2CRVA

Solution structure of c-terminal domain of mitochondrial translational initiationfactor 2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
120
structure length
120
Chain Sequence
GSSGSSGYPIGEASILATFTVTEGKKKIPVADCRVQKGQLERHKKFKLIRNGQVIWKGSLTSLKHHKDDISVIKTGMDCGLSLDEEKVEFKPGDQVICYEENKVPTKTSWDPGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of C-terminal domain of mitochondrial translational initiationfactor 2
rcsb
source organism Mus musculus
molecule tags Translation
molecule keywords Translation initiation factor IF-2
total genus 6
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2crvA01
3CCRB 4LC0A 2QTZA 1E62A 1UMKA 3P27A 1A8PA 4PC2A 1JA0A 1EXMA 4M1KA 3LVBA 2RC5A 1NDHA 1ZM4A 1QUEA 3OJWA 1EFCA 4EH1A 4MYTA 1GVHA 1HA3A 1D2EA 1GAWA 4QFMA 4G5GA 4RD6A 3CMEB 2YWGA 5TR9A 2BN4A 4TMVA 2QA4B 1E63A 4RD4A 2E1RA 3OZUA 3ZZTA 4B47A 3B82A 2B7BA 1VQMB 1QFYA 4M4SA 4Y9UA 1D1NA 2XEXA 3G6EB 2CNDA 3QFRA 1FNMA 4WQMA 2GPJA 1E64A 3W2IA 3VNUA 2VNHA 1R5BA 1QUFA 3WBKA 4H9GA 1K9MD 1DARA 3CCVB 4YAWA 1IJFA 3OW2B 3MHPA 2OTJB 1IJEA 3CD6B 4TMWA 4DQLA 4B43A 4YAUA 1KD1D 3CMAB 4YHBA 2YWEA 2BM1A 4B48A 3CCQB 1AMOA 2BVNA 4B3XA 3U6BA 1G7TA 4G1VA 3WY9A 1VQNB 5FA6A 4DQKA 2QDXA 2DCUA 3W2HA 2VNKA 1TUIA 2VNIA 2C78A 1I7PA 3B8HA 3CRZA 1ELOA 5JBQA 1YI2B 4BPRA 1EP2B 2QN6A 2VZLA 3P26A 2VNJA 3OZWA 1W34A 1DDGA 1G7CA 1R5OA 3JQRA 1KK3A 1F20A 4YALA 4FN5A 3CPWB 3CC2B 4N3GA 1DG1G 3QE2A 1ZM3A 1QH0A 2BSAA 4AF7A 4B4DA 5EMNA 1VQKB 2HMAA 1R5NA 1FNBA 4TN1A 3WXMA 3W2EA 2HCJB 2OTLB 3CXCB 4YAFA 4RD3A 3B78A 5TV2A 3AVVA 1W35A 3W5UA 3I1FA 2PLFA 1ZUNB 3PENA 3MMPA 3QFTA 3OZVA 2D74A 4AC9A 1FNCA 3I55B 1FRNA 3WBJA 4Y7CA 4AF6A 1YITB 1OGIA 4P6VF 3CCLB 2PMDA 4LBWA 2GQFA 2HDNB 4C0SA 2QTLA 2BMWA 1QGYA 4PC1A 3ZC3A 1VQ6B 3ES9A 1VQ5B 1CNEA 2CRVA 1YIJB 3I56B 1M90D 2QMUA 3VO2A 4G1BA 1YJNB 4RD0A 3QFCA 2C77A 1H85A 4QHYA 3WNCA 4MYUA 1S0UA 3AGPA 1KJZA 2QEXB 3JQQA 1KTVA 3JQPA 1KQSB 5H5JA 2BPOA 1VQOB 1OB2A 1TTTA 4HE5A 3CCJB 1F60A 3CCUB 1KC8D 1BX0A 1EP3B 1BX1A 1JNYA 2RC6A 1N8RD 4P3YA 4TMZA 4ZGQB 4ZCMA 1EP1B 2BGJA 1J9ZA 3CW2A 1TLLA 3CCEB 2YWHA 4J0QA 4YAOA 1VQ4B 1GJRA 4IW3B 2NPFA 3AVYA 2FX3A 1JB9A 4ACAA 4FWTA 4LBVA 4K1XA 3WNDA 4RCZA 4ZGNB 3ZBTA 3WYAA 4UAJA 2J7KA 4PC6A 3W5VA 5AN9A 2X3UA 1GR1A 3CB4A 5GV7A 5DSZA 4U9UA 4RCYA 1VQ7B 3VO1A 2BM0A 2PIAA 1W87A 5KSWB 3VNVA 3ZBUA 1EFTA 4ZV4A 1XE1A 1N0UA 3OJXA 3ZZ0A 1QGZA 1KK1A 3AVTA 2B7CA 3WNBA 3G71B 4M2LA 1DDIA 2ZITA 1B2RA 1BQEA 1VQ8B 1K8AD 1EFUA 5HXBA 4M53A 4R71A 1ZM2A 3ZZUA 1W2BB 1KRHA 2BV3A 1VQ9B 1ZM9A 4PGOA 1SM4A 4PC3A 4N3NA 1QVGB 3AVXA 3U6KA 4PC7A 1JJ2B 1CNFA 1KK0A 4TMTA 4B44A 5GV8A 1M1KD 1QFJA 3AGQA 4LBYA 1FDRA 3AVWA 2DERA 1BJKA 2BF4A 4C43A 3E20A 4LBZA 2OK8A 4ZCLA 1AIPA 4FK8A 1QG0A 1OB5A 2EIXA 1K73D 2DY1A 4TMXA 1FRQA 1FNDA 4NBSA 1KK2A 1YJ9B 2XNCA 1QFZA 4ZCIA 1YHQB 1QVFB 3QFSA 3W2GA 1QGAA 1Q7YD 2DEUA 4ACBA 3MCAA 2VYQA 2BGIA 3QSYA 3E1YE 1VQLB 1JA1A 4M0LA 1VQPB 4RJLA 1OGJA 2R6HA 1QX4A 1WDTA 3V76A 3LO8A 3SJZA 1G7RA 3W2FA 3CCMB 4Y9RA 3CC7B 3FPKA 1TVCA 2YWFA 3AVUA 3W5HA 1N0VC 1SKQA 4F7DA 4RD1A 4HE6A 1Q81D 2B5OA 1XB2A 2OK7A 3G4SB 3FJOA 3U2QA 1H42A 2AHOA 3CC4B 4Q7JB 1EWYA 1D8TA 1G7SA 3J81k 5H59A 4NCNA 2EFGA 1Q82D 1B23P 5THXA 5TY0A 1YJWB 1Q86D 1CQXA 2DETA 1GAQA 1NJID 2XNJA 3CCSB 3VMFA 1S72B 4RD2A 1GO2A 1U2RA 1IB0A
chains in the Genus database with same CATH superfamily
