2CRVA

Solution structure of c-terminal domain of mitochondrial translational initiationfactor 2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
120
structure length
120
Chain Sequence
GSSGSSGYPIGEASILATFTVTEGKKKIPVADCRVQKGQLERHKKFKLIRNGQVIWKGSLTSLKHHKDDISVIKTGMDCGLSLDEEKVEFKPGDQVICYEENKVPTKTSWDPGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of C-terminal domain of mitochondrial translational initiationfactor 2
rcsb
source organism Mus musculus
molecule tags Translation
molecule keywords Translation initiation factor IF-2
total genus 6
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2crvA01
4NCNA 1EXMA 4MYTA 4HE5A 4N3NA 4Q7JB 2YWEA 3QFSA 3ZZ0A 1KK1A 1AMOA 1QGAA 2X3UA 3QFCA 1OGIA 1K73D 4RD4A 4ZCMA 1JA0A 3VO1A 4ACAA 4PC7A 2XNJA 3FJOA 3AVWA 1M90D 4PC2A 1YHQB 1FNMA 4YALA 3W5HA 3SJZA 2CRVA 1KK2A 1KK0A 1GR1A 1EP3B 1G7RA 3CCRB 4WQMA 5KSWB 1VQ9B 1VQNB 3PENA 2BGJA 3CC2B 1BJKA 2BM0A 1GAQA 3I56B 3AGQA 4AC9A 1OB2A 2OK7A 1NDHA 2BN4A 1VQ7B 1DDGA 1F20A 2YWHA 1YJ9B 4AF6A 2QA4B 1E63A 1VQOB 1JA1A 4H9GA 1VQ4B 4F7DA 1W34A 1EFCA 1Q82D 1DARA 3JQQA 4QFMA 2QDXA 1I7PA 4TMVA 1KRHA 1YJWB 4ZV4A 3WY9A 4B44A 3G4SB 1GAWA 3E20A 1D8TA 2BSAA 1ZM9A 5TV2A 2C78A 1VQPB 1BX0A 1N0UA 4RD3A 3W5VA 4FK8A 3CCUB 3CD6B 1Q81D 1JJ2B 4ACBA 4FWTA 4Y9RA 2DETA 3CC7B 2BF4A 3OJXA 3CXCB 1QGZA 5HXBA 2VNIA 2RC5A 3W2EA 2BGIA 2C77A 2BPOA 1BX1A 4YHBA 3W5UA 1QVGB 2VNJA 4YAUA 3CCJB 5JBQA 1QH0A 5DSZA 3QE2A 1Q7YD 2HCJB 1TUIA 1JB9A 4B4DA 1OB5A 1XE1A 1KTVA 2QTZA 3OZVA 1N8RD 1KK3A 1G7TA 5GV7A 3ZZTA 4IW3B 4ZGQB 1J9ZA 4PGOA 1KJZA 3VMFA 1U2RA 1FNCA 3B78A 2VZLA 2YWFA 4TMXA 4M1KA 3QSYA 1ZM2A 2OTJB 2R6HA 1VQKB 3MCAA 3P27A 3JQPA 2OTLB 4G1VA 3WNCA 4QHYA 4M53A 3ZBUA 4C43A 4UAJA 2QMUA 1ZM3A 1QGYA 2VNHA 5GV8A 4PC3A 4RJLA 4LBZA 3W2GA 2FX3A 1YI2B 4PC6A 3OW2B 3WNDA 1G7CA 4G5GA 2QN6A 3ZBTA 4EH1A 3QFTA 2HDNB 3CC4B 1M1KD 4HE6A 3W2HA 3U6BA 2VNKA 4B3XA 3I55B 1QG0A 2B5OA 1CNFA 1FRQA 5EMNA 1D2EA 1G7SA 1SM4A 1R5BA 5H5JA 3OZWA 1ELOA 1EP2B 1CNEA 2XEXA 4ZCIA 3CMEB 1R5NA 4RD1A 1YITB 1YJNB 1N0VC 1QFYA 3WYAA 3FPKA 4RCZA 1W87A 1KC8D 5H59A 1EFUA 1S72B 4M2LA 3CCMB 1B23P 3AVUA 1R5OA 4ZGNB 1Q86D 2BMWA 4LBYA 2BV3A 4TN1A 3G6EB 1W35A 2GPJA 2B7BA 1VQMB 3WBJA 1GO2A 3QFRA 4M4SA 2PLFA 1VQ5B 1TLLA 3B8HA 1DDIA 1H42A 3J81k 3VNUA 2E1RA 1JNYA 3CCLB 1OGJA 3OJWA 3WNBA 4ZCLA 1KQSB 1FDRA 4R71A 3JQRA 2RC6A 1E62A 2J7KA 4MYUA 3OZUA 2HMAA 2AHOA 1ZM4A 2YWGA 4P3YA 4M0LA 3AVXA 4Y7CA 3U2QA 4B47A 4K1XA 2NPFA 3ES9A 3CCSB 3MMPA 1FNBA 5THXA 5TY0A 1F60A 3I1FA 2PIAA 1EFTA 4YAWA 2ZITA 1EWYA 1AIPA 4B48A 1TTTA 1YIJB 1VQ8B 4RD0A 4PC1A 4YAOA 2EFGA 3AVYA 3W2FA 1IJEA 3MHPA 1E64A 4NBSA 3CB4A 3CCVB 1IJFA 1XB2A 3CCQB 1B2RA 1FNDA 4N3GA 4DQLA 3U6KA 1VQLB 4LC0A 3W2IA 2DERA 3VO2A 2EIXA 5AN9A 1H85A 4DQKA 2QEXB 2XNCA 1EP1B 3AGPA 4RD6A 4J0QA 3AVTA 1QX4A 3B82A 1GJRA 1GVHA 1NJID 1W2BB 1WDTA 1UMKA 1FRNA 1QFZA 4BPRA 4B43A 2QTLA 1K9MD 1QVFB 3AVVA 4TMZA 3LO8A 4TMWA 3ZZUA 3P26A 1QUEA 3WBKA 1SKQA 4TMTA 1TVCA 2B7CA 2DCUA 3CPWB 4AF7A 2DY1A 1KD1D 4LBWA 4RCYA 4P6VF 2GQFA 4FN5A 2PMDA 3CMAB 1ZUNB 1QUFA 3ZC3A 3CRZA 3VNVA 1K8AD 1A8PA 1S0UA 3E1YE 3V76A 1D1NA 1DG1G 5TR9A 5FA6A 1CQXA 3CCEB 1BQEA 4Y9UA 4C0SA 4LBVA 3G71B 2CNDA 2OK8A 4YAFA 2VYQA 1HA3A 2BM1A 4U9UA 2BVNA 1VQ6B 1QFJA 3WXMA 4RD2A 2DEUA 1IB0A 3LVBA 3CW2A 2D74A 4G1BA
chains in the Genus database with same CATH superfamily
