2CRMA

Solution structure of the forth fniii domain of human
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
120
structure length
120
Chain Sequence
b'GSSGSSGVVEFTTCPDKPGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPAVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin type-III domain containing protein 3a
publication title Solution structure of the forth FNIII domain of human
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 8
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2crmA01
4MCZA 2V6HA 4IRJB 4O2CA 4BH7A 1HNFA 4UIMA 1E28A 2J2ZA 2IQAB 4M6MH 1INDL 2IH1A 4U49A 2WSKA 1N64H 4BQCA 5DT1L 4PJIE 5FO8A 2JIXB 5DMIL 3BRGC 2AVGA 1U42A 1XF1A 1M7XA 4TSBL 3X12B 1CGXA 2L4OA 3RZCA 3HB3C 1QPPA 3MROA 1UWGL 5FOBB 4RGMB 2AK4B 5KS9A 1JGDA 1U93A 1QRNA 2DD8L 1T0MB 1WZMA 3KLDA 3RX7A 4UQ2A 5C0JB 2OSLA 2APFA 4LBEA 3MRQA 1J1PH 1MOEA 4L5FH 3RVXC 2C4XA 3SE9H 3MA7B 1SM3H 2ILLA 1KTDB 3ARED 4LSDA 2G2RA 1N7MH 4I1NB 2ZUWA 8FABB 4G8GB 1T66C 4NUGH 4ETQA 3ULVH 4LQFH 5C0CD 5IBLC 5D7LA 1WZ1L 4XNYH 3WFCH 2BXZA 5KVFH 2VDRL 3RKPA 1CF8H 4D9RE 1GGYA 3P0VH 5IKCA 1JE6A 4NYLB 2ESVA 4KVNH 1V5JA 1J12A 1ORSA 2MQCA 1GHFH 1PY9A 3UTSD 1CK0L 5FM4A 1WTLA 4M4PA 3EZ8A 3F7YA 1AKJB 2FHBA 3BT2H 2V2TA 3N1PC 3SBWC 1UC6A 4PJXF 1G0XA 4I9WE 4K3EH 1JNLH 2VLJD 2LAAA 4XH2A 4YHZL 3TA3D 2FLBT 1SJXA 4U1NA 5FM5O 4XCFH 2AV7A 1V3JA 4XVSL 3O45B 2D4DA 4EUPH 4F33B 3HRZA 4WUUB 3PQYD 3UTZB 4LCUA 3UTQB 4K7PL 4ODBD 3DGCR 1AIFB 4RDQG 2G60H 5F9WB 3VXOB 5D7KD 1K85A 1SBSH 4YXHH 1CFSB 4K3JL 3MUHL 4KRMB 3D85B 5DK2B 3MGOB 3CFJA 3MR9A 3CFKA 3IFPB 3SQOH 3BSZL 1YPZE 3TV3H 4EZMA 3SPVB 5FYKE 1FNGA 5EG6C 5SWSD 5DHYB 4N0YH 2APXA 5DD5H 3SJVB 3O8XB 4OV5B 4GRWH 1F8TH 1OW0C 4HPOL 5IFJB 4G43B 3FOLA 3I6KA 3VXSA 3P11L 5EO9B 4HCRH 3L3HA 2C4FT 5D5MF 5L2KB 1C5CH 5I1AB 3TYFA 4I77H 4XCYB 3X3GH 5E2TH 1HINL 4XC1L 4M61B 5ESAA 3MV9B 1OL0A 1AY1L 3MRIA 5HBBA 1J05B 1NLDL 5DI8A 1DUZB 1TVDA 2VXUH 3BPCB 5C0BD 3EGSA 3VXMA 4G7YH 4CMMB 3NCYP 5A40E 5LGHL 3FQRA 4Y1AD 5GS3A 1INEH 4UV4H 2FX9L 4NO0D 4RDQF 4U1GB 3DTXB 4ZFFB 5KSUB 3EHBD 3AU1B 3ABZA 4ZNEA 5GS0L 4HIXH 5T33H 1U8NB 2F58L 4PGDB 1M71B 3MUZ1 2J6EH 4D9LL 2V2XA 4G9FD 3SGKA 3X11A 4LLAA 4O2FA 4X80H 3QIBA 1RUKL 2B1HH 4MX7A 4MHHG 1JL8A 1OAYH 4P23D 3VXTA 3GMRB 1NKOA 3QHZH 4AMKL 1D5MA 4WDIB 3RPIB 3R0MA 3VG0H 2JJSA 4PJGE 4KRLB 3RNKA 4QGTA 5C0AD 4P2QB 2JJTC 3FQUA 4XWOC 2Q86B 2UZXB 3S37L 1CT8A 1TMCB 5DD0L 3P4NA 3WJLA 5AD0A 1U8IA 3MGTB 1ZVSA 4K9EL 3I3EA 1YN7A 4NT6B 3QO1A 4DKFL 1G7JB 3W0WA 3IS1X 1NL0L 1FNHA 1TITA 1BFTA 5DYOB 4P5MB 4L4JA 5C08D 4YX2L 3G6AA 1IARB 1FL5B 3QWRA 5IHUH 5T1KD 4H20H 4QNPE 5F3HA 4PYGA 4JDVA 4UIKH 5EU7E 4B0MM 3RWIA 4J3TA 4EBQH 1EIBA 3H8NA 4PJ7A 1MCPL 1T7ZA 3DMMB 2MTPA 3RP1A 3HC3L 3GK8H 2AJXH 1S9YB 4MXQC 4MAYD 3BIBX 1LO5A 1QFPA 2AEPH 3HS0A 4R0LB 3UYRL 3M1BA 4PRPD 1SBBA 3DX6B 2D0HA 3UZEA 4TUJA 1BD2E 2UY6A 2DLTA 2VLRB 5E2WH 3CUPA 4DTGH 1MFEH 1NBVL 3OKNB 1F3JA 3AY4C 4OQTA 1SEBB 4LAQH 1JNJA 1PG7H 3FB6B 2AKRA 2P5ED 4OLEA 4PG2A 2ZUTA 4J6RL 3LKQA 1XGRA 4JCMA 2WIMA 2BRRH 3E8UL 3HUJE 3ZHDA 3CC5A 3CVHA 4OBRA 1RURH 3BN3B 1FNAA 1GC1C 5ALCH 2OL3L 1BQHG 4U1IB 4NZTL 3A6CH 4JFZH 1NJ9B 4ENEC 2DIBA 4FZEH 2CK2A 1QNZL 4JFOA 3PWNB 4RIRA 5TH2A 3QP3A 2B4CL 1QBMH 1QFWL 4U1LB 3KHQA 4G80B 1DR9A 4QRRA 5C09B 3H9SE 4X9HA 1ZLWH 3LHPL 4Z7VB 4QRQB 3AM8C 1BQSA 1BOGA 4DK6A 4BK5A 3WIHH 1NANH 2WP3T 4Y19D 3OKEB 4DW2L 3BP5B 3WJJC 3G5YB 2VH5H 4LARL 2O61B 5E7BA 1AD9A 2F19L 4IOIB 5GQBA 5ADPL 3D87B 4EVNA 4AK1A 3Q48A 3RGVD 4S10A 4Y5YB 4OZHE 2AXHA 2P5WA 4N1CA 3EDJA 1PEWA 2ERJB 1ORQB 3TH4T 5BVJB 2W65A 3KPSD 3OR7A 4PP2A 3HE7B 4ODVH 5TE6L 1JHTB 3QZWA 4H1LA 4PJDA 1NC4D 3QEUA 3O4LD 1GJIA 1I7TA 1T04B 5GRYA 3I9GL 2QSCL 1L4IA 4LLVB 5J3HD 1RUPH 4Z76A 1D9KA 1D5ZA 1IAKB 4HH8A 1IGIH 3W82A 4QWWC 3LEYL 3PHSA 3GIVB 2Q1EA 4GBXD 3UZQA 5I1DB 5BS0E 3CSYA 2ED9A 4GW1A 3D39B 4H5SB 3P4LA 1GRWA 5J4MA 2Y72A 1ZK9A 4AEIL 3A67H 3P4OB 1WCBA 3UEZA 1G9NC 3U9UB 4JVPA 4GXUM 4Z7UA 3SDYH 1F4XL 2OJZL 1EEZA 1IAIH 1TJGL 1C08A 2GAZB 4ODWA 5B3JE 5CJQH 1UEMA 4E41A 2EE3A 2XTLA 4PV9A 2AJUH 5C0ND 4JZOA 3O9WB 1GPOH 4FQQB 1MLCB 2GSIA 1KG0A 3OX8B 4R7NA 4XVUC 2C3HA 1KXTB 1A7PH 1CVRA 1PJ9A 3HNTH 3QDMD 4YHMH 2EIZA 4HK0B 3D25A 3MBXH 4I0PB 4JPWL 4QO1A 3L5XH 5E1AB 3C6LB 4TVPH 3BZEB 3MLRL 3U0PB 5C0RH 4HZAA 2ZUXA 3ARFD 4X6CE 2EDQA 3HZMA 1RU9H 3FT3A 4PTTA 1CFTB 3FMGL 2WZPD 2NYYC 3RDTC 4FHBD 1CR9L 5I1LB 1UYWL 3D69B 2W07A 4S1SH 4X98A 2EDEA 4FXGA 3L3GA 3EOYG 3HG1B 1UWEL 1YEJH 5D7IE 5F7DA 3GSVB 4OGZA 3HE6C 5JHDE 3P77A 1UZ8A 4M48L 5D2LE 4ZOBA 3L3DA 2OR9H 1QSFA 3HKFA 2VDNH 1OGTA 5KG9B 4DCQB 4PJ8C 5E8PB 4ALAL 1FBIL 1YMMB 1MAMH 1JPST 1KIPB 2HJFA 5GIRA 2PYEB 2X4NA 5E5UB 4PR5A 3SDAC 2XV6B 4KRPB 4K23H 4N0CC 5DRNA 3DNKA 5SWQB 3B2VL 3R06A 4KKCC 1B4JH 3L3KB 2UYLA 1H0DB 1QRNE 2YS4A 4JKMA 5ESQB 2X89D 2EH7L 4N90E 1KTLB 4XP9L 4YHNB 1DLHA 1H5BC 1J9CT 1HHIB 4NQED 2HKHH 2RJMA 3KJ4C 5EN2A 5F96H 5FYJD 1AGFB 1MWAA 5DTFB 3QUXB 2QHRL 4NQCA 4D8PB 1J86A 2EYTB 3K2MC 3QQ9D 1TJHL 2JB5H 3KR3H 2W92A 1CFQA 4WV1A 5ECJE 3CJJA 3V7AE 5HVHC 5T3XD 5D7LE 3GMNA 2A0LD 3SDCA 3EKCA 3K4DA 