2CRMA

Solution structure of the forth fniii domain of human
Total Genus 8
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
8
sequence length
120
structure length
120
Chain Sequence
GSSGSSGVVEFTTCPDKPGIPVKPSVKGKIHSHSFKITWDPPKDNGGATINKYVVEMAEGSNGNKWEMIYSGATREHLCDRLNPGCFYRLRVYCISDGGQSAVSESLLVQTPAVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fibronectin type-III domain containing protein 3a
publication title Solution structure of the forth FNIII domain of human
rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 8
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00041 fn3 Fibronectin type III domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 2crmA01
1E6OL 2IALB 3TBVA 1ZGLP 4YXHL 4X7DC 4WTXA 1BD2B 1IT9H 4Z7UB 4LBEA 2D7OA 2OJEA 3TJHD 4LHUG 1I9RL 1NFDF 4RX4A 2JCCA 1UA6L 3FT4A 4NM8H 3DV4B 1WC7B 3K1DA 3PGDA 5D2LE 1A1MA 1G9ML 3N1GC 3I3DA 2IMMA 1HHKA 4I2XE 2VXQL 5FYKD 4JR9L 4JQXA 2X1XR 3NIDF 2DM7A 1EVTC 2CPCA 2VH5H 1NEZA 1L7IH 4HWZA 3ALXA 3MV11 3DSFH 4M48L 5HD8D 4PRPE 4M6OL 3VFTA 4TVPH 4HT1H 1G7QA 1S7SB 1N5YL 4L8DB 2E7CA 4P3CH 5DWUH 1OAUH 1SVZA 2X4TA 3OJDB 2PXYD 5FGSA 2AJUH 4X6BA 5F7WC 2L7UA 3MGTB 3LEVL 1YUHB 1S9WA 2E8YA 1ACZA 5KVEL 4CJ1A 2J8OA 1MH5B 5D7JB 3I85A 1F45A 4Y4HA 5JQHC 2CLZB 2WINB 1RUAL 2AS5M 3C5SA 3CXHJ 3R8BB 3SY0A 1NEZG 4IRZH 2A9NH 5KVDH 5F44A 5K9OA 2VLJD 4QRSA 3EFFA 5K59E 2ZG2A 2ZPKL 1LP9E 3QUYA 3ARBC 1FNHA 3CU7A 4IOIB 1JZ4A 2EH8H 3RY4A 3RKDD 1E4XL 4YHPB 4R0LA 4RIRA 3JXAA 2VZ3A 4Z7UF 2NXYC 3QQ3A 1CGSL 4IMKC 1L6ZA 1Z0MA 3RU8H 3MFFA 5I71B 1UZ6E 3LMJL 3VW3H 4J2XA 1NMAL 3MLRL 5D7SH 2X4OA 4ZTPL 3TM6A 3RY6A 3MJ7B 3QFDA 5IBTH 1CDJA 4L3ED 1HYSD 2NW3A 3UTZB 3MCLH 3JTTA 3GHEH 3MRCB 1RI8A 3KNBB 2IAND 2J8UA 1G7JB 2XWTB 3IAPA 4TYUA 1KIRA 1F3JB 4J3OC 3MCKA 4LEXH 12E8L 1INDL 1OTUD 4OCXH 4XTRD 3ULVC 4IIQA 3HI5L 2BRRL 4HWBH 4AH2A 1UM4L 3BKCL 3SDAC 4HJJH 3B9KD 4FZEL 4PRDA 1R5IB 1NDGA 3VXMD 4NC1E 4LSQL 4ENEC 2O5XH 1GYAA 5L8KB 1NCDL 4DEPB 4AG4L 4XWOC 1ZA3B 2WLYA 3QFJD 4NHCH 1CD8A 4MAYB 1AR2A 2R2BA 3EO0A 4OCYL 3SOBL 3ARDD 1XGRB 2DQEL 1I7TA 4X4YB 2CRZA 1A7PL 3GSNL 4OF7A 1NFKA 5DSCA 3RVXC 1SBBA 5DJXA 1R0AL 4HKJA 2VXUL 3MR9B 4XMKL 4CNIB 2GHWB 4JQVA 2QADD 3HRZA 1EAJA 4H0IA 3QIUC 3MLTB 1E4WH 1KCRL 3GSWB 1I7ZB 2PTTA 2EDXA 4HK3J 3EHBC 4U6YA 3TBTA 4LOUD 1H8OA 5EOQL 5M94B 2FL5A 2NY4C 5T1DH 3L5XH 1TZHB 2ORBH 1HQ4B 5ISZB 2X4NA 4TNVK 2UZYB 4Y5XA 4PGEA 3ARGA 1OCWH 3BKYL 4WU7B 4HIEB 2IGFH 1CICA 4Z0BL 3LKSB 5DF0A 1K8DA 3FB6A 3TO4C 1CS6A 1HH6A 3ELAT 2HFFA 3BFOA 4XB8A 4JY4A 2YK1H 3QT2A 4RQQA 5I1EL 4YXLH 4HPYL 1S7UB 3ZTNL 4GG6A 2VAJA 5T3ZL 2ZJSH 5H94B 5DC4B 5FK9A 1EXUB 1FYTB 4OGAD 2X42A 4KAQL 5D70H 4C54A 5HYEA 1YMHB 3HE7D 4YDLC 3QG7L 5I1KL 5LGHL 3WIFB 3SKMA 3DECA 5FM5O 3BN9D 1BREA 4YHIB 5GJSH 1J5OH 3K8LA 2M26A 4PLKC 3T0VA 5A1AA 1VERA 1HZHL 5IW1A 2FJGA 1FCCA 2EEDA 1RIUL 1SEQH 2C1PB 4NYLB 4WI4A 5F7HA 4H5SB 5MEQA 1MLCB 4G6MH 3V6OE 2X4SA 3MV8E 4HBQA 5HGAB 5GGVH 4CDHA 2YEZB 2J1KA 4P3WA 3O6FB 4HS6A 4D0BB 3RNQB 2FSEA 4JJHA 3K8MA 3FB8B 3HC0B 4PGDB 5A2IH 5DD5L 4BFIB 2NY0B 1F4YH 2VZ1A 2V5TA 4Q58C 3GSQB 3MROA 3UTOA 5C0RH 3MLPA 2UZIL 4E42B 5C86A 3B5GA 1PYWB 43CAA 1UH2A 3FCTA 2DWDB 2BSSB 1WK0A 2HG5A 3GNMH 3HAEH 4QF1A 2MQ0A 3DVNA 3IXAB 5C0CB 1RK0A 4KTYA 3NIGE 3MNZB 4ETQB 3SO5A 4EDWL 2JIXD 4EN3D 1GGIH 2APWA 5EO0B 4DTGH 2VSCA 2WWKT 4LLAA 4ZDHA 4O00A 4Z18A 3WS3B 1NEUA 2WM0A 4KKBC 2KKQA 3MLWL 3DO3A 2VLRD 5HYJD 1LE9A 4LCWE 5L2KE 1AGBA 1JF5A 1WLHA 1ZGLB 5F3BB 4Y1AD 5IB4B 1G6RL 3NFPA 4NZTL 5EOCH 5DQJA 1QSZA 4G7VH 2WANA 3IJHB 1U3HC 2I25N 4HAFA 3IGAA 5I2IA 3OKOB 3WL9A 3HUJA 5D2NB 3FOMA 3S37H 1JGUL 4FQ1L 1DP0A 4CKVX 2VABB 4UV4H 4HFUL 5FYJU 1DBJL 3VXOA 5F88B 1X7QB 4LP5A 4MZ3A 3SPVA 4PJXE 3O41A 2XG5A 1ZEAH 5DJZB 3QUMA 4MXVE 3CUPA 3UTTB 5C08D 5CJQH 5HVHB 1J7VR 1S7QB 4OZGB 4OZIE 3KPTA 1WCBA 1CGYA 5AUMB 4JZNB 4PJAB 1EHLH 3SGKA 3O6MH 15C8L 2NQCA 1FH5H 4KU1A 3ZE2E 1V7NL 4LCUB 2OTPA 3ORJA 3DI2B 1BFSA 3VGHA 2GQHA 2HJFA 5L88H 1VHPA 4ALAL 1PLGH 4BM7A 3DUUB 5I16A 1UH4A 1KEML 1WF5A 3LQMA 5KVFH 5D71H 1EPFA 3IDGB 1U8KA 3PWLB 3CFEB 4Z7VB 1KIQB 3RTQD 2B2XH 4ZO8A 2EYTB 1J05B 3NCYS 2CK2A 3NCJL 1NCAL 2FD6H 4G8FB 3UTSA 4F15C 1A5FL 4FG6C 4NNYA 2WW8A 1J11A 5IGXL 4CVZB 4XC3L 1FFOB 3AXLB 4UQ3A 4EIZC 2NZ9C 4YPGA 3QDGA 1XF3B 3T4AA 4Y16A 1OAXH 1CFVL 1NCBH 5C0DB 5F1NA 2CKBB 2RIKA 4NP4H 4N0FA 5E03A 3RP1A 3VDAA 1CI5A 1MJJA 4GRWE 2NTFA 3MYZA 1S7WA 2Z31B 2EO1A 1X9QA 1P5VA 4I2XA 5JW4R 2ZZUT 5FYJH 3BN3B 4N68A 1MVFA 1R3LA 1OSPH 4WW1A 1FO0A 4YBQC 5JW4M 1JNHA 4U1GC 3T3ME 4RGMB 4PRPA 5DJDB 2YKLL 5IM7A 2DQDH 4MAUL 1NUGA 4NKOB 5B3NA 4PJAF 1T83C 3U46B 3MUGA 3VI4E 2M2DA 1RV6X 2L7JA 5DI8B 5HPMB 3V52H 1NC4B 5A16B 1L9MA 3FQNA 4PB0L 5CBEA 5I8OH 3CU1A 1F2QA 2ADFL 4J4PA 5I1DB 1LMKA 3QI9C 4MA3A 5EZOL 5DJCA 2VDPL 2DKSA 2MJWA 1OAYH 4MSWA 1WT5A 1LP9A 2EH7L 3REVB 1CK0H 4MXWL 1K2DB 3O8XD 1P1ZA 2W07A 5EUOF 2EEAA 4P5MB 1LEIA 2R0LH 1NLBH 4KVCL 5T1LB 3FMGH 4YHYC 5TDNB 2OQJA 1A6WH 4BZ1H 4JKKA 4KHTH 3MBEC 2AVGA 3RBGA 4PPTA 1HH9A 4X7TA 1MI5B 3BE1L 3V79C 4QHKI 4Z77B 1TIUA 5CWSB 1CGTA 3SKJH 1FZJB 5FYKE 5F7EL 4OUUA 4YGVB 2P1YA 5IHLB 5FKAA 