2VBVA 4NCNA 5J3OA 1EXMA 2I1LA 4MYTA 1N06A 4HE5A 4N3NA 1I8DA 4Q7JB 2YWEA 3QFSA 3ZZ0A 1E3XA 1VHOA 1KK1A 3A1PA 1AMOA 1QGAA 2X3UA 3QFCA 4HIZA 2D3LA 1OGIA 5BSXA 1K73D 4RD4A 4ZCMA 1JA0A 3VO1A 4ACAA 3Q3AA 4PC7A 2XNJA 3BCDA 3FJOA 2WZPP 1M90D 3AVWA 4ASUA 5DN6A 2XZOA 2JIZA 4PC2A 1IHMA 4QVAA 1YHQB 1NRKA 1KMHA 1FNMA 1P4MA 4YALA 3T53B 5TRDA 3BQJA 3W5HA 2ZL5A 3SJZA 2WZNA 2C5HA 2CRVA 1KK2A 4P2NA 2DOGA 4Z4YA 2C4UA 4P1VA 4Z4RA 1KK0A 5FO0A 4DNRB 1GR1A 1EP3B 1XFOA 1G7RA 3CCRB 2GJRA 2V7UA 3R6KA 4P22A 4WQMA 5KSWB 1VQ9B 1VQNB 4B3GA 2V4DA 3SLDA 2ZXIA 3PENA 4X7FA 3SKBA 2HLDA 2BGJA 3CC2B 1BJKA 1Q9SA 2BM0A 2F1MA 5CDFA 1GAQA 2P3MA 3I56B 4YEJA 2GK6A 1V0EA 3AGQA 5KNLA 4AC9A 3RY8A 1OB2A 1T6ZA 4XOPA 2OK7A 1NDHA 2XGJA 3GVJA 4OOSA 4DK0A 2BN4A 1VQ7B 1DDGA 3OW7A 3Q38A 4DK1A 3SJPA 1F20A 3Q6RA 4X7EA 2JN9A 2YWHA 1PJ6A 1YJ9B 4XLAA 5FIUA 4AF6A 2Z6BD 2QA4B 1E63A 1VQOB 2F4NA 1JA1A 4NNJA 1UD3A 4H9GA 1VQ4B 3OAAA 5F4MA 1N05A 1HVXA 2V7QA 4F7DA 1W34A 1EFCA 1Q82D 3HAGA 4YELA 1DARA 3JQQA 4QFMA 2QDXA 4WZTA 2QE7A 1I7PA 5HZBA 4TMVA 1KRHA 4XQFA 4XKVA 4XLFA 1OB0A 1YJWB 3ZPNA 5A8AA 4DNTB 4WZLA 1N08A 1T6YA 4ZV4A 3WY9A 4B44A 3G4SB 2V7XA 1GAWA 3E20A 1D8TA 2BSAA 1ZM9A 5TV2A 2C78A 2X0KA 1VQPB 2ZTNA 1BX0A 3G05A 1N0UA 2ZZFA 4GQNA 4RD3A 3W5VA 4FK8A 2Q6LA 4XNFA 3CCUB 3BCFA 2X85A 3CD6B 3LNNA 3CP8A 3T51B 1Q81D 3CTAA 1JJ2B 4TSFA 4ACBA 2JJ1A 3H9NA 2C4TA 4FWTA 1NBMA 4Y9RA 2DETA 3CC7B 2BF4A 3OJXA 4X7DA 3CXCB 4G6IA 1QGZA 5HXBA 2VNIA 5DS0A 5J35A 5L46A 2KVOA 2RC5A 3W2EA 2BGIA 2X6WA 2C77A 1UD5A 2BPOA 1BX1A 4YHBA 2XOKA 3W5UA 1S4MA 1QVGB 1OHHA 2WJYA 2VNJA 4XN3A 2WSSA 4YAUA 3CCJB 5JBQA 2OBTA 1QH0A 3OEEA 1WOPA 5DSZA 2VJIA 3GIRA 1PJ5A 2Q6OA 3QE2A 1Q7YD 4X07A 4XL9A 4B3FX 1E79A 5F4JA 2HCJB 1TUIA 1E1QA 1JB9A 2DYIA 4P6YA 4B4DA 1OB5A 1XE1A 1KTVA 2CK3A 2QTZA 3OZVA 1N8RD 2CC2A 5IYPA 1KK3A 2LZJA 1G7TA 3GVLA 1HZEA 1T6XA 5GV7A 3ZZTA 4IW3B 4ZGQB 3R6JA 2WR8A 1J9ZA 2WPDA 4PGOA 5FNZA 1KJZA 2VBSA 3VMFA 1U2RA 1WTHD 3VR6A 4II2A 4OPVA 1FNCA 3B78A 2VZLA 2YWFA 1VJSA 1VLYA 4RDJA 4M1KA 4TMXA 4RDLA 3PA2A 3QSYA 1ZM2A 2OTJB 3OPOA 2X8KA 2OYNA 2ZZEA 1MRZA 4P25A 2GJKA 3OFNA 5B6IA 2R6HA 1VQKB 3MCAA 1VLOA 3PUMA 3P27A 3A3GA 3JQPA 2OTLB 4G1VA 3WNCA 3OP1A 4OPOA 4M53A 4QHYA 3GQBA 3ZBUA 5BSYA 2NV4A 4C43A 2X53S 4UAJA 2VBUA 5A89A 2QMUA 1ZM3A 1BLIA 1QGYA 3ASQA 2VNHA 4XKWA 5GV8A 4PC3A 4P26A 1H8HA 4P9SA 4XN0A 1WSVA 2CBXA 3LQ6A 3BC9A 4RJLA 2D3NA 2ZBUA 4LBZA 3W2GA 2FX3A 2JJ2A 4G7WA 1YI2B 4PC6A 3OW2B 3ISXA 3WNDA 1G7CA 4QUZA 3ASPA 4G5GA 2QN6A 1H8EA 3A3BA 3ZBTA 5E6TA 4ROXA 4EH1A 1W9XA 4AVZA 5A88A 3QFTA 2VJJA 2HDNB 3CC4B 1YX2A 1WOOA 1M1KD 3V7AA 1XQBA 3H94A 3Q39A 4OP7A 4HE6A 3W2HA 3U6BA 2VNKA 5LMZA 2X6YA 4B3XA 3I55B 1QG0A 4XR6A 1PKVA 2B5OA 1CNFA 4XMYA 1V5VA 1FRQA 4RLZA 3Q6QA 5EMNA 1WP6A 3PA1A 3ASSA 1D2EA 1G7SA 1SM4A 4YXWA 1R5BA 2W6IA 3OZWA 5H5JA 1ELOA 1RQPA 3ZUGA 1EP2B 1CNEA 2XEXA 5F4OA 2JDIA 5IYQA 4ZCIA 3CMEB 1R5NA 3ASRA 3ONUA 1N07A 4RD1A 1Y0YA 3ASTA 1YITB 3BY2A 1YJNB 1N0VC 1QFYA 3A8IA 3GSIA 3WYAA 4RDKA 4Z1MA 3FPKA 4RCZA 3OE7A 1W87A 5HZAA 4WZKA 3A8KA 1KC8D 1E3ZA 5H59A 1EFUA 4OOVA 1S72B 2XZPA 4M2LA 2F1LA 3CCMB 2Q6IA 1B23P 3AVUA 2ZZGA 1R5OA 4ZGNB 3ZIAA 1Q86D 2BMWA 4LBYA 2BV3A 4P3IA 5IK2A 4TN1A 3G6EB 1W35A 2F43A 2B7BA 2GPJA 1K28D 1VQMB 4UZEA 3WBJA 4UZUA 4Z4TA 1GO2A 3QFRA 4M4SA 4G7XA 2PLFA 1VQ5B 1TLLA 3B8HA 1DDIA 1H42A 4X8IA 1V0FA 3FKSA 1RQRA 3J81k 3VNUA 2E1RA 1JNYA 2OBSA 3CCLB 4QV2A 1OGJA 3JU4A 3CESA 3OJWA 3WNBA 4ZCLA 3CP2A 1KQSB 1FDRA 4PAAA 5IYRA 4OPSA 4R71A 1WOSA 4Z4UA 1NB0A 