2CRVA

Solution structure of c-terminal domain of mitochondrial translational initiationfactor 2
Total Genus 6
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
6
sequence length
120
structure length
120
Chain Sequence
GSSGSSGYPIGEASILATFTVTEGKKKIPVADCRVQKGQLERHKKFKLIRNGQVIWKGSLTSLKHHKDDISVIKTGMDCGLSLDEEKVEFKPGDQVICYEENKVPTKTSWDPGFSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Translation initiation factor IF-2
publication title Solution structure of C-terminal domain of mitochondrial translational initiationfactor 2
rcsb
source organism Mus musculus
molecule tags Translation
total genus 6
structure length 120
sequence length 120
ec nomenclature
pdb deposition date 2005-05-20
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 2crvA01
3OJXA 1KQSB 5GV7A 1SM4A 4ZV4A 5H5JA 1FRQA 5TV2A 2VNJA 1QGZA 3W2HA 1EP1B 3AVYA 1XB2A 4HE6A 2GPJA 1D2EA 4PC6A 4B3XA 3PENA 1JNYA 3WY9A 4G5GA 4M1KA 3V76A 2VNKA 4ZGNB 1BX1A 1VQNB 3CC2B 3I1FA 1FNDA 5AN9A 2DETA 4WQMA 2D74A 3CB4A 2BM0A 1VQ4B 1FNCA 1E62A 4M4SA 3CCRB 3VNUA 2QTLA 4TMVA 5DSZA 1VQOB 2VYQA 2B5OA 1VQ6B 4TMWA 1ZM9A 1W2BB 3U6KA 1KK3A 4PC2A 1H85A 1Q86D 2HMAA 3LVBA 4RCZA 2QMUA 4ACBA 4ACAA 1D1NA 3ZC3A 1N0UA 1U2RA 1DG1G 3CCLB 4U9UA 1K73D 3P27A 1W34A 4AC9A 4B4DA 1CQXA 4Y9RA 3W2EA 2B7CA 1BX0A 1QX4A 4NCNA 3JQRA 4RD6A 3MCAA 1FNBA 4G1VA 2VNHA 4G1BA 1QGYA 3QFRA 3OZVA 4LBZA 1QVFB 5TR9A 4H9GA 1DDGA 1EP2B 2X3UA 1ZM4A 2J7KA 3B8HA 3G6EB 2PLFA 3WNCA 3ZZUA 1FRNA 4PGOA 5GV8A 2BV3A 2BN4A 3OZUA 3VO1A 4LBVA 1VQ8B 3WNBA 1EFUA 3W2FA 3ZBUA 3W5VA 3CPWB 2QA4B 1J9ZA 2DCUA 3J81k 4C43A 2VNIA 1FDRA 2OK7A 3CW2A 2C77A 3AVUA 1NJID 4TN1A 3CCUB 4RJLA 3U2QA 4MYTA 5TY0A 2HDNB 3WBJA 2BGIA 2C78A 3W2IA 2CRVA 1CNEA 1M1KD 2QTZA 3AVWA 1IJFA 3OZWA 4RD0A 1YJNB 4RD1A 