2CQLA

Solution structure of the n-terminal domain of human ribosomal protein l9
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
100
structure length
100
Chain Sequence
GSSGSSGMKTILSNQTVDIPENVDITLKGRTVIVKGPRGTLRRDFNHINVELSLLGKKKKRLRVDKWWGNRKELATVRTICSHVQNMIKGVTLGSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 60S ribosomal protein L9
publication title Solution structure of the N-terminal domain of human ribosomal protein L9
rcsb
source organism Homo sapiens
molecule tags Translation
total genus 15
structure length 100
sequence length 100
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00347 Ribosomal_L6 Ribosomal protein L6
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.90.930.12 Alpha Beta Alpha-Beta Complex Outer Surface Protein A; domain 3 Ribosomal protein L6, alpha-beta domain 2cqlA01
1VQLE 1QVFE 5GAHG 3CCVE 3DLLE 4IOAE 1YHQE 4WFBE 1KD1G 1K8AG 1VQ7E 1Q81G 1K9MG 3CCRE 5JVGE 1JJ2E 1RL6A 5DM6E 1VQPE 1YIJE 5MLCH 5AN9B 4WFNE 3CF5E 3I55E 1M90G 5DM7E 3CPWE 1QVGE 3CC7E 4U67E 5HL7E 3CCQE 1M1KG 3CCEE 4IO9E 1KQSE 3CXCE 1N8RG 3CMAE 1YJWE 1VQ4E 5JVHE 2ZJRE 3CCSE 3CCLE 1VQ6E 2OTJE 2QA4E 1VQ5E 5GADG 4WF9E 2CQLA 1VQOE 1VQ8E 3CC4E 3PIPE 3CMEE 1VQ9E 5GAGG 1VQME 1K73G 2ZJQE 1YJ9E 3G6EE 1VQKE 1Q86G 4WCEE 4UY8G 3CD6E 3CCUE 3G71E 3G4SE 1NJIG 3CCJE 2ZJPE 3CCME 1YITE 1YI2E 5H1SI 3OW2E 1KC8G 3PIOE 4WFAE 4IOCE 1Q82G 1VQNE 3I56E 1YJNE 3J7ZG 1S72E 1W2BE 5GAEG 1Q7YG 2OTLE 3CC2E 2QEXE
chains in the Genus database with same CATH superfamily
1VQLE 1QVFE 5GAHG 3CCVE 3DLLE 2G8CO 4IOAE 1YHQE 4WFBE 1KD1G 2PI3O 1K8AG 1VQ7E 3AUMO 1Q81G 1K9MG 3CCRE 5JVGE 1JJ2E 2FKGA 5B2AO 1RL6A 1FJ1E 2FKJA 5DM6E 1VQPE 1YIJE 5MLCH 4WFNE 5AN9B 3CF5E 3I55E 1M90G 5B10O 5DM7E 3EC5A 3CPWE 1QVGE 3CC7E 4U67E 5HL7E 3CCQE 1M1KG 2I5ZO 2OY1O 5B11O 3CCEE 4IO9E 1KQSE 5B3MO 3CXCE 1N8RG 3CMAE 1YJWE 1VQ4E 1RJLC 5JVHE 2ZJRE 3CKGA 3CCSE 2OYBO 3CCLE 1VQ6E 2OTJE 2QA4E 1VQ5E 5GADG 4WF9E 2CQLA 1VQOE 1VQ8E 3CC4E 2OY5O 3PIPE 2OL6O 3CMEE 2I5VO 1VQ9E 1OSPO 5GAGG 1VQME 1K73G 2ZJQE 1YJ9E 3G6EE 1VQKE 1Q86G 4WCEE 4UY8G 3CD6E 3CCUE 3IG9A 3G71E 2OY8A 3G4SE 1NJIG 3CCJE 2ZJPE 3CKFA 3CCME 1YITE 1YI2E 5H1SI 3OW2E 1KC8G 2AF5A 2OY7A 3PIOE 4WFAE 4IOCE 1Q82G 1VQNE 3IGEA 1P4PA 3I56E 1YJNE 3J7ZG 1S72E 2OL8O 2HKDA 1W2BE 5GAEG 2OL7A 1Q7YG 2OTLE 3CC2E 2QEXE