3LCYA 4FQXC 4NQDD 3VWJC 4P0DA 4GRLB 2ZUQC 4LLMA 4X4XA 3QEUB 5IQ7H 1NL0H 5EBGA 1EA9C 3T77A 4XPGH 1BQUA 5C0BD 5E9DD 3D25A 4JO4H 4YGAB 4HUVA 1P4BH 1T66C 1A3LH 4JFPA 4LLQA 3CH1A 1G1YA 3BMWA 3L3KA 3QPXH 4XH2B 4APQA 1DVFD 3N0PB 1NANI 4DW2L 1LE5A 5TFSH 1N64H 3E8UL 1MAMH 1A6AA 4NJAH 2BNQB 2VXVL 1ZT7B 2BOCB 1C5CL 3G6JE 4WWKA 5SWQB 4JHAL 4XX1E 5GRWA 4EKXA 4EVNA 3PP4L 1DL7H 4JFED 2VLJE 1N7MH 3GO1L 3H7BB 1LEKB 1D5ZB 1MLBA 4K7PL 2JJSC 3ARFA 2WIIA 2DRUA 4PV9B 3RFZC 1AQKL 2XWJB 5DT1H 2LQRA 1I1AA 3VXUB 1YEEH 1L4IA 1CE1L 1LGVA 3SDXF 5EU5B 3L95A 5I1GL 2WNGA 5GGRY 3QH3B 4X7FC 4OGYL 4L3EE 1ONQB 4ZD3L 5JZ7D 2YRLA 4AM0A 5TQ0L 1URLA 5FO7B 3QIBD 1H3WM 2XI9A 2IANE 4X9FA 3VH8A 1GXEA 4NBXB 2YRZA 5DURB 1KNOA 3NCMA 3QNYB 3C2SA 3NIFF 2QSCL 5JUEL 4OIBA 3ZTJG 1T1ZA 3IDYC 5E94B 4AEEA 4PJ9C 3DX9B 5CP3A 2AK1L 1RZKL 2IC2A 4PP2B 5GGUB 3AMLA 3VXME 5DYOB 1ZTXL 5L8JB 2PF6A 5ALBL 4YNYA 5KG9B 1QTYT 4PRHD 3K0WA 3KHQA 3QFJE 4GW1B 4PJGB 5GXBB 2ZCLH 3D3VB 3MRHA 2HTLD 1J12A 3D87B 3ZDYE 4X8XA 2CLVB 1BQHA 1FL5A 4P5KB 1Z3GL 5GHWL 2OI9B 4M9PA 5CIPA 4U1HA 4CADA 5J1AA 4KY1L 1IGIH 3P4LA 3Q2CA 3O2WL 1OTTD 5L0QC 3HTLX 3L6FB 2ZSWA 4IEFB 3V6OA 4A6YA 3MV8A 4OTXL 5L7XH 5KTEH 1BPVA 2DIAA 3OJ2C 2IPTH 2BNRD 4K8RC 3IDIA 5BMFH 5JW5A 2MOVA 3GSVA 2I07B 2BXZA 4F33A 3RVVC 1LWRA 5HI5C 3OL2A 3MRLB 3WYRA 3V0VA 1SEBA 2XKNB 5C8JB 2GSIB 3LKNA 4RMQA 4KI5C 4OCWL 2OR7A 2C9AA 3FKUS 1TITA 2JJVA 3DOSA 4G43A 2OMBA 3IRPX 2X89D 5CJXA 2HVKA 4U3XA 4O2EA 5HGBA 4MDIA 5GS1A 1FV1B 4XBPB 5HHPA 1RVFL 1H3UA 4GJTB 2IFFL 3B83A 5DC9B 3FJTA 3WS6A 1TJGL 3FFDA 3BUYA 2CDFA 4ZUUA 4HBCH 1KG0B 3WJLA 4LCWA 3ZL4L 4MD4B 5L2KA 1KN2H 5CP7A 3MRRB 4ZS6D 2DIJA 4UTAL 3ULSA 5EORL 1XGTA 1QLRA 5IROC 1T0MA 5DDHB 4FFWD 4CGTA 5IB2B 5FYLL 2WBKA 1Q1JL 3EYSL 4LLUB 2QQLH 2D0HA 4KRPC 1N4XL 4ELKA 5C0JA 2ZCHH 3H9HB 3F7VB 4JLRA 3SJVB 4HH9A 4JPKL 1IEBB 5DVKA 4PJXA 3P0VH 3BZDA 1KB5H 3FT3A 5J6HA 3WKMH 1VSCA 4PJBB 2C7UA 5DQ9A 4GAFB 4NFDA 2Z4QB 2VE6B 4HF5H 2UWEE 2H8PB 3HZYA 1FLTX 5EIQA 4OZIA 4ZPVA 2EYSB 3FAXA 3IJSA 5KW9L 4XCCH 5I1JH 3JWOH 1S9VB 3CDGB 3X3GL 1YMMB 1DSFH 4TUOB 3HRPA 1SJHA 1EIBA 2LE9A 2RB8A 1JI2A 1DEEA 4ZO6A 4M1DL 4TTDD 5GRJH 4DN3H 2V9TA 3P11H 3RA7L 1MF2H 1VFBB 4AK1A 1TZGH 2E6PA 4KDTA 4LPCA 4ZPTB 1XCTA 4S11A 4LPXA 4PR5B 4CW1B 3VFSA 3QUML 3TNMB 4X5WB 1KSRA 4IOFD 4NOBA 5ISZD 3GZKA 1KXVC 3V4VH 5HYJE 2VLRE 1BBDH 2MNUA 2XY1A 3WFBL 3MV9D 1XIWA 1H5BC 1OAQL 4DFIA 2B5IC 2R23B 2X4PA 1D6VL 4GMTH 4L8SA 4Y1AE 5EU3B 4HS3A 4UOW0 4HHAA 4N8CL 5C70A 2R0KH 4OM1L 4L5FH 5E1AB 5J3HC 3DUSB 1TDQA 2OTWB 4HWNA 2B8OT 5HHXH 1MNUH 5IR1B 2NY3C 4P4RA 2IAMC 4XVSH 2GTWA 5J8OA 3R4DA 4ELME 1F3RB 3TT1H 2P24B 3OJMB 3DJ9A 4YPJA 1IGJA 4TSBL 3C60B 1PGRB 5I8CA 1C16A 3U0TA 3WMSA 5C08E 3QPQD 4HIHA 3DIFA 2NCMA 3QIWC 4L29B 1F4WH 4PJBF 5CILL 3H2WA 1Z5LA 1EDQA 4QTIL 3RGVC 1ZANH 1QBBA 4NNPH 1Q0YH 4JCMA 3FHQA 1MUJA 3W39A 5SWZD 4X9HA 2AEWA 3QCTL 3D18B 1NBVL 4WTZG 1BAFH 3L3JA 3PWUB 4RAUA 3C08H 1RSFA 2OR8A 2Y4SA 3H3PH 3WCYA 1LO2L 3O6FD 5D72H 2MMXA 3GB7A 4K55A 4MLSA 3CXDL 3U0WH 1YN6A 3DTXA 1NCTA 1G0XA 2FYYB 9CGTA 1J8HB 1G0DA 4OKVB 1T20B 4DUWA 1CU4L 4KMTH 1CGXA 1T5XB 1BVLA 1FO0L 3HI6L 1PSKL 2CIKA 5I1LA 4HPOL 4N0CD 5C0CD 2D03H 2VR5A 4JCLA 2A73A 1MCCA 5DRWA 2FX7L 3BUTA 1QFOA 3BP6A 3KPRD 5GJTH 1N8ZA 5C3LD 4PRIB 1HXMB 4AIOA 5IVXB 3RBSA 3FO9A 1XF2A 4M62L 3KVQA 4ZNEE 1I9IL 1QR4A 3LN5B 4NRXA 5DVMA 5MERB 1OTSD 1GPOH 5SWSB 2F19L 3STLB 3QCVL 4M6NH 5ADOL 1KN4L 1KGCD 5B22A 3FQTB 3QHZH 1I8MA 4Q9CA 1IVLA 1H3TA 5F9WC 1F6LL 4LVEA 3H9SA 3D48R 2AV7B 3SGDH 5F1IA 3EGSA 5F9JB 2AKRA 3S3PA 5A3ID 1DQMH 4A2MA 1IGTB 4P59L 3ZE0E 1TVBA 5E2TL 5CEYB 3OAYK 1AI1H 2O5ZH 3GK8H 1FNGB 1QLEL 3BIAX 1G7IA 2XN9B 1ACYH 2PXYA 4HGWB 3QQ9C 4AENA 5M7QA 1OLZA 4HUNB 3T2OA 2X44D 3QUZB 3WIHA 1ETZB 1MHPL 1GZPA 1PKQE 2A1WL 2HT4C 1QACA 1Y6KR 2DM4A 4RRPA 5DJ2B 4NN5B 4YDJB 2GUOB 2GTZA 1RZJL 4R90L 3O0RL 1HHGB 4C83B 5JDSA 1NKRA 2F54D 1WQVT 3VGAC 4DZ8B 3ARYA 2Q3ZA 5GSRA 3CDYA 3G6JA 4PJ8D 3MLUH 3D3VA 3W9EA 4EI5B 3G5VA 5J1SC 4I77H 2VLJA 4CMHC 3DGGB 1KT2A 4OCSL 5LXGH 2NY7H 3RIFK 5C2BL 4KPHH 1RPQA 2P5EB 1CDGA 5IVXF 4GG8A 5IMKA 3QULB 1DQJA 3EAKA 2JJTA 5EZIL 3HMWH 4WGWB 3IFPB 4L3EA 4QRQB 2X1QA 4PGJA 1NFDE 1LQSR 5E95B 1T3FA 5JMOC 3ILPA 4PJFF 2XRAL 2IANA 3VFVA 3QZWB 5HGHA 3NA9L 1UENA 4NQDE 2V17H 4FMKA 5GRVL 4YHLH 3WIIL 5C0IB 1PG7L 1A4KB 1RHFA 4XNMA 3NIDE 4JRYB 5IMLA 1T0NA 1PDKA 5C0BE 3EJZD 5E9DE 1MPAH 3PJSB 1KENL 4MD5A 4I3SL 5BVJA 2EE9A 1WWWX 2DQUH 4B0MM 4HUXB 3WKNA 3INUH 3KYNB 3AREB 2P5WD 3SDDB 5JR1H 2DLFH 3K4AA 3QFJA 3BEVB 2DWEA 3MRJA 1MQ8A 4D0DB 5IVOA 3PWVB 4HXAH 4D8PA 4YFLF 3EIFA 3LQAH 3LZFH 3VXPB 1JWMB 3ARDA 5LWYH 4WO4C 3Q5YA 4DQOH 5CD5D 1PX3A 4OFKA 1AGDB 3I6LD 2NMSA 3MLYH 3MRNA 4JREB 2DTMH 4RISH 4JFEE 3LKRB 4ONGH 5CZXD 5IHZB 1MCQA 2GJ6B 4L4VD 2B7DT 3G6AA 3P77A 2OJZL 4GXVH 3TV3L 5TE6L 2FBJL 3TN0D 1RMFH 4P9HH 4KVNL 3TZVC 4PUBH 4G6FB 2XTJD 1A14H 5FO8A 3T3PF 3MYJA 1JPFA 4KRMB 4KKCC 1BLNB 1TJHH 1XF5B 1R5WA 3NACL 4CU6A 3W5MA 1FC1A 4BQ9A 1M6OB 4MCYB 1BWMA 1FNAA 1OPGL 1P7QD 4XBGB 4XP4L 5E8NA 2IADB 4PD4J 5F7KC 2MQ3A 1IGMH 2FO4B 4D9RD 3OPZL 4CU7A 3IKCB 1E6JH 3WDHA 2EDKA 4CL7A 3IU4H 