1MCWM 4JR9H 4AL8L 3EDDA 4AIZA 3H3KA 5ICZA 1FZOB 3ULUH 4UZGA 4GAGH 2WLYA 4Y16A 3IJHA 5MEPA 4OZFA 3QPQC 1MJ8L 4KY1H 5A43C 4ZTPL 4BH8A 3RVUC 4CNIA 3RIAF 5DUPL 3GSOB 3JTTB 2FWOA 3QUZD 5L8KB 2XICA 2WBJA 3VWJA 2YWYA 4QYOB 3WN5A 3WHXA 1MNUL 3BDXA 4UBDC 1MI5B 1NEZG 5IVZB 3D2UD 4ZYKB 2UY7A 2WUBH 4GG6B 1O7SA 2NW3B 5LJYH 3WEXB 3MMEA 3FONB 3RVTC 1RZJH 2IPTH 5CJBA 5DQ9B 4AIOA 5BV7B 4G6FB 4HZLA 3IXAA 2VDMH 5CSZA 5HPMA 3HLAB 3F58L 1FGNH 2IAMC 3EYOB 5DC0A 5IROC 2WP3O 2XKNB 4NHUA 2ADIB 3H9HB 3PHQB 1CG9B 1VFBA 5A16B 1ULVA 2GTWB 3OR6A 4JN1L 2GITB 4P9MH 3T1FA 4UOJA 5JLZA 3BE1H 1RQ5A 5FHBH 4D9QE 3IJSA 1X5XA 2Y36L 2DDQL 1BIHA 5SWZA 1XF5B 3X3FL 4WFFD 5T1MA 4FQLH 4PB9H 2R1YA 4OB5L 5ALBH 3BQUD 4X7CC 3VXSE 4LFHD 1QBBA 4DVRL 1K5NA 3QDJD 3FO9A 4F2MB 3GHEL 1BZ7B 1XR8B 1XH3B 2V17L 4JB9H 3VI3F 3VA2C 1EMTL 2XN9A 4U1JB 2DTMH 3WNNA 4L3EB 2LU7A 4YZFE 1I1AD 1PBYA 5CLTA 3VXME 4URTB 2AV1A 4ZXBB 2FD6L 4N9GA 1XCTB 4M43H 4Q7DA 3MRKB 1EHXA 2LE9A 1ADQA 3L95A 1SJEA 3OF6D 2IPKA 1W0YT 1Q72L 5C07D 4LKCB 3ZT5A 5D1QA 2KBGA 2FATL 4ZNEE 1ES0A 1YY8A 4X9IA 4OBSA 4F7PA 1JPTL 2JK5A 2R2EA 3D3VB 4YDKL 5H35B 5LBSL 4XPAL 1WEJL 3BH9A 1FYTD 2C3WA 4HJJH 1CQKA 4PJ8D 4DQOL 2E6PA 1TTUA 1NQBA 4NQSA 2VQUA 1U8QA 4CU6A 3VFNB 2CK0L 1QO3B 4KK5D 1CTNA 2IGFH 4K7FB 4F7MB 3TEUA 1N4XL 4EQ2A 3I84A 5CZXC 4ODHH 1DDHB 5F1NB 2ZCHL 4XBGA 5EUOF 5AUMB 1T5XB 4JFHE 3ZL4H 3QUYB 5T1LD 3DROA 2DQUH 1TLKA 3W0WE 4PJ9B 5CJXA 5CEXA 3V6FA 4L4TA 3OAZH 1AP2A 3BWAA 4EN3D 4R4BB 2XZQH 3K4AA 1KIUA 3NFPB 3QUKA 5LCVL 2UV3A 1KGCD 3IFLH 1JPGA 4JN2B 1KT2A 3P73A 4QOKB 4KV5F 5F6IB 3DX8A 1UM5L 1F4WH 2PTVA 4CGTA 3EDEA 4PJ7E 4RRPA 4U33A 1R5VA 2A9ML 1BVLA 5IB5B 2FYYB 5JO5A 1W72A 2F53A 2CIKA 4PV8A 2BY1A 5EOCJ 1HYSD 4KJYA 2PR4L 5GS1A 5CP3H 3ZDYE 1KN4L 4OFYA 4JO2H 5GJSL 2X4TB 4RGOL 5I30H 2DQIL 1NAMH 2W0PA 4ZTOH 2PN5A 1V3MA 3C8DA 1IVLA 3LKSB 4X5LA 2Y6SD 2MSPA 1YQ2A 4NKQB 3MLTB 3QUML 4ZFZB 4R4FL 1OQXA 1TCRB 1LO4L 3RY6A 4FQ1H 4JHZA 2E8YA 4U1MB 1U2HA 3SE4C 5BVPH 4NN6C 4WNQB 1UACL 1HIMH 3W2DH 1N3NA 5HD8D 1UENA 2JCCB 5K93A 2DQGH 5TQ2H 3C2AH 4ERSL 4XI5D 4EI5D 5F1KC 4WFHE 4OCYL 3B5HA 4P99A 1Q94B 1CGUA 4KJQC 3QCTL 4QRRE 3A6BH 1G6RL 3VFGL 2DI7A 5DD3H 4OLUH 1RZFL 5JHLH 1NCCH 2LFGA 2C3VB 2NY2B 1AO7A 1CZ8L 4U05A 4Z77A 3V5DB 1N8ZA 5JPMB 4UV7H 3PNWB 3SGJC 3ROOB 4Q6YA 4L29A 1FZJB 4PJAB 3MRCA 1OSZA 3P2TA 5DLMH 2P5WE 5GSVA 4IRSD 3S3JA 2HTKC 5HYSG 1SYSB 1BF2A 3CVIH 1A7OL 1FSKB 2A6JA 5F3BA 1Q9OA 3ES6B 4PJDE 5MEND 1IGFL 1AR2A 4K8RD 5CBAB 4F7EA 1HQ4B 4P2OB 3RPKA 4ZFGL 2GJ6D 1UQSA 4LASH 4JM2A 4I13B 1A5FL 1AD0A 4PREA 4P46A 3VJ6B 2CR6A 2CUIA 1FZKB 1RVFL 5EDXA 3LDBC 4PJBA 5JR1H 1W0WA 3ESVF 2GEEA 1WBYB 2FEDC 5C1MB 3MV7B 5INCA 4UU9A 2FHCA 1HHHB 1LEGB 2AJYL 4JO3L 4KMLB 3VFOB 1RIHH 3S5LA 4OLYL 4Z7UE 2B20A 5DQDL 3O3DA 1UJ3A 4P4KD 5ERWB 3JVGA 3IGAA 4JFPA 3PWLB 4WY7L 4E41E 4JFDA 1AXIB 1KTRL 1RZKC 3MODH 5I1JL 1H9VA 1OSPL 2FHFA 2VE6A 2IC2A 1RK1B 1ZLUK 4PYHA 5FGBC 2NY5C 3OZ9L 4PB0H 4MNQA 1IAOB 2HRLA 1N0XL 3OXSA 3DX9A 3V5KA 4YWGH 5FK9B 1CFBA 4EUPA 1GYAA 3TGXA 3K74B 2P1YA 4IRJD 1F02I 3QEQB 5EZOH 4BUGA 5JA9A 1JV5B 5GGRY 3HAEB 3ARDC 3GIZH 3TT1H 4QY8B 5E6YA 3RWHA 3MRJB 2JIXD 3VXPA 1LDPH 4U6XB 4PJHA 1L0YA 3VFPB 1WAAF 1W8OA 3PIQA 3QCUH 3HA0A 3BZFB 3DVFA 4HLJA 4ZUSA 3I50H 3QWOA 2AK4D 4LU5L 1Y18A 1CCZA 3IDGA 1YN6A 5F1IA 1QSFE 4IS6A 1NUDA 1S9WB 1MHHB 4HCRA 3PHOA 4UQ3B 1UH4A 2NW2B 1F3DH 4Y0GA 5ACMA 4LPTA 1GZPB 2H9GB 4DJMA 2ZUVA 1MHCA 2PNDA 4RNRB 2VC2L 5TDNA 1IZKA 3RDTB 4AIXA 5ILTL 2Q8BH 5E8OB 1YJDL 3FQTB 3DOSA 1BOYA 2DL9A 4PRIA 4G8GD 3SDXB 1FNFA 4NWUL 2NTFB 1X7QB 3G9AB 4QHNA 2A77L 1I8IA 3ZYIA 1MCWW 4JCLA 3AB0B 5KTEL 4LSRH 4GG6F 43CAB 1FJ1B 1YECL 2IPUK 1OQOA 2XA8H 1DEDA 1YNTA 2P49B 3HE6B 3VFTB 4PJIB 4Y2DB 2P43B 4TUOA 4NQDA 3B9KC 1BJ1H 2FZ3A 1B2WH 3UJIL 3NPSC 4X83A 3VGEA 5H8DA 4Y5VA 4KMQA 2WWKT 1NLBL 2ZUYA 3MJ9L 5HI4D 3V2AR 4FFYH 1AKJD 5T3ZD 4ZO9A 4JEGB 4EI6A 4PLOB 1YYLH 4S1RL 4J3UA 5JW4Q 1NBYA 3KPNB 3HNSL 5E2VL 5HDQL 4DVBA 5DJ0A 1TXKA 1K4CB 1LK2B 3CZFB 1CN4A 3SE3A 3BXNB 4XNUL 1KCLA 4X7TB 2VN4A 4X6EB 1G6VK 3BMVA 4LK4A 2FGZA 3EOBB 2FEEL 2CLZA 3GB7B 3MRFA 4WUUD 5LAXB 1OHQA 1A6UL 5MHSD 2EZ0D 1UM4H 2HJKB 1RMFL 3HC4H 1D6EB 1EX0A 1MRCL 3EZJB 4JPIA 3D85D 5I76A 5F7WC 4LLUB 4NQUA 4XCNB 2XY1A 4Z7OE 3SKOB 3KYKH 4K7PX 1RZ8B 4GAYA 5HVHB 1WC7A 3BGAA 3SJVD 3O8XD 1WIPA 3FFCA 5CILH 4NC2B 1E4XH 1OAZH 2DBJA 2BVOB 1WFUA 1LO3L 2YD1A 2V5SA 2HG5A 3E2HC 4NKDB 5KANG 1VDGA 4DEPB 5DRXA 5L88H 1JNHA 2K7PA 4RGNE 2VLKD 3LQAC 4NP4H 3UPRA 1NGYA 3L3IB 5F44A 1U8JB 1DBKL 1NMBL 2Y23A 1ZLSL 3C5SB 3QI9C 1KENH 4IJ3C 3L6FA 2WBWB 5L2KD 1B6UA 2VL5A 5GGVY 3EO0B 3GJEA 4BSVB 5IW1B 5GRUH 5FCUH 1MCRA 3O11B 4YIQB 3SN6N 3C09C 4A2LA 3MV9D 3QIWA 4QHUB 5T5NG 3G5ZA 4HS8H 1II4E 1T80A 4X4YA 3P9LB 5IFHH 4KK8C 1B0RB 4XPGH 5SWZE 3C60A 3EBAA 2IMNA 3CMOH 3P0GB 4GAJL 4JKKA 4XXCA 1IEBB 3U0WH 3B2UC 5C2BH 2EDTA 4R97B 1R3KB 1YPZB 5FUCE 4UTAL 3H9YA 2YZ8A 4JJ5A 1NC2B 2V2WA 1S9XA 4PGCA 5AWNL 1YDPA 3MNVA 4E42A 2R1XB 1O0VA 2XN9E 2BVPB 4U6HA 1GIGL 1I7UA 3LH2H 3BP4A 1KCUH 4ZMAT 3STZB 3ETBF 3WIHA 5SX5K 3NOIA 1BFSA 1OD9A 5AZ2L 2A1WH 3RWEB 3WNMA 1BFVH 3JV6B 3GZKA 