2CRSA

Cardiotoxin iii from taiwan cobra (naja naja atra) determination of structure in solution and comparison with short neurotoxins
Total Genus 5
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
5
sequence length
60
structure length
60
Chain Sequence
LKCNKLVPLFYKTCPAGKNLCYKMFMVATPKVPVKRGCIDVCPKSSLLVKYVCCNTDRCN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cardiotoxin III from the Taiwan cobra (Naja naja atra). Determination of structure in solution and comparison with short neurotoxins.
pubmed doi rcsb
source organism Naja atra
molecule tags Cardiotoxin
molecule keywords CARDIOTOXIN III
total genus 5
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1994-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2crsA00
5DO6A 1CCQA 2BHIA 2UWRA 1HAAA 1CXNA 1I02A 3NH7A 4ZQYA 3ERAA 1W6BA 2K3GA 1JE9A 1BTEA 1KU6B 1FF4A 1ERGA 1JBDA 1LXHA 4IYEA 1QM7A 2MFAA 4P7UA 1KC4A 1IQ9A 3BT1U 1F8UB 2I9BE 1M9ZA 1NXBA 1REWC 1FSCA 1NTNA 3VTSA 1S4YA 2MUOA 4DO8A 2ERAA 2H7ZB 4OM4A 1LX5B 2CTXA 2MJ0A 1FRAA 2GOOC 3NEQA 1TFSA 2H7ZA 1TXBA 1F94A 1B41B 3U73U 2MJYA 1G6MA 4HQPF 1NORA 2HLRA 2BTXA 1RL5A 1IDGA 1CHVS 2L03A 1KXIA 2CCXA 1IDLA 1NEAA 1YWHA 1KBAA 1RGJA 4FAOC 1FFJA 1QKEA 1IK8A 1HOYA 1CTXA 1HC9B 1CDTA 4LFTA 1QKDA 1CDSA 2H5FA 1LJZA 1BXPA 1IJCA 1XT3A 1HAJA 3U74U 1TGXA 3PLCA 1CB9A 2JQPA 2H64B 1ONJA 1V6PA 1KTZB 1CDRA 2CDXA 2MJ4A 2OFSA 1MAHF 1ERAA 1COEA 1NTXA 1H0JA 2QJAC 1CVOA 1KL8A 2H64C 1CXOA 1IDHA 2ABXA 2NBTA 4BDTB 1CRFA 3LAQU 2GOOB 1FSSB 1ZADA 3BT2U 1ABTA 4EY8B 1CREA 5DU1A 1HC9A 2QJ9C 5IMYC 2LA1A 1KBTA 1FASA 3FEVA 1VB0A 1MR6A 1CODA 2QC1A 1KBSA 3KFDE 1CDQA 2PJYC 3NDSA 1UG4A 2MHYA 4AEAA 1L4WA 2CRTA 1KFHA 2L5SA 2MUPA 2PJYB 2HLQA 1ES7B 2H62D 2X8BB 2H62C 1IDIA 5IMTD 1IKCA 2H8UA 3EBXA 4OM5A 2JVEA 4RUDA 5EBXA 2VLWA 1KS6A 1JGKA 3HH7A 4XJJA 3QB4B 1TXAA 2CRSA 2FD6U 2QJBC 1LSIA 1PLOA 1LXGA 2N99A 2UX2A 1DRSA 5DZ5A 3KFDI 4QTIU 3EVSC 4UY2C 2J8BA 4BIKB 4FAOE 1NYUA 6EBXA 2LCRA 1NYSA
chains in the Genus database with same CATH superfamily
