2CR8A

Solution structure of the zf-ranbp domain of p53-binding protein mdm4
Total Genus 0
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
0
sequence length
53
structure length
53
Chain Sequence
GSSGSSGSEDEWQCTECKKFNSPSKRYCFRCWALRKDWYSDCSKLTHSGPSSG

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mdm4 protein
publication title Solution structure of the zf-RanBP domain of p53-binding protein Mdm4
rcsb
source organism Homo sapiens
molecule tags Cell cycle
structure length 53
sequence length 53
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00641 zf-RanBP Zn-finger in Ran binding protein and others
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.20.28.240 Mainly Beta Single Sheet Rubrerythrin, domain 2 Rubrerythrin, domain 2 2cr8A01
2CR8A
chains in the Genus database with same CATH superfamily
1E8JA 1R0GA 2JI1A 4A3EL 5FLML 4BXXL 5AN9H 4A3ML 1JYBA 3KYYA 1CAAA 5GAGc 1ODHA 1SFOL 2Z3RB 4BY1L 1R0JA 4A3IL 3PKJA 3SS2A 3GTJL 4ZN3B 3LWOB 4QIWP 1LKPA 1IW7D 4K9FA 4UY81 2JA7L 1IU5A 4AI2A 1R0HA 3HOVL 1DVBA 2J9UB 3LNLA 1PFVA 2JI2A 4AHYA 4A93L 2B5ID 1RDGA 3PIP1 4TPUA 3S14L 5DM61 1CADA 3KYVA 2WAQP 4A3KL 3QQCE 1VZIA 4G6BA 1R0FA 2E2JL 5JVH1 2M6PA 2JA6L 2HR5A 2E2HL 1YK5A 5MFPA 1ZRPA 3H3VM 4BBRL 5C44L 3K35A 2C6AA 4JADA 1T9OA 2CR8A 4V196 1BQ8A 2JA8L 1H7VA 2AYJA 3GTKL 3HOUL 2XJUA 2VUML 3GTQL 5C4JL 3HJYB 2BE5D 2Y0SP 1RB9A 3S1QL 1P7PA 3A44A 5GAHc 1Z92B 3K7AL 4LHNA 1OWCA 1BFYA 1TWCL 1R9TL 3MQKB 1YV1A 4C3JL 2GMGA 5IYDL 3HKZP 2QL0A 3HOXL 3S1ML 1B71A 1PFWA 1TWHL 3S1NL 2ERSA 3J7Z1 3GTGL 4JAEA 5M5XL 1RWDA 1Y1WL 2DSXA 2NVXL 1SMMA 1I6HL 4BBSL 5M3FL 4POGA 7RXNA 1VZGA 2PMZP 3S15L 4C2M1 3RZTA 3HJWB 4Y52L 1FHMA 2A6ED 4AR4A 3M4OL 1R0IA 3MPSA 3RYGA 3JR7A 3QVDA 5MF6A 4AHXA 3I4NL 1YUZA 2R93L 2C6BA 5AI2A 3P2AA 1F4LA 1C09A 2L0ZA 2LCQA 3I4ML 2CKCA 4LHLA 4ZN1B 5M5WL 2RDVA 4YWLA 4C3IL 3HOWL 1RYQA 1SMUA 2A6HD 3S16L 1NXGA 1VCXA 3FDJA 5JVG1 1FHHA 1RYTA 2XJSA 3KYXA 1K83L 2ZIXA 4ME3A 4B8CD 2V3BB 2XJVA 1YUXA 3S1RL 3PO3L 5FJ8L 3VPBE 2APOB 4AR6A 1QYBA 4POFA 1IROA 5GADc 3PL5A 5IP9L 3RZDL 