5CYMA 5DGAA 2HFNA 4LF8F 2HNYB 2LU1A 3HHLA 2OGUA 2L3MA 3CD0A 5D4NA 1RWVB 3MMAB 1GTEA 2EFQA 4C8KA 4CO5A 2JEGA 2RJZA 2XBPA 2GHWA 1BUXA 4YN3B 1MROB 5IV4A 3GU0A 1JLAA 2BZ2A 2N4CA 2N7YA 4CLTA 5EWGA 3NNAA 2XB2D 4TVAB 3V6KA 2LEAA 3AAWB 1NRKA 4DPOA 3TNVA 3UCUP 4MIBA 4WFNQ 2CQCA 3DRYA 1YVFA 3Q24A 3CVKA 2R8KA 5E3PA 4ZHRA 3J7AN 1WC3A 3IG1A 5KT4A 5J2PB 2R42A 4ICLA 1SVDA 2CNLB 2JEJA 2YH1A 1HD1A 3OTOJ 2RHSB 2VOPA 3IXQA 1KQKA 5KG2A 4UT4A 2IMWP 2DR5A 4AXIA 1JJCB 1HLWA 2OJ3A 3LP1A 3UFCX 4N8NA 4YY3J 3EZOA 2BJ1A 4USJC 3M2UB 4DR3J 1NSAA 2R8HA 1Y00A 1UEKA 4G1IA 1XTZA 2BJ9A 4X4UA 1YGYA 4K4SA 3ISNC 2HGLA 4KGKA 1F9EB 1ZOTA 1FHTA 1S1WA 3OSNA 1VHFA 3OLBA 1TTHB 5EX0A 3BQ0A 3PHTA 1RT3B 3DU5A 1RAFB 3VGSA 4O0NA 2OHDA 1NEEA 1CJKB 2EC2A 2V8GA 3CJ5A 4ZCIA 3C15A 4CLYA 1N48A 3F56A 2VODA 3GR0A 3NBPB 1HBNB 2ZUAA 2RSQA 1SC3B 2XCPA 2ZWPA 3BSOA 3GV8B 3MOJB 2VPYB 3CCJS 2G4BA 3KJNB 1HWUA 4BC7A 2VPZB 3CCLS 1DARA 1U1MA 1EAYC 3ZTOA 5EX3A 2FYXA 1RHRB 1JLCA
chains in the Genus database with same CATH topology
3SZ2A 4FS1A 1YRUA 3O44A 3KLFA 1WACA 2QSWA 1VC5A 3R1LA 2MMYA 4DL2A 2ROEA 1NJZA 3E2EA 2HNZB 2ZNZA 3H2VE 2QA4S 2JDJA 4Q0BA 3KK1B 2B6AB 1HI0P 2GW8A 3BQ1A 2FJEB 1CQNA 4WFXA 1RI7A 3MMJA 4IOBA 4JI5F 2CFXA 2GX8A 4OHXA 4K0KF 2OPPA 1X4CA 3KLIA 5CCMA 3KLGA 3OTEA 5LJ5Y 5I42B 3KYLA 1PILA 1HMVB 2J7KA 3R5DA 5KFUA 4TU9A 4IRCA 3GG0A 3A8EA 2R7SA 2CQIA 2V8DA 2LMIA 2OAUA 5F8NA 2BA9A 2XGPA 3O3LA 2M2BA 1RT7A 5A8WB 3MF5A 2VA3A 1FE0A 4X4SA 1UVKA 3BGRA 2MQOA 1JJ2R 3DM2A 4DL0C 1L5UA 1NJYA 3SV4A 5HBMA 4GKKF 3MAQA 2I2YA 2HVHA 1P1TA 2MPUA 3BSAA 1JXLA 2YNFA 3UD4P 1EETB 5HMZA 2M7SA 2JFKA 3M32A 1YQHA 2VFRA 3MTKA 1UKUA 1VQ5S 2R2RA 3CXCR 4QYRA 3FQLA 1K73T 3LO3A 1W25A 2GA7A 7FDRA 2DBBA 5J1EB 3PKYA 1H38A 1KRPA 1JLFB 1KOHA 2B3TB 2SXLA 4HT7A 2C3OA 1AUDA 4L6V3 5F9LA 2XNQA 3OUYA 2O1PA 3NCPA 4USIA 3JYTB 3V4IB 3FVYA 1X5TA 3GE9A 1S4FA 1R3NA 1IBKF 2K3IA 3ZZRA 1JNZB 2MKHA 