3CCRB 4LC0A 2QTZA 1E62A 1UMKA 3P27A 1A8PA 4PC2A 1E3ZA 1WPCA 1JA0A 4XMYA 1EXMA 4M1KA 3LVBA 1N06A 2RC5A 3PA2A 1PJ5A 5F4OA 1NDHA 1N08A 1ZM4A 1QUEA 3OJWA 5J35A 1T6XA 4DK1A 3GVLA 4OOVA 1EFCA 3A3GA 4EH1A 2P3MA 4MYTA 1GVHA 4X7CA 5HKKA 1HA3A 1D2EA 1GAWA 1WP6A 1NBMA 2C4UA 2WZNA 4QFMA 4G5GA 4RD6A 3CMEB 5CDFA 2YWGA 1PKVA 3BQJA 5TR9A 2BN4A 4TMVA 3SLNA 3HAGA 2QA4B 1E63A 4RD4A 2E1RA 3OZUA 3ZZTA 5A8AA 4B47A 5J3OA 4Z1MA 3B82A 2B7BA 1VQMB 1Q9SA 1QFYA 2VBVA 2V7VA 4M4SA 4Y9UA 1D1NA 2XEXA 3OFNA 3G6EB 1UD6A 2JIZA 2CNDA 3QFRA 1FNMA 4WQMA 2GPJA 2VBSA 2ZZGA 1E64A 3H9NA 3W2IA 3VNUA 2WJYA 3JU4A 2VNHA 1R5BA 1QUFA 3CESA 4H9GA 4XL9A 3WBKA 1K9MD 1DARA 3CCVB 2F1MA 3ZIAA 4YAWA 1IJFA 1SKYB 3OOCA 4P22A 1EFRA 1YLOA 4G7WA 3OW2B 1VLOA 1RQRA 1RQPA 3MHPA 2OTJB 3OPOA 1IJEA 3CD6B 4TMWA 1MABA 3A3BA 4DQLA 4B43A 2V7UA 2Q6IA 2ZL5A 2ZBUA 4YAUA 1KD1D 2Q6OA 3T51B 3CMAB 5DS0A 4YHBA 5F4JA 1XQBA 2YWEA 2BM1A 1HVXA 4B48A 3CCQB 1WOOA 1AMOA 4QV2A 2BVNA 4B3XA 4CQJA 5IYNA 1G7TA 3U6BA 1W0JA 3A35A 4OPSA 3H94A 4G1VA 2FVGA 3WY9A 2JDIA 4KKSA 2C5HA 4G6IA 1VQNB 5FA6A 4X7EA 4X7DA 4DQKA 2XZOA 2QDXA 2CBXA 2DCUA 3Q3AA 2VNKA 3W2HA 1TUIA 2VNIA 2C78A 3G05A 4UZUA 1I7PA 3B8HA 2X8KA 3CRZA 1ELOA 5JBQA 1YI2B 1KMHA 3BCFA 4ASUA 1EP2B 2QN6A 2GREA 2VZLA 4BPRA 4XONA 3OE7A 1N05A 3P26A 2WYRA 5A88A 2M5SA 4XM3A 4NNJA 1NB0A 2VNJA 3OZWA 1W34A 2KVOA 1DDGA 1G7CA 1V0EA 1R5OA 3JQRA 1KK3A 5DN6A 1F20A 4YALA 4FN5A 3CPWB 3CC2B 4N3GA 4P6YA 1DG1G 3QE2A 1ZM3A 1QH0A 2BSAA 4AF7A 1VHEA 4B4DA 3OP1A 5EMNA 4XN3A 4UZEA 1VQKB 2HMAA 1R5NA 2ZXHA 1FNBA 3R6KA 4TN1A 3PUMA 4XNFA 3WXMA 3Q6QA 2ZL6A 3KEWA 3W2EA 2HCJB 2OTLB 2ZTGA 3CXCB 2DIEA 1T5EA 4YAFA 4RD3A 3B78A 3OAAA 5TV2A 3AVVA 1W35A 3W5UA 3I1FA 2PLFA 5FIUA 3BNWA 1ZUNB 4Z4RA 3PENA 1BMFA 4RPDA 2HLDA 3MMPA 3QFTA 3OZVA 5KW9A 2D74A 2V31A 4AC9A 1FNCA 3I55B 1NRKA 3A8KA 2ZZFA 1V0FA 3V7AA 4DNRB 1FRNA 3WBJA 4Y7CA 4AF6A 1YITB 2ZZEA 1OGIA 2CF4A 4P6VF 3CCLB 2PMDA 4LBWA 2GQFA 4Z4SA 1YX2A 2HDNB 3NE5B 4X7FA 3PUNA 4C0SA 2WR8A 3CTAA 2QTLA 2BMWA 1QGYA 4PC1A 4YELA 3ZC3A 1VQ6B 4XKWA 3ES9A 4II3A 4AVZA 1VQ5B 1CNEA 2CRVA 1V5VA 2D3NA 2V7TA 1YIJB 2GJPA 3I56B 1H8HA 1W0KA 2CC2A 4OPVA 1M90D 2QMUA 3VO2A 2ZBVA 1MRZA 4G1BA 1YJNB 1H8EA 2I1LA 4RD0A 3QFCA 3ISXA 2C77A 1H85A 3ZPNA 4QHYA 4QVJA 1W9XA 4RDJA 3WNCA 2DOGA 4MYUA 2XZPA 2X6YA 1S0UA 1BLIA 3AGPA 4KKUA 4WZTA 1KJZA 4P25A 2QEXB 1T6YA 3ASRA 3FPPA 3JQQA 4P12A 2WZPP 1UD2A 3CPXA 1KTVA 3JQPA 3SKBA 1KQSB 2D9RA 3DDYA 5H5JA 4XLFA 2BPOA 3GIRA 5KNLA 2ZL7A 4RM0A 1I8DA 1VQOB 1OB2A 1TTTA 4HE5A 3CCJB 1F60A 2PE3A 2ZXIA 3CP8A 2C4TA 5A89A 3SJPA 4RPBA 1WSRA 3CCUB 1KC8D 1BX0A 1EP3B 1BX1A 1JNYA 2RC6A 1N8RD 4P3YA 4TMZA 1XFOA 4Z4YA 2GJRA 4ZGQB 4RDLA 4ZCMA 1EP1B 2BGJA 1J9ZA 3CW2A 2Z6BD 1TLLA 3PA1A 2VBTA 3CCEB 2YWHA 3A1PA 4J0QA 4P3IA 4YAOA 1VQ4B 1WOSA 1GJRA 3ASQA 1Y0YA 4FXUA 4IW3B 3R6JA 2NPFA 3AVYA 4II2A 2W6IA 2FX3A 2OBSA 1JB9A 4WZKA 4YEJA 4ACAA 4FWTA 1VF7A 4LBVA 2X0KA 4K1XA 5TRDA 3WNDA 4RCZA 1NB9A 3T56B 3OEEA 2GK7A 2JN9A 5BSYA 4ZGNB 2NV4A 3WYAA 2GK6A 3ZBTA 4UAJA 2J7KA 2F4NA 4PC6A 3W5VA 4DNTB 1K28D 2GJKA 2OYNA 1GR1A 2X3UA 5AN9A 2V7XA 2ZZQA 3CB4A 5GV7A 4P2NA 3A8JA 5DSZA 4U9UA 3A8IA 2XGJA 4OOSA 4RCYA 4OOXA 1VQ7B 3SLDA 4JMQA 3LQEA 3OW7A 1T6ZA 3VO1A 4XN0A 2BM0A 5HZAA 4XQFA 2PIAA 1W87A 2OBRA 3GSIA 2VJIA 5KSWB 4X0CA 3VNVA 2V4DA 3ZBUA 1I18A 4XR6A 1Y0RA 4ROXA 5FL7A 1EFTA 4QVAA 4RLZA 1VJSA 3KL9A 4WZEA 4ZV4A 1XE1A 4E0FA 1N0UA 3Q38A 4B3GA 4YXWA 1OB0A 3OJXA 3ZZ0A 5BSXA 1QGZA 4Z4TA 1KK1A 3WQZA 3AVTA 2B7CA 3WNBA 3G71B 2ZTNA 1WORA 