4E0FA 4X7CA 3JQRA 2RC6A 2XZLA 1EFRA 3PVDA 5IYWA 1E62A 2J7KA 4MYUA 4Z4WA 3OZUA 2HMAA 2ZL6A 1I18A 2AHOA 3WQZA 1ZM4A 2YWGA 2GK7A 2DIEA 1FX0A 4P3YA 4XLHA 4CQJA 4M0LA 3AVXA 4Y7CA 2FVGA 3U2QA 4B47A 4TKOB 1NB9A 2D9RA 4K1XA 2NPFA 3T56B 3ES9A 3CCSB 3MMPA 3GVKA 2ZBVA 4XLEA 1FNBA 5THXA 1E1RA 5TY0A 3SEJA 1F60A 3I1FA 2PIAA 3CPXA 1EFTA 4YAWA 2WYRA 2ZITA 1WSRA 1EWYA 5HKKA 2CF4A 1AIPA 2V7WA 1UD6A 4B48A 1TTTA 4KKSA 1YIJB 1VQ8B 4RD0A 4OOXA 4PC1A 4YAOA 2EFGA 2OBRA 3AVYA 5FO1A 3W2FA 2WJVA 3OKXA 1IJEA 1UD8A 3MHPA 1E64A 4NBSA 3NE5B 3CB4A 1YLOA 2XNDA 5FL7A 1WORA 3CCVB 1IJFA 1XB2A 1COWA 2PE3A 3CCQB 1B2RA 1FNDA 4N3GA 4RPDA 4DQLA 3PUNA 3U6KA 1VQLB 4LC0A 3BH4A 3W2IA 2DERA 2M5SA 3VO2A 2ZTGA 2E1BA 4KKUA 2EIXA 4XD7A 5AN9A 1H85A 2R9VA 4DQKA 2QEXB 4RPBA 1E43A 2XNCA 3ONYA 4WZEA 1BMFA 4XLCA 4Z4VA 4WWVA 1EP1B 4X05A 5IYNA 2C2WA 3AGPA 1VF7A 4RD6A 2X6XA 3OEHA 4J0QA 4II3A 4X06A 3AVTA 1QX4A 2ZXHA 2V31A 1BPLA 1UD2A 2V7VA 3B82A 1GJRA 1GVHA 1NJID 3BNWA 1WDTA 1W2BB 1SKYB 1UMKA 1FRNA 1QFZA 3OOCA 4B43A 4BPRA 1WPCA 5KW9A 2QTLA 1K9MD 4XOTA 1QVFB 3AVVA 4TMZA 3LO8A 1T5EA 4TMWA 1PJ7A 1UD4A 3ZZUA 1MABA 3P26A 1QUEA 3WBKA 2VBTA 1SKQA 4TT3A 4TMTA 1TVCA 2B7CA 2DCUA 4L8JA 3FPPA 4AF7A 4XONA 2DY1A 3CPWB 1KD1D 1WU8A 4LBWA 3LQEA 4P12A 4RCYA 2V7TA 4P6VF 2GQFA 3SLNA 3A8JA 4FN5A 2GREA 2PMDA 4PABA 3CMAB 1ZUNB 4QVJA 1QUFA 2C5BA 4XORA 3ZC3A 3A35A 3CRZA 2QGGA 3CMMA 3VNVA 1W0KA 1W0JA 2Q6KA 1K8AD 1A8PA 1S0UA 3E1YE 4JMQA 4Z4ZA 1VHEA 3V76A 2GJPA 4FXUA 1DG1G 3BY1A 1D1NA 5TR9A 2ZZQA 5FA6A 4KKTA 2W6JA 4RM0A 2CW5A 3KEWA 1CQXA 3CCEB 4UZFA 3DDYA 1Y0RA 3KL9A 4Z4SA 1BQEA 4Y9UA 4C0SA 4LBVA 3G71B 2CNDA 4XM3A 2OK8A 4YAFA 2VYQA 4X0CA 1HA3A 2BM1A 2BVNA 4U9UA 1VQ6B 1QFJA 3WXMA 4RD2A 1KZLA 2DEUA 1IB0A 3LVBA 2ZL7A 3CW2A 3D26A 2D74A 4G1BA
chains in the Genus database with same CATH topology
4NCNA 1EXMA 4MYTA 4HE5A 4N3NA 4Q7JB 2YWEA 3QFSA 3ZZ0A 1KK1A 1AMOA 1QGAA 2X3UA 3QFCA 1OGIA 1K73D 4RD4A 4ZCMA 1JA0A 3VO1A 4ACAA 4PC7A 2XNJA 3FJOA 3AVWA 1M90D 4PC2A 1YHQB 1FNMA 4YALA 3W5HA 3SJZA 2CRVA 1KK2A 1KK0A 1GR1A 1EP3B 1G7RA 3CCRB 4WQMA 5KSWB 1VQ9B 1VQNB 3PENA 2BGJA 3CC2B 1BJKA 2BM0A 1GAQA 3I56B 3AGQA 4AC9A 1OB2A 2OK7A 1NDHA 2BN4A 1VQ7B 1DDGA 1F20A 2YWHA 1YJ9B 4AF6A 2QA4B 1E63A 1VQOB 1JA1A 4H9GA 1VQ4B 4F7DA 1W34A 1EFCA 1Q82D 1DARA 3JQQA 4QFMA 2QDXA 1I7PA 4TMVA 1KRHA 1YJWB 4ZV4A 3WY9A 4B44A 3G4SB 1GAWA 3E20A 1D8TA 2BSAA 1ZM9A 5TV2A 2C78A 1VQPB 1BX0A 1N0UA 4RD3A 3W5VA 4FK8A 3CCUB 3CD6B 1Q81D 1JJ2B 4ACBA 4FWTA 4Y9RA 2DETA 3CC7B 2BF4A 3OJXA 3CXCB 1QGZA 5HXBA 2VNIA 2RC5A 3W2EA 2BGIA 2C77A 2BPOA 1BX1A 4YHBA 3W5UA 1QVGB 2VNJA 4YAUA 3CCJB 5JBQA 1QH0A 5DSZA 3QE2A 1Q7YD 2HCJB 1TUIA 1JB9A 4B4DA 1OB5A 1XE1A 1KTVA 2QTZA 3OZVA 1N8RD 1KK3A 1G7TA 5GV7A 3ZZTA 4IW3B 4ZGQB 1J9ZA 4PGOA 1KJZA 3VMFA 1U2RA 1FNCA 3B78A 2VZLA 2YWFA 4TMXA 4M1KA 3QSYA 1ZM2A 2OTJB 2R6HA 1VQKB 3MCAA 3P27A 3JQPA 2OTLB 4G1VA 3WNCA 4QHYA 4M53A 3ZBUA 4C43A 4UAJA 2QMUA 1ZM3A 1QGYA 2VNHA 5GV8A 4PC3A 4RJLA 4LBZA 3W2GA 2FX3A 1YI2B 4PC6A 3OW2B 3WNDA 1G7CA 4G5GA 2QN6A 3ZBTA 4EH1A 3QFTA 2HDNB 3CC4B 1M1KD 4HE6A 3W2HA 3U6BA 2VNKA 4B3XA 3I55B 1QG0A 2B5OA 1CNFA 1FRQA 5EMNA 1D2EA 1G7SA 1SM4A 1R5BA 5H5JA 3OZWA 1ELOA 1EP2B 1CNEA 2XEXA 4ZCIA 3CMEB 1R5NA 4RD1A 1YITB 1YJNB 1N0VC 1QFYA 3WYAA 3FPKA 4RCZA 1W87A 1KC8D 5H59A 1EFUA 1S72B 4M2LA 3CCMB 1B23P 3AVUA 1R5OA 4ZGNB 1Q86D 2BMWA 4LBYA 2BV3A 4TN1A 3G6EB 1W35A 2GPJA 2B7BA 1VQMB 3WBJA 1GO2A 3QFRA 4M4SA 2PLFA 