3GILA 3JTOA 3FEYB 3QPIA 2Z8QA 4LQ3A 5IQQA 2HHVA 5KFSA 4ED6A 2B5JA 1FXLA 1RT6A 2OSQA 2K7JA 3C66A 1DJ0A 3RB0A 1H6KX 3BREA 3DDNA 3M1VA 5CCLA 3F73A 4H4MB 1TR0A 3DHWC 3O5TB 1YRXA 2D9PA 4OIXA 4DUYF 2OSRA 5IM0A 1HHTP 4OHVA 3CJ0A 1M5VC 3MM7A 1QY7A 1HNXF 1D9FA 4PXBA 4B9SA 1SJQA 2YVSA 2HNDB 2C28A 2IMOA 4WK3A 5KFCA 2JHEA 3K8VA 2ROGA 1X9WA 3CIMA 2CPHA 4PG8A 4X4VA 5KFBA 5KTQA 1WWHA 4ELTA 4O4GA 3DLGB 1QSYA 1FNXH 2DCUB 3I0SA 1NNDA 2ZD1B 3O2IA 4L3NA 3THPA 4BBYA 3M9NB 3MEEA 1HPZB 2FC9A 2KH9A 1FKPB 4B9LA 2VBZA 3R5BA 5L38A 4ZPCA 3CCES 4A8QA 1HD0A 2GQ2A 3N4WA 3SFGA 4WFBQ 2HHQA 4U9RA 5E33A 4QWAA 3WZ0A 4P7TA 3DN9A 2VH7A 3CDWA 1P6TA 4URQU 3I9V9 4DFPA 3T6BA 2AD9A 2LDYA 5KFTA 2DPJA 3RTVA 3M8PB 2AYMA 1VQKS 2ZHOA 4TXSA 3JSBA 4A47A 4IH6A 2EFNA 4LF9F 5DQHA 1JB0C 1QE1B 3OLAA 4C11B 1S0MA 2AYBA 2QT7A 2R7TA 4F3OA 1VBZA 2Z0GA 4EU0A 3OJUA 3BDPA 4YFUA 2FJDB 5F8MA 2CJKA 2PT0A 2D9OA 5GAGI 2CIMA 2JZ5A 2MKCA 4DQPA 3KMQA 2R7XA 3NKYA 1CSJA 4NLVA 1BQXA 1TL4A 2P9GA 1MMNA 1MW7A 4WYLA 2I5JA 1LWFB 4C9DA 2RRNA 1YJRA 3K57A 1URNA 4XO0A 5C5JA 4F3MA 3E01A 3HVAA 2XULA 3J80Y 2DT9A 3DLLQ 3GYXB 1H0HB 3VTIA 3MECA 3OV7A 1J5OA 1KQSR 2PA3A 5KFYA 2DNRA 1T03A 1GXUA 1OSCA 3CEDA 4C0OC 5E2QA 2U2FA 4Y34A 1ZM9A 2YKPA 3JAMY 4PWDB 3CDBA 3T1AA 2JL9A 3RB3A 1UEVA 3CPWR 5KOWA 2IAJB 4YR3A 1IKVB 1LW0A 3EUNA 2J9EA 4JV5F 2RS2A 1AFJA 4O3SA 1C1BB 1RTJA 2Q6CA 6FD1A 2OPSA 3EX7B 4NOHA 2KYZA 1M90T 2Q6BA 2LEBA 2UXDF 4K4YA 1S1XA 3BGLA 3CDAA 5FLXY 1KFSA 1FD2A 3CF5Q 3NS6A 2J6TA 3UNGC 3G6ES 5L1JA 1X5SA 2FDNA 1OQ3A 2NUHA 2JLFA 2UUCF 3FRYA 3MMBA 5AXLA 3SDEB 4XIUA 2I0XA 3H5SA 4FXVA 2NXUA 2V94A 3I9ZA 1TL3A 3FZBA 4NLOA 3D0GE 2M52A 3JTPA 1QAXA 1VIXA 4F25A 2IVFB 4ED5A 3J7A1 4MFBB 4I2QB 3PM9A 3S7RA 1RT4A 2VG7A 1TVRB 1KLMA 2VKRA 3M6XA 3L09A 2HPUA 4Q2MA 4QJVA 4EO8A 4IQXA 1K8AT 4CO1A 3J7YU 2R7RA 3T9NA 1IR0A 3MM8A 3SV3A 1T05B 1ZH5A 5A8RA 2RRAA 3M6UA 4NX9A 1JLQB 2XS5A 3EZ5A 2YKMA 