1J8HA 3GI9H 3IDJB 5FYLH 3KPPA 5HI3D 3GKWL 3CFEB 1HCFX 1KB5B 4P2QD 4JKWA 5IEHB 3BUYA 5JIKA 3V7MA 1FFQA 1JVKA 1A7BA 1TETL 4Y5XA 4Z9KB 5IWLC 3HMXA 3FB5B 4FN0A 2DJ4A 4OZIF 1HXYB 1JWSA 2EDXA 4XP5L 5T5NF 2PTUA 3S37X 43C9B 3MLVH 4WI2A 5HVGB 5C2UB 2J3SA 2XI9A 4WHYG 4GKSA 4XCEB 3UYPA 4HF5H 1ETZB 4L9DA 3NIFF 3GSRB 4YK4C 2H3NA 2GCYB 4YFDB 4MSWB 5CUSH 2OCFD 4IIQA 5DVKA 3T2OA 1M7IA 5FV2A 3FJTA 3DMMD 3KYNB 2HH0L 3BEVA 1LMKA 3S34L 2BVEA 4YPGB 4JKLA 4PRDA 3ZKMD 2EYSA 2WQRA 2G75B 3VXNB 5J1AA 5CINL 2OXGA 4PGEB 1RIVL 4L4TE 3UC0H 1E4JA 2VLRD 4PJGB 2R0WH 5AEAA 1OP5K 5CS7A 2HTLD 4NBXB 1G7MA 3BI9X 4NKMA 1IC5L 3U4BL 4BZ1H 1AXSA 4X4ZA 3FN3A 4O02H 4MQSB 1F6AB 3EJYD 1EZVX 1XAUA 4S1DD 4KU1A 4FQHA 2F53E 5CP7A 5DF0A 2G9HA 2ID5A 2CMRL 4PG2C 2J88L 1YUHB 4JPKH 5IMMA 4F9LC 4WO4B 1AQDB 2A6IA 3WLWD 2W38A 4WWID 4YEEA 4ZPTB 5C0GB 3P0YL 2V7NB 5HGDB 1FL3A 2LVEA 5C09D 1SY6H 3ZTNH 1KCRL 3C5JB 2DQTL 5E9DB 4JREB 4OLZH 4GH7B 5ETUB 3MO1A 4R3SB 5I1CH 2JB6B 1NFDB 1EJOL 5I8EB 4JY6B 1U8HA 4QF1B 3QR2A 32C2B 4LOUC 4UOW1 4FABH 3HAEG 1PAMA 3HI1B 4PJ5B 1X5FA 2ICWA 1OAKH 1BD2B 1RK0A 2P48B 4P3DA 5DUBB 2PW2B 3OTTA 4FQ2H 2RR3A 1G1YA 4O51B 3TO4B 3TZVA 2HT4D 3TFKD 4NRYB 4HJ0D 2DM7A 4D94A 3QNXA 3VMNA 4MA3A 3HE7D 4KJPC 3WFBL 2XQYG 2V7HA 5D1ZC 4HWEH 4QXWA 4MJ6B 3HUJB 2HA1A 2Y7QB 2Z31B 3GUTA 1I8MA 1AO7E 4U1SA 2XY2A 4GAFB 4EJ1C 1OT2A 4JFYA 4CJ1A 3WS3B 2XG4A 1EUTA 3MRRB 3KWWB 3W9DA 4W6XB 5BZWA 3NH7L 3RIFF 4KK9D 2X1QA 4Z95L 3H9SB 4N0RA 2UUDK 4C83B 3D39D 2YPLB 4KH2A 5ENWA 1ZXQA 1W0VA 5I8KL 2VR4A 1PSKL 2COQA 2BVQB 2BFVH 2DYPA 3U7AA 1YNLL 1GH7A 4QHKI 5ABDE 1FFPA 1F58L 4MCYA 4C56A 2ZKHL 4D0CB 5D6DC 3TBYB 4R96A 3ULVE 2LV4A 4ZUUB 1VADB 4PJBE 3O9WD 3DUSA 5L9DH 2QADB 5E70A 2OQJA 4YXKL 2ARJA 1EA9C 4WWKC 4I0PD 1FH5H 3D18B 4HWBH 1VGKA 3SKNA 5CIPB 3EOTH 9CGTA 3STLA 2ZSVA 3PXHA 3WD5L 3VFWA 1D5BB 4G42B 4KHTH 5HHNA 1YEEL 3LPFA 5CD3B 5HYQA 5BS0B 1YQVL 2R0KH 5CZKA 3QH3B 4XHJD 1YEHL 3V4UH 2D7QA 4W81A 3NGBB 5GPRA 2ICEA 2K9UA 3NABH 3MLYL 3DRTA 3MQIA 1DANT 3HG1D 4RFEB 5E8NB 3SDXF 4MNQE 1J0YA 2OI9B 2UWEF 3F6LA 4YDLC 3TJHC 2MCPL 3BESR 4G6ML 4PP1C 5MERA 3QXVA 4NZUL 4JY4A 5J56B 4B41A 1XGTA 4OI8A 1DZBA 4P59L 5E2UH 1MCQA 5B8CA 1YMMD 2JJVA 1WBZB 2WUCL 2YD8A 1CE1H 5EPMB 3UDWC 2PYED 3AGVA 1S5IL 1I3GL 4KJWD 1QLRB 3GBNH 4BKLA 5I15L 2CLVA 4KRPD 2W91A 1BJ8A 2CJUH 2MKWA 4R2GC 4DUVA 2XWTB 3IETB 3O2DH 5TQ0H 1CI5A 2X4RB 4X6CB 2NZ9C 1IILE 5BJTA 4K3HA 5I16B 3TBSB 4LSUL 2VRAA 5GGSB 4NC1E 1HEZB 5DJXB 3AAZB 2V9QA 1WJ3A 1HHGA 1A64A 3RVVD 3MREB 5TFSL 3QUXD 5E0QA 1OAUL 4LCCB 3U2SB 3RBSA 3TWCH 1OPGL 4PRIE 4F8TA 5JHDB 3OB0K 3IDIB 4U7MA 5D2LB 4BH7B 1FO0H 4O2CB 5DR5H 1ODAA 4UIMB 1E28B 3QA3A 1Z3GL 4YE4H 5BXFA 5HHVH 4FA8A 1T22B 1L7IL 2QKIA 3KPRA 2IH1B 4XB7A 4KI5F 1JN6A 1GGCH 5FO8B 3TBWA 5I1KL 2CSPA 4NQDE 2GKIA 3I75B 2ZG1A 1U3HA 5IVXF 4YHOL 3RZCB 5KJRH 4JFFA 3JV4A 3SCMA 3MROB 2GUOA 4WCYL 3WIFA 3LEVL 4R90L 4KTEH 1C7SA 1JGDB 1U93B 1QRNB 5DD6A 3WE6A 5GGTL 5KS9B 3QBTB 3MRGA 2OP4H 4LAJH 4UQ2B 1MI5D 4OD2A 4PIRF 4MJ2A 5J11C 2OSLB 5KZCB 1U95A 4QXUL 5C7XH 4OCXL 5D2NA 2Q8AH 3MRQB 1OY3B 1TZIA 3BPNB 1K8DB 4H0HB 3MZGB 3CZJA 1NAKL 2OTWA 2G2RB 3BYTA 1KIRA 4G6FD 4MXWH 3MLZL 3OAYK 4ETQB 3CH1A 4F15C 2A6KA 4KKNA 5D7LB 3RI5K 4M5YH 5GZOD 3NIDE 3G04A 3KGRA 3TPUB 4FNLH 3V4VL 4K3DL 5SV4A 5IKCB 2ESVB 2QQLL 4U6YA 2F9BT 2DQFA 4XT1C 1AI1L 1ORSB 1OARH 3FFCE 2VZ3A 1MVUA 4I0CC 4OTXH 3BKYL 2DI9A 2RB8A 2WQ8A 3MLWL 5IQ7H 1HDMA 3F7YB 3FQNB 4LDLB 4NN5B 2V2TB 5FHAH 5E8EA 1CWVA 4HEPG 1BWMA 2FIRT 4AG4L 1RUQH 4OGYL 4XH2B 5GISL 2YRZA 1T03L 3O0RH 1UA6L 4FQJH 4LLYA 4R8WL 4U1NB 3BKML 5CP3A 1N6UA 4ZPVA 2AV7B 5JXEA 4XNZC 1NAMA 1JZ3A 1DFBH 5C92A 1UH2A 1U91A 4L3ED 3DXAA 3HRZB 4LHUA 4UAOC 3OL2A 5FUCC 4LCUB 3TVMC 4KTDH 3N9GL 4ZXBD 1JHLL 2UZYB 1F90H 2XQBH 2CD0A 4L5FL 3CFJB 1SM3L 5J8OA 3MR9B 3CFKB 2KQNA 3C5ZA 4BQ8A 1KPVA 4GMSL 5JZ7C 1LO0H 1BGXH 2C3GA 4NZRH 5HDLA 4G3YH 3D3VD 3UXFA 4LHJB 5C6TL 3FOLB 4YHIA 3I6KB 2AP2A 5F7LB 5BO1H 3QFJA 3T2QA 3VXSB 3FT2A 5FO9A 4V1DA 5I66A 3LRHA 1GOGA 1CTOA 3L3HB 1J8HE 2Z91A 1FVEA 2MQ0A 1PZ5A 5GRWA 2BK8A 3TYFB 4MB3A 1KF9B 2PXYA 3RNQA 2ENYA 2R29L 2ZUQC 2R0LH 2YRLA 3BT2L 3LS4L 5ESAB 3MRIB 4JO1L 5DI8B 1JTOA 1DBMH 3BIKA 4PJCE 1UGNA 3EGSB 2FH8A 3VD5A 3VXMB 3QUYD 2F54E 4RZCA 4JGMA 5DVLA 1P7KA 3FQRB 4O00A 4XP1L 4F37K 5C0FA 4XNXH 5IEKA 4MB4A 4Y4HA 4CDGC 3FRPA 4XX1E 2EDJA 1OTTD 1LP9F 3S88H 1H8OA 1OGAA 3GSNH 4LVNB 5BW7C 4QOKD 1P4IL 4I3SL 4K9EC 1JFQH 3V8OA 1HWGB 2P4AB 5J12B 1PX3A 3RWGA 1X4ZA 2V2XB 3X11B 1U8KA 4POZC 4NFCA 4O2FB 3QIBB 4KGJA 4MX7B 3VXTB 1WVZA 3T4YA 5EORH 4NN7B 3SKMA 1D5MB 3U6RA 5DO2C 3I6LE 4KQ4H 5DD5L 1NMCB 3RNKB 3H2WA 3B83A 1BIIA 3FQUB 3GBLA 3VMPA 4HG4J 1A22B 1WZLA 1CT8B 5DVOA 5AD0B 1U8IB 1ZVSB 1P4BL 7FABH 1YN7B 4HCRL 1JYVA 1RUMH 4JFQA 3RX5A 3QO1B 5I17A 1I3VA 3W0WB 5DZOA 2CIIA 3B9VA 1GC1H 2N4IA 3DWTA 4MA8L 4DGIH 1IT9L 3G6AB 4ODUA 4NKIH 3HZVA 1JF5A 1ZHNA 4QRTA 1G9EA 5F3HB 1DBJL 1UWXH 5IB2A 4JDVB 2BSED 3MOQA 3U30C 4G7YL 3GO1H 5FB8A 3HNVL 3G9VA 4UTBH 4X7SH 4PJ7B 2X70A 1MAKA 4UV4L 2CDGA 2NY2D 1LO5B 2PYFA 3HS0B 2BHYA 4NNYA 5I74B 3OAUH 4L3AA 2NY4C 4TUJB 3QDGA 2Q6WA 