chains in the Genus database with same CATH topology
1VQLE 1QVFE 5GAHG 3CCVE 3DLLE 4IOAE 1YHQE 4WFBE 1KD1G 1K8AG 1VQ7E 1Q81G 1K9MG 3CCRE 5JVGE 1JJ2E 1RL6A 5DM6E 1VQPE 1YIJE 5MLCH 5AN9B 4WFNE 3CF5E 3I55E 1M90G 5DM7E 3CPWE 1QVGE 3CC7E 4U67E 5HL7E 3CCQE 1M1KG 3CCEE 4IO9E 1KQSE 3CXCE 1N8RG 3CMAE 1YJWE 1VQ4E 5JVHE 2ZJRE 3CCSE 3CCLE 1VQ6E 2OTJE 2QA4E 1VQ5E 5GADG 4WF9E 2CQLA 1VQOE 1VQ8E 3CC4E 3PIPE 3CMEE 1VQ9E 5GAGG 1VQME 1K73G 2ZJQE 1YJ9E 3G6EE 1VQKE 1Q86G 4WCEE 4UY8G 3CD6E 3CCUE 3G71E 3G4SE 1NJIG 3CCJE 2ZJPE 3CCME 1YITE 1YI2E 5H1SI 3OW2E 1KC8G 3PIOE 4WFAE 4IOCE 1Q82G 1VQNE 3I56E 1YJNE 3J7ZG 1S72E 1W2BE 5GAEG 1Q7YG 2OTLE 3CC2E 2QEXE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VQL E;  1QVF E;  5GAH G;  3CCV E;  3DLL E;  4IOA E;  1YHQ E;  4WFB E;  1KD1 G;  1K8A G;  1VQ7 E;  1Q81 G;  1K9M G;  3CCR E;  5JVG E;  1JJ2 E;  1RL6 A;  5DM6 E;  1VQP E;  1YIJ E;  5MLC H;  5AN9 B;  4WFN E;  3CF5 E;  3I55 E;  1M90 G;  5DM7 E;  3CPW E;  1QVG E;  3CC7 E;  4U67 E;  5HL7 E;  3CCQ E;  1M1K G;  3CCE E;  4IO9 E;  1KQS E;  3CXC E;  1N8R G;  3CMA E;  1YJW E;  1VQ4 E;  5JVH E;  2ZJR E;  3CCS E;  3CCL E;  1VQ6 E;  2OTJ E;  2QA4 E;  1VQ5 E;  5GAD G;  4WF9 E;  2CQL A;  1VQO E;  1VQ8 E;  3CC4 E;  3PIP E;  3CME E;  1VQ9 E;  5GAG G;  1VQM E;  1K73 G;  2ZJQ E;  1YJ9 E;  3G6E E;  1VQK E;  1Q86 G;  4WCE E;  4UY8 G;  3CD6 E;  3CCU E;  3G71 E;  3G4S E;  1NJI G;  3CCJ E;  2ZJP E;  3CCM E;  1YIT E;  1YI2 E;  5H1S I;  3OW2 E;  1KC8 G;  3PIO E;  4WFA E;  4IOC E;  1Q82 G;  1VQN E;  3I56 E;  1YJN E;  3J7Z G;  1S72 E;  1W2B E;  5GAE G;  1Q7Y G;  2OTL E;  3CC2 E;  2QEX E; 
#chains in the Genus database with same CATH topology