4JFFB 4MNHA 3MLXH 3D9AL 3KPSB 5I8EB 3L5HA 3PL6D 2FO1A 1TLKA 1Z9SA 3BPCA 3LRSB 4LNRA 4POUB 5LGJB 4NSKA 3ZLQC 3GHBL 4PGBA 1G7MA 5CSGA 2EDYA 1KIPB 4W6YB 5IT2L 1AFVL 3ZZ1A 5JXEC 2OR9L 5DK0B 3U30B 4ZSOB 1FP5A 4PRHE 3HE7A 5ADPH 3T1WA 4RGNC 7FABL 3P4OA 4RZCA 4S1SH 4M43L 3GMPB 5DFVD 4ESKA 2JK5B 1DBAH 1FRGL 2RJMA 1QRKA 3OKMA 3O3AA 3JUZA 1IKFL 3VI3F 4PREB 2UWEA 4HWUA 1FYHB 4S0TD 4IDJH 1ZLSH 2BNRE 4QGTA 3ULVF 5GS2H 1T1YA 2VLKB 4DGIL 1KLUA 3BAEH 1VGKB 5DUPH 2AXFB 3NFSH 1EO7A 4RMRA 1E4KA 3MZTA 3I02A 2VOTA 4EXKA 5CEZH 5I75B 1TQBB 1F90L 1TCRA 1OP3H 4NQEB 2FB4L 1OF2A 2QQQA 3EO1B 3WEXB 4DKFH 4RFOL 2HVJB 3KS0J 2JIXA 1MRCH 2QHRH 3DX6A 4EN3A 5HYQA 5BW7A 4M5ZL 3C6LC 4F9PC 5HYJA 2QQNL 2VLRA 4X6CE 3OAUL 2VKXA 3RJQB 3RVTD 5E00B 4O2FA 2H41A 1T20A 4FQ2H 3KPOB 1CN4A 4Y1AA 8FABB 3VWKA 1UWGL 1K8IB 1UJ3A 3E2HB 1E6OH 4LKXB 3U2SA 4YXHH 2Y9RT 1OOAA 4F3FA 4JKPL 1KCUH 5JHLL 3VD3A 3BW9A 1EH9A 2A77L 4ELMA 5D1XD 1I3UA 1MFAH 3QNXB 1FLRL 1UA6H 2AW2A 2PO6D 3H0TB 2VZUA 3M1BB 2FJHA 3HCVA 4L8CA 3JV4A 3CC5A 4Q6YA 2Y5TA 3WN5B 4E5XA 3PNWA 5C08A 3TESA 1G9MH 5EPMB 1MAJA 4YHZH 4Q9RL 5FO9A 1IM3B 2ICEB 1UACL 2ITCA 2VXQH 3JTSA 4JR9H 3WNPA 2QBWA 5DUML 5FUOL 1FVEB 2IPKA 3OF6D 4K7PX 2R69L 4ZFOA 4HAGA 2FEEI 3HAEB 4M48H 1AO7B 4Y5VC 2EDFA 4M6OH 2CMRL 5B8CC 4ZOAA 2RR3A 1N5YH 2D31A 3PE9A 4K94L 1U8QA 4DK3A 4CVWA 3TLRA 1OLLA 5C0FB 5E6IC 2F5AL 5ENWA 1D5BB 1NFIB 5FM4A 1LO3L 3TVMD 3O3EA 2VXTL 1IEAA 4LVOC 5E8EA 3L3GA 3DRQB 4P23D 5K9JL 5ISZE 5AAWA 2Y7QB 3RTQA 1TVHB 3F58H 4M6MH 4WI9A 4S2SA 1AGFA 3MV9E 3ZYOA 1F8TH 1MQKL 4KQ4L 4FQQA 2ZCKH 4Z7WE 3VMPA 3CSGA 1WZLA 3NH7L 4ZODA 2IQAB 4CN6A 3G04A 5D4QA 5BQ7B 3ULUH 2GY7B 1YEDB 5IHUL 1E4XH 4X98A 4PG2C 5D9SB 1FNSH 1HILA 1LNUB 3D39A 4UOJA 1RIHL 1T5WA 3A6BH 5JLZB 4DKDC 1BJ1J 4M7KL 1JWSA 2BVQA 1TTGA 1NMAH 4HZLA 4ZTPH 3UJTL 4P46D 43C9B 3IFNH 4YO0A 1G7PB 4Y4KD 4JM2C 3MJGX 4IRSD 2HLAB 5DJ0B 1A2YA 1RUQH 4JO2L 3VFPA 1F5WA 3ULUC 4PV8B 4JPIB 1FJ1B 3SJVD 3ZKXB 3TA3C 3BP5A 2B39A 3N06B 3P3YA 3ZYJA 4YDVA 4M8QB 5SWZE 1INDH 1C5DB 4HMCA 2CRMA 5F21B 3HI5H 2BRRH 3BKCH 2A83B 4OB5L 3N85L 3STBA 4FZEH 4QKXB 2AGJL 4P4KB 3WUWA 1KTLB 5J6GA 3QO0B 4LSQH 1T04A 5DA4A 1PKQA 1G7LB 4LPWA 1NCDH 3KYNA 4LLYA 5EIVA 5IVNA 4LFHD 5EG6C 4FHBD 5FYKL 1F4AA 1RZGB 5CGYC 5KAQF 1Z6JT 3RDTB 3UYRL 4F7MB 1ZHLB 2HFTA 2R1XA 5C0CE 3HE6B 3HS0B 2H3NB 3QXTA 4XP6H 3SOBH 4CUCA 2W60B 3HNSL 3F5WA 2FATL 3QZWG 3SEPA 3TBYB 4H25A 4M1CD 5HTSA 1QEWA 1A7PH 3GSNH 3KPRE 3BH9A 1R0AH 4U33A 2XFXA 4X80L 5DVLA 2VXUH 3O8XA 3MXVL 3NABL 4D9QD 1IGYB 2Z8WC 3UC0L 3THML 1DFBH 4WFED 4EZMA 1X3DA 4F57L 5FCUL 4JFDD 3CVHH 1KCRH 1R5VB 1JGEA 3WIHL 4H8WH 1KGCE 2KZWA 3WO4C 2H26B 1RJYA 5EOQH 5CEXB 4H1LH 1NFDA 4OIIH 2EYRA 5IESH 3I6GB 3OGOE 4IRJB 3ZKQD 1W8OA 1MEXL 3IXTB 4F7TB 4Q74A 1ES0B 1QQDA 4NQDA 2Z92B 3TCLB 1FFNB 2VC2L 1YY9D 4Z0BH 4HKBA 1LO0L 1JF6A 5I74C 4BZ2H 2OTUA 3MRKA 3VGGA 2QQKH 4UI2A 3RVWC 3OAZH 5E9DA 5IVZA 5F7NC 3DWTA 2VQ1A 5I1EH 3KPNA 3BO8B 3ZTNH 5IKCB 2GITA 4U6XA 4IMLA 3T0EC 5GGRA 3KWWB 3IF1A 1DVFA 4MYWB 5AWNH 2D7TH 4G8EA 5DEFB 2AK4B 4KAQH 3EDKA 3TH3T 3QG7H 1NBYA 3PUCA 2F54E 4UT6H 5I1KH 4FN0A 5DRXA 4JHWL 5LGHH 5CJBA 2R1WA 4X6EA 4HWEL 3MV7B 4JFEA 4UUJB 2XACC 5E7BA 3MC0A 1HZHH 1F11A 4LEOB 5EULV 3M17B 2P8LB 1RIUH 4K7FB 4LDLB 4ZAKD 4NC0B 1T7VA 4UU9B 5HGDB 3ZKNC 1C12A 1FORL 1XF4A 2CLRB 4WGVB 5F6IC 3SDCB 3WE6A 3OB8A 5B38B 1TNMA 3DO7B 1FNLA 3HG1B 3U48A 3FO0H 5DD0L 5EUOE 3JWDL 4GAGH 3QUXD 1AR1C 5F7YC 5HYIA 3BP7B 1UYWL 4Q6IC 5DD5H 1I3GL 2W9LA 1YNKL 5IB5B 2LABA 1KJVA 3QIBA 1SJEA 2UZIH 5F89A 1FBIL 4D3CL 2VL5B 2H2SD 4RMWA 4F37F 1FN4A 4H0GA 4KJPD 1HHJA 3LH2L 1I1FB 4LASH 3MXWL 4ZNCD 5SX5K 1WEJL 2I9LA 3B4NA 4MXQD 4HX1B 4EDWH 4QHNB 4R2GB 4J1UA 3QO1A 2BFVL 5I6XB 3CXHK 4LSUH 4GRMB 3SDYL 3UCRA 3MLWH 3MOBL 1NDMA 5FCSH 5TDPB 2Q7YB 1JYWA 1ULVA 3ESUF 3PP3H 3U6RA 1ZWIA 4X6DF 2HYMA 3MCG1 3GBNL 1G6RH 2P5WE 1T2QL 2HMID 4PRHA 3OZ9L 4BSVA 4NIKB 4L8BA 2VYRE 3V4PL 3RZCC 1QRNB 1YQ2A 3KPQA 3N1QC 4M4RA 2YD8A 3BT2L 5ICXB 1JGUH 4FQ1H 3BOVA 4N1CA 3HZVB 1Q72H 3I6LE 4J12A 4HUUA 3R8QA 3WDIA 2P45B 1QKZL 1CVSC 1UADC 4XTRC 4LDOB 4L4VE 4S10A 3STZA 4AEHL 2NY2B 1LDSA 4ODXA 1H0DB 3B9KC 1VKXA 4WUUA 3VJ6B 4OZ4B 4CMMA 4JN2B 1FFPA 2XTJE 4RAVB 2BNRA 4MJ6A 4Q7DA 2WBWB 5EUKB 1MRFL 5KSAB 1ZS8A 5GZOC 1BFOA 1AQDB 1V7NH 5KZCD 1N6VA 4NRYA 1WZ1L 4TNWF 3F8UB 3EYQC 1S5IL 4D9RE 3T8XB 3SDXE 1AJ7H 1EEYA 3RWFB 1W72A 1U95B 2EC9U 5LAXB 4ALAH 1TZIB 1G1CA 2EIZB 1FAIL 2R2CA 4JFXA 3HN3A 3QQNA 4Z78B 4ZO7A 4X6CA 1INEH 3MBXL 5D1ZB 3WUZA 1V3KA 5EC2B 1HNFA 4NQCD 4Y4FB 1F58L 2FGWL 1NCAH 3AFLA 1KYOK 2FCBA 5IGXH 2A6KA 4MX7A 4XC3H 5DRZB 3DX7A 1XH3A 2IBGA 3ARBD 4WJ5B 1CL7I 4YQXL 1NBQA 3D85B 2VR9A 4OZHB 2NXYD 1QSFB 4X99A 1NC2B 2NY6B 1MJUL 1QZ1A 2FEEL 3ARED 5JOPD 5GS0C 1MVUA 3GSUA 3NGBB 1T89C 5BS0D 1HEZB 2NTSP 1MOEA 5C7XL 1DBML 1KV3A 1U3ZA 2B1HL 3VRJA 4QRTB 1WISA 1EK3A 5ACLA 3MREA 1HHHB 3VRIA 1BJ1H 4MQTB 5BXFB 1BX2B 3MGAA 1LO5A 4XXDA 5FGCE 3UZEA 1WBZB 4MAUH 4OD2A 3GKWH 3TBWB 3D69B 4FXGA 3ULVD 3SDAD 1YY8A 4FTVA 1J1XL 4LF3A 4EI6B 2UUDK 1OW0C 4Q0XH 4I0PC 4ENED 4EXPX 5E99H 3ZSSA 4X8JB 3L7EB 1WZKA 2DICA 4UV7H 3REWA 3C5ZC 4DGYL 2Q6WA 