4YAFA 2DY1A 1QH0A 5H59A 1JJ2B 2OK8A 1VQLB 1G7SA 1UMKA 2YWFA 1QUFA 2EFGA 3CCQB 1TLLA 5THXA 2XNCA 2VZLA 5KSWB 3LO8A 3ZBTA 1QFYA 1YITB 1W35A 2RC5A 1AMOA 4F7DA 2FX3A 5FA6A 3OJWA 4ZGQB 1KK2A 4N3GA 1TVCA 1TTTA 1QGAA 1M90D 1TUIA 4RCYA 1VQ7B 3CCMB 2B7BA 1VQ5B 3QFSA 4M53A 1WDTA 4K1XA 1ELOA 2BSAA 3QFCA 3CCSB 3P26A 4DQLA 1K9MD 4B47A 1W87A 1YJWB 1ZUNB 2AHOA 2ZITA 3W5HA 4LBYA 2DEUA 4M2LA 4RD2A 3AVVA 4FN5A 3CCJB 1Q82D 2XEXA 2GQFA 1VQ9B 4PC3A 1EFTA 4IW3B 4QHYA 1I7PA 3QFTA 1OGIA 4AF6A 1KRHA 1QUEA 1GO2A 4ZCLA 1R5NA 3B82A 1OGJA 4AF7A 2BF4A 1DARA 2EIXA 3CCEB 3AVXA 3CMEB 1S0UA 1GAQA 4FWTA 3E20A 4NBSA 4EH1A 4MYUA 1QVGB 2YWHA 1ZM2A 4B43A 1Q7YD 4TMXA 2BGJA 1OB2A 4RD3A 1QG0A 4QFMA 3QSYA 1R5BA 2YWEA 4YAOA 1FNMA 3CRZA 3ZZTA 3JQPA 1R5OA 3E1YE 3WYAA 4TMZA 3WXMA 4P6VF 1OB5A 1G7TA 3G4SB 2QN6A 4BPRA 2PIAA 3I56B 1B2RA 4FK8A 2QEXB 1GVHA 1JA1A 3ZZ0A 3U6BA 2XNJA 2QDXA 1F20A 3AGPA 1HA3A 3G71B 4Q7JB 1GJRA 3CC4B 1AIPA 1CNFA 3VMFA 3CC7B 3CMAB 3SJZA 4HE5A 1NDHA 3AGQA 1YHQB 3CXCB 1VQMB 1K8AD 1Q81D 1YJ9B 2PMDA 5JBQA 4P3YA 1VQKB 4YAWA 1KD1D 1JA0A 4B44A 4YALA 4C0SA 2BM1A 1DDIA 1QFZA 4UAJA 2RC6A 1KTVA 2BVNA 1VQPB 3MHPA 3JQQA 2BMWA 3WNDA 2E1RA 1G7CA 5EMNA 3AVTA 2BPOA 2HCJB 1A8PA 1G7RA 1KJZA 1IB0A 4LC0A 3W5UA 2NPFA 4ZCMA 3VNVA 3CD6B 1H42A 4PC7A 3I55B 1GR1A 4J0QA 1S72B 1JB9A 1XE1A 1B23P 4B48A 1BJKA 1KC8D 4Y9UA 3FJOA 4LBWA 1YIJB 1EFCA 1IJEA 4PC1A 5HXBA 1E64A 2YWGA 1N8RD 4M0LA 3W2GA 3WBKA 4DQKA 1KK1A 3OW2B 1EXMA 1YI2B 1BQEA 3QE2A 4YAUA 4YHBA 4N3NA 2R6HA 1EWYA 4R71A 1E63A 3MMPA 3B78A 4ZCIA 2DERA 1GAWA 1ZM3A 1KK0A 3VO2A 3ES9A 1F60A 1QFJA 1SKQA 2CNDA 1D8TA 4TMTA 4Y7CA 3FPKA 1N0VC 3CCVB 2OTJB 4RD4A 1EP3B 2OTLB
chains in the Genus database with same CATH superfamily