1VQ5B 1TLLA 3B8HA 1DDIA 1H42A 3J81k 3VNUA 2E1RA 1JNYA 3CCLB 1OGJA 3OJWA 3WNBA 4ZCLA 1KQSB 1FDRA 4R71A 3JQRA 2RC6A 1E62A 2J7KA 4MYUA 3OZUA 2HMAA 2AHOA 1ZM4A 2YWGA 4P3YA 4M0LA 3AVXA 4Y7CA 3U2QA 4B47A 4K1XA 2NPFA 3ES9A 3CCSB 3MMPA 1FNBA 5THXA 5TY0A 1F60A 3I1FA 2PIAA 1EFTA 4YAWA 2ZITA 1EWYA 1AIPA 4B48A 1TTTA 1YIJB 1VQ8B 4RD0A 4PC1A 4YAOA 2EFGA 3AVYA 3W2FA 1IJEA 3MHPA 1E64A 4NBSA 3CB4A 3CCVB 1IJFA 1XB2A 3CCQB 1B2RA 1FNDA 4N3GA 4DQLA 3U6KA 1VQLB 4LC0A 3W2IA 2DERA 3VO2A 2EIXA 5AN9A 1H85A 4DQKA 2QEXB 2XNCA 1EP1B 3AGPA 4RD6A 4J0QA 3AVTA 1QX4A 3B82A 1GJRA 1GVHA 1NJID 1W2BB 1WDTA 1UMKA 1FRNA 1QFZA 4BPRA 4B43A 2QTLA 1K9MD 1QVFB 3AVVA 4TMZA 3LO8A 4TMWA 3ZZUA 3P26A 1QUEA 3WBKA 1SKQA 4TMTA 1TVCA 2B7CA 2DCUA 3CPWB 4AF7A 2DY1A 1KD1D 4LBWA 4RCYA 4P6VF 2GQFA 4FN5A 2PMDA 3CMAB 1ZUNB 1QUFA 3ZC3A 3CRZA 3VNVA 1K8AD 1A8PA 1S0UA 3E1YE 3V76A 1D1NA 1DG1G 5TR9A 5FA6A 1CQXA 3CCEB 1BQEA 4Y9UA 4C0SA 4LBVA 3G71B 2CNDA 2OK8A 4YAFA 2VYQA 1HA3A 2BM1A 4U9UA 2BVNA 1VQ6B 1QFJA 3WXMA 4RD2A 2DEUA 1IB0A 3LVBA 3CW2A 2D74A 4G1BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NCN A;  1EXM A;  4MYT A;  4HE5 A;  4N3N A;  4Q7J B;  2YWE A;  3QFS A;  3ZZ0 A;  1KK1 A;  1AMO A;  1QGA A;  2X3U A;  3QFC A;  1OGI A;  1K73 D;  4RD4 A;  4ZCM A;  1JA0 A;  3VO1 A;  4ACA A;  4PC7 A;  2XNJ A;  3FJO A;  3AVW A;  1M90 D;  4PC2 A;  1YHQ B;  1FNM A;  4YAL A;  3W5H A;  3SJZ A;  2CRV A;  1KK2 A;  1KK0 A;  1GR1 A;  1EP3 B;  1G7R A;  3CCR B;  4WQM A;  5KSW B;  1VQ9 B;  1VQN B;  3PEN A;  2BGJ A;  3CC2 B;  1BJK A;  2BM0 A;  1GAQ A;  3I56 B;  3AGQ A;  4AC9 A;  1OB2 A;  2OK7 A;  1NDH A;  2BN4 A;  1VQ7 B;  1DDG A;  1F20 A;  2YWH A;  1YJ9 B;  4AF6 A;  2QA4 B;  1E63 A;  1VQO B;  1JA1 A;  4H9G A;  1VQ4 B;  4F7D A;  1W34 A;  1EFC A;  1Q82 D;  1DAR A;  3JQQ A;  4QFM A;  2QDX A;  1I7P A;  4TMV A;  1KRH A;  1YJW B;  4ZV4 A;  3WY9 A;  4B44 A;  3G4S B;  1GAW A;  3E20 A;  1D8T A;  2BSA A;  1ZM9 A;  5TV2 A;  2C78 A;  1VQP B;  1BX0 A;  1N0U A;  4RD3 A;  3W5V A;  4FK8 A;  3CCU B;  3CD6 B;  1Q81 D;  1JJ2 B;  4ACB A;  4FWT A;  4Y9R A;  2DET A;  3CC7 B;  2BF4 A;  3OJX A;  3CXC B;  1QGZ A;  5HXB A;  2VNI A;  2RC5 A;  3W2E A;  2BGI A;  2C77 A;  2BPO A;  1BX1 A;  4YHB A;  3W5U A;  1QVG B;  2VNJ A;  4YAU A;  3CCJ B;  5JBQ A;  1QH0 A;  5DSZ A;  3QE2 A;  1Q7Y D;  2HCJ B;  1TUI A;  1JB9 A;  4B4D A;  1OB5 A;  1XE1 A;  1KTV A;  2QTZ A;  3OZV A;  1N8R D;  1KK3 A;  1G7T A;  5GV7 A;  3ZZT A;  4IW3 B;  4ZGQ B;  1J9Z A;  4PGO A;  1KJZ A;  3VMF A;  1U2R A;  1FNC A;  3B78 A;  2VZL A;  2YWF A;  4TMX A;  4M1K A;  3QSY A;  1ZM2 A;  2OTJ B;  2R6H A;  1VQK B;  3MCA A;  3P27 A;  3JQP A;  2OTL B;  4G1V A;  3WNC A;  4QHY A;  4M53 A;  3ZBU A;  4C43 A;  4UAJ A;  2QMU A;  1ZM3 A;  1QGY A;  2VNH A;  5GV8 A;  4PC3 A;  4RJL A;  4LBZ A;  3W2G A;  2FX3 A;  1YI2 B;  4PC6 A;  3OW2 B;  3WND A;  1G7C A;  4G5G A;  2QN6 A;  3ZBT A;  4EH1 A;  3QFT A;  2HDN B;  3CC4 B;  1M1K D;  4HE6 A;  3W2H A;  3U6B A;  2VNK A;  4B3X A;  3I55 B;  1QG0 A;  2B5O A;  1CNF A;  1FRQ A;  5EMN A;  1D2E A;  1G7S A;  1SM4 A;  1R5B A;  5H5J A;  3OZW A;  1ELO A;  1EP2 B;  1CNE A;  2XEX A;  4ZCI A;  3CME B;  1R5N A;  4RD1 A;  1YIT B;  1YJN B;  1N0V C;  1QFY A;  3WYA A;  3FPK A;  4RCZ A;  1W87 A;  1KC8 D;  5H59 A;  1EFU A;  1S72 B;  4M2L A;  3CCM B;  1B23 P;  3AVU A;  1R5O A;  4ZGN B;  1Q86 D;  2BMW A;  4LBY A;  2BV3 A;  4TN1 A;  3G6E B;  1W35 