5DO6A 1CCQA 2BHIA 2UWRA 1HAAA 1CXNA 1I02A 3NH7A 4ZQYA 3ERAA 1W6BA 2K3GA 1JE9A 1BTEA 1KU6B 1FF4A 1ERGA 1JBDA 1LXHA 4IYEA 1QM7A 2MFAA 4P7UA 1KC4A 1IQ9A 3BT1U 1F8UB 2I9BE 1M9ZA 1NXBA 4KSNA 1REWC 1FSCA 1NTNA 3VTSA 1S4YA 2MUOA 4DO8A 2ERAA 2H7ZB 4OM4A 1LX5B 2CTXA 2MJ0A 1FRAA 2GOOC 3NEQA 1TFSA 2H7ZA 1TXBA 1F94A 1B41B 3U73U 2MJYA 1G6MA 4HQPF 1NORA 2HLRA 2BTXA 1RL5A 1IDGA 1CHVS 2L03A 1KXIA 2CCXA 1IDLA 1NEAA 1YWHA 1KBAA 1RGJA 4FAOC 1FFJA 1QKEA 1IK8A 1HOYA 1CTXA 1HC9B 1CDTA 4LFTA 1QKDA 1CDSA 2H5FA 1LJZA 1BXPA 1IJCA 1XT3A 1HAJA 3U74U 1TGXA 3PLCA 1CB9A 2JQPA 2H64B 1ONJA 1V6PA 1KTZB 1CDRA 2CDXA 2MJ4A 2OFSA 1MAHF 1ERAA 1COEA 1NTXA 1H0JA 2QJAC 1CVOA 1KL8A 2H64C 1CXOA 1IDHA 2ABXA 2NBTA 4BDTB 1CRFA 3LAQU 2GOOB 1FSSB 1ZADA 3BT2U 1ABTA 4EY8B 1CREA 5DU1A 1HC9A 2QJ9C 5IMYC 2LA1A 1KBTA 1FASA 3FEVA 1VB0A 1MR6A 1CODA 2QC1A 1KBSA 3KFDE 1CDQA 2PJYC 3NDSA 1UG4A 2MHYA 4AEAA 1L4WA 2CRTA 1KFHA 2L5SA 2MUPA 2PJYB 2HLQA 1ES7B 2H62D 2X8BB 2H62C 1IDIA 5IMTD 1IKCA 2H8UA 3EBXA 4OM5A 2JVEA 4RUDA 5EBXA 2VLWA 1KS6A 1JGKA 3HH7A 4XJJA 3QB4B 1TXAA 2CRSA 2FD6U 2QJBC 1LSIA 1PLOA 1LXGA 2N99A 2UX2A 1DRSA 5DZ5A 3KFDI 4QTIU 3EVSC 4UY2C 2J8BA 4BIKB 4FAOE 1NYUA 6EBXA 2LCRA 1NYSA
chains in the Genus database with same CATH topology
5DO6A 1CCQA 2BHIA 2UWRA 1HAAA 1CXNA 1I02A 3NH7A 4ZQYA 3ERAA 1W6BA 2K3GA 1JE9A 1BTEA 1KU6B 1FF4A 1ERGA 1JBDA 1LXHA 4IYEA 1QM7A 2MFAA 4P7UA 1KC4A 1IQ9A 3BT1U 1F8UB 2I9BE 1M9ZA 1NXBA 4KSNA 1REWC 1FSCA 1NTNA 3VTSA 1S4YA 2MUOA 4DO8A 2ERAA 2H7ZB 4OM4A 1LX5B 2CTXA 2MJ0A 1FRAA 2GOOC 3NEQA 1TFSA 2H7ZA 1TXBA 1F94A 1B41B 3U73U 2MJYA 1G6MA 4HQPF 1NORA 2HLRA 2BTXA 1RL5A 1IDGA 1CHVS 2L03A 1KXIA 2CCXA 1IDLA 1NEAA 1YWHA 1KBAA 1RGJA 4FAOC 1FFJA 1QKEA 1IK8A 1HOYA 1CTXA 1HC9B 1CDTA 4LFTA 1QKDA 1CDSA 2H5FA 1LJZA 1BXPA 1IJCA 1XT3A 1HAJA 3U74U 1TGXA 3PLCA 1CB9A 2JQPA 2H64B 1ONJA 1V6PA 1KTZB 1CDRA 2CDXA 2MJ4A 2OFSA 1MAHF 1ERAA 1COEA 1NTXA 1H0JA 2QJAC 1CVOA 1KL8A 2H64C 1CXOA 1IDHA 2ABXA 2NBTA 4BDTB 1CRFA 3LAQU 2GOOB 1FSSB 1ZADA 3BT2U 