1JWMA 3HI6L 5L7XH 1QTYT 2B4CC 3CUPB 1JZ7A 1FGVH 3HPLA 5FYJU 1I8KA 2VXSH 1F3JB 2J6EL 1J87A 1I9JL 3UCRA 1IGTA 2A6DB 4MNHA 2AKRB 2BSSA 5L6YH 4LSVH 3ISWA 1LEKA 3LKQB 3QHZL 3VFRA 5K9QI 4APQC 2O93L 3LKNA 4HT1H 3CC5B 2HKFL 3CVHB 4PG9A 1KACB 4P2OD 1N5YH 2MWCA 3RTQA 4JFOB 3N1MC 1HKLL 4KAQH 4RIRB 2C4FU 4DGVH 5TH2B 3NFSH 4JO4H 4JDTH 4OUUA 4OM1H 2XZAH 1U8MA 2HVKA 4PUBH 4QRRB 4TULH 2AJSL 5HGBA 1VGEH 3TBVA 1BOGB 4ODTH 3V4PH 2ORBH 3HRPA 1UH3A 4DN4L 4HKZB 5DXWA 1ZSDB 3VXQA 1AD9B 2J8UF 4IRZL 1E0OB 1F3DJ 4H20L 3WKMH 1F42A 1RZ7L 4YUEL 1G9NH 4EVNB 4UIKL 2GW5A 3VXRA 4XCCH 4LRNH 4W6YB 1IC4L 3H0TA 1T0NA 1MJUH 2VDQH 2P5WB 4OCWL 4LSTH 2I9TA 3BEWB 1C1EL 2YXFA 5DWUH 2W65B 2JJWA 5LWYH 1TJIH 3OR7B 1MRFH 4PP2B 3H3BC 3QZWB 3ULUE 4H1LB 5H37H 4PJDB 5DUMH 3QEUB 3MRNB 5DQJB 1I7TB 4OF0A 5KVDH 4LLMA 4Z76B 1IC1A 1D9KB 1D5ZB 5GS0D 3NN8A 5HHOE 2H32H 1NCAL 5I8CB 3VE0A 4LAQL 3QEQD 1PG7L 1BJ1J 5F7UA 2CRIA 5I75B 3CSYB 3T0EC 2H45A 4GW1B 2BRRL 1TQBC 2FL5B 4FMKA 4P2RD 4F8QA 2PCPB 2HAZA 5EIVA 1U3JA 1IGCL 1Q0XL 4GXVH 2P8MA 5IFAL 1H15A 3LSOA 3MFFA 4Z7UB 1QBML 1HNGA 1VFMA 2FBOJ 1IC7H 1C08B 4K7PY 4ODWB 1MF2H 4E41B 5J0BA 4XZUA 4PV9B 4F9PA 4Y4KA 4JZOB 4LSQL 2GSIB 4HWNA 4PLNC 4R7NB 4UINH 2EIZB 3T04D 1A6AA 1J8KA 2BSTA 3D25B 1CD1A 4M7LT 5KS9F 4XAKD 3PDGA 5EULV 4ZFOL 4OLVH 4MS8C 3HZMB 3FT3B 5DJAA 4PTTB 4JFEE 4U3CA 3REVA 1I3RA 3GHBH 4C4KT 3KYOA 1FG9C 4X98B 4FXGB 5EBWA 1CXHA 2A73A 2EEDA 1NUGA 1RUPL 1HHKA 1IGIL 4KKLC 5F7DB 1A6VL 3P77B 1UZ8B 1XCQA 2Q3ZA 3VCLB 1NGWB 3IXTA 3L3DB 3Q1SH 4PLKD 1QSFB 4KKAC 1CBVL 5EU3B 4MJIA 3UBXG 1Z9OA 4Y5VC 2B5IB 4WUKH 3KPRE 1LO2H 2HJFB 5GIRB 1E4WH 4DKAA 2X4NB 5HPOA 5GJTL 5F7FA 1OTSC 4LLWA 1CGYA 3DRQA 4PR5B 1DBAH 3SDYL 5DRNB 5TDPA 1C12A 1IAIL 4GQ9L 4JFFE 3R06B 5IBTH 4D0BA 3S3PA 4M7JH 2WV3A 4EKXA 1JJUA 3ZLQC 2AQ2A 5HDBF 4CADA 1T1WA 3HNTL 1MAJA 2VSDA 4KRNA 1NCBH 3MBXL 5D2NE 1NPUA 3L5XL 5EN2B 3BVNA 2NY1B 5K9KA 1MWAB 4P3WA 4TVPL 3MLPA 4KI5D 1MIEH 3NA9H 3SDDC 1ERNA 4NQCB 3RVWC 3F7QA 5D93B 4FFWD 1IBGH 5AYQA 3P4MB 1CFQB 1MQ8A 4WV1B 3GRWH 3H7BA 2YMXH 3Q6GH 4KGLA 5FYKH 4I9WD 3CDFA 4XWGH 3GMNB 3P30L 1MFBH 3SDCB 2OX5A 4ONFH 4AIZB 5ICZB 3QCVL 3SKUD 1QFWI 2AK1H 1CDHA 1XIWC 1A9BB 4Y16B 1V7MH 5MEPB 4Q6IC 4OZFB 5SV3A 1BFOA 2VDNL 4BH8B 4CNIB 2HFEA 2X40A 3BKCH 2FWOB 1AR1D 2WBJB 3VWJB 5KN5A 2PO6C 1IKNA 3WN5B 3WHXB 2B1AH 3ZKNC 2DTSA 3OAZK 3PGFH 3T0VA 2YR3A 3TIEA 5T3XL 1FC2D 3AREA 1G0DA 5KSBB 4GG8A 1N6QL 3C60C 4K23L 4JQVC 4ZS6C 3G5XA 2X4QA 1CIDA 4A6YA 4HZLB 3DXAE 2E27L 5CSZB 4BFBD 5HPMB 4HHAA 3PE9A 3MC0A 4RGNB 3RRQA 2HKHL 3LN4A 3CU7A 1Z6JT 4JDZA 5CJOL 1VFBB 4JVUA 3ARGD 3TN0A 1O5DT 4L8BA 3OR6B 4PPTA 1OP9A 3KR3L 5I1EH 4NQXA 4CMHB 3ECBA 1ZS8A 3T1FB 5JLZB 2WLZA 3IJSB 1QYGL 3MLSH 5SWZB 1LNUA 2LTQC 5T1MB 5D7JA 4OFPA 4XNZB 4JR9L 4HLZG 4FQXC 3JTSA 5JW4N 2RAMA 2AW2A 1K5NB 3QQ3A 3FO9B 4RAVA 4V1DE 4ESKA 4GAGL 1CGSH 4UAOB 4WTZA 2KKQA 4E5XB 1I4FA 1Y6KR 2VXTH 4L9LC 1U36A 2X05A 2IANA 5DC9B 3FKUS 1A3LH 3OKMA 1EK3A 2QJDA 4YBLB 4YHYC 4BSWA 2R56H 4WFEE 2FJFA 1E4KC 2AV1B 1BZQK 3FAWA 3GM8A 3KLHC 5F9OH 4N9GB 2BVYA 3MLUH 3IF1A 5SWSA 1QBLH 4IIQC 2HLFD 4X7FC 1BM3H 5F71A 1OP3K 3L95B 1F4AA 1SJEB 2IPTL 1PKOA 2ADGA 5K9JH 5I73C 1OGAE 5D1QB 3VDBA 5JDSA 1WT5C 1ES0B 1YY8B 1I9RH 3GSQA 1HILA 2JK5B 3EDKA 2R2EB 1JGVH 5DJ6A 3BH9B 4RMSA 4HWBA 1NCDH 4NQSB 3WXWL 2H2SD 2CO6B 2EDLA 3CDCA 4FP8H 2QQKL 4N5ED 5GGVH 1TVBA 3W39A 3AC0A 3QZWG 4UDUA 3S36L 4H1LG 3ILQD 4NM8H 3TM6A 4WO4D 3BE1L 2A9NH 1I9EA 1MRDL 4OF6A 5KOMC 3GMQA 2QTEA 4ISVA 4XBGB 4NKOA 5E9DD 3Q3GA 3MLXL 4I5BA 5IHLB 3CXDL 4C4KO 3X17A 2Y25A 3P3YA 4UT6L 4RCAA 5EWIH 3DROB 2E7LC 4NO0A 5B39G 5HHPA 1TQCC 1IMHC 4PJ5D 2CKNA 5CEXB 1TPXB 4DAGL 5HYEA 1BD2D 3V6FB 3CFCL 4LSSH 3BWAB 3OPZL 3ZE2F 3MJGX 4GKZA 1EO7A 3O6FB 3QUKB 3TO4D 1JPGB 2F5AH 3RJQB 1KT2B 4RFNC 2VITA 2VDLH 4G9FA 1BEYL 1CDUA 4P23A 1M6OA 4Y2OA 4ODXA 5CEZE 1R5VB 4FTVA 1BVLB 2Z31D 5JO5B 5HYJA 1W72B 1A1OA 2F53B 4Q58C 4WVRA 2CIKB 3O4OC 4HPYL 4PV8B 4WU7A 1D3CA 5C0AA 2HLAA 3SKJH 4KJYB 4I3RH 4X6BA 4AEHL 2I9LA 3QDGE 5GS1B 1C7TA 2BJMH 4ELMA 2V5RA 4P2CG 2BNRA 3H9SD 1T7YA 2YPLD 4EIGB 4XBPA 5CSBA 2BCKA 5TJWK 3R0NA 5GGUA 4RMRA 3VGBA 3EOAA 1IRAY 1GZQA 1WISA 5HHQA 2LU3A 2VLME 3VRIA 2IQ9H 3V0WH 1N3NB 4JZNA 4P5TC 3O6ML 1AFVH 5EA0L 1F00I 1K4DA 1FO0A 1T1ZA 3I6GA 1Q0YH 4WI4A 3R8BB 1OAQH 4MD4A 5F7EH 4U1HA 1S7QA 4MJ4A 3RU8H 3RUGA 3ZE0F 2QADD 2O26U 1JRHH 2KH2B 2DF3A 3AS2A 4X5WA 2DQUL 1WUNT 5DJDA 5AG9A 4Z77B 1AO7B 1N8ZB 5D1XD 4HIEA 5BRZA 5ITBL 3IFLL 4OCNC 4QTHA 1G7QB 4L29B 3PGDA 2MMXA 4BFGA 5BS0D 3MRCB 1YY9D 1OSZB 3SBWA 4OJFH 3FN0L 1CXFA 4NJAH 5GSVB 3BP6A 1ED3A 1RZKH 4LGRB 3CX5K 4R26H 3MXWL 2A6JB 3SOBH 4U3HA 5F3BB 1Q9OB 2NY5H 1AHWA 2BDNH 4HUWB 4JQIL 4F7EB 2DM2A 4QEGA 4LEXH 4PTUA 3GNMH 3RWJA 4JM2B 1AD0B 2P42B 4PREB 1OWWA 3BDYL 4P46B 4ZTOL 4XBEH 4YQXL 3RKDD 4L8DA 3K80A 4ZSOA 4PJBB 1NCWH 1W0WB 2OYPA 1X5YA 1MFAL 2FECI 1P9MC 4NO2B 5INCB 4FQ1L 4UU9B 3B8YA 4MZ2A 1C5DA 4ZODA 1HIML 2Z8RA 1JTPA 2DQGL 5DMGC 3RGVA 3MYJA 1S7UA 2H6PA 3P40A 4KUZH 1LVEA 3VWKC 3S5LB 1A4JA 1YEDA 1OW0A 4MQXD 2CKBH 4WI6A 5INDA 3O3DB 3A6BL 4K8RL 1UJ3B 4YFLI 3D0LA 3IGAB 4JFPB 