4M2LA 1COWA 3BCDA 1DDIA 2W6JA 2ZITA 1B2RA 1E79A 1BQEA 1VQ8B 4TT3A 4GQNA 4XORA 2F1LA 1K8AD 2CK3A 3BH4A 3GVKA 1EFUA 3GQBA 2CW5A 5HXBA 4G7XA 5F4MA 1E43A 4M53A 2XZLA 4R71A 4XD7A 1ZM2A 4OP7A 1WOPA 4X06A 1WU8A 3ZZUA 3ASSA 2WJVA 1W2BB 2D3LA 2V7QA 4XLAA 1KRHA 2BV3A 2C2WA 5FNZA 1ZM9A 1VQ9B 4PGOA 1SM4A 4PC3A 4N3NA 1QVGB 4WZLA 3AVXA 1PJ7A 3OEHA 3U6KA 4PC7A 3SEJA 1JJ2B 5LMZA 1CNFA 1KK0A 4TMTA 5IYWA 3RY8A 2Q6LA 4B44A 2QGGA 5GV8A 1M1KD 1QFJA 3AGQA 4LBYA 1FDRA 2X6WA 4WWVA 4B3FX 1UD8A 2DERA 3AVWA 5IK2A 3CP2A 4KKTA 1BJKA 2Q6KA 4P9SA 2BF4A 2X53S 2VJJA 1PJ6A 4C43A 3E20A 2LZJA 4LBZA 4PABA 3T53B 4DK0A 1WTHD 1VLYA 5FO1A 1S4MA 2OK8A 4OPOA 4ZCLA 4Z4UA 4X8IA 1AIPA 4FK8A 4XLEA 1QG0A 4UZFA 1UD4A 1OB5A 5FO0A 2EIXA 1K73D 2DY1A 4TMXA 3VR6A 1FRQA 3CMMA 3Q6RA 1FNDA 2E1BA 4NBSA 5E6TA 5IYRA 5IYPA 1KK2A 1YJ9B 2XNCA 2X6XA 3PVDA 1QFZA 4ZCIA 1YHQB 1QVFB 3QFSA 4XOPA 3W2GA 1QGAA 1Q7YD 2DEUA 4ACBA 4QUZA 1HZEA 3MCAA 2VYQA 2F43A 2BGIA 3QSYA 4X05A 3E1YE 1VQLB 5IYQA 1JA1A 4M0LA 4X07A 1VQPB 3ONYA 4RJLA 3ASPA 1OGJA 2V7WA 2QE7A 2R6HA 1QX4A 3D26A 1WDTA 4TKOB 3V76A 3LO8A 1VHOA 3SJZA 2XOKA 2DYIA 1G7RA 3W2FA 2WSSA 1UD5A 4L8JA 3CCMB 4Y9RA 1E1RA 3BY1A 3CC7B 3FPKA 1TVCA 2YWFA 3AVUA 3W5HA 1N0VC 4RDKA 3ZUGA 1SKQA 4PAAA 3ONUA 4XLHA 4F7DA 1WSVA 3OKXA 5B6IA 1BPLA 1KZLA 4RD1A 1UD3A 4HE6A 1Q81D 2B5OA 2JJ2A 3BC9A 3LQ6A 1XB2A 2OK7A 3BY2A 4Z4VA 3G4SB 4TSFA 1IHMA 3FJOA 2XNDA 3LNNA 2OBTA 3U2QA 1H42A 2AHOA 1P4MA 4P26A 4Q7JB 1EWYA 3FKSA 1D8TA 3ASTA 4XLCA 3CC4B 1G7SA 1FX0A 3J81k 5L46A 1E1QA 4NCNA 5H59A 1OHHA 2EFGA 1Q82D 1B23P 1E3XA 5THXA 5TY0A 1YJWB 4HIZA 4XKVA 4Z4ZA 1Q86D 2C5BA 2JJ1A 5HZBA 1CQXA 2DETA 1GAQA 2VBUA 2WPDA 2X85A 4Z4WA 1NJID 2XNJA 3Q39A 1N07A 2R9VA 4XOTA 3VMFA 4P1VA 3CCSB 1S72B 4RD2A 3GVJA 1GO2A 1U2RA 1IB0A
chains in the Genus database with same CATH topology
3CCRB 4LC0A 2QTZA 1E62A 1UMKA 3P27A 1A8PA 4PC2A 1JA0A 1EXMA 4M1KA 3LVBA 2RC5A 1NDHA 1ZM4A 1QUEA 3OJWA 1EFCA 4EH1A 4MYTA 1GVHA 1HA3A 1D2EA 1GAWA 4QFMA 4G5GA 4RD6A 3CMEB 2YWGA 5TR9A 2BN4A 4TMVA 2QA4B 1E63A 4RD4A 2E1RA 3OZUA 3ZZTA 4B47A 3B82A 2B7BA 1VQMB 1QFYA 4M4SA 4Y9UA 1D1NA 2XEXA 3G6EB 2CNDA 3QFRA 1FNMA 4WQMA 2GPJA 1E64A 3W2IA 3VNUA 2VNHA 1R5BA 1QUFA 3WBKA 4H9GA 1K9MD 1DARA 3CCVB 4YAWA 1IJFA 3OW2B 3MHPA 2OTJB 1IJEA 3CD6B 4TMWA 4DQLA 4B43A 4YAUA 1KD1D 3CMAB 4YHBA 2YWEA 2BM1A 4B48A 3CCQB 1AMOA 2BVNA 4B3XA 3U6BA 1G7TA 4G1VA 3WY9A 1VQNB 5FA6A 4DQKA 2QDXA 2DCUA 3W2HA 2VNKA 1TUIA 2VNIA 2C78A 1I7PA 3B8HA 3CRZA 1ELOA 5JBQA 1YI2B 4BPRA 1EP2B 2QN6A 2VZLA 3P26A 2VNJA 3OZWA 1W34A 1DDGA 1G7CA 1R5OA 3JQRA 1KK3A 1F20A 4YALA 4FN5A 3CPWB 3CC2B 4N3GA 1DG1G 3QE2A 1ZM3A 1QH0A 2BSAA 4AF7A 4B4DA 5EMNA 1VQKB 2HMAA 1R5NA 1FNBA 4TN1A 3WXMA 3W2EA 2HCJB 2OTLB 3CXCB 4YAFA 4RD3A 3B78A 5TV2A 3AVVA 1W35A 3W5UA 3I1FA 2PLFA 1ZUNB 3PENA 3MMPA 3QFTA 3OZVA 2D74A 4AC9A 1FNCA 3I55B 1FRNA 3WBJA 4Y7CA 4AF6A 1YITB 1OGIA 4P6VF 3CCLB 2PMDA 4LBWA 2GQFA 2HDNB 4C0SA 2QTLA 2BMWA 1QGYA 4PC1A 3ZC3A 1VQ6B 3ES9A 1VQ5B 1CNEA 2CRVA 1YIJB 3I56B 1M90D 2QMUA 3VO2A 4G1BA 1YJNB 4RD0A 3QFCA 2C77A 1H85A 4QHYA 3WNCA 4MYUA 1S0UA 3AGPA 1KJZA 2QEXB 3JQQA 1KTVA 3JQPA 1KQSB 5H5JA 2BPOA 1VQOB 1OB2A 1TTTA 4HE5A 3CCJB 1F60A 3CCUB 1KC8D 1BX0A 1EP3B 1BX1A 1JNYA 2RC6A 1N8RD 4P3YA 4TMZA 4ZGQB 4ZCMA 1EP1B 2BGJA 1J9ZA 3CW2A 1TLLA 3CCEB 2YWHA 4J0QA 4YAOA 1VQ4B 1GJRA 4IW3B 2NPFA 3AVYA 2FX3A 1JB9A 4ACAA 4FWTA 4LBVA 4K1XA 3WNDA 4RCZA 4ZGNB 3ZBTA 3WYAA 4UAJA 2J7KA 4PC6A 