3OJXA 1KQSB 5GV7A 3Q6RA 1RQPA 1SM4A 3SKBA 4ZV4A 5H5JA 1KZLA 2PE3A 1FRQA 2ZBUA 4Z1MA 1E43A 5TV2A 1W0KA 2VNJA 1N08A 1QGZA 1WOOA 3W2HA 1EP1B 2CBXA 2X6WA 3AVYA 1XB2A 3FKSA 4Z4RA 1UD6A 4XR6A 3CMMA 4HE6A 2GPJA 1D2EA 2CW5A 2ZZQA 3Q6QA 4XMYA 5IK2A 4PC6A 3OFNA 4B3XA 3OEHA 2VBTA 1JNYA 3PENA 3WY9A 1T5EA 4G5GA 3H9NA 3GSIA 4M1KA 3V76A 4X7DA 4DNRB 4II2A 2Q6LA 2VNKA 4ZGNB 2HLDA 1BX1A 4XLFA 1FX0A 1VQNB 1PKVA 2C4TA 3CC2B 3ZPNA 3I1FA 1T6XA 1FNDA 1V5VA 4OOSA 3ASQA 4X7EA 5AN9A 2ZZEA 4PAAA 4GQNA 4WZEA 1Y0YA 2DETA 4WQMA 2D74A 3CB4A 4OOVA 2BM0A 4QVAA 3R6KA 1FNCA 1VQ4B 1E62A 1T6YA 2GJRA 4M4SA 4Z4TA 2DOGA 3CCRB 3VNUA 3KEWA 5KW9A 2QTLA 1E3ZA 3GVLA 4TMVA 4TT3A 2WJVA 3A8JA 2OBTA 5DSZA 1VQOB 1W0JA 4XN0A 2C4UA 3T56B 2VYQA 2B5OA 4DK1A 1VQ6B 4YXWA 3ASPA 4TMWA 2P3MA 1PJ7A 3ZUGA 1N06A 1ZM9A 1W2BB 5FL7A 2M5SA 3PUMA 3U6KA 1KK3A 3JU4A 4RPDA 4XL9A 3OEEA 4PC2A 1NB9A 1H85A 3OE7A 1Q86D 2HMAA 3LQ6A 3LVBA 4RCZA 2QMUA 3LQEA 4ACBA 4ACAA 4XLHA 3BNWA 1D1NA 5FNZA 3ZC3A 3NE5B 4UZUA 1N0UA 1U2RA 1DG1G 3CCLB 3BCFA 4U9UA 1BPLA 3P27A 4X05A 1K73D 1W34A 4AC9A 4B4DA 3SJPA 1CQXA 4Z4YA 4X7FA 4Y9RA 3W2EA 3A35A 2B7CA 1BX0A 1QX4A 4NCNA 3JQRA 3OKXA 2V4DA 4RD6A 3MCAA 3Q38A 1FNBA 4G1VA 2VNHA 5E6TA 4YELA 1XQBA 1UD4A 4G1BA 1QGYA 5L46A 3QFRA 3OZVA 4LBZA 1QVFB 5TR9A 4H9GA 3BH4A 1DDGA 2C5HA 5DN6A 1EP2B 2XGJA 2X3UA 1ZM4A 2J7KA 3B8HA 3G6EB 2PLFA 3WNCA 3ZZUA 2ZXHA 1E1QA 4Z4UA 4WZLA 1FRNA 4PGOA 5GV8A 2WPDA 1N05A 2BV3A 2BN4A 2Z6BD 3OZUA 4OPSA 1P4MA 3VO1A 3A8IA 3CTAA 4LBVA 1VQ8B 1V0FA 1EFUA 4G7WA 3WNBA 3D26A 3W2FA 3ZBUA 3W5VA 3CPWB 2QA4B 3ASSA 1J9ZA 2DCUA 4B3GA 3J81k 4C43A 2ZL5A 2Q6IA 3CP8A 2R9VA 2VNIA 3PUNA 1KMHA 1FDRA 1NBMA 4UZFA 1VF7A 2OK7A 5IYRA 4KKTA 1YX2A 3CW2A 2C77A 3AVUA 1Q9SA 1NJID 4G7XA 2VBSA 3GVJA 4TN1A 3CCUB 4RJLA 3BY2A 2OYNA 3U2QA 4MYTA 4DK0A 4Z4WA 1VHEA 2JJ2A 3OOCA 1WSRA 3BY1A 5DS0A 