3WDIA 4LCWA 1FNEA 4JFDB 5DD3L 2DWEA 5JHLL 1NCCL 2VE6B 2YUVA 1E6OH 4UB0H 1R5WA 4MNQB 3ZSSA 4ZD3H 1JHKH 3OXSB 3DX9B 1JPSL 5JHDD 3V5KB 4EUPB 5F7YC 1PD6A 3FQWA 4U2YA 2DS4A 4KC3B 2KDGA 2P44B 1HHJA 5FUZH 2Y9RT 1ZVHA 1Q8MA 3LB6D 3RWHB 3VXPB 3O6LH 2NX5E 3ZDXF 4PJHB 3PL6C 3OKDA 1DEEA 3QSKB 4KI1A 2QSVA 4P3CH 4ZUSB 3RZCD 4GRWB 3KJ6H 5A3IC 1PW3A 3QWOB 1JWUA 3QRGL 4P57B 3TT3H 5JR1L 2EO9A 1KOAA 1YN6B 5F1IB 3N85L 4N90D 1NGXB 1KFAL 2JE8A 1X5HA 3L5WA 4IS6B 1MCNA 2ADJA 4MJIE 5KZCD 4OI7A 3PHOB 1NCUA 4WEBH 2Z0BA 3DV6A 5FYLE 3U0TA 1KEGH 1MHCB 3MJ8B 4YHPB 4PRIB 3RWDA 4MWFA 2Z8WC 1CQYA 4QHNB 1I8IB 5J6HA 5DRZA 3C08H 5D7LD 4K2UH 2IBBA 2IBZX 4KVCH 3VXUA 3KAAA 4G8FA 5KSBF 3G6JF 5D71H 2HFGL 3LIZL 2DQEL 5A2KH 1YNTB 4CW1A 1PLGL 1L6ZA 3V0VA 3EO1A 2ESVD 3FN9A 4PJEE 4TUOB 4NQDB 2FZ3B 1DUYB 3GSNA 5KAQF 1H3PL 4XP4L 3ET9F 4ZO6A 1KJVB 4Y5VB 4XP6L 2ICWI 1P69B 25C8L 2CDEA 3FFDA 5EZOL 1CDCA 4EI6B 1P5UA 4PRHD 1NBYB 4JAMA 1WCQA 3FZUC 3JWNC 3CK0L 3GIZL 3LQAH 4DVBB 3TIDA 2WWMC 5DJ0B 1LDPL 3E6HA 3QCUL 4HWUA 2B7DT 3IVKA 4L1DA 3VI4E 2IG2L 1JTTA 1O7VA 1YEIL 2WM0A 2CLZB 1D5IH 3LPGA 3AY4A 3F65A 4ODSL 3IRPX 4XVTH 1FNSH 3E6FA 2VQ1A 1F2QA 3MUGA 4RMWA 4JPIB 5HY9A 1CLOL 1N0LA 5I76B 3CAFA 3F7RA 3EFDL 4PS4L 3CXHJ 4NNPH 4GAYB 5J6GA 2FJGA 1WC7B 2I5YL 3FFCB 4Q9CA 1CL7L 5FKAA 1MCLA 2ZOKA 1UB5A 2HG5B 2C3XA 5CCKL 5M7QA 4QCIA 4LSRL 3AM8A 5ITFA 5DRXB 1VACA 1JNHB 4GW5A 3UPRB 1NGYB 3VXSD 2L0DA 2AJVL 3WSQH 4LPWA 4HAGA 5E00A 4RRPG 4U0RB 3L6FB 2YA1A 3GJEB 2EXWC 3RJDA 4ZUVA 1J1OH 3Q6FB 3ZDZF 4JM4H 3UJTH 3NTCH 2VXQH 3QIWB 1I8LC 1SEQH 1YYLL 3O41B 3G5ZB 4X4YB 3HN3A 3TP4A 5D8JH 5I2IA 2PXYC 2KZWA 1HI6A 1MHEB 5J13C 2HWZH 2DBLH 1MY5A 2H8PA 4IM8A 2XA3A 1H8SA 4JJ5B 4PGCB 2V2WB 1S9XB 2WK2A 5IESH 1YDPB 3MNVB 3V8CA 4E42B 4I18C 4KK6C 3GI8H 4UNTA 1ZHLA 5E24E 2IANE 4U6HB 4S0TD 1I7UB 3BP4B 5D7KE 1UM6H 5IJKC 3MOAL 3VD7A 5IR1A 3CLEH 3H9ZA 4D0DA 1JZ4A 4PJXA 1I3UA 4QRPA 3QPXH 1L9NA 3QIBD 2J8OA 3ARBC 4OCSL 3U1SL 1QFUL 5E56A 1U9KA 5D96B 1AXTH 4U1KA 5SWSE 5DJCB 4TNVF 1J8HB 3KPPB 2J5LC 1MCEA 5CILL 1OAZL 1OM3H 4PRNA 5KVEH 4LEOA 3I3DA 3BUYB 5L2JA 3HCVA 2XTJE 2R2CA 4Y5XB 4GW4A 3HZKA 4YAQA 5EZIL 1IQWL 2V9TA 3ZT6A 1BVZA 1AJ7L 1JWSB 5JOPE 3W0WD 4OQTH 3U7WH 4XMPH 2E5EA 4WW2F 2YSSA 3D5OF 1L0XA 4MQTB 5FCUL 1U8PA 1Z9SA 2H32A 2VZTA 1D5XA 4MA1C 4GKSB 3QWRD 5C0EA 3DX7A 1CGTA 2WW8A 3DBXA 2H1PL 5DRWA 2H3NB 5IFHL 4M1DH 5C0BE 4XPGL 2OTPA 5HI5C 1M7IB 4PD4J 3MRBA 4WI5A 3SE8L 3K3QA 3BEVB 2NY7L 3EYSH 3MRDA 1XR9B 4PRDB 5I73B 5FF6B 2EYSB 4YDIH 5FAAA 1WGOA 4NNXB 4GMTH 5J1AB 1MFCH 5CHNA 5B4MD 5C07A 4B7LA 3JWOL 4XAWH 5D5MA 1HZHL 4Y4FC 1AE6L 1L6XA 1FHGA 1FL6B 1G7MB 3C8KA 5CGYC 4J23A 4NKMB 4G9FE 2M2DA 3DYOA 4PJ8A 1AXSB 2C7UA 4BYHA 4JG1H 4Z7QE 2A1WL 1IKFH 1BFVL 5EFIA 2FB4H 1AGCA 3G6DH 5I1GL 1JYWA 5CP7B 2G9HB 3VRLE 2YD3A 3WO4B 4ZAKC 5C0AE 4YBQD 5E4EB 5IMMB 3I2CL 2DKUA 4AM0A 4ELME 2XPGA 2A6IB 2VXVH 4OGXL 3TYGL 4QRRD 4EUPG 1FL3B 1H5BA 2EC9T 3S35H 4I4WA 4OZGE 2NR6D 1KJ2H 3MO1B 5AZEL 2EE2A 3EDFA 1QA9A 4NJ9L 1FN4A 1KUMA 4HMDA 1U8HB 3TBTA 3OKKA 4DFIA 4EN3A 4HMCA 2ICWB 1RK0B 5ISZD 3QJFA 4X8JA 1F3RB 4P3DB 2DI8A 1JGLL 1ZLUH 2EKJA 2P5WD 2WINA 4HS3A 3TZVB 5E95B 3L7FA 2R2BA 2WNGA 3QNXB 3RUGE 1FDLH 4MA3B 3PV6A 1FLRL 5DDHA 1A6WH 1CICC 2V7HB 3BX7C 4EOWL 3LKPA 3MNWA 1I1CA 1JMZA 1EDQA 3VDCA 3OSKA 3VGAB 4M7ZB 1I8MB 3UC0L 2AERT 4U1SB 4YJZL 4JFYB 1D9KD 4LVOB 3S98A 2AGJH 5BRZE 4M1CD 3W9DB 2J12B 5BZWB 4J7RA 4O02L 3VH8B 3EYQC 2NTSP 4HULB 4DK3A 2D7NA 1M7DA 2O5ZH 1ZMYA 5ENWB 2VR5A 1W0VB 4NUJA 1PG7X 2DYPB 3C6SA 2GJZA 4IDJL 1FFPB 3VDAA 5ADOL 4EI5A 4MCYB 4JFXA 4R4NC 4JHWH 4C56B 5L8LB 3W11D 5LKNA 5MEQA 3GRWA 1SY6L 3ZSTA 2IAMA 5GGRA 1S7RA 4ZSOE 5IROA 3VU2A 5I1CL 3DUSB 5K59E 4L4VA 2HRPH 2OQJB 2ZG2A 1JBJA 3IFNH 2ARJB 3RWFA 1Y6MR 1YEGH 2FBJH 4QRUA 1OAKL 1VGKB 3SKNB 3O2WL 3STLB 4KKBD 3NCJL 3WXVL 2ZSVB 4ZOAA 4FQ2L 5FDWA 1BMGA 3VFWB 2VDOL 5HHNB 4U6VL 4MVBC 5HYQB 4HC1L 4IRSA 5CJ8A 1EBAA 4WEUD 5DJ8A 4LCWE 1INDH 2LAGB 3QAZC 5EIIA 2ICEB 5DT1H 2D9CA 5DMIH 4Z7QF 3DRTB 2C9AA 4GOSA 4GRLC 5CD5D 4HUVA 2GJ6A 5A2IH 5HHXL 2X9YA 4EDXA 5A1AA 2QEJA 1BPVA 3O81A 1UWGH 3QG7H 4K71C 4NO3A 2DD8H 5MERB 1QSFD 3RL1A 1XGTB 2NXYC 3VRJA 5B8CB 4P2YA 3R8QA 3QQ4A 2APWA 4OZGF 3HMWH 5ELIA 1UZ6F 2X9WA 2F5BH 2BHZA 2CLVB 2D7TL 4M3JA 3S97C 5GZND 4UNVA 5B22A 3AFLA 3ZE1F 4XPBL 1KLFA 1P84J 5BJTB 3VD3A 1S9KC 4ORGA 2VDRH 3ZYZA 3QDME 1WZKA 1TIUA 1FH5L 3DETD 4LSPL 4XPHL 4JJHA 2NY1D 1HHGB 1RJZA 2DICA 4J4PD 2W0LA 4NQCD 3TF7C 4H25A 3U4EA 1CK0H 4QTIH 4Z7WE 3SO5A 5E6IB 2R0KL 2ARJQ 4G6AD 5F93C 3PUCA 1IGML 2H2PD 3DARA 3QA3B 2NY3D 3SDCD 4ONGL 5BXFB 1S8DA 3NABL 2NY6B 4YHZH 2QKIB 4YC2C 2DQHH 3KPRB 3LOWA 1JN6B 3BPLC 3TBWB 2GHWB 4Q9QL 1R3LB 2X41A 4Y16D 1U3HB 4JFFB 3JV4B 3SCMB 3WIFB 2GUOB 4K7PH 3WE6B 2WBJD 2D9QB 5E2UL 1MFNA 5CMAA 3MRGB 3VWJD 3LVEA 4K3JH 4OD2B 1U95B 5IQ9A 4WHYH 5D2NB 3BSZH 2APVA 2CJUL 3QEGH 4YR6A 3DJ9A 1TZIB 4LRIA 1MQKL 3O2DL 5SX5H 5FM5M 2OTWB 3BD4A 1XGQA 1KIRB 5D72H 5L0QC 3AREC 1DSFL 3CH1B 5EOTA 2A6KB 3DVNA 3P11H 1FORL 5FYJE 2HJLA 3SE4A 3G04B 1A7RL 4EXKA 3MTRA 4U6YB 4HUXA 1DANU 1EFXA 1HINH 4XC1H 1MREL 1MVUB 4NQVA 1NLDH 