1ABTA 4EY8B 1CREA 5DU1A 1HC9A 2QJ9C 5IMYC 2LA1A 1KBTA 1FASA 3FEVA 1VB0A 1MR6A 1CODA 2QC1A 1KBSA 3KFDE 1CDQA 2PJYC 3NDSA 1UG4A 2MHYA 4AEAA 1L4WA 2CRTA 1KFHA 2L5SA 2MUPA 2PJYB 2HLQA 1ES7B 2H62D 2X8BB 2H62C 1IDIA 5IMTD 1IKCA 2H8UA 3EBXA 4OM5A 2JVEA 4RUDA 5EBXA 2VLWA 1KS6A 1JGKA 3HH7A 4XJJA 3QB4B 1TXAA 2CRSA 2FD6U 2QJBC 1LSIA 1PLOA 1LXGA 2N99A 2UX2A 1DRSA 5DZ5A 3KFDI 4QTIU 3EVSC 4UY2C 2J8BA 4BIKB 4FAOE 1NYUA 6EBXA 2LCRA 1NYSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5DO6 A;  1CCQ A;  2BHI A;  2UWR A;  1HAA A;  1CXN A;  1I02 A;  3NH7 A;  4ZQY A;  3ERA A;  1W6B A;  2K3G A;  1JE9 A;  1BTE A;  1KU6 B;  1FF4 A;  1ERG A;  1JBD A;  1LXH A;  4IYE A;  1QM7 A;  2MFA A;  4P7U A;  1KC4 A;  1IQ9 A;  3BT1 U;  1F8U B;  2I9B E;  1M9Z A;  1NXB A;  1REW C;  1FSC A;  1NTN A;  3VTS A;  1S4Y A;  2MUO A;  4DO8 A;  2ERA A;  2H7Z B;  4OM4 A;  1LX5 B;  2CTX A;  2MJ0 A;  1FRA A;  2GOO C;  3NEQ A;  1TFS A;  2H7Z A;  1TXB A;  1F94 A;  1B41 B;  3U73 U;  2MJY A;  1G6M A;  4HQP F;  1NOR A;  2HLR A;  2BTX A;  1RL5 A;  1IDG A;  1CHV S;  2L03 A;  1KXI A;  2CCX A;  1IDL A;  1NEA A;  1YWH A;  1KBA A;  1RGJ A;  4FAO C;  1FFJ A;  1QKE A;  1IK8 A;  1HOY A;  1CTX A;  1HC9 B;  1CDT A;  4LFT A;  1QKD A;  1CDS A;  2H5F A;  1LJZ A;  1BXP A;  1IJC A;  1XT3 A;  1HAJ A;  3U74 U;  1TGX A;  3PLC A;  1CB9 A;  2JQP A;  2H64 B;  1ONJ A;  1V6P A;  1KTZ B;  1CDR A;  2CDX A;  2MJ4 A;  2OFS A;  1MAH F;  1ERA A;  1COE A;  1NTX A;  1H0J A;  2QJA C;  1CVO A;  1KL8 A;  2H64 C;  1CXO A;  1IDH A;  2ABX A;  2NBT A;  4BDT B;  1CRF A;  3LAQ U;  2GOO B;  1FSS B;  1ZAD A;  3BT2 U;  1ABT A;  4EY8 B;  1CRE A;  5DU1 A;  1HC9 A;  2QJ9 C;  5IMY C;  2LA1 A;  1KBT A;  1FAS A;  3FEV A;  1VB0 A;  1MR6 A;  1COD A;  2QC1 A;  1KBS A;  3KFD E;  1CDQ A;  2PJY C;  3NDS A;  1UG4 A;  2MHY A;  4AEA A;  1L4W A;  2CRT A;  1KFH A;  2L5S A;  2MUP A;  2PJY B;  2HLQ A;  1ES7 B;  2H62 D;  2X8B B;  2H62 C;  1IDI A;  5IMT D;  1IKC A;  2H8U A;  3EBX A;  4OM5 A;  2JVE A;  4RUD A;  5EBX A;  2VLW A;  1KS6 A;  1JGK A;  3HH7 A;  4XJJ A;  3QB4 B;  1TXA A;  2CRS A;  2FD6 U;  2QJB C;  1LSI A;  1PLO A;  1LXG A;  2N99 A;  2UX2 A;  1DRS A;  5DZ5 A;  3KFD I;  4QTI U;  3EVS C;  4UY2 C;  2J8B A;  4BIK B;  4FAO E;  1NYU A;  6EBX A;  2LCR A;  1NYS A; 