 1VQL E;  1QVF E;  5GAH G;  3CCV E;  3DLL E;  2G8C O;  4IOA E;  1YHQ E;  4WFB E;  1KD1 G;  2PI3 O;  1K8A G;  1VQ7 E;  3AUM O;  1Q81 G;  1K9M G;  3CCR E;  5JVG E;  1JJ2 E;  2FKG A;  5B2A O;  1RL6 A;  1FJ1 E;  2FKJ A;  5DM6 E;  1VQP E;  1YIJ E;  5MLC H;  4WFN E;  5AN9 B;  3CF5 E;  3I55 E;  1M90 G;  5B10 O;  5DM7 E;  3EC5 A;  3CPW E;  1QVG E;  3CC7 E;  4U67 E;  5HL7 E;  3CCQ E;  1M1K G;  2I5Z O;  2OY1 O;  5B11 O;  3CCE E;  4IO9 E;  1KQS E;  5B3M O;  3CXC E;  1N8R G;  3CMA E;  1YJW E;  1VQ4 E;  1RJL C;  5JVH E;  2ZJR E;  3CKG A;  3CCS E;  2OYB O;  3CCL E;  1VQ6 E;  2OTJ E;  2QA4 E;  1VQ5 E;  5GAD G;  4WF9 E;  2CQL A;  1VQO E;  1VQ8 E;  3CC4 E;  2OY5 O;  3PIP E;  2OL6 O;  3CME E;  2I5V O;  1VQ9 E;  1OSP O;  5GAG G;  1VQM E;  1K73 G;  2ZJQ E;  1YJ9 E;  3G6E E;  1VQK E;  1Q86 G;  4WCE E;  4UY8 G;  3CD6 E;  3CCU E;  3IG9 A;  3G71 E;  2OY8 A;  3G4S E;  1NJI G;  3CCJ E;  2ZJP E;  3CKF A;  3CCM E;  1YIT E;  1YI2 E;  5H1S I;  3OW2 E;  1KC8 G;  2AF5 A;  2OY7 A;  3PIO E;  4WFA E;  4IOC E;  1Q82 G;  1VQN E;  3IGE A;  1P4P A;  3I56 E;  1YJN E;  3J7Z G;  1S72 E;  2OL8 O;  2HKD A;  1W2B E;  5GAE G;  2OL7 A;  1Q7Y G;  2OTL E;  3CC2 E;  2QEX E; 
#chains in the Genus database with same CATH homology
 1VQL E;  1QVF E;  5GAH G;  3CCV E;  3DLL E;  4IOA E;  1YHQ E;  4WFB E;  1KD1 G;  1K8A G;  1VQ7 E;  1Q81 G;  1K9M G;  3CCR E;  5JVG E;  1JJ2 E;  1RL6 A;  5DM6 E;  1VQP E;  1YIJ E;  5MLC H;  5AN9 B;  4WFN E;  3CF5 E;  3I55 E;  1M90 G;  5DM7 E;  3CPW E;  1QVG E;  3CC7 E;  4U67 E;  5HL7 E;  3CCQ E;  1M1K G;  3CCE E;  4IO9 E;  1KQS E;  3CXC E;  1N8R G;  3CMA E;  1YJW E;  1VQ4 E;  5JVH E;  2ZJR E;  3CCS E;  3CCL E;  1VQ6 E;  2OTJ E;  2QA4 E;  1VQ5 E;  5GAD G;  4WF9 E;  2CQL A;  1VQO E;  1VQ8 E;  3CC4 E;  3PIP E;  3CME E;  1VQ9 E;  5GAG G;  1VQM E;  1K73 G;  2ZJQ E;  1YJ9 E;  3G6E E;  1VQK E;  1Q86 G;  4WCE E;  4UY8 G;  3CD6 E;  3CCU E;  3G71 E;  3G4S E;  1NJI G;  3CCJ E;  2ZJP E;  3CCM E;  1YIT E;  1YI2 E;  5H1S I;  3OW2 E;  1KC8 G;  3PIO E;  4WFA E;  4IOC E;  1Q82 G;  1VQN E;  3I56 E;  1YJN E;  3J7Z G;  1S72 E;  1W2B E;  5GAE G;  1Q7Y G;  2OTL E;  3CC2 E;  2QEX E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...