3WWLA 6RXNA 4AYBP 5H1Sc 4AI3A 4AI0A 3B0AB 2R92L 3H99A 3P8BA 3CQZL 4AHWA 5MGNA 2KN9A 3HOYL 2XJQA 1TWAL 5EIOC 2M4VA 3GTLL 1B13A 5GAEc 5DM71 1WJVA 1BRFA 5EINC 2NVTL 5M5YL 2RFKB 4AR3A 3KYWA 2M6OA 1TWFL 4A3JL 4A3DL 4JAFA 2MS3A 2PSMC 2R7ZL 4JAGA 1IU6A 5M3ML 5MFZA 2WB1P 3PWFA 8RXNA 1PFUA 3PO2L 3WWNB 1DX8A 3S2HL 2PPTA 3S17L 3MSUA 1S2ZA 3FKIL 2JI3A 2PVEA 1S24A 4TVMA 1QCVA 3ZG6A 4A3FL 3IU3I 4AI1A 3GTOL 5MLC3 2XJPA 1PFYA 2NVQL 1B2OA 3RZOL 3H9BA 1BQ9A 4X6AL 2JA5L 3LWRB 2YU9L 2AUSB 1T9QA 5C4XL 4A3CL 1OWBA 3GTML 1B2JA 3NFPI 2M4YA 2XJRA 4A3GL 1LKOA 5IYBL 3LWPB 4AR5A 3LPEB 2NYDA 3PKIA 1TWGL 3PIO1 5C3EL 4A3LL 2V0FA 3RZ6A 3KYUA 1WCML 4RXNA 4U671 3LWQB 3HOZL 1NNQA 3H0GL 1T9PA 2B63L 2KKDA 1S30A 4A3BL 1I3QL 2K2DA 1QQTA 3H9CA 3S2DL 4E6YA 2A69D 2E2IL 3HAXC 1IRNA 5RXNA 2NVYL 2XJTA 1Y1VL 5IY0A 5AI3A 1SMWA 4XGHA 3GTPL 1I50L 2AQCA 1LTLA 1NXEA 2VL6A 2V0EA 3H97A 3J7Y1 1VZHA 4WFN1 2PVXA 4C3HL 1RDVA 4XXBB 1PZXA 2ERJA 2A68D 3B08B 2Z3QB 5IYCL 3M3YL 4YWMA 4BY7L 3PZAA 1BE7A 2CKAA 2EY4E 5K2ME 2O5JD 1YK4A 4AHZA 4Y7NL 4GS7D 5IP7L 1LKMA 2HVYC 2H12A 3LWVB 2PYAA
chains in the Genus database with same CATH topology
1YUXA 1E8JA 1RB9A 1T9QA 1R0GA 3A44A 3VPBE 2JI1A 4AR6A 5GAHc 1QYBA 1Z92B 4POFA 1IROA 1OWBA 5GADc 5AN9H 1B2JA 3NFPI 4LHNA 1OWCA 1JYBA 1BFYA 3KYYA 1CAAA 5GAGc 1YV1A 1ODHA 3WWLA 6RXNA 2M4YA 2Z3RB 1R0JA 2GMGA 3PKJA 2XJRA 3SS2A 2QL0A 5H1Sc 4AI3A 1LKOA 1B71A 4AI0A 3B0AB 4ZN3B 4AR5A 3LPEB 2NYDA 3PKIA 2ERSA 3J7Z1 3P8BA 4AHWA 4JAEA 1LKPA 1IW7D 1RWDA 4K9FA 3PIO1 2DSXA 1SMMA 5MGNA 2KN9A 4UY81 2V0FA 1IU5A 2XJQA 3RZ6A 4AI2A 1R0HA 5EIOC 2M4VA 4POGA 3KYUA 1DVBA 7RXNA 1B13A 1VZGA 2J9UB 3LNLA 4RXNA 5GAEc 4U671 2JI2A 1NNQA 4AHYA 1WJVA 5DM71 1BRFA 2B5ID 1T9PA 1RDGA 3RZTA 3PIP1 4TPUA 2KKDA 5EINC 1FHMA 2A6ED 4AR4A 1S30A 1R0IA 3MPSA 3RYGA 4AR3A 3KYWA 3QVDA 5MF6A 2K2DA 4AHXA 5DM61 1YUZA 1CADA 2M6OA 2C6BA 3KYVA 5AI2A 3P2AA 4E6YA 1C09A 2A69D 3QQCE 2L0ZA 1IRNA 1VZIA 5RXNA 4JAFA 4G6BA 1R0FA 2XJTA 5IY0A 5AI3A 2MS3A 1SMWA 4XGHA 2LCQA 2PSMC 5JVH1 2CKCA 2M6PA 4LHLA 2HR5A 1IU6A 4JAGA 4ZN1B 1YK5A 5MFPA 2XJVA 2RDVA 