A;  2GPJ A;  2B7B A;  1VQM B;  3WBJ A;  1GO2 A;  3QFR A;  4M4S A;  2PLF A;  1VQ5 B;  1TLL A;  3B8H A;  1DDI A;  1H42 A;  3J81 k;  3VNU A;  2E1R A;  1JNY A;  3CCL B;  1OGJ A;  3OJW A;  3WNB A;  4ZCL A;  1KQS B;  1FDR A;  4R71 A;  3JQR A;  2RC6 A;  1E62 A;  2J7K A;  4MYU A;  3OZU A;  2HMA A;  2AHO A;  1ZM4 A;  2YWG A;  4P3Y A;  4M0L A;  3AVX A;  4Y7C A;  3U2Q A;  4B47 A;  4K1X A;  2NPF A;  3ES9 A;  3CCS B;  3MMP A;  1FNB A;  5THX A;  5TY0 A;  1F60 A;  3I1F A;  2PIA A;  1EFT A;  4YAW A;  2ZIT A;  1EWY A;  1AIP A;  4B48 A;  1TTT A;  1YIJ B;  1VQ8 B;  4RD0 A;  4PC1 A;  4YAO A;  2EFG A;  3AVY A;  3W2F A;  1IJE A;  3MHP A;  1E64 A;  4NBS A;  3CB4 A;  3CCV B;  1IJF A;  1XB2 A;  3CCQ B;  1B2R A;  1FND A;  4N3G A;  4DQL A;  3U6K A;  1VQL B;  4LC0 A;  3W2I A;  2DER A;  3VO2 A;  2EIX A;  5AN9 A;  1H85 A;  4DQK A;  2QEX B;  2XNC A;  1EP1 B;  3AGP A;  4RD6 A;  4J0Q A;  3AVT A;  1QX4 A;  3B82 A;  1GJR A;  1GVH A;  1NJI D;  1W2B B;  1WDT A;  1UMK A;  1FRN A;  1QFZ A;  4BPR A;  4B43 A;  2QTL A;  1K9M D;  1QVF B;  3AVV A;  4TMZ A;  3LO8 A;  4TMW A;  3ZZU A;  3P26 A;  1QUE A;  3WBK A;  1SKQ A;  4TMT A;  1TVC A;  2B7C A;  2DCU A;  3CPW B;  4AF7 A;  2DY1 A;  1KD1 D;  4LBW A;  4RCY A;  4P6V F;  2GQF A;  4FN5 A;  2PMD A;  3CMA B;  1ZUN B;  1QUF A;  3ZC3 A;  3CRZ A;  3VNV A;  1K8A D;  1A8P A;  1S0U A;  3E1Y E;  3V76 A;  1D1N A;  1DG1 G;  5TR9 A;  5FA6 A;  1CQX A;  3CCE B;  1BQE A;  4Y9U A;  4C0S A;  4LBV A;  3G71 B;  2CND A;  2OK8 A;  4YAF A;  2VYQ A;  1HA3 A;  2BM1 A;  4U9U A;  2BVN A;  1VQ6 B;  1QFJ A;  3WXM A;  4RD2 A;  2DEU A;  1IB0 A;  3LVB A;  3CW2 A;  2D74 A;  4G1B A; 
#chains in the Genus database with same CATH topology
 2VBV A;  4NCN A;  5J3O A;  1EXM A;  2I1L A;  4MYT A;  1N06 A;  4HE5 A;  4N3N A;  1I8D A;  4Q7J B;  2YWE A;  3QFS A;  3ZZ0 A;  1E3X A;  1VHO A;  1KK1 A;  3A1P A;  1AMO A;  1QGA A;  2X3U A;  3QFC A;  4HIZ A;  2D3L A;  1OGI A;  5BSX A;  1K73 D;  4RD4 A;  4ZCM A;  1JA0 A;  3VO1 A;  4ACA A;  3Q3A A;  4PC7 A;  2XNJ A;  3BCD A;  3FJO A;  2WZP P;  1M90 D;  3AVW A;  4ASU A;  5DN6 A;  2XZO A;  2JIZ A;  4PC2 A;  1IHM A;  4QVA A;  1YHQ B;  1NRK A;  1KMH A;  1FNM A;  1P4M A;  4YAL A;  3T53 B;  5TRD A;  3BQJ A;  3W5H A;  2ZL5 A;  3SJZ A;  2WZN A;  2C5H A;  2CRV A;  1KK2 A;  4P2N A;  2DOG A;  4Z4Y A;  2C4U A;  4P1V A;  4Z4R A;  1KK0 A;  5FO0 A;  4DNR B;  1GR1 A;  1EP3 B;  1XFO A;  1G7R A;  3CCR B;  2GJR A;  2V7U A;  3R6K A;  4P22 A;  4WQM A;  5KSW B;  1VQ9 B;  1VQN B;  4B3G A;  2V4D A;  3SLD A;  2ZXI A;  3PEN A;  4X7F A;  3SKB A;  2HLD A;  2BGJ A;  3CC2 B;  1BJK A;  1Q9S A;  2BM0 A;  2F1M A;  5CDF A;  1GAQ A;  2P3M A;  3I56 B;  4YEJ A;  2GK6 A;  1V0E A;  3AGQ A;  5KNL A;  4AC9 A;  3RY8 A;  1OB2 A;  1T6Z A;  4XOP A;  2OK7 A;  1NDH A;  2XGJ A;  3GVJ A;  4OOS A;  4DK0 A;  2BN4 A;  1VQ7 B;  1DDG A;  3OW7 A;  3Q38 A;  4DK1 A;  3SJP A;  1F20 A;  3Q6R A;  4X7E A;  2JN9 A;  2YWH A;  1PJ6 A;  1YJ9 B;  4XLA A;  5FIU A;  4AF6 A;  2Z6B D;  2QA4 B;  1E63 A;  1VQO B;  2F4N A;  1JA1 A;  4NNJ A;  1UD3 A;  4H9G A;  1VQ4 B;  3OAA A;  5F4M A;  1N05 A;  1HVX A;  2V7Q A;  4F7D A;  1W34 A;  1EFC A;  1Q82 D;  3HAG A;  4YEL A;  1DAR A;  3JQQ A;  4QFM A;  2QDX A;  4WZT A;  2QE7 A;  1I7P A;  5HZB A;  4TMV A;  1KRH A;  4XQF A;  4XKV A;  4XLF A;  1OB0 A;  1YJW B;  3ZPN A;  5A8A A;  4DNT B;  4WZL A;  1N08 A;  1T6Y A;  4ZV4 A;  3WY9 A;  