4JQXA 4DFHA 1T2XA 2D4FA 1ADQH 1HDMB 3THMH 4Z8FL 5SWZD 3TLRA 5E8EB 5CBEA 5BV7L 3N50A 4OZHA 5LGHH 1GGCL 4O9HL 4U3XA 1VA9A 5K33A 1J5OL 1UCBL 3O45A 2IFFH 4LLYB 5E8DH 3SGJA 4F33A 1UWXK 3TA3C 4N0FA 4OFKA 1NAMB 3FCTA 5DD1H 2F58H 4KTEL 4DZ8A 2VZ1A 3DXAB 3PABB 4LHUB 1B6DA 2F8XC 1CFSA 4D9LH 2AABL 3D85A 4TSCH 4IOFD 4NFBA 1RUKH 2UVFA 5FV1L 5C7XL 5F6HJ 4HS6A 4AMKH 1OP5H 2RIKA 3M45A 2ZZUT 4P5KA 2EIBA 3C5ZB 2BOBA 1M4KA 1KPVB 4KPHH 1E4XI 5D1QD 5KSAD 4LIQL 3S37H 1LHZA 3F7VA 2VLKA 5DD0H 4HKXA 2DLFL 4AQ1B 4K9EH 4M5YL 4EEEA 4ORZC 4N0UE 3TESA 1VERA 3LD8C 4PJXE 2AI0L 4QRPE 4YHIB 3QFJB 5JMRA 1NL0H 2N7AA 3FT2B 5FO9B 4V1DB 5I66B 1JZ2A 2Z91B 1OARL 1FVEB 4OTXL 4BM7A 4RMUA 4DGYL 3RNQB 2I60L 3VMOA 2YKLH 5IQ7L 4WJ5A 4LF3A 4FQIL 2AEWA 1KCSH 3S36X 3RBGA 2X10A 1RUQL 4TTDD 4LGPB 2R4RL 4M6OL 5FGBA 5T5FL 3VH8G 1KELH 4RZCB 1P7KB 3UYRH 1MCBA 3GMPA 3AU1A 5C0FB 4QGYA 5IEKB 4Y4HB 4HQQH 3O6FD 1NBVH 4RBPK 5MI0B 3W5MA 5IHZA 5D7IA 3K1DA 3EHBC 3QISA 4HUNB 2R23A 3TO2A 1F90L 2XQBL 3QIUB 4L8SC 3ARDA 4F58L 3RWGB 3E8UH 1U8KB 3F7PC 3V5HA 2NXZD 1T21A 2F53D 4NGHL 1YEKL 3SO3C 3T4YB 2OL3H 1H3GA 3SKMB 3V52L 3D48R 1KLUA 4OGAD 3U6RB 2P8LA 3E3QC 4P23C 1QNZH 5C07E 5D5ME 3WHE1 1J1XL 2UUDH 2CKBA 4OFYD 1Q1JH 2ZNWA 1FCCA 1NEZA 1QKZL 2B4CH 2BNQA 1BIIB 1QFWH 4OLXL 2BRQA 5CGMA 3LHPH 3WIIL 4N5UA 5BO1L 3K8LA 4DW2H 4JFQB 5E1HB 5I17B 2CIIB 4LVHC 4YHLH 2F19H 1A8JH 5ADPH 4NBZB 2E9WA 3FL7A 2EIDA 4QT5A 3UZVB 1LDSA 1MFDH 3U36A 3HZVB 1ZHNB 2W9EL 4QRTB 5DFWH 2OK0H 4IDLA 4QHLA 5IB2B 3ELAT 3IRZA 4LFHG 4EXPX 3GSUA 1V7NL 3WDJA 1R3IL 4PJFF 2X70B 3CNKA 2CUMA 2YD5A 2CDGB 1AO7D 3I9GH 3B9KA 2PYFB 1P1ZA 2VLRA 2BSRA 1IAIM 4NNYB 1MIMH 2Q20A 4M8VA 1WV7T 4MAYC 4CVXA 3QDGB 2JLLA 1JWMB 1RJYA 2AQ1A 3HPLB 4Y88A 1I8KB 3KXFA 4MA7L 5EUOA 4MNHB 4WTWA 2BSSB 5FFLA 1LEKB 4LCIH 2VISA 3VFRB 3BPOC 4ACPA 3LKNB 3EJZD 4KQ4L 5LGJA 1RY7B 4UI2A 4KZEL 3AROA 4PG9B 4AEIH 3VW3L 4HKBB 3J7HA 2EDBA 4JM2D 2D0GA 3RTQB 2FIKA 4P46D 3ULVD 2QBWA 2OJZH 1TJGH 1MCJA 4ZQKA 1LK3L 4OUUB 5KVMC 1UVQA 1LGVA 1AHWC 1U8MB 2HVKB 5I19L 1KJMB 5F7NC 4M7KL 2JJUA 4PLJD 4I2XA 4Q2ZB 3TBVB 3QNYA 2I07A 1T4KA 3MCKA 4Y8DC 2I26N 1FZMA 1GC1L 4IOIA 4JPWH 5IF0A 1DVFB 3ZTJG 3OKLA 3VXQB 3UX9B 3MLRH 5FO7A 1CGVA 2W0FA 4RISL 1ORQA 3VXRB 3H0TB 3FMGH 3RY5A 4AJ0A 2MNUA 1CR9H 3GO1L 4JFDD 1UYWH 1GGBL 3RGVC 2I9TB 1EJ6A 4L4VE 5EU6A 1KXVC 4U7KA 3DO3A 4LNRA 3QI9A 4LLVA 4PY7A 4F57L 3OB0H 3OAUL 1UWEH 5JNYA 2V5YA 3MZTA 2X9XA 3GIVA 4LLMB 2XIDA 3NN8B 4CVZB 1T2QL 1RHHA 2VXSL 3JBG7 1M1SA 4PRAB 5LVEA 3VE0B 5J3HC 4ALAH 2QV2A 4J3WA 4QHKJ 1FBIH 4GBXC 5E6ZA 1S78D 4DUWA 1N5YL 2GJ6E 2DLIA 2F74A 3AS3A 4KAQL 3V79C 5ICXA 3B2VH 2P8MB 4OM1L 1KBGL 3LSOB 4YBHA 3MFFB 4FQQA 2EH7H 1ZAGA 4TULL 4XP9H 1PYWA 1NSNH 1VGEL 4XZUB 4Y4KB 2EDRA 3V4PL 5HSFA 5I9QB 5T1DL 4MGXA 5C0NC 1P84K 3OAYH 1CLZL 1A6AB 2BSTB 1ZA6A 1HSBA 4BFEA 2DQCL 4RA3A 2QHRH 4I48A 1CD1B 5EOQL 2GSGB 4HXBL 3DVGA 1TJHH 4XCCL 4LRNL 3QAZB 5IWLA 3PP3H 3RWCA 1EFQA 4XC3L 5DJAB 5ACLA 5LWYL 2YZ1A 2VR9A 1MRFL 3REVB 1I3RB 3ARFC 4LHUG 1AGEA 2RCSL 3KYOB 4AL8H 4K71B 1QFHA 4X4MA 3TPKA 4G6JL 5EBWB 2A73B 4NQDD 5H94A 1HHKB 3FB8A 1Z9LA 1I75A 1MJ8H 4ZTPH 3HR5B 1XCQB 1L0QA 5JUEH 3NAAL 5KG9A 3IXTB 5JPNB 1KCVL 1MNUH 4MJIB 4MJ5A 1DCLA 4MXVF 1CFVH 4OF3A 5FM8A 1ZTXL 4GXVL 4LLWB 4H8WL 2BP3A 1EAJA 2DMKA 3DRQB 5HYSA 5B38G 2VMFA 5TDPB 1C12B 2J4WL 4TQEL 2Z93A 5KVGL 1MF2L 3F58H 1I85C 3JWDH 4D0BB 1XF2A 1EGJL 4H26A 2Z35A 1MH5B 4CADB 1T1WB 1GGIL 3KLAA 5FKPA 5E4IA 1MCOL 3BVNB 1J0HA 4JN1H 5K9KB 1WAAA 2Y07L 5A2LH 4F9LA 3QQNA 3FFCD 5F88A 3BWUC 4GSDL 1ZVYA 3S96A 2YPKA 3FRPG 3BGFC 2Y06L 3H7BB 3QQ9C 2IMMA 4PRBA 4OB5H 3R1GL 3G08A 1MCIA 3L9RA 4DVRH 5KOVC 3WFHA 1X5GA 4I3GA 2R4SH 2QQNL 2A0LC 2V17H 1EMTH 4Z0BH 1HE7A 1B88A 4PGBA 2VDKL 3MJ7A 5E03A 4MD5B 3QIWD 5T3ZE 4CJ0A 3JTTA 3INUL 1BFOB 2VL4A 1ZWIA 1CLYL 5FDYA 2K3TA 2ICES 2FD6H 4O2EA 5D1ZA 4F3FA 4GG6A 2DLHA 3QUZC 4FFVD 3EO9L 3HMXH 1HOCA 1JYXA 4GG8B 3QXTA 1MCKA 4JRXA 2FATH 3ILPA 3G5XB 1VEOA 2X1WL 3J8F7 3H3PL 2X4QB 4M7JL 4A6YB 4XGZA 1JPTH 5JOFA 1JIBA 1KJ2A 1VENA 4X6DF 4JRYA 5CEYA 3T08A 5JW5A 5LBSH 4XPAH 1WEJH 4HHAB 3H9HA 2NY0B 3PHQA 4DQOH 4I8DA 3K1KC 3SGEI 3LN4B 1Y6NR 4JDZB 2CK0H 4LPVA 1RULL 5JDJA 1J8HD 3HC0A 1R3HB 1N4XH 2E7HA 3TN0B 5D6DA 3IKCA 1TTFA 4BSJA 4QXTB 5EC2B 3OWEA 2ZCHH 4NQXB 5I0ZA 3ECBB 3X13B 3GRWL 4ZUWA 1OCWH 2YMXL 2VKXA 4XWGL 2VLKE 4E9LA 4GS7B 2VZUA 1VCAA 1LNUB 1OTUD 1T7XA 1A47A 5D7JB 4WWKA 4H88L 1A1MA 3NACL 4TRPL 3JTSB 1ITBB 3ARSA 3QQ3B 4U0QB 4YHKH 5I1HL 2W9DL 1IL1A 3BQUC 1I4FB 2E6QA 1NCNA 2XZCL 4JHAL 2IANB 3BKCL 3RIAK 1ZLVK 1UM5H 1KB5L 3OKMB 4BSWB 3T09A 5I8OL 2E7CA 3CLFL 2FJFB 3IAGC 2A9MH 5E08H 3FO2A 3DGGA 1XGPB 2B8OT 3PGFL 1I1AC 1CE6A 4OT1L 3UP1A 3IF1B 3VG9B 3I6LD 4Q0XL 5SWSB 4GJTB 5I71C 2PR4H 2X7LA 5BMFL 4W4OA 4KROB 2YN3A 5GJSH 2ADGB 4RGOH 2XTJB 2DQJL 5JDSB 4HV8A 3GSQB 3KYAA 1HILB 4GLRI 4OKDA 4RFOL 3QUMH 3CFDA 4R4FH 1KYOK 3UDWA 5DJ6B 2EDKA 4N1EA 5HXMA 5DA4A 1IFHL 2DIAA 4K7FA 3RA7L 3C8HA 1RZIA 1UACH 3HI5H 4TVPD 4KZDL 1A7QH 1TVBB 4KWUA 3W39B 5I1EL 4ERSH 4OLWL 3VI3E 1BWWA 3EIFA 1DBBL 4OCYH 4KK5C 1MUJA 2BNQE 3GMQB 3QCTH 4ISVB 3MLSL 1G6RH 