#chains in the Genus database with same CATH topology
 5DO6 A;  1CCQ A;  2BHI A;  2UWR A;  1HAA A;  1CXN A;  1I02 A;  3NH7 A;  4ZQY A;  3ERA A;  1W6B A;  2K3G A;  1JE9 A;  1BTE A;  1KU6 B;  1FF4 A;  1ERG A;  1JBD A;  1LXH A;  4IYE A;  1QM7 A;  2MFA A;  4P7U A;  1KC4 A;  1IQ9 A;  3BT1 U;  1F8U B;  2I9B E;  1M9Z A;  1NXB A;  4KSN A;  1REW C;  1FSC A;  1NTN A;  3VTS A;  1S4Y A;  2MUO A;  4DO8 A;  2ERA A;  2H7Z B;  4OM4 A;  1LX5 B;  2CTX A;  2MJ0 A;  1FRA A;  2GOO C;  3NEQ A;  1TFS A;  2H7Z A;  1TXB A;  1F94 A;  1B41 B;  3U73 U;  2MJY A;  1G6M A;  4HQP F;  1NOR A;  2HLR A;  2BTX A;  1RL5 A;  1IDG A;  1CHV S;  2L03 A;  1KXI A;  2CCX A;  1IDL A;  1NEA A;  1YWH A;  1KBA A;  1RGJ A;  4FAO C;  1FFJ A;  1QKE A;  1IK8 A;  1HOY A;  1CTX A;  1HC9 B;  1CDT A;  4LFT A;  1QKD A;  1CDS A;  2H5F A;  1LJZ A;  1BXP A;  1IJC A;  1XT3 A;  1HAJ A;  3U74 U;  1TGX A;  3PLC A;  1CB9 A;  2JQP A;  2H64 B;  1ONJ A;  1V6P A;  1KTZ B;  1CDR A;  2CDX A;  2MJ4 A;  2OFS A;  1MAH F;  1ERA A;  1COE A;  1NTX A;  1H0J A;  2QJA C;  1CVO A;  1KL8 A;  2H64 C;  1CXO A;  1IDH A;  2ABX A;  2NBT A;  4BDT B;  1CRF A;  3LAQ U;  2GOO B;  1FSS B;  1ZAD A;  3BT2 U;  1ABT A;  4EY8 B;  1CRE A;  5DU1 A;  1HC9 A;  2QJ9 C;  5IMY C;  2LA1 A;  1KBT A;  1FAS A;  3FEV A;  1VB0 A;  1MR6 A;  1COD A;  2QC1 A;  1KBS A;  3KFD E;  1CDQ A;  2PJY C;  3NDS A;  1UG4 A;  2MHY A;  4AEA A;  1L4W A;  2CRT A;  1KFH A;  2L5S A;  2MUP A;  2PJY B;  2HLQ A;  1ES7 B;  2H62 D;  2X8B B;  2H62 C;  1IDI A;  5IMT D;  1IKC A;  2H8U A;  3EBX A;  4OM5 A;  2JVE A;  4RUD A;  5EBX A;  2VLW A;  1KS6 A;  1JGK A;  3HH7 A;  4XJJ A;  3QB4 B;  1TXA A;  2CRS A;  2FD6 U;  2QJB C;  1LSI A;  1PLO A;  1LXG A;  2N99 A;  2UX2 A;  1DRS A;  5DZ5 A;  3KFD I;  4QTI U;  3EVS C;  4UY2 C;  2J8B A;  4BIK B;  4FAO E;  1NYU A;  6EBX A;  2LCR A;  1NYS A; 