4B44 A;  3G4S B;  2V7X A;  1GAW A;  3E20 A;  1D8T A;  2BSA A;  1ZM9 A;  5TV2 A;  2C78 A;  2X0K A;  1VQP B;  2ZTN A;  1BX0 A;  3G05 A;  1N0U A;  2ZZF A;  4GQN A;  4RD3 A;  3W5V A;  4FK8 A;  2Q6L A;  4XNF A;  3CCU B;  3BCF A;  2X85 A;  3CD6 B;  3LNN A;  3CP8 A;  3T51 B;  1Q81 D;  3CTA A;  1JJ2 B;  4TSF A;  4ACB A;  2JJ1 A;  3H9N A;  2C4T A;  4FWT A;  1NBM A;  4Y9R A;  2DET A;  3CC7 B;  2BF4 A;  3OJX A;  4X7D A;  3CXC B;  4G6I A;  1QGZ A;  5HXB A;  2VNI A;  5DS0 A;  5J35 A;  5L46 A;  2KVO A;  2RC5 A;  3W2E A;  2BGI A;  2X6W A;  2C77 A;  1UD5 A;  2BPO A;  1BX1 A;  4YHB A;  2XOK A;  3W5U A;  1S4M A;  1QVG B;  1OHH A;  2WJY A;  2VNJ A;  4XN3 A;  2WSS A;  4YAU A;  3CCJ B;  5JBQ A;  2OBT A;  1QH0 A;  3OEE A;  1WOP A;  5DSZ A;  2VJI A;  3GIR A;  1PJ5 A;  2Q6O A;  3QE2 A;  1Q7Y D;  4X07 A;  4XL9 A;  4B3F X;  1E79 A;  5F4J A;  2HCJ B;  1TUI A;  1E1Q A;  1JB9 A;  2DYI A;  4P6Y A;  4B4D A;  1OB5 A;  1XE1 A;  1KTV A;  2CK3 A;  2QTZ A;  3OZV A;  1N8R D;  2CC2 A;  5IYP A;  1KK3 A;  2LZJ A;  1G7T A;  3GVL A;  1HZE A;  1T6X A;  5GV7 A;  3ZZT A;  4IW3 B;  4ZGQ B;  3R6J A;  2WR8 A;  1J9Z A;  2WPD A;  4PGO A;  5FNZ A;  1KJZ A;  2VBS A;  3VMF A;  1U2R A;  1WTH D;  3VR6 A;  4II2 A;  4OPV A;  1FNC A;  3B78 A;  2VZL A;  2YWF A;  1VJS A;  1VLY A;  4RDJ A;  4M1K A;  4TMX A;  4RDL A;  3PA2 A;  3QSY A;  1ZM2 A;  2OTJ B;  3OPO A;  2X8K A;  2OYN A;  2ZZE A;  1MRZ A;  4P25 A;  2GJK A;  3OFN A;  5B6I A;  2R6H A;  1VQK B;  3MCA A;  1VLO A;  3PUM A;  3P27 A;  3A3G A;  3JQP A;  2OTL B;  4G1V A;  3WNC A;  3OP1 A;  4OPO A;  4M53 A;  4QHY A;  3GQB A;  3ZBU A;  5BSY A;  2NV4 A;  4C43 A;  2X53 S;  4UAJ A;  2VBU A;  5A89 A;  2QMU A;  1ZM3 A;  1BLI A;  1QGY A;  3ASQ A;  2VNH A;  4XKW A;  5GV8 A;  4PC3 A;  4P26 A;  1H8H A;  4P9S A;  4XN0 A;  1WSV A;  2CBX A;  3LQ6 A;  3BC9 A;  4RJL A;  2D3N A;  2ZBU A;  4LBZ A;  3W2G A;  2FX3 A;  2JJ2 A;  4G7W A;  1YI2 B;  4PC6 A;  3OW2 B;  3ISX A;  3WND A;  1G7C A;  4QUZ A;  3ASP A;  4G5G A;  2QN6 A;  1H8E A;  3A3B A;  3ZBT A;  5E6T A;  4ROX A;  4EH1 A;  1W9X A;  4AVZ A;  5A88 A;  3QFT A;  2VJJ A;  2HDN B;  3CC4 B;  1YX2 A;  1WOO A;  1M1K D;  3V7A A;  1XQB A;  3H94 A;  3Q39 A;  4OP7 A;  4HE6 A;  3W2H A;  3U6B A;  2VNK A;  5LMZ A;  2X6Y A;  4B3X A;  3I55 B;  1QG0 A;  4XR6 A;  1PKV A;  2B5O A;  1CNF A;  4XMY A;  1V5V A;  1FRQ A;  4RLZ A;  3Q6Q A;  5EMN A;  1WP6 A;  3PA1 A;  3ASS A;  1D2E A;  1G7S A;  1SM4 A;  4YXW A;  1R5B A;  2W6I A;  3OZW A;  5H5J A;  1ELO A;  1RQP A;  3ZUG A;  1EP2 B;  1CNE A;  2XEX A;  5F4O A;  2JDI A;  5IYQ A;  4ZCI A;  3CME B;  1R5N A;  3ASR A;  3ONU A;  1N07 A;  4RD1 A;  1Y0Y A;  3AST A;  1YIT B;  3BY2 A;  1YJN B;  1N0V C;  1QFY A;  3A8I A;  3GSI A;  3WYA A;  4RDK A;  4Z1M A;  3FPK A;  4RCZ A;  3OE7 A;  1W87 A;  5HZA A;  4WZK A;  3A8K A;  1KC8 D;  1E3Z A;  5H59 A;  1EFU A;  4OOV A;  1S72 B;  2XZP A;  4M2L A;  2F1L A;  3CCM B;  2Q6I A;  1B23 P;  3AVU A;  2ZZG A;  1R5O A;  4ZGN B;  3ZIA A;  1Q86 D;  2BMW A;  4LBY A;  2BV3 A;  4P3I A;  5IK2 A;  4TN1 A;  3G6E B;  1W35 A;  2F43 A;  2B7B A;  2GPJ A;  1K28 D;  1VQM B;  4UZE A;  3WBJ A;  4UZU A;  4Z4T A;  1GO2 A;  3QFR A;  4M4S A;  4G7X A;  2PLF A;  1VQ5 B;  1TLL A;  3B8H A;  1DDI A;  1H42 A;  4X8I A;  1V0F A;  3FKS A;  1RQR A;  3J81 k;  3VNU A;  2E1R A;  1JNY A;  2OBS A;  3CCL B;  4QV2 A;  1OGJ A;  3JU4 A;  3CES A;  3OJW A;  3WNB A;  