3W5VA 5AN9A 2X3UA 1GR1A 3CB4A 5GV7A 5DSZA 4U9UA 4RCYA 1VQ7B 3VO1A 2BM0A 2PIAA 1W87A 5KSWB 3VNVA 3ZBUA 1EFTA 4ZV4A 1XE1A 1N0UA 3OJXA 3ZZ0A 1QGZA 1KK1A 3AVTA 2B7CA 3WNBA 3G71B 4M2LA 1DDIA 2ZITA 1B2RA 1BQEA 1VQ8B 1K8AD 1EFUA 5HXBA 4M53A 4R71A 1ZM2A 3ZZUA 1W2BB 1KRHA 2BV3A 1VQ9B 1ZM9A 4PGOA 1SM4A 4PC3A 4N3NA 1QVGB 3AVXA 3U6KA 4PC7A 1JJ2B 1CNFA 1KK0A 4TMTA 4B44A 5GV8A 1M1KD 1QFJA 3AGQA 4LBYA 1FDRA 3AVWA 2DERA 1BJKA 2BF4A 4C43A 3E20A 4LBZA 2OK8A 4ZCLA 1AIPA 4FK8A 1QG0A 1OB5A 2EIXA 1K73D 2DY1A 4TMXA 1FRQA 1FNDA 4NBSA 1KK2A 1YJ9B 2XNCA 1QFZA 4ZCIA 1YHQB 1QVFB 3QFSA 3W2GA 1QGAA 1Q7YD 2DEUA 4ACBA 3MCAA 2VYQA 2BGIA 3QSYA 3E1YE 1VQLB 1JA1A 4M0LA 1VQPB 4RJLA 1OGJA 2R6HA 1QX4A 1WDTA 3V76A 3LO8A 3SJZA 1G7RA 3W2FA 3CCMB 4Y9RA 3CC7B 3FPKA 1TVCA 2YWFA 3AVUA 3W5HA 1N0VC 1SKQA 4F7DA 4RD1A 4HE6A 1Q81D 2B5OA 1XB2A 2OK7A 3G4SB 3FJOA 3U2QA 1H42A 2AHOA 3CC4B 4Q7JB 1EWYA 1D8TA 1G7SA 3J81k 5H59A 4NCNA 2EFGA 1Q82D 1B23P 5THXA 5TY0A 1YJWB 1Q86D 1CQXA 2DETA 1GAQA 1NJID 2XNJA 3CCSB 3VMFA 1S72B 4RD2A 1GO2A 1U2RA 1IB0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CCR B;  4LC0 A;  2QTZ A;  1E62 A;  1UMK A;  3P27 A;  1A8P A;  4PC2 A;  1JA0 A;  1EXM A;  4M1K A;  3LVB A;  2RC5 A;  1NDH A;  1ZM4 A;  1QUE A;  3OJW A;  1EFC A;  4EH1 A;  4MYT A;  1GVH A;  1HA3 A;  1D2E A;  1GAW A;  4QFM A;  4G5G A;  4RD6 A;  3CME B;  2YWG A;  5TR9 A;  2BN4 A;  4TMV A;  2QA4 B;  1E63 A;  4RD4 A;  2E1R A;  3OZU A;  3ZZT A;  4B47 A;  3B82 A;  2B7B A;  1VQM B;  1QFY A;  4M4S A;  4Y9U A;  1D1N A;  2XEX A;  3G6E B;  2CND A;  3QFR A;  1FNM A;  4WQM A;  2GPJ A;  1E64 A;  3W2I A;  3VNU A;  2VNH A;  1R5B A;  1QUF A;  3WBK A;  4H9G A;  1K9M D;  1DAR A;  3CCV B;  4YAW A;  1IJF A;  3OW2 B;  3MHP A;  2OTJ B;  1IJE A;  3CD6 B;  4TMW A;  4DQL A;  4B43 A;  4YAU A;  1KD1 D;  3CMA B;  4YHB A;  2YWE A;  2BM1 A;  4B48 A;  3CCQ B;  1AMO A;  2BVN A;  4B3X A;  3U6B A;  1G7T A;  4G1V A;  3WY9 A;  1VQN B;  5FA6 A;  4DQK A;  2QDX A;  2DCU A;  3W2H A;  2VNK A;  1TUI A;  2VNI A;  2C78 A;  1I7P A;  3B8H A;  3CRZ A;  1ELO A;  5JBQ A;  1YI2 B;  4BPR A;  1EP2 B;  2QN6 A;  2VZL A;  3P26 A;  2VNJ A;  3OZW A;  1W34 A;  1DDG A;  1G7C A;  1R5O A;  3JQR A;  1KK3 A;  1F20 A;  4YAL A;  4FN5 A;  3CPW B;  3CC2 B;  4N3G A;  1DG1 G;  3QE2 A;  1ZM3 A;  1QH0 A;  2BSA A;  4AF7 A;  4B4D A;  5EMN A;  1VQK B;  2HMA A;  1R5N A;  1FNB A;  4TN1 A;  3WXM A;  3W2E A;  2HCJ B;  2OTL B;  3CXC B;  4YAF A;  4RD3 A;  3B78 A;  5TV2 A;  3AVV A;  1W35 A;  3W5U A;  3I1F A;  2PLF A;  1ZUN B;  3PEN A;  3MMP A;  3QFT A;  3OZV A;  2D74 A;  4AC9 A;  1FNC A;  3I55 B;  1FRN A;  3WBJ A;  4Y7C A;  4AF6 A;  1YIT B;  1OGI A;  4P6V F;  3CCL B;  2PMD A;  4LBW A;  2GQF A;  2HDN B;  4C0S A;  2QTL A;  2BMW A;  1QGY A;  4PC1 A;  3ZC3 A;  1VQ6 B;  3ES9 A;  1VQ5 B;  1CNE A;  2CRV A;  1YIJ B;  3I56 B;  1M90 D;  2QMU A;  3VO2 A;  4G1B A;  1YJN B;  4RD0 A;  3QFC A;  2C77 A;  1H85 A;  4QHY A;  3WNC A;  4MYU A;  1S0U A;  3AGP A;  1KJZ A;  2QEX B;  3JQQ A;  1KTV A;  3JQP A;  1KQS B;  5H5J A;  2BPO A;  1VQO B;  1OB2 A;  1TTT A;  4HE5 A;  3CCJ B;  1F60 A;  3CCU B;  1KC8 D;  1BX0 A;  1EP3 B;  1BX1 A;  1JNY A;  2RC6 A;  1N8R D;  4P3Y A;  4TMZ A;  4ZGQ B;  4ZCM A;  1EP1 B;  2BGJ A;  1J9Z A;  3CW2 A;  1TLL A;  3CCE B;  2YWH A;  4J0Q A;  4YAO A;  1VQ4 B;  1GJR A;  4IW3 B;  2NPF A;  3AVY A;  2FX3 A;  1JB9 A;  4ACA A;  4FWT A;  4LBV A;  4K1X