3F12A 3Q3GB 1QSEA 4I5BB 4HFUH 4X4XA 3T77A 1G7IA 5IM7A 1TDQA 3UO1L 3EYUL 5HHPB 2VXTL 4AT6A 4KHXL 4G5ZL 2MOVA 5C0DA 5J9PA 4QRSB 4GKZB 4ELKA 2ZP0T 3QHFH 1BBDH 4N9OB 3MA9L 3TZVD 4EN3C 4J1UB 2VITB 4DKEL 1CU4H 1DQMH 4RWYH 1A7OH 1M6OB 4HKJA 3MLUL 4OZIA 4ODXB 2KUTA 4FS0A 4MDJA 4FTVB 1P53A 1CS6A 5HYJB 1A1OB 3MV8A 2OZ4L 3PWUB 2VLRE 4WU7B 4OCMC 4ZFGH 2OR7A 5C0AB 2HLAB 5K9JL 1A5FH 4X6BB 2I9LB 1QZ1A 3IU4H 1Q9WA 1RVFH 3AMLA 4M1GL 1HYSC 4ELMB 1S7TB 3SGDI 3KXFE 2HT2D 5F97E 2BNRB 5EUOE 12E8H 3M07A 3NZHH 4XBPB 5GGUB 3T0DA 2Y6SC 3EOAB 2AJYH 3OKOA 4JO3H 1GZQB 5HHQB 3VRIB 3V0AC 4JZNB 4C56D 1K4DB 4P0DA 5DQDH 1JZ6A 1FO0B 3I6GB 5C09E 2CQVA 3QEHA 2EECA 4WY7H 4MD4B 4XMKL 5HD8C 4U1HB 3B9EA 2E7BA 1XF4A 5I1JH 4KV5E 4XI5C 3RUGB 1OSPH 2FX7L 1NDMA 3FRUA 4EI5C 1P6FA 1S7VA 3FHAA 4I2XE 3ULUD 4M4RA 4MMXC 4X5WB 2X09A 5JPMA 3OZ9H 1H3WM 5DJDB 1IEAB 1N0XH 3LS5L 3PNWA 3ROOA 2EDOA 1GSMA 4LSSL 1DQJB 3BD5A 4HIEB 5BRZB 3I02B 2YWZA 5TE4H 2F5AL 1NFIA 4QTHB 3BPOB 3PGDB 3PP4L 3IAQA 3QT2A 2MPAH 3BAEL 2BX5A 3QNZA 1NCTA 4R9HA 3BP6B 2CRYA 1ED3B 5EU6E 1D6VH 5BCAA 1R3JA 4IRSC 3DIFA 3SKJL 2Z92A 4I3RL 2E8ZA 2X4SA 1FZKA 3CDYA 3B3IA 4LU5H 4PTUB 3RWJB 2BVUA 1N26A 1LILA 1R24B 4K8RC 5IT2H 4M7LL 3TVMA 3CDGA 3RFZC 4L8DB 4TVSa 5MP6H 3D39E 5GRXG 4ZSOB 1P5VA 3T8XA 2DRUA 5LG1A 3WUZA 2OXHA 1C5DB 2NNAA 3V0WL 2VZOA 4HJGA 1MJ7L 1EHLL 3BN9D 1GAFL 3MYJB 1XMWA 2H6PB 4M6AA 5ERWA 3MCG1 4JANB 1OAQL 4BQBA 3PWLA 1A4JB 1KJ3L 1YEDB 2A77H 2R9HD 5F7EL 3S3SA 5INDB 5KTEH 2YK1L 4RA0C 4F7CA 3D0LB 3QXUA 3CSGA 4LCWB 1YECH 1FNEB 3KPTA 2DN7A 3MACL 5IW3A 4P4KC 2DWEB 1MCSA 1R5WB 4WHTA 3UJIH 1L7TH 1U0QA 5C9KA 1NLBH 3MJ9H 5E6ID 4HGWB 3WHE0 2GIYA 3FQWB 2OMNA 4S1RH 1MCDA 2YA0A 4NJAL 5GS2H 3HAEA 5E2VH 1RZKL 1HHJB 3K2UL 5DFTA 5HDQH 1TZGH 2PETA 3MNZA 2NY6D 4IRJC 4P2RA 3KPRD 3HPJA 3HG1E 5D70H 1NGQH 4YDJA 3PWJA 4X4ME 4XNUH 3MRHA 1QBAA 3OKDB 1GL4B 3GNML 1U3HD 2AS5M 4C55A 5CSGA 5BW7A 2FGWH 4JFFD 3SCMD 1JWUB 5GHWL 1RMFH 4L8CA 4BZ2H 1U3ZA 1MRCH 4RGMC 4Z7VF 3KLSA 2RHEA 2ADJB 5DVMA 3RGHA 4HXAL 5D9SA 3DV6B 5E8OA 2D31B 3U0TB 1T1YA 3E1F1 1NMAH 1R6VA 3SDXA 2NPLX 2UWEA 1X7QA 4ZS7L 2CKBL 3UAJD 3RWDB 1VPOH 4MWFB 1H3UA 4BZYA 1FJ1A 2RBLA 4LRIC 3M8OL 5J6HB 5DRZB 4U7SA 1UCTA 1LE9A 4G7VL 1DBKH 3REWA 3VXUB 4JGUA 4G8FB 1ZLSH 2IWGA 2N7BA 4CW1B 3V0VB 1BQLH 5DMJB 1WAAE 1JGEA 3GSNB 2XRAL 5DEGA 4CVWA 5FUZL 2CDEB 3FFDB 1ZT1B 1IM3A 1SJVA 4O58L 4H0IA 3MGAA 5HI4C 5FECA 1K4CA 4JAMB 2B2XL 3DLQR 3TIDB 2OL3A 3O6LL 4JQXC 3GMOA 4D3CH 3E6HB 5GGQL 1WFNA 4FFZL 3VFVA 4UTAH 3IVKB 5JXED 4P3CL 2YUWA 4L3CA 1HWHB 4CUCA 5LAXA 2IADB 2VAAA 2O5YL 5C8JA 4DOHB 1T6WA 4Z0XB 1GIGH 3GBMH 1PZUB 1AC0A 3DXAD 4LHUD 2P45B 2Y4SA 1XZ0A 2F8VA 1JNNL 1MI5E 3E6FB 1OP3H 5AZ2H 4XB8A 2FO1A 2VQ1B 4APQA 4WEBL 4OFIA 4GG6E 3MUGB 2EZ0C 3NIGF 2RQ8A 5HY9B 1KEGL 2Z4QA 5F9WC 3IFOA 3C5ZD 1OAXL 2BVOA 2IF7A 3PXJA 4YFEA 5J6GB 2FJGB 4JRXE 1A6PA 1TETH 3IDMA 5FKAB 5IVXA 3BYYA 2ZOKB 1UB5B 3NMEA 3BGMB 5IHBA 3O8XC 4MHHI 4JRYE 4QCIB 3PDOA 5ITFB 1VACB 4XP5H 4GW5B 5D71L 4FRWA 3QFJD 3MBED 1KEML 3EO0A 1AQKL 4V1DD 1TENA 4Q74A 3O11A 5E00B 3DHJA 2GJJA 3VFMA 2VDPH 1UXSA 4ZUVB 2JELH 2NCMA 5FA4A 1EO8H 2HH0H 3LQAL 3KDMA 6CGTA 4JVWA 4O4YH 4YGAB 1HI6B 4D2NA 2EDYA 1MHPH 4KUCF 2BXYA 2HT3D 4RMQA 2IALA 5CINH 3OQ3B 2H8PB 1RIVH 4Y4HD 1X9QA 2YA2A 2R0ZL 3T0AA 1D5IL 1A6ZA 2Z9TA 4LLQA 1G84A 4XVTL 4U1GC 5IMKA 3OJDA 1INQA 4ONOA 1FNSL 3T0EA 1IC5H 1ZHLB 4WI8A 4OM0H 4EQ3A 5F70A 3QIUD 4XNMA 1TNNA 1F4YL 4JZJA 4OD1L 4ZUTA 5IR1B 4D0DB 2VIRA 2Q87A 1HQRA 4PJXB 4QRPB 4HBQA 3ARGA 4NNPL 5D7SH 1T7VA 3BP7A 2CMRH 4U1KB 4OSUH 2EEBA 1I7ZA 4WGVB 2J88H 2CXKA 3EFFA 1T83A 3DHMA 4PRNB 5CEZH 3C87A 4LEOB 2EDDA 3U7YL 5L2JB 1KC5L 3HCVB 1IE5A 1WWBX 5HI3C 3D3VE 1YC7A 3NVQA 1L9MA 2DQTH 4GW4B 3HZKB 2MCG1 4YAQB 3KYMA 3ARZA 1EJOH 1ONQA 3GM0A 3BRDA 3JWOC 4NSKA 2EDFA 2YSSB 4RWHA 1P7QA 1U8PB 4KTYA 1J1OL 2H32B 1G9ML 1D5XB 4JM4L 3T3MF 4MSWA 3DYPA 3TNNA 5C0EB 3DX7B 3WFDL 3WKNA 3DBXB 2CPCA 4P49A 4WHDA 5DRWB 1E6JL 1DQDH 1IAMA 3O3EA 3GDBA 1QSEE 3ZKSD 4DWHA 3MOBL 3MRBB 2AXJA 1KSRA 3ARXA 3ZKXC 5C3TA 3MRDB 4Y8AA 1OWRM 1J7VR 3DMMC 1DQTA 1KIQA 1B0GB 1HSAA 4YNYA 5CHNB 3BH8A 1N59A 1QG3A 3NFNA 1Q9LA 3QDGD 5D5MB 4R0LC 3ZKMC 1U3YA 4CAGA 2YBRA 1P4LA 3NH7H 3CLEL 2HTLC 4PJ8B 2GQHA 2C7UB 5I8KH 2M1KA 3QWQB 4OZIE 1PSKH 4RMTA 5JQ6L 5EFIB 1AGCB 1V3LA 4IMLA 1ZV5A 5M95B 1YUHA 2VLMD 2N56A 3EJYC 3MV8E 3O6KH 2P7TA 3SDAB 4S1DC 1F58H 3BW9A 3HHRB 5HTSA 5KVEL 4LPXA 1F45A 4M6NH 2ZKHH 3RTQD 1ZANH 2YD4A 1HXMA 4KDTC 1LP9A 4YPJA 4AM0B 2ZCKL 3VFUA 2XPGB 3QFDA 4Z78A 3NIFE 5C6WH 3OKYA 3L3OA 1H5BB 4I4WB 3WLWC 1QA9B 3KJ4B 4OQTL 1Y0LA 1FN4B 4HBCH 1DVFD 3TBTB 1MELA 1LQSR 1IM9A 3OKKB 4HUKB 4MQ7B 3SDDA 2V5TA 3WD5H 1FG2A 5EO0A 3LN5A 3T0XA 3RAJL 3P9MA 1UB6B 3CVHL 1NUFA 3QJFB 4X8JB 3VXRD 4M62L 4KQ3H 1YQVH 4HSQA 1RJCA 2WINB 4HS3B 5F6HI 3L7FB 1YEHH 1U41A 2R2BB 3CPLA 4YDVA 1BAFL 4Y5YC 3W5NA 3BJ91 1Z5LA 1CVSC 2HT4C 3TFKC 2ERJC 1T7WA 5DDHB 4HJ0C 1K3IA 1CL7I 2NQCA 3MNWB 3HE7C 3NCMA 1XIWA 5IVOA 2MCPH 3ARRA 1NFKA 4Q6IA 4G6MH 4NZUH 2D2OA 4FQCL 5J06A 2PO6A 4P59H 1IKFL 4CVUA 4MYWB 1IJ9A 5JOEA 1QSVA 4KK9C 1I3GH 2QR0A 4M9PA 35C8L 5FA3A 