2HDNB 5TY0A 3WBJA 2D3NA 5BSYA 2BGIA 4HIZA 2C78A 3W2IA 5IYNA 1EFRA 2WZPP 4X8IA 3A3BA 1UD8A 1V0EA 2CRVA 3ONUA 1CNEA 4YEJA 4UZEA 1M1KD 2QTZA 1UD5A 3ISXA 3AVWA 1IJFA 2V7UA 3OZWA 4RD0A 3GIRA 1YJNB 1H8HA 4X7CA 2CK3A 3A1PA 5B6IA 4QUZA 4RD1A 4YAFA 2DY1A 1QH0A 2FVGA 3T53B 3HAGA 3R6JA 2LZJA 5H59A 1JJ2B 2OK8A 1VQLB 1OB0A 2XOKA 2Q6OA 1G7SA 1UMKA 2YWFA 1QUFA 2EFGA 3CP2A 2ZTNA 2GK6A 2ZTGA 4WZTA 3CCQB 2D9RA 2WYRA 2V7QA 3T51B 3BC9A 1TLLA 2GK7A 5THXA 4XM3A 2XNCA 2WZNA 4P22A 5IYWA 2VZLA 5KSWB 3LO8A 4P9SA 1VLOA 3ZBTA 1QFYA 1YITB 1W35A 2RC5A 2V7WA 4F7DA 1AMOA 3WQZA 2FX3A 5F4JA 1E1RA 3BCDA 5IYPA 4RDKA 2ZBVA 5FIUA 5FA6A 3GQBA 3OJWA 4ZGQB 3VR6A 1HZEA 1KK2A 4N3GA 5HZBA 2F1MA 1TVCA 1UD2A 2F1LA 1TTTA 5F4OA 1QGAA 4X07A 1M90D 1TUIA 4RCYA 1VQ7B 3CCMB 2B7BA 1VQ5B 2X0KA 2V7TA 3QFSA 1NB0A 3BQJA 4M53A 4RLZA 1WDTA 4P2NA 4NNJA 4K1XA 4TSFA 1ELOA 2BSAA 3QFCA 3CCSB 3V7AA 2X6YA 3P26A 4DQLA 4G6IA 1K9MD 4RPBA 4B47A 1W87A 3Q39A 1YJWB 1ZUNB 5F4MA 4FXUA 2AHOA 2ZITA 3W5HA 4Z4VA 2VJJA 4LBYA 4RDJA 2DEUA 4M2LA 4RD2A 3AVVA 4FN5A 5CDFA 1MRZA 3CCJB 1Q82D 2XEXA 4L8JA 2GQFA 2X53S 1VQ9B 2V7VA 4PC3A 1EFTA 4IW3B 4XOTA 4QHYA 1I7PA 4X06A 3QFTA 1OGIA 2V7XA 4AF6A 2JJ1A 1KRHA 3H94A 3ASTA 1QUEA 1GO2A 4ZCLA 1R5NA 3B82A 1OGJA 4AF7A 2BF4A 3SLDA 5LMZA 1N07A 1DARA 2EIXA 4XOPA 1WORA 3CCEB 5FO0A 3AVXA 3CMEB 1S4MA 1S0UA 4P3IA 2VBUA 1GAQA 4FWTA 2D3LA 4X0CA 4XLAA 3E20A 1E79A 4NBSA 4EH1A 2WR8A 5IYQA 2GJKA 4MYUA 1QVGB 2DYIA 3OP1A 2QE7A 2YWHA 1PJ6A 3G05A 1ZM2A 1K28D 4RDLA 1WOPA 1VJSA 4XLCA 2W6IA 4OPVA 4B43A 1Q7YD 3GVKA 4TMXA 2BGJA 1OB2A 4RD3A 1QG0A 4QFMA 3QSYA 1R5BA 2ZL6A 2OBRA 2YWEA 4YAOA 1E3XA 1FNMA 3CRZA 5J35A 3ZZTA 3JQPA 1R5OA 3E1YE 2W6JA 5FO1A 3WYAA 4Z4ZA 4TMZA 2GREA 4P6VF 3WXMA 1OB5A 2X8KA 3OAAA 4JMQA 3OPOA 1G7TA 3G4SB 2QN6A 1WPCA 