A;  3WND A;  4RCZ A;  4ZGN B;  3ZBT A;  3WYA A;  4UAJ A;  2J7K A;  4PC6 A;  3W5V A;  5AN9 A;  2X3U A;  1GR1 A;  3CB4 A;  5GV7 A;  5DSZ A;  4U9U A;  4RCY A;  1VQ7 B;  3VO1 A;  2BM0 A;  2PIA A;  1W87 A;  5KSW B;  3VNV A;  3ZBU A;  1EFT A;  4ZV4 A;  1XE1 A;  1N0U A;  3OJX A;  3ZZ0 A;  1QGZ A;  1KK1 A;  3AVT A;  2B7C A;  3WNB A;  3G71 B;  4M2L A;  1DDI A;  2ZIT A;  1B2R A;  1BQE A;  1VQ8 B;  1K8A D;  1EFU A;  5HXB A;  4M53 A;  4R71 A;  1ZM2 A;  3ZZU A;  1W2B B;  1KRH A;  2BV3 A;  1VQ9 B;  1ZM9 A;  4PGO A;  1SM4 A;  4PC3 A;  4N3N A;  1QVG B;  3AVX A;  3U6K A;  4PC7 A;  1JJ2 B;  1CNF A;  1KK0 A;  4TMT A;  4B44 A;  5GV8 A;  1M1K D;  1QFJ A;  3AGQ A;  4LBY A;  1FDR A;  3AVW A;  2DER A;  1BJK A;  2BF4 A;  4C43 A;  3E20 A;  4LBZ A;  2OK8 A;  4ZCL A;  1AIP A;  4FK8 A;  1QG0 A;  1OB5 A;  2EIX A;  1K73 D;  2DY1 A;  4TMX A;  1FRQ A;  1FND A;  4NBS A;  1KK2 A;  1YJ9 B;  2XNC A;  1QFZ A;  4ZCI A;  1YHQ B;  1QVF B;  3QFS A;  3W2G A;  1QGA A;  1Q7Y D;  2DEU A;  4ACB A;  3MCA A;  2VYQ A;  2BGI A;  3QSY A;  3E1Y E;  1VQL B;  1JA1 A;  4M0L A;  1VQP B;  4RJL A;  1OGJ A;  2R6H A;  1QX4 A;  1WDT A;  3V76 A;  3LO8 A;  3SJZ A;  1G7R A;  3W2F A;  3CCM B;  4Y9R A;  3CC7 B;  3FPK A;  1TVC A;  2YWF A;  3AVU A;  3W5H A;  1N0V C;  1SKQ A;  4F7D A;  4RD1 A;  4HE6 A;  1Q81 D;  2B5O A;  1XB2 A;  2OK7 A;  3G4S B;  3FJO A;  3U2Q A;  1H42 A;  2AHO A;  3CC4 B;  4Q7J B;  1EWY A;  1D8T A;  1G7S A;  3J81 k;  5H59 A;  4NCN A;  2EFG A;  1Q82 D;  1B23 P;  5THX A;  5TY0 A;  1YJW B;  1Q86 D;  1CQX A;  2DET A;  1GAQ A;  1NJI D;  2XNJ A;  3CCS B;  3VMF A;  1S72 B;  4RD2 A;  1GO2 A;  1U2R A;  1IB0 A; 
#chains in the Genus database with same CATH topology
 3CCR B;  4LC0 A;  2QTZ A;  1E62 A;  1UMK A;  3P27 A;  1A8P A;  4PC2 A;  1E3Z A;  1WPC A;  1JA0 A;  4XMY A;  1EXM A;  4M1K A;  3LVB A;  1N06 A;  2RC5 A;  3PA2 A;  1PJ5 A;  5F4O A;  1NDH A;  1N08 A;  1ZM4 A;  1QUE A;  3OJW A;  5J35 A;  1T6X A;  4DK1 A;  3GVL A;  4OOV A;  1EFC A;  3A3G A;  4EH1 A;  2P3M A;  4MYT A;  1GVH A;  4X7C A;  5HKK A;  1HA3 A;  1D2E A;  1GAW A;  1WP6 A;  1NBM A;  2C4U A;  2WZN A;  4QFM A;  4G5G A;  4RD6 A;  3CME B;  5CDF A;  2YWG A;  1PKV A;  3BQJ A;  5TR9 A;  2BN4 A;  4TMV A;  3SLN A;  3HAG A;  2QA4 B;  1E63 A;  4RD4 A;  2E1R A;  3OZU A;  3ZZT A;  5A8A A;  4B47 A;  5J3O A;  4Z1M A;  3B82 A;  2B7B A;  1VQM B;  1Q9S A;  1QFY A;  2VBV A;  2V7V A;  4M4S A;  4Y9U A;  1D1N A;  2XEX A;  3OFN A;  3G6E B;  1UD6 A;  2JIZ A;  2CND A;  3QFR A;  1FNM A;  4WQM A;  2GPJ A;  2VBS A;  2ZZG A;  1E64 A;  3H9N A;  3W2I A;  3VNU A;  2WJY A;  3JU4 A;  2VNH A;  1R5B A;  1QUF A;  3CES A;  4H9G A;  4XL9 A;  3WBK A;  1K9M D;  1DAR A;  3CCV B;  2F1M A;  3ZIA A;  4YAW A;  1IJF A;  1SKY B;  3OOC A;  4P22 A;  1EFR A;  1YLO A;  4G7W A;  3OW2 B;  1VLO A;  1RQR A;  1RQP A;  3MHP A;  2OTJ B;  3OPO A;  1IJE A;  3CD6 B;  4TMW A;  1MAB A;  3A3B A;  4DQL A;  4B43 A;  2V7U A;  2Q6I A;  2ZL5 A;  2ZBU A;  4YAU A;  1KD1 D;  2Q6O A;  3T51 B;  3CMA B;  5DS0 A;  4YHB A;  5F4J A;  1XQB A;  2YWE A;  2BM1 A;  1HVX A;  4B48 A;  3CCQ B;  1WOO A;  1AMO A;  4QV2 A;  2BVN A;  4B3X A;  4CQJ A;  5IYN A;  1G7T A;  3U6B A;  1W0J A;  3A35 A;  4OPS A;  3H94 A;  4G1V A;  2FVG A;  3WY9 A;  2JDI A;  4KKS A;  2C5H A;  4G6I A;  1VQN B;  5FA6 A;  4X7E A;  4X7D A;  4DQK A;  2XZO A;  2QDX A;  2CBX A;  2DCU A;  3Q3A A;  2VNK A;  3W2H A;  