3PDOA 2P8MA 1T03L 4JRXB 3GM0A 2VKWA 2EDNA 2I26N 1RURL 5D7IB 1Y0LB 3MV9A 5T1KD 1OGAD 2D9QB 4P2CG 3S34L 1SMAA 2ADFH 4Z7WA 4B7LA 5J12C 1B88A 2NY1B 3O9WC 2DQTH 1PG7X 5DJ6B 4ZFOL 2GCYA 5C6TL 2A2QT 3RVXD 1K9TA 3SHSA 2VDPH 3TIDB 2DQFB 3A0OA 1XR8A 5ID0B 1T1WA 3IB4A 5CMAB 3T04D 1LK2A 5BO1L 3O4LD 1DBKL 1KB5B 3QIUD 4PJ7B 3WNOA 1MAKA 4OZHF 1R3HB 4KI5F 4E41B 2MPAL 4I48A 3EHBD 4KVCH 4PRNA 3U0PA 1SJXA 3T1FB 2EIDA 1DE4A 4JGUA 1LD9B 2NY4D 3L7FB 3BE1H 3A67L 4HK0A 1P7KA 2YPVL 1QA9A 1HKLH 5F7EH 5I1HL 4NKIH 3OKNB 4P2OC 3PV7A 1UWEL 2D7NA 5EU6D 4OLXL 4OLZH 5FA3A 3CPLB 5SWZA 3BXNB 3ROOB 3RWGA 5BV7C 4PP1C 4LPVA 1VACB 3SE4A 4OFYD 3EFDL 5A40E 2VZVA 1NAMA 3O3BA 4RA0C 4X0KA 4QYOB 4O5LL 3GMQB 1DUZB 2FH8A 4WUKL 4X7SL 2WBJC 2AJVL 3PWNB 4PRBB 1JN6B 2P8PB 3W9DB 5I66A 2XNAA 4DW2H 4PJCB 3GUTB 3E8UH 3QG6B 4GQPH 5T5FL 1IRAY 2Q76B 4QHKJ 4L9LA 1U9KA 4NO3A 3PHOA 4PLKD 5GSVB 2F58H 3S6CA 1RZFL 1C5CH 4JHAH 2RAMA 5EIIA 3KPRA 4NBYB 1ZVSB 3MRGA 4KZDL 2PW2A 1G7HA 4UBDC 1A7RH 4K7PH 3FFCB 3WHXB 2ENSA 1IC4H 3FB7B 4RWHA 1CXFA 3ISWA 1AQKH 3D0VA 5HSFA 1WWCA 5BVPL 4MA1B 4PJ7F 5D6DC 4FFZH 4Y0GA 4HIIB 5IV2A 1CE1H 4ZXBC 2Q20A 3CSYA 4OGYH 4PTTA 5CBAB 1U8LB 3FQUB 1QBLL 5ESQA 1AGEA 4Z6AT 3SJVE 1XZ0A 5H35A 4M61B 5KSBB 5E4EB 4JZOA 2HRPL 4JANB 2H32A 4MJ4A 4PJBE 3PGFL 2QSCH 2FWOB 4EUPA 1B0RA 4KKBD 1KCSL 5DS8A 1WBYB 3DX8B 5C07B 3GBML 3IU3A 5T3ZD 4KUZH 3K2MC 1CXLA 2AK1H 1RZKH 1L7TL 3QBTB 2XQBL 1ZTXH 5ALBH 3O2VH 1JMXA 1MHHB 3AU1B 1U3HD 5ESAA 4N1EA 3O45A 1TFHA 2DYPD 4ONOA 1OAKL 2DKUA 3U9PH 4TUKL 2ICCA 3VXNA 5I15L 2BXYA 1A3RL 4PJ8A 3RWCB 4PJCF 4KK9C 2OP4H 1U93B 4WNQB 4B53A 1Z3GH 4OSUH 1NMBH 5GHWH 4XP9H 3WFCL 4KY1H 1OARL 5DJ8A 3DBXB 5FB8B 5EBMA 1OSZB 3O2WH 1S3KH 3ZKMC 3CDFA 3EYVB 1GZQB 5D96B 4G8IA 4D9QE 3G5XB 4P5TA 2BJML 4LCYB 4OTXH 3BI9X 4WFEE 4BH7A 2PCPB 4JFDE 3C5JA 3BPLB 3FRPA 4XC1L 5EUOA 1P84J 4NQXA 5EUKA 3HZKB 5IFJA 3B5TA 5H2BA 2YUWA 1K4CA 2Q8AL 2QJDA 4OCWH 2Z9TA 2DQIL 4OLUL 4QCIB 3JV6B 1M7IA 2X70A 1KJ3L 5E7FA 2YBRA 1EZVX 1RVFH 3MRQA 4UQ2A 2E7LC 2IFFH 4UINL 2XA3A 1KXTB 1TJGH 5ITFB 1WBXB 4C4KT 3MRPB 4MB4A 4PJEB 4FG6D 3RWIB 4UMGA 5A2FA 3PABB 2P5WA 5ICZB 4UTAH 5EORH 3RHWF 5T3XH 2FJFA 4M5YH 1FC2D 3TH2T 2B20A 2W0KA 2NZ9D 4R96B 1GOGA 1RQ5A 1CGWA 1OGTB 4OCRL 4DVBB 1NQBA 1Q1JH 3EYSH 2DQHL 3BIKA 4I18B 4AIZA 5JPMB 2HKFL 3U7YL 1N4XH 4R4FH 4L4VA 3IS0X 3QDMD 4C4KO 2Y06H 4JPKH 5FUCE 1AD0A 4F9LA 1MFCH 4H26A 5LCVL 3TN0A 5ACZB 3CSBA 2CO6B 1T1XB 5EC1B 4JVUA 2C3XA 1UKTA 3AY4A 35C8H 4WI3A 1R3KB 2VWEE 1ODAA 2AQ1A 4TQEL 4Z95L 4YBQD 2DQCL 4LKCB 5E5MB 5ETUA 2R0WL 5KW9H 3CFDA 1OQXA 4PJIB 2EE2A 2KQNA 2BC4B 4WU5B 5HDOA 2XWBB 5CD3A 5GGSA 4JDTL 5JO5A 3MO1B 1U8JA 1P7QA 1TJIL 1YN7A 4BUGA 3LQZA 5JPNB 1A6VL 1MJ8H 3C8KA 3FONA 5GIRA 3DARA 4M1DH 4B7IA 4MD0A 3SDXA 1MHEA 4UB0H 4F7PA 2FZ3A 3RA7H 4OT1L 5GRUL 1Q9LB 1QP1A 3LY6A 5JORB 2G2RA 1UQSB 1VADA 3PL6A 1I1YA 4PJFE 1CL7L 1QHPA 1S7VB 4Q9QL 3QUMH 4M7ZC 1D6EA 2C26A 1UB5A 4GKNA 3EDEA 2EIBA 4RFNB 2NLJB 1OQOA 3EOBA 3QI9D 4ZFGL 1RULL 1P4LA 1SJVA 1OAQH 3OR6B 3Q6GL 2JJWA 3O11B 1D6VH 3W0WB 4PJEF 3L3DA 1HDMA 1IFHL 2WUCL 4JG0H 4DZBA 2R56L 3BKMH 1J86A 3NN8B 4KMQA 5ILTL 1Z9LA 4NN6B 2QLVB 4YHNB 4JZJA 1W72L 4UAOB 3SGEH 3MRIB 3MLZH 3MBED 4FABL 2AK4D 4FQCL 5EO1B 4LSTL 3I75A 1W0WA 2VR4A 4TSBH 4YX2H 1A9BA 4CVXB 1V7MH 5IMOA 1CG9A 1B0GB 3MRBA 4XNZB 1MCSA 3UBXB 4PJHB 4FQXD 5CILH 4G8GB 3RL1A 3VWJD 4QTIH 1FNEA 4LLDA 2H6PA 4UDUA 1NGXB 3T3PE 5EWIH 4J8RB 4QEGA 5J7CC 1T66D 4NWTL 2GFBB 5JQ6L 1MY5A 1JV5B 2NX5D 2R1YB 5D7JC 5FUZL 2EDBA 1ZHNB 5L6YL 3X3FL 2OL3A 3CXDH 4JDVB 3FQRA 4W4OC 4EDXB 4QHMA 3K4ZA 3G6DL 1CU4H 5FHBH 4M02A 1D9KA 2VN4A 1FO0H 1UCBL 1PSKH 3HI6H 4NQCE 3LKOB 1IKNA 5DHXB 3P4MB 1CE6A 3QEGH 4DGVL 2FX7H 2YD7A 2PNDA 3ABZA 4G7YH 4Z0XB 3KPLB 1RJLA 1T22B 2EEBA 3QNZA 4U1MB 1I9IH 3MMEA 4K3DL 5I71C 1CCZA 1EMTL 4OF0A 1N59B 4NQVB 3WHXA 5ANME 3DMMA 2F19H 4PGCA 5D1XA 2PO6A 3QCVH 2MQCA 4JFYB 3HNTH 5JOPE 5ADOH 1YEHH 1KN4H 4OAWB 5BS0E 3CX5K 5EU7C 3SE8L 4ZS6C 4QWWC 1JMZA 1AP2B 3GMLB 1I7RB 3BX7C 5JW3H 4I3GA 1G9NC 2W9EH 3OF6A 3VI3E 4PLJC 2ARJB 5A2KH 4LLWA 5DEGB 3WSQL 5I30L 1NANH 3B3IB 5L9DH 4U1JA 4MWFB 2RQ8A 1Y6MR 4GKZB 3MJ8A 3ULVE 3N9GL 1QLEH 4PJ9D 3TWCH 1M05A 3BEWA 1EUTA 1IC5L 1A1NA 1D5XB 4DEPC 3TVMA 2AJ3A 4OZFA 3P0GB 3GMMA 2BVEA 4MAYC 4JY5L 1CLOH 1AXSA 4P23A 1MHPH 2A1WH 3U1SH 3KYMB 2ERJB 3Q48A 4POZC 4AJ0A 4WVRA 4WCYL 1RZJH 4R90H 4Y5YB 3O0RH 3V95A 1OGAE 3V5KB 1QR1A 4W81A 4HZAA 1KTDA 1DLHA 2KL6A 4MJ2A 3P30L 3O3DA 3VMOA 5C9KA 4GW5A 3E6FA 3UZQA 1AKJD 1CDYA 4OCSH 4OQTH 3BZEA 5HY9B 1BGXH 4JHBA 3O4LE 5D1QB 4NFCA 5C2BH 1MCHA 1CTNA 1NAML 3QWOA 3QDJB 5D7LB 4K8RD 4LIQE 2PN5A 4UIMA 1WICA 5CJ8A 1OY3B 5DHVA 3SE3A 3T65A 4IJ3B 1KBGL 4LK4A 4M00A 5DGRA 3Q0HA 5CUSH 3RVVD 5HI5D 1HHIA 4XGZA 5IW6B 2AJZB 3ES6B 1W0VA 4JY6A 4P46A 1IQDA 3FO1A 5IF0B 4KXZI 4QT5B 4Y4KA 4IRSA 3LKPB 1E28A 4KI5D 4AYFA 2HKHH 1KJ2A 1UM6H 3LV3A 4JFQB 3FTGB 2K7PA 3K74B 2XRAH 3F7YB 5C0AB 3NA9H 5EU6E 5DHYB 5GRYA 3VFUB 2N7AA 3WIIH 2FIKB 3ZO0A 2AERT 3T2NL 4FXKB 1ZHBA 4LARL 3G9VA 3S88L 2A9ML 2DLGA 4P3DA 2W92A 3DXAB 2DIBA 3G5ZB 2EKSA 1XGYH 3HZMB 4LGRB 1FE8L 3A6CL 1RZIA 4I3SH 5CS7A 1U8HB 2YD2A 