1LTLA 4YWLA 1NXEA 1ZRPA 2VL6A 2V0EA 5MFZA 3PWFA 8RXNA 3J7Y1 1VZHA 3WWNB 4WFN1 1DX8A 2PPTA 2PVXA 1RDVA 1RYQA 1SMUA 4XXBB 2A6HD 2ERJA 3K35A 2A68D 2C6AA 3B08B 1S2ZA 3MSUA 4JADA 1NXGA 1T9OA 1VCXA 2JI3A 2Z3QB 2CR8A 2PVEA 1S24A 4V196 1BQ8A 4TVMA 4YWMA 1H7VA 1QCVA 2AYJA 5JVG1 1FHHA 3PZAA 2XJUA 3ZG6A 1RYTA 2XJSA 3KYXA 1BE7A 3IU3I 2CKAA 4AI1A 5K2ME 2O5JD 5MLC3 2XJPA 1YK4A 4AHZA 4GS7D 1B2OA 1LKMA 2ZIXA 2BE5D 4ME3A 4B8CD 2H12A 2V3BB 2PYAA 1BQ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CR8 A; 
#chains in the Genus database with same CATH topology
 1E8J A;  1R0G A;  2JI1 A;  4A3E L;  5FLM L;  4BXX L;  5AN9 H;  4A3M L;  1JYB A;  3KYY A;  1CAA A;  5GAG c;  1ODH A;  1SFO L;  2Z3R B;  4BY1 L;  1R0J A;  4A3I L;  3PKJ A;  3SS2 A;  3GTJ L;  4ZN3 B;  3LWO B;  4QIW P;  1LKP A;  1IW7 D;  4K9F A;  4UY8 1;  2JA7 L;  1IU5 A;  4AI2 A;  1R0H A;  3HOV L;  1DVB A;  2J9U B;  3LNL A;  1PFV A;  2JI2 A;  4AHY A;  4A93 L;  2B5I D;  1RDG A;  3PIP 1;  4TPU A;  3S14 L;  5DM6 1;  1CAD A;  3KYV A;  2WAQ P;  4A3K L;  3QQC E;  1VZI A;  4G6B A;  1R0F A;  2E2J L;  5JVH 1;  2M6P A;  2JA6 L;  2HR5 A;  2E2H L;  1YK5 A;  5MFP A;  1ZRP A;  3H3V M;  4BBR L;  5C44 L;  3K35 A;  2C6A A;  4JAD A;  1T9O A;  2CR8 A;  4V19 6;  1BQ8 A;  2JA8 L;  1H7V A;  2AYJ A;  3GTK L;  3HOU L;  2XJU A;  2VUM L;  3GTQ L;  5C4J L;  3HJY B;  2BE5 D;  2Y0S P;  1RB9 A;  3S1Q L;  1P7P A;  3A44 A;  5GAH c;  1Z92 B;  3K7A L;  4LHN A;  1OWC A;  1BFY A;  1TWC L;  1R9T L;  3MQK B;  1YV1 A;  4C3J L;  2GMG A;  5IYD L;  3HKZ P;  2QL0 A;  3HOX L;  3S1M L;  1B71 A;  1PFW A;  1TWH L;  3S1N L;  2ERS A;  3J7Z 1;  3GTG L;  4JAE A;  5M5X L;  1RWD A;  1Y1W L;  2DSX A;  2NVX L;  1SMM A;  1I6H L;  4BBS L;  5M3F L;  4POG A;  7RXN A;  1VZG A;  2PMZ P;  3S15 L;  4C2M 1;  3RZT A;  3HJW B;  4Y52 L;  1FHM A;  2A6E D;  4AR4 A;  3M4O L;  1R0I A;  3MPS A;  3RYG A;  3JR7 A;  3QVD A;  5MF6 A;  4AHX A;  3I4N L;  1YUZ A;  2R93 L;  2C6B A;  5AI2 A;  3P2A A;  1F4L A;  1C09 A;  2L0Z A;  2LCQ A;  3I4M L;  2CKC A;  4LHL A;  4ZN1 B;  5M5W L;  2RDV A;  4YWL