1TUI A;  2VNI A;  2C78 A;  3G05 A;  4UZU A;  1I7P A;  3B8H A;  2X8K A;  3CRZ A;  1ELO A;  5JBQ A;  1YI2 B;  1KMH A;  3BCF A;  4ASU A;  1EP2 B;  2QN6 A;  2GRE A;  2VZL A;  4BPR A;  4XON A;  3OE7 A;  1N05 A;  3P26 A;  2WYR A;  5A88 A;  2M5S A;  4XM3 A;  4NNJ A;  1NB0 A;  2VNJ A;  3OZW A;  1W34 A;  2KVO A;  1DDG A;  1G7C A;  1V0E A;  1R5O A;  3JQR A;  1KK3 A;  5DN6 A;  1F20 A;  4YAL A;  4FN5 A;  3CPW B;  3CC2 B;  4N3G A;  4P6Y A;  1DG1 G;  3QE2 A;  1ZM3 A;  1QH0 A;  2BSA A;  4AF7 A;  1VHE A;  4B4D A;  3OP1 A;  5EMN A;  4XN3 A;  4UZE A;  1VQK B;  2HMA A;  1R5N A;  2ZXH A;  1FNB A;  3R6K A;  4TN1 A;  3PUM A;  4XNF A;  3WXM A;  3Q6Q A;  2ZL6 A;  3KEW A;  3W2E A;  2HCJ B;  2OTL B;  2ZTG A;  3CXC B;  2DIE A;  1T5E A;  4YAF A;  4RD3 A;  3B78 A;  3OAA A;  5TV2 A;  3AVV A;  1W35 A;  3W5U A;  3I1F A;  2PLF A;  5FIU A;  3BNW A;  1ZUN B;  4Z4R A;  3PEN A;  1BMF A;  4RPD A;  2HLD A;  3MMP A;  3QFT A;  3OZV A;  5KW9 A;  2D74 A;  2V31 A;  4AC9 A;  1FNC A;  3I55 B;  1NRK A;  3A8K A;  2ZZF A;  1V0F A;  3V7A A;  4DNR B;  1FRN A;  3WBJ A;  4Y7C A;  4AF6 A;  1YIT B;  2ZZE A;  1OGI A;  2CF4 A;  4P6V F;  3CCL B;  2PMD A;  4LBW A;  2GQF A;  4Z4S A;  1YX2 A;  2HDN B;  3NE5 B;  4X7F A;  3PUN A;  4C0S A;  2WR8 A;  3CTA A;  2QTL A;  2BMW A;  1QGY A;  4PC1 A;  4YEL A;  3ZC3 A;  1VQ6 B;  4XKW A;  3ES9 A;  4II3 A;  4AVZ A;  1VQ5 B;  1CNE A;  2CRV A;  1V5V A;  2D3N A;  2V7T A;  1YIJ B;  2GJP A;  3I56 B;  1H8H A;  1W0K A;  2CC2 A;  4OPV A;  1M90 D;  2QMU A;  3VO2 A;  2ZBV A;  1MRZ A;  4G1B A;  1YJN B;  1H8E A;  2I1L A;  4RD0 A;  3QFC A;  3ISX A;  2C77 A;  1H85 A;  3ZPN A;  4QHY A;  4QVJ A;  1W9X A;  4RDJ A;  3WNC A;  2DOG A;  4MYU A;  2XZP A;  2X6Y A;  1S0U A;  1BLI A;  3AGP A;  4KKU A;  4WZT A;  1KJZ A;  4P25 A;  2QEX B;  1T6Y A;  3ASR A;  3FPP A;  3JQQ A;  4P12 A;  2WZP P;  1UD2 A;  3CPX A;  1KTV A;  3JQP A;  3SKB A;  1KQS B;  2D9R A;  3DDY A;  5H5J A;  4XLF A;  2BPO A;  3GIR A;  5KNL A;  2ZL7 A;  4RM0 A;  1I8D A;  1VQO B;  1OB2 A;  1TTT A;  4HE5 A;  3CCJ B;  1F60 A;  2PE3 A;  2ZXI A;  3CP8 A;  2C4T A;  5A89 A;  3SJP A;  4RPB A;  1WSR A;  3CCU B;  1KC8 D;  1BX0 A;  1EP3 B;  1BX1 A;  1JNY A;  2RC6 A;  1N8R D;  4P3Y A;  4TMZ A;  1XFO A;  4Z4Y A;  2GJR A;  4ZGQ B;  4RDL A;  4ZCM A;  1EP1 B;  2BGJ A;  1J9Z A;  3CW2 A;  2Z6B D;  1TLL A;  3PA1 A;  2VBT A;  3CCE B;  2YWH A;  3A1P A;  4J0Q A;  4P3I A;  4YAO A;  1VQ4 B;  1WOS A;  1GJR A;  3ASQ A;  1Y0Y A;  4FXU A;  4IW3 B;  3R6J A;  2NPF A;  3AVY A;  4II2 A;  2W6I A;  2FX3 A;  2OBS A;  1JB9 A;  4WZK A;  4YEJ A;  4ACA A;  4FWT A;  1VF7 A;  4LBV A;  2X0K A;  4K1X A;  5TRD A;  3WND A;  4RCZ A;  1NB9 A;  3T56 B;  3OEE A;  2GK7 A;  2JN9 A;  5BSY A;  4ZGN B;  2NV4 A;  3WYA A;  2GK6 A;  3ZBT A;  4UAJ A;  2J7K A;  2F4N A;  4PC6 A;  3W5V A;  4DNT B;  1K28 D;  2GJK A;  2OYN A;  1GR1 A;  2X3U A;  5AN9 A;  2V7X A;  2ZZQ A;  3CB4 A;  5GV7 A;  4P2N A;  3A8J A;  5DSZ A;  4U9U A;  3A8I A;  2XGJ A;  4OOS A;  4RCY A;  4OOX A;  1VQ7 B;  3SLD A;  4JMQ A;  3LQE A;  3OW7 A;  1T6Z A;  3VO1 A;  4XN0 A;  2BM0 A;  5HZA A;  4XQF A;  2PIA A;  1W87 A;  2OBR A;  3GSI A;  2VJI A;  5KSW B;  4X0C A;  3VNV A;  2V4D A;  3ZBU A;  1I18 A;  4XR6 A;  1Y0R A;  4ROX A;  5FL7 A;  1EFT A;  4QVA A;  4RLZ A;  1VJS A;  3KL9 A;  4WZE A;  4ZV4 A;  1XE1 A;  4E0F A;  1N0U A;  3Q38 A;  4B3G A;  4YXW A;  1OB0 A;  3OJX A;  3ZZ0 A;  