4OP7A 4TKOB 2PIAA 4BPRA 3I56B 1B2RA 4PABA 2DIEA 4FK8A 2QEXB 3LNNA 4XKWA 1GVHA 2ZL7A 1JA1A 1XFOA 3ZZ0A 2XNJA 2QDXA 3U6BA 1F20A 3AGPA 1OHHA 1VHOA 4II3A 1HA3A 4XORA 4XN3A 2X6XA 3PA2A 3G71B 2WJYA 4KKSA 2NV4A 3A3GA 4Q7JB 1GJRA 3CC4B 1AIPA 1I18A 2VBVA 1CNFA 3VMFA 3A8KA 3CC7B 3CMAB 2JIZA 4HE5A 1NDHA 1BLIA 3AGQA 3SJZA 1YHQB 3RY8A 3CXCB 4P12A 4ASUA 1VQMB 1K8AD 2V31A 1Q81D 2KVOA 1YJ9B 2PMDA 2QGGA 5TRDA 5JBQA 4OOXA 5J3OA 2XZLA 4P3YA 1VQKB 3Q3AA 4CQJA 3ONYA 3OW7A 4YAWA 1W9XA 2ZXIA 4KKUA 3CESA 1WOSA 1KD1D 2CC2A 1JA0A 4B44A 5A89A 1WTHD 4YALA 4C0SA 2BM1A 4QV2A 4P6YA 1DDIA 1QFZA 4UAJA 2RC6A 2VJIA 1KTVA 2BVNA 1HVXA 1MABA 1VQPB 3MHPA 2OBSA 3JQQA 2BMWA 3WNDA 5BSXA 2E1RA 3KL9A 1G7CA 2ZZGA 5EMNA 2WSSA 2BPOA 3PA1A 2HCJB 3AVTA 1A8PA 1G7RA 4ROXA 3SEJA 1KJZA 2CF4A 1IB0A 4LC0A 1VLYA 3SLNA 3W5UA 1H8EA 2NPFA 4ZCMA 3VNVA 1T6ZA 2C5BA 3CD6B 1H42A 4PC7A 3I55B 2GJPA 1GR1A 4J0QA 2XZPA 4Z4SA 1S72B 1JB9A 1I8DA 1XE1A 3ASRA 1B23P 1WU8A 1BJKA 4B48A 5A88A 1SKYB 4Y9UA 1KC8D 3FJOA 1NRKA 4LBWA 5KNLA 3CPXA 2Q6KA 2F43A 1YIJB 5HZAA 1EFCA 3PVDA 1IJEA 4PC1A 3ZIAA 4B3FX 4XKVA 5A8AA 4QVJA 5HXBA 3DDYA 1E64A 2YWGA 1N8RD 4M0LA 3W2GA 1PJ5A 3WBKA 4DNTB 4DQKA 1KK1A 3OW2B 2XZOA 1EXMA 1YI2B 2I1LA 1BQEA 3QE2A 4YAUA 4XLEA 4YHBA 4N3NA 2R6HA 1EWYA 2X85A 2JDIA 4R71A 1E63A 3MMPA 4OPOA 1YLOA 2E1BA 4WZKA 3B78A 4XNFA 4ZCIA 2ZZFA 1UD3A 4P25A 2OTLB 2C2WA 2XNDA 2DERA 1GAWA 1ZM3A 1BMFA 4XD7A 1KK0A 3VO2A 4E0FA 3ES9A 1F60A 4P1VA 1WP6A 1QFJA 1SKQA 1WSVA 2CNDA 1COWA 1D8TA 1Y0RA 4XONA 4XQFA 4TMTA 4Y7CA 3FPKA 4P26A 4AVZA 5HKKA 1N0VC 3FPPA 4WWVA 1IHMA 1RQRA 4RM0A 3CCVB 2JN9A 2OTJB 4RD4A 1EP3B 2F4NA
chains in the Genus database with same CATH topology