4JFHD 2I9TB 5TQ2L 3SKOA 2VUYA 1N26A 1MFEL 1A21A 4QRRB 3QAZB 4V2BA 5DZNA 1ZLVK 1RU9H 1GJIA 4KRPD 4XPTL 5KS9F 4JDZB 5INDB 1K5NB 4NKDA 4J3SA 4H88L 4O58L 4Z5RB 1BZ9A 3BWAA 3CFIC 4PTUA 3QHFH 5FA4B 2XA8L 3NPSB 4PJDF 1RHHA 5TE6H 2FBJH 4O51A 3IDNB 3O6FC 4NRZA 4Q2ZB 4KVNH 1ZE3C 5CP3H 1EFXD 2YMXL 3TC9A 7CGTA 1P6FA 4JFDA 4KROB 1OP3K 3UPAA 4QNPF 4ZUVB 4OI8A 2VZTA 2NY0C 4DKAA 3VG0L 4QHUB 1XR9A 4MJID 4AMKL 5KN5B 2EXYC 3DRTB 5ESVB 3BVNA 5FKPB 1RJZB 4XP4H 2APTA 3ZT6A 4OV5B 3OPZH 2F5BL 5T5NG 5CIPH 3AS1A 1QO3B 1RZ7H 3EOAB 1U0QA 3D9AH 2FBOJ 4ORZC 1I4FA 1RY7B 4XCNB 4A6YH 5IBLC 5T3ZE 2W38A 2YWYA 3VXQB 5MEOA 1DEDA 4QHLA 1AIFA 5IT2H 1F42A 2B4CL 4BYHA 5D2NC 3BISA 4GW4A 2OR9H 1EAPA 4WW2B 3EJYC 5J3HD 2CKBL 1Y18B 4P2RB 7FABH 2AABH 3MA7B 3GSNB 2NY3D 3BQUB 2IAMD 2I60H 1RZ8A 3QQ4A 4ISVB 4M43H 1NSNL 2M8XA 1U8IA 1JJUA 4ODTL 3DVGA 3ULUF 1NGYB 4HUWA 1UWXH 4S1QL 5HVHC 4AT6B 3CVHB 4ZAKA 3UPRA 3JBG7 1J1OH 3QJHA 1CD1B 3DGCR 4NKMA 5FIEA 3VCLA 1IKFH 5DMYA 1JF1A 5FHAL 2ATPA 3QIWD 4PG9B 4G42B 4H1LB 3L3IB 4KFZC 3RGVD 4JG1L 1Q94A 4DGIH 3C9NB 3HR5A 4L4TD 3CK0L 1RUML 2X4RA 2JF1A 3QUXA 3AM8C 4M7LH 2MCPL 3V6FB 2N7BA 1ADQA 1U92B 1EJOL 4I5BB 1F90H 3ECBA 3WFHB 3B6SB 4QOKB 2F53D 1O7SA 2H1PL 5JA9A 4RFOH 5C0GA 1DLFL 3BGAA 4PJFA 5FAAA 4R3SB 3VFOB 1E27A 4QXGL 4M5ZH 5HJ3A 1JVKA 3Q3GB 3KDMB 2Z35A 3SCMB 3BSZL 3OAUH 1CIDA 3GGWA 2L4OA 1AXTH 1P69B 3AAZB 1GGCL 3WJJA 2GSGB 3F12A 3UBXG 5DR5H 4BH8B 2ZG3A 2FLBT 1UWGH 4JJ5A 3RUGF 2ED9A 5HYFA 1QFHA 4OLWH 1U8PB 5CLTA 4KK6C 2DMBA 4NUJA 5I1IL 2IG2L 5DMKB 1PZ5A 1SYSA 5LG1A 1F4HA 2BERA 3PQYD 3KLAB 5JHLH 2Z31C 5DRNA 2A77H 3EDDA 1N59A 3QDME 1FLRH 4ODBD 2X6MA 5I18H 5MENB 1KACB 5JOFA 1S7TB 3BYTA 3PWPB 1IQWL 1K4DB 1NAKL 1FGNH 4FQHA 4N0UB 3BZ4A 4GS7B 4RGMC 2Z93B 3MNWA 5KJRL 4GKOA 1UACH 2VQTA 3RQ3A 1NJ9B 2W65A 5I17B 1LHZA 5I1AB 5DUMH 3BRFA 2YSSB 2PW1A 4MGXA 5C0EB 4YR6B 4R8WH 2PYFA 2R69H 4ZUTB 4F58L 1RD6A 4TTGA 3DV6A 2DMCA 2CMRH 3TPUB 4K94H 4Y89A 1A0QH 3UO1L 1NGPL 2DAVA 3UTPD 1AY1L 3MRMA 4UILL 2F5AH 3MTRA 3GSOA 4OD3L 1LO3H 4GRWH 5GGTA 2CDGA 2HT4D 3LB6C 4LCCB 4ZYKB 3VXSA 4MQ7A 1G6RB 5HYSA 5SX4H 3MFGB 2YD5A 4HKZB 4MA8L 4NQCA 4Y2DB 4WHYH 6FABL 1YNTA 4R4BA 2R2EB 4RFEB 1MQKH 1FG2A 2ED8A 2P7TA 3D1MC 2GAZB 5BZWB 4YFLI 4XBEL 1S5HB 1BP3B 3ARBA 3KYOA 4U0QB 1AHWB 3UJJL 1S9XB 1FZMA 3BPNB 2YPLB 5E8OB 5JIPA 4LHQB 4UOW1 4X6DE 5IHUH 1IARB 3GDBA 5ANMA 1PBYA 2X9XA 4TPRL 4IMKA 1S9YA 1S9KC 4XPHL 3OXSA 3C87A 3QXWA 2JE8A 5BS0A 3LD8B 2OL3L 2AK4E 1IMHC 3WBDA 4M7KH 4PD4K 3CVIH 3ARRA 3UJTH 2FHCA 4D0CA 3UDWC 1IEHA 2YD3A 1YJDL 3OAZK 4HIJA 3R06A 4GRLC 4NNXB 4JO2H 4R7NA 2AXGA 4L1HA 1II4E 2ZOKA 5IUSA 1A64A 1NCCH 1TPXB 1R3JB 1UM5L 5LQBL 5D5MB 4ZFZA 3RWHA 3SDAA 4XCEA 2I5YL 3OKYA 4BKLA 2X2YA 2QTEA 2NY5C 4U1LA 5BJTA 2O61A 4OB5H 1BIIB 2NX5E 3D5OF 3VFWA 1NBZA 1X5IA 4HFWB 1BFVL 2AGJH 1S7RA 5E08H 2Z91A 1BBJA 2YA1A 4I3RL 4I4WA 4G9DA 4W6XB 4WV1B 1KPUA 5T1KA 1OGAA 1RK1A 2P46B 1JHKL 5TDOA 3GM8A 1JK8B 1DDHA 2R2HB 4WO4D 1XCQA 3UYRH 1HKFA 3KPMA 3VE0B 4HWBA 2ZOLA 4V1DB 1V3LA 3HNSH 3PV6B 1N2RB 3HPLA 2CUHA 3HLAA 4ZQKB 1JGLL 3O4LA 3TZVD 2SEBB 2XZQH 2Y5EA 3MXVH 3NABH 4GBXB 3QIUA 1GRWA 3IETB 1JPGA 3RPIA 3THMH 4KKCD 3P40A 3CMOL 5FCUH 3V6ZB 2X1OA 3WIHH 4LSSH 2X10A 3KYAA 1XGUB 3D2UB 3TBVB 4W68A 1WWAX 5IQ9A 1WFNA 4HEME 4LBEB 2OJEB 2PTVA 4TRPH 5EU6A 3U4AA 3NAAL 1A6ZA 3TO4A 3H42H 5F96L 2VIRA 3WFEL 3EZ8A 3PP3K 1LO0H 4L4JA 2UY7A 2JCCB 3FT4B 5ACMA 3HNVL 4UT9H 4OFYA 3V6BR 3PGDB 1A1MB 1QD0A 1UB6A 3MRFA 4FFYL 4JAMA 1HHKB 5JXED 2BVYA 3PGCA 1NEZB 4RGND 4HWZB 1YYLH 4NO0D 1KJ2L 2OI9C 3X14A 3VFTB 5BRZA 1G7QB 2GK0A 3TBSA 2X4TB 3UAJC 2KBGA 2VN7A 3FOLA 4J7RA 4WI2A 1IBGH 4TSCL 1NH6A 3PHQA 4X6BB 1A7QL 1PQZA 1S9WB 3EYOA 1FORH 2BDNL 4Y4HB 5T33L 1QFUL 3C5SB 3SY0B 3HFML 2EDQA 3JWDH 2NPLX 2CUMA 4KI5E 3P73A 4NT6A 5K9OB 4QRSB 1UYWH 3EFFB 1I3GH 2PYED 1Q9KA 2WIMA 4OJFL 1JTPA 3QUYB 3WFDL 4MS8C 3RJDA 1DR9A 3B2UC 1FBIH 4D3CH 4F37K 3LN4A 4R0LB 4RIRB 1M71A 3LH2H 3MXWH 1SBSH 4K9EL 3QQ3B 1CBVL 1HYRC 4OFDA 3C6LD 2ZUVA 3MFFB 1X5KA 2IPUK 3CLFL 2BFVH 2Q86A 2X4OB 1DUYA 1L0QA 2XOTA 5E2VL 3MOBH 3QFDB 4ZFFA 2NW3B 4JFHE 4PRAA 3W5NA 4ZG1A 3QEHA 1U3HA 3QEQA 3GBNH 1T2QH 4R4NC 2J8UB 3OZ9H 3B9DA 2DYPA 1KIRB 3V4PH 3MCKB 3BT2H 3HPJA 1C1EL 1N6QH 5ITBL 4IIQB 1RUKL 2A0LC 4XAKD 4RMUA 4AH2B 3MODL 3PG2A 1QKZH 4WY7H 4PRDB 2AJXL 4XHQA 4AEHH 1NDGB 5JHDA 2ADGA 3WO3B 3NTCL 1U91A 4ZUWA 4U1IA 4YDIH 2J5LB 4GT7A 2R2BB 3EO0B 1MRFH 4MJIE 1I7TB 4YR6A 1T6WA 4UTBL 3QUKA 1V3MA 5DSCB 1WZ1H 2ZUYA 4I0KA 4PJ7E 5DJXB 5E6ID 4DAGH 4HKJB 3I50L 1VFMA 3HRZB 4QRPD 4LVHB 4JFZL 2AI0L 4P2QD 1RIVH 4K9EC 2EC8A 1F6AA 3PHSA 3TIEA 4XCYA 4YDKL 1FAIH 5L2JA 1DQLL 2P43B 2PTTB 4U6YB 4UIKH 3TBTB 3GIZL 3N1PC 3MBXH 3FZUC 2FL5B 3MACL 4H20L 5FGRA 1IAKA 4ZTOL 1F58H 2FGWH 2X4NB 4Y5XB 4PGEB 5K9QI 3ARGB 4JGJA 5ABDE 2NXZB 1CICB 1ADQL 4KTEL 4NJ9H 3GSXA 1K8DB 4YQXH 1JGVL 1JBJA 4MNGE 3FB6B 2V2WA 4NPYA 1HH6B 5IEKA 2HFFB 2VDOL 4JY4B 1FGVL 4HV8B 3C60C 4RQQB 3QDMA 5DJYA 4GG6B 5EOTA 4XPBH 4NCC2 2PTUA 2DQGH 5C7XH 2B1HH 4JM2D 5FK9B 5MEPA 4NHUA 2G75A 3ULUD 3TA3D 3KR3L 4L4TE 3SKMB 4PJ5D 1T83A 2YUZA 4O4YL 4AY0A 5IW1B 2FJGB 5I73B 4Y19D 3LEXA 1WITA 