5BSX A;  1QGZ A;  4Z4T A;  1KK1 A;  3WQZ A;  3AVT A;  2B7C A;  3WNB A;  3G71 B;  2ZTN A;  1WOR A;  4M2L A;  1COW A;  3BCD A;  1DDI A;  2W6J A;  2ZIT A;  1B2R A;  1E79 A;  1BQE A;  1VQ8 B;  4TT3 A;  4GQN A;  4XOR A;  2F1L A;  1K8A D;  2CK3 A;  3BH4 A;  3GVK A;  1EFU A;  3GQB A;  2CW5 A;  5HXB A;  4G7X A;  5F4M A;  1E43 A;  4M53 A;  2XZL A;  4R71 A;  4XD7 A;  1ZM2 A;  4OP7 A;  1WOP A;  4X06 A;  1WU8 A;  3ZZU A;  3ASS A;  2WJV A;  1W2B B;  2D3L A;  2V7Q A;  4XLA A;  1KRH A;  2BV3 A;  2C2W A;  5FNZ A;  1ZM9 A;  1VQ9 B;  4PGO A;  1SM4 A;  4PC3 A;  4N3N A;  1QVG B;  4WZL A;  3AVX A;  1PJ7 A;  3OEH A;  3U6K A;  4PC7 A;  3SEJ A;  1JJ2 B;  5LMZ A;  1CNF A;  1KK0 A;  4TMT A;  5IYW A;  3RY8 A;  2Q6L A;  4B44 A;  2QGG A;  5GV8 A;  1M1K D;  1QFJ A;  3AGQ A;  4LBY A;  1FDR A;  2X6W A;  4WWV A;  4B3F X;  1UD8 A;  2DER A;  3AVW A;  5IK2 A;  3CP2 A;  4KKT A;  1BJK A;  2Q6K A;  4P9S A;  2BF4 A;  2X53 S;  2VJJ A;  1PJ6 A;  4C43 A;  3E20 A;  2LZJ A;  4LBZ A;  4PAB A;  3T53 B;  4DK0 A;  1WTH D;  1VLY A;  5FO1 A;  1S4M A;  2OK8 A;  4OPO A;  4ZCL A;  4Z4U A;  4X8I A;  1AIP A;  4FK8 A;  4XLE A;  1QG0 A;  4UZF A;  1UD4 A;  1OB5 A;  5FO0 A;  2EIX A;  1K73 D;  2DY1 A;  4TMX A;  3VR6 A;  1FRQ A;  3CMM A;  3Q6R A;  1FND A;  2E1B A;  4NBS A;  5E6T A;  5IYR A;  5IYP A;  1KK2 A;  1YJ9 B;  2XNC A;  2X6X A;  3PVD A;  1QFZ A;  4ZCI A;  1YHQ B;  1QVF B;  3QFS A;  4XOP A;  3W2G A;  1QGA A;  1Q7Y D;  2DEU A;  4ACB A;  4QUZ A;  1HZE A;  3MCA A;  2VYQ A;  2F43 A;  2BGI A;  3QSY A;  4X05 A;  3E1Y E;  1VQL B;  5IYQ A;  1JA1 A;  4M0L A;  4X07 A;  1VQP B;  3ONY A;  4RJL A;  3ASP A;  1OGJ A;  2V7W A;  2QE7 A;  2R6H A;  1QX4 A;  3D26 A;  1WDT A;  4TKO B;  3V76 A;  3LO8 A;  1VHO A;  3SJZ A;  2XOK A;  2DYI A;  1G7R A;  3W2F A;  2WSS A;  1UD5 A;  4L8J A;  3CCM B;  4Y9R A;  1E1R A;  3BY1 A;  3CC7 B;  3FPK A;  1TVC A;  2YWF A;  3AVU A;  3W5H A;  1N0V C;  4RDK A;  3ZUG A;  1SKQ A;  4PAA A;  3ONU A;  4XLH A;  4F7D A;  1WSV A;  3OKX A;  5B6I A;  1BPL A;  1KZL A;  4RD1 A;  1UD3 A;  4HE6 A;  1Q81 D;  2B5O A;  2JJ2 A;  3BC9 A;  3LQ6 A;  1XB2 A;  2OK7 A;  3BY2 A;  4Z4V A;  3G4S B;  4TSF A;  1IHM A;  3FJO A;  2XND A;  3LNN A;  2OBT A;  3U2Q A;  1H42 A;  2AHO A;  1P4M A;  4P26 A;  4Q7J B;  1EWY A;  3FKS A;  1D8T A;  3AST A;  4XLC A;  3CC4 B;  1G7S A;  1FX0 A;  3J81 k;  5L46 A;  1E1Q A;  4NCN A;  5H59 A;  1OHH A;  2EFG A;  1Q82 D;  1B23 P;  1E3X A;  5THX A;  5TY0 A;  1YJW B;  4HIZ A;  4XKV A;  4Z4Z A;  1Q86 D;  2C5B A;  2JJ1 A;  5HZB A;  1CQX A;  2DET A;  1GAQ A;  2VBU A;  2WPD A;  2X85 A;  4Z4W A;  1NJI D;  2XNJ A;  3Q39 A;  1N07 A;  2R9V A;  4XOT A;  3VMF A;  4P1V A;  3CCS B;  1S72 B;  4RD2 A;  3GVJ A;  1GO2 A;  1U2R A;  1IB0 A; 
#chains in the Genus database with same CATH homology
 3CCR B;  4LC0 A;  2QTZ A;  1E62 A;  1UMK A;  3P27 A;  1A8P A;  4PC2 A;  1JA0 A;  1EXM A;  4M1K A;  3LVB A;  2RC5 A;  1NDH A;  1ZM4 A;  1QUE A;  3OJW A;  1EFC A;  4EH1 A;  4MYT A;  1GVH A;  1HA3 A;  1D2E A;  1GAW A;  4QFM A;  4G5G A;  4RD6 A;  3CME B;  2YWG A;  5TR9 A;  2BN4 A;  4TMV A;  2QA4 B;  1E63 A;  4RD4 A;  2E1R A;  3OZU A;  3ZZT A;  4B47 A;  3B82 A;  2B7B A;  1VQM B;  1QFY A;  4M4S A;  4Y9U A;  1D1N A;  2XEX A;  3G6E B;  2CND A;  3QFR A;  1FNM A;  4WQM A;  2GPJ A;  1E64 A;  3W2I A;  3VNU A;  2VNH A;  1R5B A;  1QUF A;  3WBK A;  4H9G A;  1K9M D;  1DAR A;  3CCV B;  4YAW