3OJXA 1KQSB 5GV7A 1SM4A 4ZV4A 5H5JA 1FRQA 5TV2A 2VNJA 1QGZA 3W2HA 1EP1B 3AVYA 1XB2A 4HE6A 2GPJA 1D2EA 4PC6A 4B3XA 3PENA 1JNYA 3WY9A 4G5GA 4M1KA 3V76A 2VNKA 4ZGNB 1BX1A 1VQNB 3CC2B 3I1FA 1FNDA 5AN9A 2DETA 4WQMA 2D74A 3CB4A 2BM0A 1VQ4B 1FNCA 1E62A 4M4SA 3CCRB 3VNUA 2QTLA 4TMVA 5DSZA 1VQOB 2VYQA 2B5OA 1VQ6B 4TMWA 1ZM9A 1W2BB 3U6KA 1KK3A 4PC2A 1H85A 1Q86D 2HMAA 3LVBA 4RCZA 2QMUA 4ACBA 4ACAA 1D1NA 3ZC3A 1N0UA 1U2RA 1DG1G 3CCLB 4U9UA 1K73D 3P27A 1W34A 4AC9A 4B4DA 1CQXA 4Y9RA 3W2EA 2B7CA 1BX0A 1QX4A 4NCNA 3JQRA 4RD6A 3MCAA 1FNBA 4G1VA 2VNHA 4G1BA 1QGYA 3QFRA 3OZVA 4LBZA 1QVFB 5TR9A 4H9GA 1DDGA 1EP2B 2X3UA 1ZM4A 2J7KA 3B8HA 3G6EB 2PLFA 3WNCA 3ZZUA 1FRNA 4PGOA 5GV8A 2BV3A 2BN4A 3OZUA 3VO1A 4LBVA 1VQ8B 3WNBA 1EFUA 3W2FA 3ZBUA 3W5VA 3CPWB 2QA4B 1J9ZA 2DCUA 3J81k 4C43A 2VNIA 1FDRA 2OK7A 3CW2A 2C77A 3AVUA 1NJID 4TN1A 3CCUB 4RJLA 3U2QA 4MYTA 5TY0A 2HDNB 3WBJA 2BGIA 2C78A 3W2IA 2CRVA 1CNEA 1M1KD 2QTZA 3AVWA 1IJFA 3OZWA 4RD0A 1YJNB 4RD1A 4YAFA 2DY1A 1QH0A 5H59A 1JJ2B 2OK8A 1VQLB 1G7SA 1UMKA 2YWFA 1QUFA 2EFGA 3CCQB 1TLLA 5THXA 2XNCA 2VZLA 5KSWB 3LO8A 3ZBTA 1QFYA 1YITB 1W35A 2RC5A 1AMOA 4F7DA 2FX3A 5FA6A 3OJWA 4ZGQB 1KK2A 4N3GA 1TVCA 1TTTA 1QGAA 1M90D 1TUIA 4RCYA 1VQ7B 3CCMB 2B7BA 1VQ5B 3QFSA 4M53A 1WDTA 4K1XA 1ELOA 2BSAA 3QFCA 3CCSB 3P26A 4DQLA 1K9MD 4B47A 1W87A 1YJWB 1ZUNB 2AHOA 2ZITA 3W5HA 4LBYA 2DEUA 4M2LA 4RD2A 3AVVA 4FN5A 3CCJB 1Q82D 2XEXA 2GQFA 1VQ9B 4PC3A 1EFTA 4IW3B 4QHYA 1I7PA 3QFTA 1OGIA 4AF6A 1KRHA 1QUEA 1GO2A 4ZCLA 1R5NA 3B82A 1OGJA 4AF7A 2BF4A 1DARA 2EIXA 3CCEB 3AVXA 3CMEB 1S0UA 1GAQA 4FWTA 3E20A 4NBSA 4EH1A 4MYUA 1QVGB 2YWHA 1ZM2A 4B43A 1Q7YD 4TMXA 2BGJA 1OB2A 4RD3A 1QG0A 4QFMA 3QSYA 1R5BA 2YWEA 4YAOA 1FNMA 3CRZA 3ZZTA 3JQPA 1R5OA 3E1YE 3WYAA 4TMZA 3WXMA 4P6VF 1OB5A 1G7TA 3G4SB 2QN6A 4BPRA 2PIAA 3I56B 1B2RA 4FK8A 2QEXB 1GVHA 1JA1A 3ZZ0A 3U6BA 2XNJA 2QDXA 1F20A 