#chains in the Genus database with same CATH homology
 5DO6 A;  1CCQ A;  2BHI A;  2UWR A;  1HAA A;  1CXN A;  1I02 A;  3NH7 A;  4ZQY A;  3ERA A;  1W6B A;  2K3G A;  1JE9 A;  1BTE A;  1KU6 B;  1FF4 A;  1ERG A;  1JBD A;  1LXH A;  4IYE A;  1QM7 A;  2MFA A;  4P7U A;  1KC4 A;  1IQ9 A;  3BT1 U;  1F8U B;  2I9B E;  1M9Z A;  1NXB A;  4KSN A;  1REW C;  1FSC A;  1NTN A;  3VTS A;  1S4Y A;  2MUO A;  4DO8 A;  2ERA A;  2H7Z B;  4OM4 A;  1LX5 B;  2CTX A;  2MJ0 A;  1FRA A;  2GOO C;  3NEQ A;  1TFS A;  2H7Z A;  1TXB A;  1F94 A;  1B41 B;  3U73 U;  2MJY A;  1G6M A;  4HQP F;  1NOR A;  2HLR A;  2BTX A;  1RL5 A;  1IDG A;  1CHV S;  2L03 A;  1KXI A;  2CCX A;  1IDL A;  1NEA A;  1YWH A;  1KBA A;  1RGJ A;  4FAO C;  1FFJ A;  1QKE A;  1IK8 A;  1HOY A;  1CTX A;  1HC9 B;  1CDT A;  4LFT A;  1QKD A;  1CDS A;  2H5F A;  1LJZ A;  1BXP A;  1IJC A;  1XT3 A;  1HAJ A;  3U74 U;  1TGX A;  3PLC A;  1CB9 A;  2JQP A;  2H64 B;  1ONJ A;  1V6P A;  1KTZ B;  1CDR A;  2CDX A;  2MJ4 A;  2OFS A;  1MAH F;  1ERA A;  1COE A;  1NTX A;  1H0J A;  2QJA C;  1CVO A;  1KL8 A;  2H64 C;  1CXO A;  1IDH A;  2ABX A;  2NBT A;  4BDT B;  1CRF A;  3LAQ U;  2GOO B;  1FSS B;  1ZAD A;  3BT2 U;  1ABT A;  4EY8 B;  1CRE A;  5DU1 A;  1HC9 A;  2QJ9 C;  5IMY C;  2LA1 A;  1KBT A;  1FAS A;  3FEV A;  1VB0 A;  1MR6 A;  1COD A;  2QC1 A;  1KBS A;  3KFD E;  1CDQ A;  2PJY C;  3NDS A;  1UG4 A;  2MHY A;  4AEA A;  1L4W A;  2CRT A;  1KFH A;  2L5S A;  2MUP A;  2PJY B;  2HLQ A;  1ES7 B;  2H62 D;  2X8B B;  2H62 C;  1IDI A;  5IMT D;  1IKC A;  2H8U A;  3EBX A;  4OM5 A;  2JVE A;  4RUD A;  5EBX A;  2VLW A;  1KS6 A;  1JGK A;  3HH7 A;  4XJJ A;  3QB4 B;  1TXA A;  2CRS A;  2FD6 U;  2QJB C;  1LSI A;  1PLO A;  1LXG A;  2N99 A;  2UX2 A;  1DRS A;  5DZ5 A;  3KFD I;  4QTI U;  3EVS C;  4UY2 C;  2J8B A;  4BIK B;  4FAO E;  1NYU A;  6EBX A;  2LCR A;  1NYS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...