2COQA 1N3NA 1P4IH 4AL8L 4FXLA 5MEQB 5C1MB 2F53E 2X4SB 3BKJH 3GSRA 3MUJA 1CGUA 4HS6B 1T03H 2MSPA 5CGYD 1RURH 2FSEB 4BQ6A 5AD0A 1GC1C 3QI9A 1FSKB 2E8ZA 3S34H 2KZ1B 3U4EA 3CNKA 3MROB 2OLDA 43CAB 3RY5A 1O5DT 3FCTB 4HW6A 5C6TH 2HG5B 1A1OA 4QF1B 3DVNB 1RK0B 4HJ0C 2GW5A 4X6DA 5BO1H 2H2SC 1DBKH 3PQYE 3E6HA 1U42A 4ZDHB 3FQXA 3PXJA 4LSRH 1P5UA 5GGTL 3MBEA 3GMRA 3LN9A 5EZJA 2MPAH 5HI3C 1L7IL 3TNNA 1LE9B 2B0SL 1AGBB 2OCFD 1ZT1A 3PWJA 3VFRA 3WNNA 3IDUA 3NFPB 4WHTA 4YHML 1I9EA 3A67H 5DQJB 4Y88A 2YPVH 4LRIC 3BWUC 4FQXA 1JWUA 2IPUG 3IGAB 5I2IB 3VWJA 5I1HH 3WL9B 3HUJB 3FOMB 2AJUL 2EKJA 1UWEH 2FH6A 2WSKA 4OLXH 5HVFB 1BOYA 3VXOB 4YK4B 1JHTA 3RVWD 3O3UN 1FZOA 5HHOD 3SPVB 3VXRD 3QUZC 3O41B 3UTPE 5ELIA 3QUMB 3CUPB 2NX5A 4OF5A 3WLBA 4NN5C 4HKXA 1BIHA 2R0ZL 3T0ED 1X5HA 2A9NL 4C57C 4X7SH 4KH2A 2AJVH 1VEPA 1WCBB 3CFJA 3VMNA 4EI5C 2J88H 5DJAA 2NW2A 2W9DL 1A02N 1CFNA 1YPZF 5HHQA 2QSTA 1RZFH 5E6ZA 3QJFA 4ZUSB 1CYGA 4M93B 2HJFB 1GGTA 3ULVL 3VW3L 2JJSA 5D7SL 3ZKND 3TO2A 5I16B 2H9GA 5DK2A 1W2KT 4PJEE 5F9DC 3MCLL 1RFDL 3LIZL 1U8KB 5CJOH 2V2XA 1T4KA 2IBBA 5BVPH 1NCWH 4X5XA 3UTSB 1AR1D 4LEXL 4M03A 2NZIA 4KDVA 4NNYB 5DUBA 1UJTA 1BQSA 1IGCL 4HWBL 4UQ3B 3QHTC 1UXWA 1QBLH 4YPGB 3QDGB 2E6QA 2V7HA 3T4AB 4Y16B 2D2OA 5F1NB 5MEND 2O5XL 2YZ8A 4DOHE 4N0FB 2ICWA 2BNUA 3MOAL 1MJJB 4PJ9A 3PGFH 2DI9A 4LIQL 3UP1A 5J06A 2NTFB 1KCSH 5J9PA 1S7WB 3AREC 3SDDC 3U7WL 3GBMH 1ZA6A 2W0PA 4Z7NF 1I75A 4I2XB 1L7TH 1UZ8A 3QRGH 3S5LA 1R3LB 4L3CA 5KOMC 2OYPA 4WW1B 3H3KA 4RDQG 1FO0B 1N5AA 3FB5A 1JNHB 3RZCD 3LEYL 4PRPB 2XPGA 4ORGA 5IM7B 5I15H 2NNAA 4JREC 2WK2A 1CR9H 4MNQD 1A3RH 4LHJB 2MKWA 1HIML 3EKCA 1E4WL 1T7ZA 3FT2A 1CXKA 5DEZA 4NN7B 3MUGB 1AKJA 1U8OA 4Z7QF 1OARH 1I3RA 2A6IA 3X12A 5IB3A 1A6TA 3FQNB 3P4NA 5CBEB 4X6FA 4WHDA 4TNVF 2VZOA 4FQLL 3MRDA 1OCWL 4ODSL 4GAYA 2IGFL 4JPVL 4FZ8H 3QDAA 5GZOD 3K3QA 4XC1H 2CIIA 4MA3B 4YHOL 2ICWI 5C9JB 5DJCB 1BOGA 3OGCA 3QA3A 2YK1L 3UXFA 4FOMA 3EYQD 4MSWB 2VO5A 1LP9B 2F8VA 3BIBX 2Q8AH 1MCLA 4RMTA 3OKLA 4LU5H 4OLUH 5IMMA 1P1ZB 1KYOJ 2ZJSL 3RPKA 1BECA 1LEIB 2XIDA 1A6UL 3OKKA 1S78C 2JB6A 5IK3A 2OQJB 5D70L 4ODUA 4UINH 1HH9B 1HQRA 4X7TB 3NPZB 1PY4A 3BGMA 3L5IA 3U30C 5GJSL 5IROA 5HHNA 3I9GL 4OUUB 3RHWK 4MJ5A 2FEDD 2LAGB 1NCNA 5FKAB 3VGEA 3RGHA 1CFSA 4RGNE 3ARUA 3NBNA 2N4IA 2GT9A 4LLMB 4X4XB 5CSZA 1QSEA 4GH7B 3T77B 3NZ8A 2HKFH 3PF2A 5GS0D 3D25B 4GMSH 3MV01 4HV8A 4HUVB 4JFPB 4LLQB 3V7AE 4PY8I 3CH1B 25C8H 5LCVH 2D3VA 3L3KB 4APQB 1EFXA 2CGRH 4NO2A 1LE5B 2HAZA 4O02H 4TQEH 4D94A 3GNML 1F00I 1A6AB 4LHUD 2R0WH 4U1KA 5JW4N 5I75C 4MJIA 1TQBC 3KPPA 4WWKB 2VB5A 4JDTH 4EVNB 2DD8H 1TJIH 3LKQA 2PYEE 1ZT4A 1A6VH 2E27H 1MLBB 2DI8A 3KJ6L 4R26H 1X5GA 4U49A 2IWGA 4I0PD 3ARFB 5IEHA 2WIIB 4OT1H 5GRUH 3WDJA 3C5ZD 3DROA 5C09D 4G7VL 1SYVA 1I1AB 4Q9QH 3ZYIA 1H5BA 3MNVA 4KC3B 3L95B 4PBVC 3GJFA 2V2TA 3O9WD 4CBPA 3E2HC 1RULH 4ERSH 2DQJH 1H3VA 5TF1L 4AM0B 2KUTA 1T7XA 1VFAA 3Q6GH 3OQ3B 3ARWA 1IFHH 5EBWA 2WUCH 3VH8B 2OMNA 3BD5A 5HVGB 4RWYH 2R56H 4MNGA 3VDBA 1JRHI 3BD4A 1KNOB 2X4QA 2IAMA 5ILTH 5D93B 5CJQL 3FRUA 3IKKA 1T1ZB 4XAKE 3WN5C 4HLZH 5ID1B 1YEJL 3D0LA 4CU8A 1QOKA 4MB5A 4FABH 4FQCH 5KS9E 3O6ML 3UTQA 2C1OA 3QIWA 4YNYB 8CGTA 3UPCA 1L6XA 5HHMB 1A8JH 1R6VA 4LSDA 3RGVA 2ADIA 4G9FD 1G84A 2WP3O 4P2OD 4L4TA 4XXCC 4PJDE 3MRHB 3SE9L 3DSNA 5F1SA 1BQHB 1QLFA 1FL5B 1MY7A 3HB3C 4PP1D 5CIPB 4U1HB 4CADB 5J1AB 2JB5L 1WAAE 4QNPE 5IG7A 1WSST 4RA3A 1U3YA 1IAMA 1Q8MA 2F53A 5DMIH 2B2XL 4NWTH 5JQ6H 2QSQA 2ZSWB 4QRPE 4WDIA 4A6YB 3MV8B 2PUQT 4M7JH 2FD6L 4P2QE 3NFNB 2WBJD 2JELH 1FL3A 3IDIB 5L6YH 3X3FH 5JW5B 3GSVB 2FHFA 4F33B 3MLSL 3BHBA 1R24A 4K71B 3G6DH 3V0VB 1SEBB 1OAXL 3LKNB 4JO3L 4E0RA 3V4UL 1X6NA 1BVKA 3BD3A 1UCBH 4WEMB 2BMKA 4OGZA 2BY0A 1JUFA 3EJJX 4G43B 3SBWC 4DGVH 4WFHD 2HVKB 4UBDD 4BUHA 4ZUSA 4O2EB 5HGBB 4MDIB 2DL2A 4F80A 5GS1B 5HHPB 3U9UA 2Z8VC 5FYJL 5I0DA 1EMTH 1OSPL 2CR3A 3FFDB 1P84K 3BUYB 2CDFB 4UDTA 4ZUUB 4LCWB 3LS4L 4QO1A 4KJQD 3ARQA 5L2KB 3GJEA 5CP7B 1CFQA 5GRVK 1YDPA 2DQDL 3KXFD 4ZXBD 3OR7A 3ULSB 1XGTB 2VDQL 3SE8H 3E1F1 1QLRB 5SX5H 3ZKXC 3V0AC 1T0MB 3ULUE 4ONHA 2DDQL 2FR4A 3OKDA 3RL2A 3HI1A 2X7LA 3T4YA 5FDWA 3NCEB 4YAQA 3V52L 4PJ5E 4ELKB 5C0JB 3WSQH 5I30H 4JLRB 4HH9B 4NQSA 2YPKA 1VA9A 4PJXB 2YN3A 2W0FA 3N9GH 4P4KC 3FT3B 4Y19E 5J6HB 1KC5L 2BHZA 5D2LA 1IC5H 2C7UB 5DQ9B 1M7DA 1UFUA 3CZFA 5CHNA 2WAHA 3HZYB 2C4FT 4NC2B 4XRCA 4BA8A 1VCAA 2OX5A 4JY5H 4OZIB 4ZPVB 3RDTC 2O93L 32C2A 4S1RH 2EO9A 1OAYL 3IJSB 4F7EA 3HE6C 4R97B 2DLTA 4GUPA 3RZWA 4WCYH 1SJHB 4KK9D 4OZGF 4LAJH 1DEEB 5I1CL 5D8JL 4BZ1L 3P30H 4XWGH 3ZKMD 3VFGH 4C56D 2AXJA 1XCTB 3J7HA 1KB9K 4Z76A 1YYML 3JV0A 3VFSB 3K2UL 1NAMH 3RUGE 4NUGL 1KBGH 1IM9A 3ARZA 1XIWB 1LEGA 4IRJC 4AEIL 3EO9L 2VNCA 2X4PB 4L8SB 1IAOA 4I1NB 4HS3B 4HHAB 4Z7VF 5C9JA 3C6SA 4YIQA 4X9BA 4JO4L 4QLRA 4YC2B 2BK8A 3SGDI 1EVUA 4P4RB 4QY8A 2GTWB 4YEFA 1C08A 4MHHI 2QKIA 4GRWB 3T2NH 4LARH 3S88H 5HHOE 5TFSL 1CFTA 4HGKC 3BP4A 1IGJB 2OSLA 2A9MH 3VXRE 1N64L 1IL1A 1MAML 5I8CB 3IDXL 1C16B 3U0TB 4XNQA 4YBLB 1FE8H 3A6CH 3T0EE 2Z8SA 4HIHB 3DIFB 5GS3A 4MXVF 4UT7L 4XI5C 3RX7A 1Z5LB 3F6LA 4JHZA 1MFEH 3HC4L 1MIML 1UWXK 