A;  4C3I L;  3HOW L;  1RYQ A;  1SMU A;  2A6H D;  3S16 L;  1NXG A;  1VCX A;  3FDJ A;  5JVG 1;  1FHH A;  1RYT A;  2XJS A;  3KYX A;  1K83 L;  2ZIX A;  4ME3 A;  4B8C D;  2V3B B;  2XJV A;  1YUX A;  3S1R L;  3PO3 L;  5FJ8 L;  3VPB E;  2APO B;  4AR6 A;  1QYB A;  4POF A;  1IRO A;  5GAD c;  3PL5 A;  5IP9 L;  3RZD L;  3WWL A;  6RXN A;  4AYB P;  5H1S c;  4AI3 A;  4AI0 A;  3B0A B;  2R92 L;  3H99 A;  3P8B A;  3CQZ L;  4AHW A;  5MGN A;  2KN9 A;  3HOY L;  2XJQ A;  1TWA L;  5EIO C;  2M4V A;  3GTL L;  1B13 A;  5GAE c;  5DM7 1;  1WJV A;  1BRF A;  5EIN C;  2NVT L;  5M5Y L;  2RFK B;  4AR3 A;  3KYW A;  2M6O A;  1TWF L;  4A3J L;  4A3D L;  4JAF A;  2MS3 A;  2PSM C;  2R7Z L;  4JAG A;  1IU6 A;  5M3M L;  5MFZ A;  2WB1 P;  3PWF A;  8RXN A;  1PFU A;  3PO2 L;  3WWN B;  1DX8 A;  3S2H L;  2PPT A;  3S17 L;  3MSU A;  1S2Z A;  3FKI L;  2JI3 A;  2PVE A;  1S24 A;  4TVM A;  1QCV A;  3ZG6 A;  4A3F L;  3IU3 I;  4AI1 A;  3GTO L;  5MLC 3;  2XJP A;  1PFY A;  2NVQ L;  1B2O A;  3RZO L;  3H9B A;  1BQ9 A;  4X6A L;  2JA5 L;  3LWR B;  2YU9 L;  2AUS B;  1T9Q A;  5C4X L;  4A3C L;  1OWB A;  3GTM L;  1B2J A;  3NFP I;  2M4Y A;  2XJR A;  4A3G L;  1LKO A;  5IYB L;  3LWP B;  4AR5 A;  3LPE B;  2NYD A;  3PKI A;  1TWG L;  3PIO 1;  5C3E L;  4A3L L;  2V0F A;  3RZ6 A;  3KYU A;  1WCM L;  4RXN A;  4U67 1;  3LWQ B;  3HOZ L;  1NNQ A;  3H0G L;  1T9P A;  2B63 L;  2KKD A;  1S30 A;  4A3B L;  1I3Q L;  2K2D A;  1QQT A;  3H9C A;  3S2D L;  4E6Y A;  2A69 D;  2E2I L;  3HAX C;  1IRN A;  5RXN A;  2NVY L;  2XJT A;  1Y1V L;  5IY0 A;  5AI3 A;  1SMW A;  4XGH A;  3GTP L;  1I50 L;  2AQC A;  1LTL A;  1NXE A;  2VL6 A;  2V0E A;  3H97 A;  3J7Y 1;  1VZH A;  4WFN 1;  2PVX A;  4C3H L;  1RDV A;  4XXB B;  1PZX A;  2ERJ A;  2A68 D;  3B08 B;  2Z3Q B;  5IYC L;  3M3Y L;  4YWM A;  4BY7 L;  3PZA A;  1BE7 A;  2CKA A;  2EY4 E;  5K2M E;  2O5J D;  1YK4 A;  4AHZ A;  4Y7N L;  4GS7 D;  5IP7 L;  1LKM A;  2HVY C;  2H12 A;  3LWV B;  2PYA A; 
#chains in the Genus database with same CATH homology