A;  1IJF A;  3OW2 B;  3MHP A;  2OTJ B;  1IJE A;  3CD6 B;  4TMW A;  4DQL A;  4B43 A;  4YAU A;  1KD1 D;  3CMA B;  4YHB A;  2YWE A;  2BM1 A;  4B48 A;  3CCQ B;  1AMO A;  2BVN A;  4B3X A;  3U6B A;  1G7T A;  4G1V A;  3WY9 A;  1VQN B;  5FA6 A;  4DQK A;  2QDX A;  2DCU A;  3W2H A;  2VNK A;  1TUI A;  2VNI A;  2C78 A;  1I7P A;  3B8H A;  3CRZ A;  1ELO A;  5JBQ A;  1YI2 B;  4BPR A;  1EP2 B;  2QN6 A;  2VZL A;  3P26 A;  2VNJ A;  3OZW A;  1W34 A;  1DDG A;  1G7C A;  1R5O A;  3JQR A;  1KK3 A;  1F20 A;  4YAL A;  4FN5 A;  3CPW B;  3CC2 B;  4N3G A;  1DG1 G;  3QE2 A;  1ZM3 A;  1QH0 A;  2BSA A;  4AF7 A;  4B4D A;  5EMN A;  1VQK B;  2HMA A;  1R5N A;  1FNB A;  4TN1 A;  3WXM A;  3W2E A;  2HCJ B;  2OTL B;  3CXC B;  4YAF A;  4RD3 A;  3B78 A;  5TV2 A;  3AVV A;  1W35 A;  3W5U A;  3I1F A;  2PLF A;  1ZUN B;  3PEN A;  3MMP A;  3QFT A;  3OZV A;  2D74 A;  4AC9 A;  1FNC A;  3I55 B;  1FRN A;  3WBJ A;  4Y7C A;  4AF6 A;  1YIT B;  1OGI A;  4P6V F;  3CCL B;  2PMD A;  4LBW A;  2GQF A;  2HDN B;  4C0S A;  2QTL A;  2BMW A;  1QGY A;  4PC1 A;  3ZC3 A;  1VQ6 B;  3ES9 A;  1VQ5 B;  1CNE A;  2CRV A;  1YIJ B;  3I56 B;  1M90 D;  2QMU A;  3VO2 A;  4G1B A;  1YJN B;  4RD0 A;  3QFC A;  2C77 A;  1H85 A;  4QHY A;  3WNC A;  4MYU A;  1S0U A;  3AGP A;  1KJZ A;  2QEX B;  3JQQ A;  1KTV A;  3JQP A;  1KQS B;  5H5J A;  2BPO A;  1VQO B;  1OB2 A;  1TTT A;  4HE5 A;  3CCJ B;  1F60 A;  3CCU B;  1KC8 D;  1BX0 A;  1EP3 B;  1BX1 A;  1JNY A;  2RC6 A;  1N8R D;  4P3Y A;  4TMZ A;  4ZGQ B;  4ZCM A;  1EP1 B;  2BGJ A;  1J9Z A;  3CW2 A;  1TLL A;  3CCE B;  2YWH A;  4J0Q A;  4YAO A;  1VQ4 B;  1GJR A;  4IW3 B;  2NPF A;  3AVY A;  2FX3 A;  1JB9 A;  4ACA A;  4FWT A;  4LBV A;  4K1X A;  3WND A;  4RCZ A;  4ZGN B;  3ZBT A;  3WYA A;  4UAJ A;  2J7K A;  4PC6 A;  3W5V A;  5AN9 A;  2X3U A;  1GR1 A;  3CB4 A;  5GV7 A;  5DSZ A;  4U9U A;  4RCY A;  1VQ7 B;  3VO1 A;  2BM0 A;  2PIA A;  1W87 A;  5KSW B;  3VNV A;  3ZBU A;  1EFT A;  4ZV4 A;  1XE1 A;  1N0U A;  3OJX A;  3ZZ0 A;  1QGZ A;  1KK1 A;  3AVT A;  2B7C A;  3WNB A;  3G71 B;  4M2L A;  1DDI A;  2ZIT A;  1B2R A;  1BQE A;  1VQ8 B;  1K8A D;  1EFU A;  5HXB A;  4M53 A;  4R71 A;  1ZM2 A;  3ZZU A;  1W2B B;  1KRH A;  2BV3 A;  1VQ9 B;  1ZM9 A;  4PGO A;  1SM4 A;  4PC3 A;  4N3N A;  1QVG B;  3AVX A;  3U6K A;  4PC7 A;  1JJ2 B;  1CNF A;  1KK0 A;  4TMT A;  4B44 A;  5GV8 A;  1M1K D;  1QFJ A;  3AGQ A;  4LBY A;  1FDR A;  3AVW A;  2DER A;  1BJK A;  2BF4 A;  4C43 A;  3E20 A;  4LBZ A;  2OK8 A;  4ZCL A;  1AIP A;  4FK8 A;  1QG0 A;  1OB5 A;  2EIX A;  1K73 D;  2DY1 A;  4TMX A;  1FRQ A;  1FND A;  4NBS A;  1KK2 A;  1YJ9 B;  2XNC A;  1QFZ A;  4ZCI A;  1YHQ B;  1QVF B;  3QFS A;  3W2G A;  1QGA A;  1Q7Y D;  2DEU A;  4ACB A;  3MCA A;  2VYQ A;  2BGI A;  3QSY A;  3E1Y E;  1VQL B;  1JA1 A;  4M0L A;  1VQP B;  4RJL A;  1OGJ A;  2R6H A;  1QX4 A;  1WDT A;  3V76 A;  3LO8 A;  3SJZ A;  1G7R A;  3W2F A;  3CCM B;  4Y9R A;  3CC7 B;  3FPK A;  1TVC A;  2YWF A;  3AVU A;  3W5H A;  1N0V C;  1SKQ A;  4F7D A;  4RD1 A;  4HE6 A;  1Q81 D;  2B5O A;  1XB2 A;  2OK7 A;  3G4S B;  3FJO A;  3U2Q A;  1H42 A;  2AHO A;  3CC4 B;  4Q7J B;  1EWY A;  1D8T A;  1G7S A;  3J81 k;  5H59 A;  4NCN A;  2EFG A;  1Q82 D;  1B23 P;  5THX A;  5TY0 A;  1YJW B;  1Q86 D;  1CQX A;  2DET A;  1GAQ A;  1NJI D;  2XNJ A;  3CCS B;  3VMF A;  1S72 B;  4RD2 A;  1GO2 A;  1U2R A;  1IB0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...