4ZCL A;  3CP2 A;  1KQS B;  1FDR A;  4PAA A;  5IYR A;  4OPS A;  4R71 A;  1WOS A;  4Z4U A;  1NB0 A;  4E0F A;  4X7C A;  3JQR A;  2RC6 A;  2XZL A;  1EFR A;  3PVD A;  5IYW A;  1E62 A;  2J7K A;  4MYU A;  4Z4W A;  3OZU A;  2HMA A;  2ZL6 A;  1I18 A;  2AHO A;  3WQZ A;  1ZM4 A;  2YWG A;  2GK7 A;  2DIE A;  1FX0 A;  4P3Y A;  4XLH A;  4CQJ A;  4M0L A;  3AVX A;  4Y7C A;  2FVG A;  3U2Q A;  4B47 A;  4TKO B;  1NB9 A;  2D9R A;  4K1X A;  2NPF A;  3T56 B;  3ES9 A;  3CCS B;  3MMP A;  3GVK A;  2ZBV A;  4XLE A;  1FNB A;  5THX A;  1E1R A;  5TY0 A;  3SEJ A;  1F60 A;  3I1F A;  2PIA A;  3CPX A;  1EFT A;  4YAW A;  2WYR A;  2ZIT A;  1WSR A;  1EWY A;  5HKK A;  2CF4 A;  1AIP A;  2V7W A;  1UD6 A;  4B48 A;  1TTT A;  4KKS A;  1YIJ B;  1VQ8 B;  4RD0 A;  4OOX A;  4PC1 A;  4YAO A;  2EFG A;  2OBR A;  3AVY A;  5FO1 A;  3W2F A;  2WJV A;  3OKX A;  1IJE A;  1UD8 A;  3MHP A;  1E64 A;  4NBS A;  3NE5 B;  3CB4 A;  1YLO A;  2XND A;  5FL7 A;  1WOR A;  3CCV B;  1IJF A;  1XB2 A;  1COW A;  2PE3 A;  3CCQ B;  1B2R A;  1FND A;  4N3G A;  4RPD A;  4DQL A;  3PUN A;  3U6K A;  1VQL B;  4LC0 A;  3BH4 A;  3W2I A;  2DER A;  2M5S A;  3VO2 A;  2ZTG A;  2E1B A;  4KKU A;  2EIX A;  4XD7 A;  5AN9 A;  1H85 A;  2R9V A;  4DQK A;  2QEX B;  4RPB A;  1E43 A;  2XNC A;  3ONY A;  4WZE A;  1BMF A;  4XLC A;  4Z4V A;  4WWV A;  1EP1 B;  4X05 A;  5IYN A;  2C2W A;  3AGP A;  1VF7 A;  4RD6 A;  2X6X A;  3OEH A;  4J0Q A;  4II3 A;  4X06 A;  3AVT A;  1QX4 A;  2ZXH A;  2V31 A;  1BPL A;  1UD2 A;  2V7V A;  3B82 A;  1GJR A;  1GVH A;  1NJI D;  3BNW A;  1WDT A;  1W2B B;  1SKY B;  1UMK A;  1FRN A;  1QFZ A;  3OOC A;  4B43 A;  4BPR A;  1WPC A;  5KW9 A;  2QTL A;  1K9M D;  4XOT A;  1QVF B;  3AVV A;  4TMZ A;  3LO8 A;  1T5E A;  4TMW A;  1PJ7 A;  1UD4 A;  3ZZU A;  1MAB A;  3P26 A;  1QUE A;  3WBK A;  2VBT A;  1SKQ A;  4TT3 A;  4TMT A;  1TVC A;  2B7C A;  2DCU A;  4L8J A;  3FPP A;  4AF7 A;  4XON A;  2DY1 A;  3CPW B;  1KD1 D;  1WU8 A;  4LBW A;  3LQE A;  4P12 A;  4RCY A;  2V7T A;  4P6V F;  2GQF A;  3SLN A;  3A8J A;  4FN5 A;  2GRE A;  2PMD A;  4PAB A;  3CMA B;  1ZUN B;  4QVJ A;  1QUF A;  2C5B A;  4XOR A;  3ZC3 A;  3A35 A;  3CRZ A;  2QGG A;  3CMM A;  3VNV A;  1W0K A;  1W0J A;  2Q6K A;  1K8A D;  1A8P A;  1S0U A;  3E1Y E;  4JMQ A;  4Z4Z A;  1VHE A;  3V76 A;  2GJP A;  4FXU A;  1DG1 G;  3BY1 A;  1D1N A;  5TR9 A;  2ZZQ A;  5FA6 A;  4KKT A;  2W6J A;  4RM0 A;  2CW5 A;  3KEW A;  1CQX A;  3CCE B;  4UZF A;  3DDY A;  1Y0R A;  3KL9 A;  4Z4S A;  1BQE A;  4Y9U A;  4C0S A;  4LBV A;  3G71 B;  2CND A;  4XM3 A;  2OK8 A;  4YAF A;  2VYQ A;  4X0C A;  1HA3 A;  2BM1 A;  2BVN A;  4U9U A;  1VQ6 B;  1QFJ A;  3WXM A;  4RD2 A;  1KZL A;  2DEU A;  1IB0 A;  3LVB A;  2ZL7 A;  3CW2 A;  3D26 A;  2D74 A;  4G1B A; 
#chains in the Genus database with same CATH homology
 4NCN A;  1EXM A;  4MYT A;  4HE5 A;  4N3N A;  4Q7J B;  2YWE A;  3QFS A;  3ZZ0 A;  1KK1 A;  1AMO A;  1QGA A;  2X3U A;  3QFC A;  1OGI A;  1K73 D;  4RD4 A;  4ZCM A;  1JA0 A;  3VO1 A;  4ACA A;  4PC7 A;  2XNJ A;  3FJO A;  3AVW A;  1M90 D;  4PC2 A;  1YHQ B;  1FNM A;  4YAL A;  3W5H A;  3SJZ A;  2CRV A;  1KK2 A;  1KK0 A;  1GR1 A;  1EP3 B;  1G7R A;  3CCR B;  4WQM A;  5KSW B;  1VQ9 B;  1VQN B;  3PEN A;  2BGJ A;  3CC2 B;  1BJK A;  2BM0 A;  1GAQ A;  3I56 B;  3AGQ A;  4AC9 A;  1OB2 A;  2OK7 A;  1NDH A;  2BN4 A;  1VQ7 B;  1DDG A;  1F20 A;  2YWH A;  1YJ9 B;  4AF6 A;  2QA4 B;  1E63 A;  1VQO