2IEPA 1QBMH 1ZKAA 2Y23A 4WO4A 3JV5A 5CZKA 1MUJB 4XPTH 3W39B 2VISA 1YEKL 1UG9A 3S4SA 4IHOA 3L3JB 4J3VA 3RNKA 4RAUB 4H88H 4O58H 5J0BA 2H32H 3IDJA 3UROR 3SDCC 4O2CA 3TZVA 1JNNL 4YE4L 2WMPA 1L9NA 2XA8H 3GB7B 5T3XD 1YN6B 3DTXB 4KKAC 2YMXH 4KQ3H 3SO3B 1X4XA 5FOBA 1BF8A 1BVLB 1J9CT 2CIKB 2UUDH 5I1LB 3BGFB 5F71A 2QR0A 2A73B 4AMKH 5DRWB 2ESVD 3BP6B 1FCGA 4XHJC 5MP6H 1OP5H 1N8ZB 5KANI 1N0XH 1GHFL 3FO9B 1XF2B 4QRUA 1P2CA 2BVPA 2F5BH 4R2GC 5E2WL 1JI1A 4NRXB 1YECL 3FN9A 5BZDA 5MENE 5I6XC 2IH1A 2Y36H 4G6AD 3TPKA 1INQA 4K8RL 1KELL 1I8MB 2ZCLL 1MWAA 5F7LB 3H9SB 1DQTA 1JPTL 1JE6A 1BD2D 5JXEA 1XGQA 5F1IB 4BQ8A 3EGSB 2AKRB 4NO0A 4P49A 5IIEA 2ZKHL 1TVBB 4WI7A 4MCZA 2EXWC 1A7OL 2VUOA 2MCG1 3CFKA 4MNQE 5HDBF 1V5JA 3QXUA 2IPTL 1G7IB 2NY2C 2PXYB 2VITA 1NSNH 4AENB 3X11A 1OM3L 4ODTH 1D5IH 5ID1A 4S1QH 3VI4F 4PBXA 1NCUA 1I7UA 3V8CA 1GZPB 3CD4A 5FHAH 5KSAC 1JTTA 5F1KC 2GTZB 3H9ZA 4TOYL 3L5JA 2ZSVA 1HN1A 5JDSB 4JG1H 2VAAA 3RIAK 1LDPL 5GSRB 2DM2A 3CK0H 1RUMH 3G6JB 4XPFL 5TE7L 1UH3A 3W9EB 3G5VB 5DC0A 1S7XA 1A7BA 3VH8G 2VLJB 4XZUA 5DZLA 3C2AL 2PYEA 3EYFA 1KT2B 5GZNC 1KJMA 1EBAA 4NM4H 5D7JD 4MMZC 2H1PH 4GG8B 1G9EA 1DLFH 3AC0A 5D1ZC 5IMKB 3C6LA 4HULB 1DQJB 4F9PA 3NFNA 1JRHL 5B39A 2UYLA 2C3GA 4QXGH 4Y4FC 4J3XA 5JNYA 4HC1A 4L3EB 3QDGD 5ECJE 1GGCH 1T3FB 1JPST 4ONFH 3ILPB 1U41A 3GI8L 3UMTA 1GVIA 3CX5J 2IANB 4U1NA 3VFVB 4G3YL 5FF6A 5HGHB 5F3HA 1KB5L 5I9QB 3DURA 1BQHG 4G80A 5LBSL 5EZLA 1MRDH 2NY6C 2GJZA 4YXKH 5I1IH 4XNMB 3NGBC 1D3CA 3MOQA 4DVRL 5IMLB 1T0NB 4HMDA 2HT3D 5EFIA 5LKNA 3GIVA 4XCCL 4MD5B 3JWOL 3VD5A 5FDYA 5BVJB 5KS9A 4QWWD 1IQWH 2KPNA 1NAKH 1CDCA 3QFJB 5AYUL 2DWEB 5KJRH 3MRJB 2BX5A 1CT8A 3P11L 4HSQA 4PJDA 4PLJD 5T1MA 4D8PB 5J11B 5F9OL 4Y5VA 1TZGL 1J88A 3ARDB 5B8CA 1EEZA 4N0RA 4XCFL 4AQOA 5CFHA 3MRNB 4PJGF 1WAAA 1SQ2N 1DQDL 1DN0A 4GKSA 4X4ZA 5E6IA 1K6QH 4U31A 3G6AB 3P77B 3UO1H 5IJKC 1NGPH 2QADB 4QRPA 5FECA 1KCVL 4UILH 4P2QA 4MAYD 3H8NA 5FO8B 1OD7A 4GMTL 1QSVA 3MYJB 3RAJL 2OK0L 5C09E 1JPFB 4POZD 1R5WB 2V5YA 2DI7A 2NY1C 3LDBB 1CLCA 4L5FL 4EQ2A 4NWUL 1H8NA 5HHXL 4XVSL 6FABH 5E8NB 2A38A 1HINL 2DS4A 5E4IA 4TN9A 4MNHB 5E0QA 4JFOA 3G9AB 4PG2A 2NR6C 3BH8A 4X9GA 1ZAGA 3IYLW 5E6YA 3BPCB 1JIBA 4LNRB 1T21A 4XPHH 3JWOC 2OL3H 4NSKB 4PGBB 1ZANL 4U7MA 1G7MB 1HE7A 4JM2A 2Q7NA 2VLLA 1Q9OA 2G60H 2EDJA 3HE7B 1BAFL 1YJDH 4G9FE 1ORSA 3TA3A 3P4OB 2UVFA 2I24N 4RZCB 5D72L 2HFEA 4KZEL 4PJ5A 5HDLA 3V7MA 1DJSA 3OSKA 3GMNA 4Y19A 5ALCL 4CJ0A 3Q1SH 3OKMB 1A47A 3O3AB 1FYTD 3RI5F 2UWEB 3CCHA 4IS6A 5I19H 2WQRA 3I6KA 3RX5A 4DCQA 4NCC1 1A9EA 4G5ZL 1T1YB 1KLUB 1U8NA 2V9QA 4LSPH 3JWNC 1ED3A 2FDBP 4I3RH 3VRLF 1H15A 2IH3A 3MA9H 1AGCB 3I02B 3V5HA 1TCRB 4M6NL 1QYGL 1OF2B 1FVDA 4WFHE 5H37G 2BY3A 4F7CA 1NGWA 1TMCB 3DX6B 2JIXB 4EN3B 4MA1C 2A74A 5HYQB 5FEBA 3ZHDA 3RUGA 2X9WA 4OZFH 1D5MA 5HYJB 2VLRB 1LO4L 1DQML 3CMOH 2NY0D 1WIUA 4O2FB 1AD9A 5ICYA 4Y1AB 3KXFE 4WHYG 2EXYD 1HSAA 5I0ZA 3GK8L 3VWKB 3WV0A 2VDNL 5E4EC 1UJ3B 4ZOCA 3U2SB 4YBHA 4YWGL 2JKXA 4F3FB 5K9KA 2WLZA 1GAFH 3NAAH 4R9HA 2YOCA 5F96H 5HGGS 3BW9B 1DANT 4NO5A 3W11C 4ELMB 2DF3A 5HHOA 1UKQA 2FJHB 3C8DA 3HCVB 3IJYA 5GISL 3VXRA 4L8CB 5IBLD 3JV4B 5HHMD 3CC5B 4FQPA 2Y5TB 5DHVH 4E5XB 3PNWB 4ODWA 4FFYH 1XGPA 5C08B 3T0EA 4NZUL 4PY7A 1H8SA 3MLUL 3B2VL 2YN5A 5FO9B 1BZ7A 2ITCB 1NGQL 3U4BH 3JTSB 4I77L 4Z9KB 1KLFA 4U0RB 3EJYD 2A6JA 2IPKB 4HDIA 3RIFF 4ZFOB 4OFIA 2HJKA 4OF3A 1ZXQA 4KPHL 2AJSL 4ZS7L 2D31B 1U8QB 4HMEA 2CXGA 3UTTD 3VFNA 2EE3A 3AB0B 5D96C 5ENWB 2VDRH 3HMWL 4TSCH 1JCKA 3FN3A 3O3EB 3UYOD 1IEAB 3G08A 4C56E 2IQ9L 3DVIA 1A7QH 3BPLC 5E2JA 5E8EB 1KCLA 3L3GB 2BDNH 1H9VA 1ZSDA 3RTQB 1I8KA 2CJUL 4S2SB 1AGFB 2CRIA 5T33H 1QFUH 4FQQB 3ZDXE 3HFMH 4Q6IA 1FZKA 2HLFC 2RGSA 3P9LA 2VDKH 4N9GA 2R29H 3G04B 4HJGA 1U8MA 4KV5F 1WV7T 5HBBA 4OJFH 1V3JA 5A2LH 2CDEA 3TFKC 5AZ2L 3WFDH 2RCSL 2DQUL 4K2UH 4X98B 4HUKB 1MCPL 1DQQA 2BP3A 4FQJL 4YH6A 1HILB 4Y8DC 1CBVH 3D39B 1T5WB 3IAQA 1T2JA 5EO9A 5JXAL 3LRHA 1ND0A 3CLFH 1JWSB 2CR6A 2BVQB 4HZLB 2ZG1A 5DA0B 4RRPG 1MHCA 4YO0B 5E2VH 5LWYL 4YHKL 1A2YB 4OKDA 3ZE1F 1LK3L 2DTML 3VFPB 2DKMA 4I18C 3RWDA 3RZCA 4KK6D 2PETA 4XX1G 3FL7A 4NDMA 3BP5B 2DLHA 3C09B 1A7NH 1RMFL 3C8HA 4MNQA 4UZGA 4YDVB 1A14L 2Z31D 4CN1A 4O9HL 1C1EH 2K9UA 3K46A 5ITBH 4XVUC 3BMVA 4EOWL 3MODH 4M4PA 3MGOA 2P4AB 3OHXA 3NMEA 3B9KA 2AJXH 3WUWB 5J6GB 1YPZE 1JGDA 2IF7A 4WI8A 3MUY1 1T04B 3VXMA 5DD6A 5T3XE 1PKQB 3QXDA 2VXSL 5E8PA 1MWAL 4LLYB 2OZ4A 1IGML 1J0HA 4Y7MA 4ODVL 4N8VA 1GIGL 2R1XB 2LAAA 3JUYA 2F9BT 3QXAA 3T0AA 2XZCL 3F5WB 4GAJL 1CF8H 4H25B 2ESVE 1CLZL 1Q9WA 1QEWB 2K7QA 1NC4D 5EB9A 3BH9B 1FVCA 4R7DA 2XFXB 3O8XB 3P9MA 1MCBA 1IAII 2R4RL 2PR4H 1HWGB 3O2DA 1BJ8A 2AI0H 3LB6D 1KCKA 2F8OA 3FO2A 5DD3H 4YDKH 4RFNC 1JGEB 4QGYA 5ADPL 1RJYB 1BFTA 2WQ8A 2AEQH 3LQAC 1ORQA 1NFDB 4CDGC 3MACH 4H20H 4JN1H 2EYRB 4B41A 3L5WA 4S1SL 1B0WA 1BD2E 4Z7UE 5ERWA 4NN6C 4EJ1C 1QQDB 4NQDB 5KVMC 1KUMA 1DBAL 1ADQH 5T1LD 4Z7NE 4HKBB 3MJ9A 4UAOC 5F6HI 4P9HC 5EN2A 2GK2A 1JGVH 2OTUB 5GQBA 3MRKB 3DHMA 4XNXL 1W0YT 1MI5D 1XF1A 5E9DB 1FGVH 5IVZB 1T89A 2VQ1B 1J0KA 2D7MA 3KPNB 3E0GA 5DUPL 4XNZC 2GITB 5INCA 4U6XB 4IMLB 2RFXA 5GGRB 3IF1B 