1VLYA 2Y0SD 3MPVA 3BGFA 4ZPVR 1UVJA 2DNHA 1S6QB 4USHA 3V5RA 1GX5A 1JK9B 4DR2F 3HHKA 1DRZA 2XMTA 3BM7A 1CPZA 4JV0A 5BJRA 4BS2A 3DLJA 1VI7A 3HP6A 3RR7A 1S48A 1U25A 1ZZNA 1B0TA 2V4JB 2ZHAA 5D3GA 3DLEB 1RJJA 4CO0A 4XPEA 4JI1F 4DJBA 1PGZA 1OPZA 3C3LA 2CQ2A 3CTRA 1Q86T 2DH7A 4O44B 1FXDA 3U1MA 1FT8A 3PJWA 1NKCA 2P9EA 2F8HA 3VQTA 5JVGQ 2XGQA 1FKOB 1LWEB 3HFKA 5A8KA 2RDJA 1H3DA 1MWZA 1FJCA 3VQSA 2BJEA 4NLUA 2J0WA 4RW4A 1JLBA 3TYTA 4J9NA 4DL4A 2ROPA 4FVMA 5J2QA 2OKQA 1NJXA 4K5SA 1JLGA 2DGQA 4DV3F 5CHCB 4QBUA 4KC5A 2HAIA 1XMOF 3NGDA 2KDOA 3NAIA 2ZZNA 2NPIA 3HF5A 4ED1A 3V6HA 4U7CA 2DH8A 2G9OA 1U47A 1J2VA 1MSWD 3V2UC 1U48A 1RISA 3I4HX 2MJUA 2V0NA 5FJ4A 3OTOF 4C8ZA 1ZTTA 3N6MA 3DRPA 1FRMA 3TARA 2CDQA 1GH8A 3QJPA 2J5AA 3CD6S 2ZUGA 1SXLA 4Q8EA 3C6UB 4NCGB 4DQQA 2B7CB 1P1LA 2G1DA 2VFUA 3E51A 3ZZOA 1RT1B 1O5JA 1S1TA 3JSYA 3CJKA 4KJIA 1C4CA 1Q7YT 3HX9A 4YY3F 3DRRB 3D5MA 1TKZA 1ZPVA 4DL7A 4C8NA 1XN9A 1REVA 2NUUG 2YWHA 2RKIB 5C25B 5M2UA 4IDKA 3J81Y 1IKYB 2W24A 5HMWA 2CPZA 3FRZA 4DR3F 4UW2A 2PEHA 1VQOS 5H9EJ 2HWTA 2Z2MA 4FZVA 2NREA 4ETZA 1XWLA 3GYNA 3W2WA 4AFFA 4NLRA 5SZTA 3QLHB 2WONA 3KMSA 4RNFA 3KK2B 1KTVA 4BCAA 1NK5A 5HP1A 3TOQA 1KN6A 2E29A 1NB7A 3OVBA 3S8SA 5I3QA 1CC8A 4ZCMA 4ZVFA 1JKHA 1WTBA 4PRFA 3M2RA 1L3UA 2R4FA 2AJQA 3T3FA 4FF1A 3OFGA 2UP1A 2DGOA 3IR7B 3UR3C 3CJ2A 1K0TA 3KKFA 4ED3A 1CQMA 4URGA 4QR2A 4DFKA 2VG5A 3LP0B 3DLBA 1IQZA 5DGBA 1XR5A 3DRSB 1LW2A 1JMTA 2LA4A 2M4MA 1TK8A 3MI7X 3P5TL 4F02A 2GO9A 4J5OA 5D8HB 3M4XA 1WTFA 5JJBA 4Y2CA 4U6PA 1HBUB 3CB4A 2ZH7A 2VG6A 1IBMF 3PXGa 2UUWA 5AXMA 5C42A 3T6JA 3HPOA 4QQBA 3US5A 2ZH8A 1Z1ZA 1RTHA 5CA5A 4UY85 4WFZA 4KO0A 4O3OA 1VRUA 4CTAA 2F7VA 5ITHA 5A6WA 3P96A 2OFHX 4QW8A 3K5OA 3T5KA 1XR6A 4ZK7M 2ZBCA 5B7WA 2DO0A 2OLWA 1X5OA 1VQPS 4WFAQ 3Q0AA 4QR0A 3H8YA 1ZETA 4MAKA 1ULRA 2XLIA 2EFOA 2KFYA 1UVIA 5A2QY 3K58A 4TY9A 3B4MA 2ZKUA 3AQPA 1UJ6A 4RW8B 2VONA 4J9LA 2KRBA