4JQVA 2XWJA 3MYZA 3C6SB 2GJZB 3OGOE 1GCFA 4EI5B 4JFXB 5MEQB 1SJHA 1EUUA 3NZ8A 4LSUH 2IAMB 3S35L 5GGRB 1S7RB 4Y4KD 3FB7A 1JRHI 4L4VB 4S1QL 4UUJA 4BELD 2QHLA 5CIPA 1KCKA 3MCLL 3RWFB 1GOFA 3O9WC 5DSCA 2R69L 1V8HA 5TFSH 5D1XA 1OAUH 4QRUB 1GGUA 3G5VB 4XTRD 1CDYA 1OPGH 2EH8L 1QLEH 4I0PC 5FDWB 4ZO7A 2EYRA 1Z3GH 1FDLL 3UPCA 5DJ8B 1MEXL 1FE8H 1L7IH 1CDBA 4FQXA 3Q0HA 3MUJA 5E8NA 5EIIB 1EEYA 1G0YR 2XFXA 5I1KH 4XHJC 4PJCA 4L9LA 4OI9A 4HUVB 4HIJB 4MDIA 2F54A 5KW9L 4EDXB 2J8UA 5E5RB 3QEQE 3LEVH 4R90H 4NO3B 3RIFK 3RL1B 1E4KA 3NBNA 5DFVD 1FPTH 5LXGL 5EPMA 4MJID 3GGWA 3VRJB 4P2RE 4OCRL 4OCXH 5FYLD 2RFXA 1T0PB 2EC9U 4MLIA 1S5HA 1NAKH 2Y5EA 3MXVL 4P4RB 4JPVL 3IS0X 2JCCF 1IZJA 1C5BL 4KJWC 4IHOA 1WT5A 2LQRA 4KRPC 2IJ0C 5DHVH 5GGSA 4OD3H 3T0BA 3GSWA 4ORGB 3V6BR 3UTOA 2W60A 4DN3L 4NM4H 4BA8A 4RSVA 3QRFM 3SY0A 1BP3B 3ZZ1A 8CGTA 3V4VH 1NEUA 3KPLA 2QQLH 4XAKE 1AI1H 3SDXE 2UWEE 2XQYK 3WO3B 4H25B 2PF6A 3BKYH 3U4EB 4NPYA 2X4OA 3OHXA 1A7NL 3QO0A 5FGRA 3MLWH 4LLDA 3RVVC 3QUXC 4HGMA 4PJAF 1T22A 4C59B 1BJMA 4POYA 3WS6C 4AG4H 5AYUH 1C8PA 1QVOA 1S8DB 4OGYH 1RUAL 1XT5A 2E7LA 5GISH 4Z5RA 1T03H 1HKFA 1UA6H 4R8WH 4A6YH 3I75A 3BKMH 2VN7A 1HH6A 3FTGB 1MJJA 4XXDA 2H41A 3CMGA 3QG7L 4V2CB 4IMKC 5HYIA 5GRJH 4OZ4A 2PKDA 4HH9A 1N6VA 5LQBH 1M05A 1MWAL 1KPUA 3QUMA 4ETYA 3N9GH 1JHLH 4O5LL 5CMAB 4J2XA 3VGDA 1V05A 3HMWL 4GFTB 2F5BL 5IQ9B 1K8DA 3BKJL 2ZCLL 3GMMB 1BF8A 2AJZA 1MPAL 2BVTA 5H37G 4YR6B 3TC9A 4GMSH 2VJXA 1ZE3C 1T89C 5D4QA 5MEOA 1XGQB 1G6RA 3JXAA 3Q2CA 4LPCA 1NGPL 1MCFA 1KPRA 2YXMA 5C6TH 5EOTB 5BV7C 2NY0D 3TPUA 3DVNB 2HJLB 1G7HA 4NN6B 2ICWJ 4KI5E 1OT1A 1IQDB 5GZOC 4P5TA 3TN0D 1U6AH 4QTIL 4MD0A 2R29H 4HUXB 1I1RA 1EFXB 3FQNA 3LS4H 5DJZA 5E5MA 5IVXE 4NQVB 4JO1H 1MCCA 3V95A 3D9AL 4PRHA 2EXYD 4ZG1A 1YNKL 1KB9K 3OB8A 4DKDC 4RX4A 5D7JD 5CBEB 2DQHL 4Z7NE 4OZHB 3RL2A 5BZDA 3T3PF 4XP1H 1FRGL 1OB1A 3C9NA 4R7DA 4N0FB 4GUPA 1TFHA 4TSAL 3FCTB 4OQ1A 2WAHA 1CD9B 1P4IH 2IAND 3C6LD 5F9JA 5TDOA 4DZ8B 1UT9A 4I3SH 4XPTH 4TPRH 3BDBA 1S7XA 4FG6D 2ZNXA 5HHOA 1EAPA 2MQ3A 4FXKA 2C1OA 4HS6B 3X14A 3QEGL 1K8IA 2ITCA 4ZXBC 2R2HA 1QLFA 4JY5L 4KROD 3QXAA 4P5KB 2BOBB 2R8SL 4HD9A 3UBXA 5D72L 2XTJD 4YH6A 2YRPA 3LDBB 3T0EE 4CKVX 3BO8B 2Q7YB 3F7VB 2VLKB 4W4OC 4HKXB 1P4BH 1P9MA 1TZHA 1B9ZA 4LDOB 4NO5A 5JOPD 2EC8A 1VHPA 4K55A 4JKPL 4UT7L 3WNOA 3PWVA 4PJIF 6FABL 1YYMH 1B4RA 4MA8H 1IT9H 4KUCD 3VWKA 3ESUF 1RFDL 4LMQE 2CLRA 1TTGA 1DBJH 4QXGL 1ADQL 3THML 2O5XL 4TN9A 4FQPA 4LF3B 4WJ5B 2ZPKL 3OMZA 3HNVH 2HN7A 4WEMB 1S3KH 1DN2A 4LHQB 3BRFA 1OD7A 2I27N 5E8DL 2IFFL 4JFEA 2M8XA 3GMPB 3QUYC 2EDWA 5JW4M 3HI6H 1NBZA 4PJ9C 5DD1L 5EO1A 2WBKA 3IDXL 5EC1A 1I9JH 2WIIA 5IHZB 4JHBA 5D7IB 2EE6A 1OTTC 4TSCL 2R23B 1JF1A 3TO2B 3ARDB 3WFZA 3K81A 5F6IC 4MCZB 1HN1A 1PY4A 4FTVD 3V5HB 2HKFH 4KFZC 3WNLA 5HYJD 1T21B 3PL6A 5EOCL 2AXGA 1KLUB 5J1SC 2P8LB 1QRKA 3HB3D 4KPHL 4J3XA 1HKLH 2OJEA 2CKBB 3CX2A 2BERA 1NEZB 2BNQB 3EJJX 5DVNA 2BNRD 2AJSH 4LPYA 3ME0A 1FAIH 2B0SL 3FT4A 1KN2L 3LKOA 3RVXD 2IH3A 4JGJA 1WITA 4DN4H 5J1TC 1CXLA 4AENA 4Z7NF 4CN1A 3A6OA 3UTTA 3MJ9A 4IRZH 2BC4A 1RZ7H 4YUEH 2ED8A 1T66D 3UJJL 2YKLL 4LBEB 1W72L 4QT5B 3U36B 1IC4H 1JGUH 4M5ZL 1LP9E 4OCLC 5E9DE 1KCSL 3ZKXB 5IBLD 4OCWH 4QHLB 1C1EH 4N68A 5JORA 1NFDE 3DURA 3GSUB 2C5DC 1KELL 3N1QC 2X1OA 2EO1A 1FYHB 4K94L 4PJ5E 3WL9A 3L3JA 3B9KB 4WI9A 3H6JA 1P1ZB 4HQQL 3WUWA 2UVEA 1YPZF 2BSRB 3SGEH 3NPSB 2CGRH 5BRZD 3PP3K 2HFTA 2NY2C 2ADFH 4CVXB 1JMXA 1NCAH 5I18H 1EH9A 1RJYB 4GRMA 2A6DA 4P9HL 3ARVA 3KXFB 1H3XA 1PKQA 3N06B 5EUOB 3ARUA 3TNMA 4Q9RH 2IEPA 2VISB 2VUOA 1A9EA 4M6ML 5LGJB 1IGCH 3ULSA 1FSKC 1N64L 1Q0XH 1Q1JL 5IFAH 1CFNA 1WIOA 4NOFA 2FIKB 4YO0A 3S4SA 1PQZA 4P2OC 4ZQKB 3UPAA 1UVQB 1OOAA 2YPLE 3OGCA 4JLRA 1WICA 4LSQH 5E94A 4B5EA 3W9EA 4I2XB 4HKZA 3QNYB 2I07B 1ZSDA 1K6QH 4YHLL 1T4KB 1UFUA 3MCKB 1FZMB 3PJSA 1QD0A 1EEQA 5IF0B 5ISZA 3OKLB 1J1PL 1MFDL 2BMKA 3E2HB 3SE9L 2OK0L 2ATPA 5FO7B 2W0FB 1C16A 3K0WA 3BEWA 1QQDA 1N7ML 1FNGB 4NWTH 4LCWD 4NUGL 2YPVH 1A14H 3ULVL 3MRNA 4LQFL 5DQJA 5EU6B 4LNRB 4BFIA 3QI9B 4XNYL 3WFCL 2ARWA 4GLRH 4IJ3B 4PY7B 5KVFL 1CF8L 1MIML 3QDHA 3QDAA 5JNYB 3P0VL 3C09B 5I8CA 1A6VH 4PJGF 1I8LA 1R5IA 3KPOA 4KVNL 3EUUA 1RHHB 5IJVA 1GHFL 5B39A 2FL5A 1CBVH 2R1WA 5GS0C 1IGYA 2ZJSH 4LCIL 5IK3A 4XRCA 4WTXA 2PCPA 4K3EL 1JNLL 4E0RA 5GJTH 4M8QA 1QHPA 1A02N 2OS7A 2F74B 1H8NA 4I18A 4PJ9D 1OLZA 2J8UE 4XCFL 5ICXB 4GQ9H 3KPQA 4QNPF 3T65A 2GY5A 5IJKA 2E9IA 3VGHA 1PYWB 3ARBA 4X6FA 1FFOA 2DIJA 2HVJA 1NFDF 1I1YA 3IT8D 2G60L 1ND0A 1SBSL 4YXHL 4NRZA 2VWEE 1ZA6B 1HSBB 4I48B 1S7SA 3SQOL 3TV3L 3DVGB 4XWOD 2DMCA 5C86A 4N0YL 3DECA 4JE4B 1Z2KA 1NDGA 4JG0H 4WFGE 3RWCB 3P30H 1F8TL 3VXUD 3SGDH 1AGEB 3AB0C 5IIEA 3HUJF 1CDIA 3QCVH 3P4NB 2X2YA 4H8WC 5KANI 4WW1A 5H94B 1BBJA 3VCLA 1NGWA 4PFEA 2XNAA 3FB8B 4Y2DC 5CWSA 4YK4B 5FYJH 1C5CL 5EU3A 4I77L 2J7LA 3X3GL 5J7CC 5E2TL 1JZ8A 4HIHA 4OFDA 2G5BA 4HK3N 3PG2A 4MXQD 3BZ4A 1YMHA 2VXUL 4IOSD 4PLKC 1X4XA 4MJ5B 5T3XH 3DSNA 3RWIB 3ARQA 1N6QH 1XGYH 4Y4FA 1INEL 3SHSA 2GYSA 5HYSB 4TUKH 5KS9E 3M1BB 2Z93B 2E27H 4OZHF 1X6NA 3PWPA 1NSNL 1XF2B 4HIXL 1WWCA 5T33L 3WNKA 4H26B