1DVFB 2ADJA 4G8EB 4HC1L 5JMRA 4GRLD 2C3WA 4Z7QE 1WWBX 4ZOBA 5GRXG 1WGOA 4LHUA 3AGVA 1NBYB 4NCDA 5DRXB 5IHBA 1ITCA 5GGSY 2R1WB 5E8DL 3SN6N 3NCFB 4X6EB 1AC6A 1MRCL 2QHRL 4JFEB 1O0VA 4O4YH 3S8WA 1F11B 1OW0A 3RX8A 2O5YH 3RWEA 3V0WL 2AV1A 4I0PA 2DN7A 4AL8H 1C12B 1XF4B 1ZLVH 5B3JF 3C5ZA 3WE6B 2XG4A 4LP4A 4U6HA 5C09A 1SHMA 4U2ZA 2BNQD 1JZ8A 4DKEH 3OXRA 4PB9L 2G9HA 2YC1A 2VMFA 1MSPA 1T7YA 4GLRI 3O9WA 3QDGE 1KCUL 3TCXA 4MDJA 1KJVB 3QIBB 1SJEB 5F89B 1MFAL 1AGCA 3CJJA 1J8KA 2OS7A 3PIQA 2R9HC 1FN4B 4Q9BA 1AE6H 1HHJB 2HRLA 1XMWA 2I9LB 3VG9B 4TUJA 5KSVA 1KPVA 3VXUD 4YHZL 4HLJA 1FQ9C 4J1UB 3BDYL 3H9SD 3KAAA 1KFAL 2G5BA 3QO1B 2DLEA 5GGTH 2A6DA 1NDMB 3I3BA 5EU7E 2BCKA 2B0SH 2BSRA 1HXYA 2FLRT 2NYYC 1ZWIB 3U6RB 4YHMH 4PRHB 5DURD 2HJLA 4BSVB 4G9FA 4HS8L 5IWLC 3SKNA 4L8BB 4P2OA 3KPQB 3IVKA 1UXSA 1TETL 2X4UA 5C0NC 1SVCP 1EGJA 2EZ0C 1T6VN 3VGDA 4HUUB 1I9RH 3STZB 4CAGA 4ODXB 3F58L 4M6ML 1VKXB 4RNRA 3VFMA 4WUUB 4A2LA 1F8TL 4CMMB 2ERJC 2WBJA 1FFPB 2ZCKL 2R0ZH 2BNRB 5E1HB 3P9WB 4Y5YC 3D3VD 2Y6SD 4GOSA 1X5XA 4MJ6B 3L9RA 5DTFA 2EE6A 1ZS8B 1FL6A 3ULUL 4OIAA 1BFOB 3P0YL 2W9DH 3TYFA 2R8SL 1S8DA 4NRYB 2VDLL 3UAJD 1FNSL 4NOFA 5D1QC 1EUUA 2V5RA 3A6BL 4BELD 5C2UB 1EEYB 3ULVH 3FQWA 2B1AL 1W72B 2DLIA 2ZUWA 3Q5TA 4IJ3C 1G9MC 3IFNL 1K85A 2VJXA 4YZFF 3V5DA 4JFXB 5CLWA 3LEVH 4XT1C 1RUQL 3QB7C 1RFDH 3LIZH 4X6CB 5D6DA 3WFZA 5KVEH 1B4RA 2ATKA 3KXFA 5FGBC 4ZXBA 2C5DC 5FOJA 1RUAH 2A6KB 2ZNXA 4MX7B 3DX7B 1XH3B 5F1OB 1IGCH 2K1MA 4MS8D 3B2UD 4GFTB 4ZNEA 4NZDA 2ZPKH 4X99B 5DD1L 3N1FC 2V7NA 2YHGA 3IFOA 2X05A 3MOAH 1I85C 3Q6FA 1MVUB 2DB8A 3GSUB 4QXTA 1K3ZA 4LIQH 1CGSH 4KKNA 1FYTE 4U05A 3VRJB 3LMJH 3U7WH 3MLRH 5EBLA 4XP6L 4NBZB 4D9LL 3MREB 3A6OA 3QAZC 3VRIB 2WZPD 1NGZA 1MCOL 4BSWA 4KJYA 4R4ND 2MKLC 1LO5B 2C3VA 3LEYH 4XXDB 1MCDA 1KF9B 2YXFA 4BJLA 3I84A 3T09A 4OD2B 3VD4A 3L3HA 4FXGB 1DFBL 2A0LD 3LSOA 4Q97A 1HIMH 3CVHL 1KTKE 12E8H 1YY8B 2EDRA 2BSTA 2P47B 3NPSC 4FTVB 4LF3B 4QTHA 2UY6A 1FFRA 4H8WL 4K3JL 1IC7L 3HR6A 4C56A 4OBSA 1UM4H 3EDJA 4KROC 1BQLL 4OIIL 3B9VA 2APBA 5IESL 1YMMD 3QCUL 3REWB 1KLGA 2Q6WB 3PDOB 2P8MB 2ITDA 4AG4H 2BOBA 4FQLH 4K07A 3MV9B 4XMPL 4ODSH 5IOPA 4JPVH 1UVQA 1J0YA 1MCWM 4X6CF 4Z7WB 5AG9A 4GQ9L 4BZ2L 1UEYA 4OCYH 4YHOH 2QQKL 2GCYB 4U2YA 1ROWA 5IB1A 2DQEH 5CKGA 3K1KC 3GBLA 1OB1A 1XR8B 4JB9L 1T1WB 2CH8A 3M8OL 3QWRD 1LK2B 5CCKL 1OAZL 3JVGC 5TGBA 4XMKH 5CAYB 2E7LA 1MIEL 5AWNL 1A6UH 3U36A 2D7TL 4I48B 4PRNB 3U0PB 1DE4B 1U3JA 3RWJA 3WUWG 3FZUD 5HHME 3DYMA 4UT6L 4C59B 1HI6A 1HSBA 2FIRT 2N1KA 3LS5L 4HK0B 1P7KB 4WW2C 3L3OA 1QA9B 5D2NE 3I9GH 3BQUC 2BVOA 4KK5C 4M1GL 2R4SL 4OUOA 1C5BL 4EQ3A 5EU4A 3BKYH 5FA3B 3QR2A 3VXTA 5SWZB 3RWGB 1B2WL 2ICWJ 2MHAA 3C60D 3V2AR 4WI6A 4XNUL 3UTTE 3OKEA 4P57A 4H8WC 1WVZA 1QVOA 4LLVA 5C0BA 1NAMB 3O3BB 4X0KB 1GGUA 3FO0L 3X13A 1YPZA 4HPYH 2H2PC 4OZGE 5K93A 3OX8A 5KVGL 4GAGL 1PKOA 1WCQA 1XEDA 3E3QC 5D6CA 5T3ZH 3S96A 4PJAE 3CX2A 4KKLC 5KSUA 5I66B 1IAIL 2XNAB 5DLML 3TJEL 4XVTL 4DFHA 4L9LB 4LASL 4NO3B 3PHOB 4U6VL 3GMOA 2ESVA 3GEWB 5EIIB 5LJYH 3KPRB 4Z7WF 3GRWA 3MRGB 2PW2B 1G7HB 4OF6A 4F2MA 2F74A 4LSUL 1KXQE 3KJ6H 3QISA 5J13B 1J8HD 3HKFA 4Z7VE 1B4JL 3SCMC 5IJVA 1JNLL 3D0VB 3IS1X 1SY6A 3VWKD 4G6KL 4U7SA 5IV2B 5DK3A 2IALA 2OZ4L 4PY8J 3KLHC 1BD2A 3CSYB 4Z7UA 4PRID 3R1GL 4PTTB 2D4FA 1Q72L 2WWKO 5TF1H 5ESQB 1AGEB 1XZ0B 3EYUL 4HJ0D 5SWSD 5H35B 4JZOB 3DPBA 3DV4A 1WC7A 2H32B 5F93C 3MLVL 4EUPB 1B0RB 4CRPA 2XYCA 3O2DL 5DS8B 3I2CL 5HI3D 3IU3B 1YEJH 4GS7C 3KS0H 2XV6B 2WUBL 3WLWC 1JNJA 3DYOA 5ESAB 3O45B 1S7SA 4N9OB 4NZTH 4DN4L 3OB0K 4L8DA 2HT2C 3VXNB 2F54B 1AJ7L 2XN9D 4PJ8B 3OJDA 5DMGC 3SE9H 3KJ4B 4HIXL 3MUZ1 3MJ9L 3MGTA 4HFUH 1DBJH 1YUHA 3QUZD 2JB5H 4IBLT 5DJ8B 1INEL 5EBMB 4LCCC 5GS0L 3PDDA 1MH5A 5D7JA 3CMGA 4G8IB 3J8F7 4P5TB 2CLZA 2WINA 4W4OA 4BH7B 2F8XC 3C5JB 4Y2DC 2ARWA 4KK8C 4EI5D 4FFVC 3MLSH 4K3GA 5EUOB 4NQXB 2J6EA 1I8LC 2LU3A 5IFJB 5H2BB 4U3HA 4JO3H 1AHWC 4IOIA 3V4UH 4XVJL 3BPNC 15C8H 1K4CB 2DBJA 4YHPA 1XFPA 2P5ED 1M7IB 2X70B 1QPXA 3D39D 3O4OB 2X89A 2YBRB 4KTDL 3FAWA 3LD8C 2DMKA 3MRQB 4UQ2B 1MI5E 4OLYL 3MJ7A 4GXUN 2YA0A 1KEMH 2HA1A 1T2XA 1CXHA 3UTZA 2ARJQ 3TT3L 3LS4H 3SGEI 3MRCA 4TVPD 3KNBA 5HDBE 1KIUA 1G7JA 2XWTA 2P5WB 3GKWL 4EEEA 1F3JA 3NCJH 2VDQH 3NIFE 2D7PA 1A5FH 2FJFB 2VDML 1TPXC 2DDQH 4Q0XL 2FEDC 4JRYD 1U58B 3BIKB 4AIZB 5E99L 2BSED 1R5IA 3O81A 1CFVH 4UV7L 1GGYA 2JTDA 4L4VB 3AS3A 4KRNA 5E56A 1AD0B 4HLZG 1ZA3A 5MI0B 1KEGL 4H26B 3SDDD 3TN0B 1KC5H 2BVTA 2LU4A 4MAYA 1NMCB 3EDFA 5TPWL 2XTJB 4WV1C 3SGJC 2DQTL 2J4WL 1NUFA 3OG6B 4N5EC 2BNQE 1XGRA 2Q87A 5E2UL 5ETUB 3R0NA 4JO1L 3V9FA 3CFDB 4X4YA 2XZAL 5CD3B 5GGSB 2GJ6D 5JO5B 3MR9A 1U8JB 1P7QB 1YN7B 2YKLH 4CNIA 3LQZB 1EGJL 2JLLA 3C8KB 3FONB 1NLDL 5D8JH 5GIRB 5I1CH 2FHBA 4MD0B 4GBXC 4G6FD 1MHEB 3SDXB 5BV7L 4F7PB 3MLTA 2FZ3B 2XKUA 3GSWA 1I7ZA 4BK4A 1J0JA 2G2RB 1VADB 3PL6B 1I1YB 3VXUE 1YYMH 1P9MC 4AQ1B 3K2UH 1D6EB 1TZHA 3H9SE 1HKLL 4PB0H 1OP5K 1HQ4A 4NUGH 5ISZA 4NKIL 1UB5B 4GKNB 5D7KD 2ENYA 1Z9MA 4CVUA 3EOBB 1M7XA 4AEIH 1P4LB 4OLZL 4WU7A 4HIEA 4PGZA 3EO9H 2E9WA 3LKSA 3L3DB 1HDMB 4OQTA 4JFFD 5EZOH 4DZBB 1UCTA 3KPSD 1Q0XL 2EH7H 2CSPA 4JZJB