 1YUX A;  1E8J A;  1RB9 A;  1T9Q A;  1R0G A;  3A44 A;  3VPB E;  2JI1 A;  4AR6 A;  5GAH c;  1QYB A;  1Z92 B;  4POF A;  1IRO A;  1OWB A;  5GAD c;  5AN9 H;  1B2J A;  3NFP I;  4LHN A;  1OWC A;  1JYB A;  1BFY A;  3KYY A;  1CAA A;  5GAG c;  1YV1 A;  1ODH A;  3WWL A;  6RXN A;  2M4Y A;  2Z3R B;  1R0J A;  2GMG A;  3PKJ A;  2XJR A;  3SS2 A;  2QL0 A;  5H1S c;  4AI3 A;  1LKO A;  1B71 A;  4AI0 A;  3B0A B;  4ZN3 B;  4AR5 A;  3LPE B;  2NYD A;  3PKI A;  2ERS A;  3J7Z 1;  3P8B A;  4AHW A;  4JAE A;  1LKP A;  1IW7 D;  1RWD A;  4K9F A;  3PIO 1;  2DSX A;  1SMM A;  5MGN A;  2KN9 A;  4UY8 1;  2V0F A;  1IU5 A;  2XJQ A;  3RZ6 A;  4AI2 A;  1R0H A;  5EIO C;  2M4V A;  4POG A;  3KYU A;  1DVB A;  7RXN A;  1B13 A;  1VZG A;  2J9U B;  3LNL A;  4RXN A;  5GAE c;  4U67 1;  2JI2 A;  1NNQ A;  4AHY A;  1WJV A;  5DM7 1;  1BRF A;  2B5I D;  1T9P A;  1RDG A;  3RZT A;  3PIP 1;  4TPU A;  2KKD A;  5EIN C;  1FHM A;  2A6E D;  4AR4 A;  1S30 A;  1R0I A;  3MPS A;  3RYG A;  4AR3 A;  3KYW A;  3QVD A;  5MF6 A;  2K2D A;  4AHX A;  5DM6 1;  1YUZ A;  1CAD A;  2M6O A;  2C6B A;  3KYV A;  5AI2 A;  3P2A A;  4E6Y A;  1C09 A;  2A69 D;  3QQC E;  2L0Z A;  1IRN A;  1VZI A;  5RXN A;  4JAF A;  4G6B A;  1R0F A;  2XJT A;  5IY0 A;  5AI3 A;  2MS3 A;  1SMW A;  4XGH A;  2LCQ A;  2PSM C;  5JVH 1;  2CKC A;  2M6P A;  4LHL A;  2HR5 A;  1IU6 A;  4JAG A;  4ZN1 B;  1YK5 A;  5MFP A;  2XJV A;  2RDV A;  1LTL A;  4YWL A;  1NXE A;  1ZRP A;  2VL6 A;  2V0E A;  5MFZ A;  3PWF A;  8RXN A;  3J7Y 1;  1VZH A;  3WWN B;  4WFN 1;  1DX8 A;  2PPT A;  2PVX A;  1RDV A;  1RYQ A;  1SMU A;  4XXB B;  2A6H D;  2ERJ A;  3K35 A;  2A68 D;  2C6A A;  3B08 B;  1S2Z A;  3MSU A;  4JAD A;  1NXG A;  1T9O A;  1VCX A;  2JI3 A;  2Z3Q B;  2CR8 A;  2PVE A;  1S24 A;  4V19 6;  1BQ8 A;  4TVM A;  4YWM A;  1H7V A;  1QCV A;  2AYJ A;  5JVG 1;  1FHH A;  3PZA A;  2XJU A;  3ZG6 A;  1RYT A;  2XJS A;  3KYX A;  1BE7 A;  3IU3 I;  2CKA A;  4AI1 A;  5K2M E;  2O5J D;  5MLC 3;  2XJP A;  1YK4 A;  4AHZ A;  4GS7 D;  1B2O A;  1LKM A;  2ZIX A;  2BE5 D;  4ME3 A;  4B8C D;  2H12 A;  2V3B B;  2PYA A;  1BQ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...