B;  1JA1 A;  4H9G A;  1VQ4 B;  4F7D A;  1W34 A;  1EFC A;  1Q82 D;  1DAR A;  3JQQ A;  4QFM A;  2QDX A;  1I7P A;  4TMV A;  1KRH A;  1YJW B;  4ZV4 A;  3WY9 A;  4B44 A;  3G4S B;  1GAW A;  3E20 A;  1D8T A;  2BSA A;  1ZM9 A;  5TV2 A;  2C78 A;  1VQP B;  1BX0 A;  1N0U A;  4RD3 A;  3W5V A;  4FK8 A;  3CCU B;  3CD6 B;  1Q81 D;  1JJ2 B;  4ACB A;  4FWT A;  4Y9R A;  2DET A;  3CC7 B;  2BF4 A;  3OJX A;  3CXC B;  1QGZ A;  5HXB A;  2VNI A;  2RC5 A;  3W2E A;  2BGI A;  2C77 A;  2BPO A;  1BX1 A;  4YHB A;  3W5U A;  1QVG B;  2VNJ A;  4YAU A;  3CCJ B;  5JBQ A;  1QH0 A;  5DSZ A;  3QE2 A;  1Q7Y D;  2HCJ B;  1TUI A;  1JB9 A;  4B4D A;  1OB5 A;  1XE1 A;  1KTV A;  2QTZ A;  3OZV A;  1N8R D;  1KK3 A;  1G7T A;  5GV7 A;  3ZZT A;  4IW3 B;  4ZGQ B;  1J9Z A;  4PGO A;  1KJZ A;  3VMF A;  1U2R A;  1FNC A;  3B78 A;  2VZL A;  2YWF A;  4TMX A;  4M1K A;  3QSY A;  1ZM2 A;  2OTJ B;  2R6H A;  1VQK B;  3MCA A;  3P27 A;  3JQP A;  2OTL B;  4G1V A;  3WNC A;  4QHY A;  4M53 A;  3ZBU A;  4C43 A;  4UAJ A;  2QMU A;  1ZM3 A;  1QGY A;  2VNH A;  5GV8 A;  4PC3 A;  4RJL A;  4LBZ A;  3W2G A;  2FX3 A;  1YI2 B;  4PC6 A;  3OW2 B;  3WND A;  1G7C A;  4G5G A;  2QN6 A;  3ZBT A;  4EH1 A;  3QFT A;  2HDN B;  3CC4 B;  1M1K D;  4HE6 A;  3W2H A;  3U6B A;  2VNK A;  4B3X A;  3I55 B;  1QG0 A;  2B5O A;  1CNF A;  1FRQ A;  5EMN A;  1D2E A;  1G7S A;  1SM4 A;  1R5B A;  5H5J A;  3OZW A;  1ELO A;  1EP2 B;  1CNE A;  2XEX A;  4ZCI A;  3CME B;  1R5N A;  4RD1 A;  1YIT B;  1YJN B;  1N0V C;  1QFY A;  3WYA A;  3FPK A;  4RCZ A;  1W87 A;  1KC8 D;  5H59 A;  1EFU A;  1S72 B;  4M2L A;  3CCM B;  1B23 P;  3AVU A;  1R5O A;  4ZGN B;  1Q86 D;  2BMW A;  4LBY A;  2BV3 A;  4TN1 A;  3G6E B;  1W35 A;  2GPJ A;  2B7B A;  1VQM B;  3WBJ A;  1GO2 A;  3QFR A;  4M4S A;  2PLF A;  1VQ5 B;  1TLL A;  3B8H A;  1DDI A;  1H42 A;  3J81 k;  3VNU A;  2E1R A;  1JNY A;  3CCL B;  1OGJ A;  3OJW A;  3WNB A;  4ZCL A;  1KQS B;  1FDR A;  4R71 A;  3JQR A;  2RC6 A;  1E62 A;  2J7K A;  4MYU A;  3OZU A;  2HMA A;  2AHO A;  1ZM4 A;  2YWG A;  4P3Y A;  4M0L A;  3AVX A;  4Y7C A;  3U2Q A;  4B47 A;  4K1X A;  2NPF A;  3ES9 A;  3CCS B;  3MMP A;  1FNB A;  5THX A;  5TY0 A;  1F60 A;  3I1F A;  2PIA A;  1EFT A;  4YAW A;  2ZIT A;  1EWY A;  1AIP A;  4B48 A;  1TTT A;  1YIJ B;  1VQ8 B;  4RD0 A;  4PC1 A;  4YAO A;  2EFG A;  3AVY A;  3W2F A;  1IJE A;  3MHP A;  1E64 A;  4NBS A;  3CB4 A;  3CCV B;  1IJF A;  1XB2 A;  3CCQ B;  1B2R A;  1FND A;  4N3G A;  4DQL A;  3U6K A;  1VQL B;  4LC0 A;  3W2I A;  2DER A;  3VO2 A;  2EIX A;  5AN9 A;  1H85 A;  4DQK A;  2QEX B;  2XNC A;  1EP1 B;  3AGP A;  4RD6 A;  4J0Q A;  3AVT A;  1QX4 A;  3B82 A;  1GJR A;  1GVH A;  1NJI D;  1W2B B;  1WDT A;  1UMK A;  1FRN A;  1QFZ A;  4BPR A;  4B43 A;  2QTL A;  1K9M D;  1QVF B;  3AVV A;  4TMZ A;  3LO8 A;  4TMW A;  3ZZU A;  3P26 A;  1QUE A;  3WBK A;  1SKQ A;  4TMT A;  1TVC A;  2B7C A;  2DCU A;  3CPW B;  4AF7 A;  2DY1 A;  1KD1 D;  4LBW A;  4RCY A;  4P6V F;  2GQF A;  4FN5 A;  2PMD A;  3CMA B;  1ZUN B;  1QUF A;  3ZC3 A;  3CRZ A;  3VNV A;  1K8A D;  1A8P A;  1S0U A;  3E1Y E;  3V76 A;  1D1N A;  1DG1 G;  5TR9 A;  5FA6 A;  1CQX A;  3CCE B;  1BQE A;  4Y9U A;  4C0S A;  4LBV A;  3G71 B;  2CND A;  2OK8 A;  4YAF A;  2VYQ A;  1HA3 A;  2BM1 A;  4U9U A;  2BVN A;  1VQ6 B;  1QFJ A;  3WXM A;  4RD2 A;  2DEU A;  1IB0 A;  3LVB A;  3CW2 A;  2D74 A;  4G1B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...