3AGPA 1HA3A 3G71B 4Q7JB 1GJRA 3CC4B 1AIPA 1CNFA 3VMFA 3CC7B 3CMAB 3SJZA 4HE5A 1NDHA 3AGQA 1YHQB 3CXCB 1VQMB 1K8AD 1Q81D 1YJ9B 2PMDA 5JBQA 4P3YA 1VQKB 4YAWA 1KD1D 1JA0A 4B44A 4YALA 4C0SA 2BM1A 1DDIA 1QFZA 4UAJA 2RC6A 1KTVA 2BVNA 1VQPB 3MHPA 3JQQA 2BMWA 3WNDA 2E1RA 1G7CA 5EMNA 3AVTA 2BPOA 2HCJB 1A8PA 1G7RA 1KJZA 1IB0A 4LC0A 3W5UA 2NPFA 4ZCMA 3VNVA 3CD6B 1H42A 4PC7A 3I55B 1GR1A 4J0QA 1S72B 1JB9A 1XE1A 1B23P 4B48A 1BJKA 1KC8D 4Y9UA 3FJOA 4LBWA 1YIJB 1EFCA 1IJEA 4PC1A 5HXBA 1E64A 2YWGA 1N8RD 4M0LA 3W2GA 3WBKA 4DQKA 1KK1A 3OW2B 1EXMA 1YI2B 1BQEA 3QE2A 4YAUA 4YHBA 4N3NA 2R6HA 1EWYA 4R71A 1E63A 3MMPA 3B78A 4ZCIA 2DERA 1GAWA 1ZM3A 1KK0A 3VO2A 3ES9A 1F60A 1QFJA 1SKQA 2CNDA 1D8TA 4TMTA 4Y7CA 3FPKA 1N0VC 3CCVB 2OTJB 4RD4A 1EP3B 2OTLB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OJX A;  1KQS B;  5GV7 A;  1SM4 A;  4ZV4 A;  5H5J A;  1FRQ A;  5TV2 A;  2VNJ A;  1QGZ A;  3W2H A;  1EP1 B;  3AVY A;  1XB2 A;  4HE6 A;  2GPJ A;  1D2E A;  4PC6 A;  4B3X A;  3PEN A;  1JNY A;  3WY9 A;  4G5G A;  4M1K A;  3V76 A;  2VNK A;  4ZGN B;  1BX1 A;  1VQN B;  3CC2 B;  3I1F A;  1FND A;  5AN9 A;  2DET A;  4WQM A;  2D74 A;  3CB4 A;  2BM0 A;  1VQ4 B;  1FNC A;  1E62 A;  4M4S A;  3CCR B;  3VNU A;  2QTL A;  4TMV A;  5DSZ A;  1VQO B;  2VYQ A;  2B5O A;  1VQ6 B;  4TMW A;  1ZM9 A;  1W2B B;  3U6K A;  1KK3 A;  4PC2 A;  1H85 A;  1Q86 D;  2HMA A;  3LVB A;  4RCZ A;  2QMU A;  4ACB A;  4ACA A;  1D1N A;  3ZC3 A;  1N0U A;  1U2R A;  1DG1 G;  3CCL B;  4U9U A;  1K73 D;  3P27 A;  1W34 A;  4AC9 A;  4B4D A;  1CQX A;  4Y9R A;  3W2E A;  2B7C A;  1BX0 A;  1QX4 A;  4NCN A;  3JQR A;  4RD6 A;  3MCA A;  1FNB A;  4G1V A;  2VNH A;  4G1B A;  1QGY A;  3QFR A;  3OZV A;  4LBZ A;  1QVF B;  5TR9 A;  4H9G A;  1DDG A;  1EP2 B;  2X3U A;  1ZM4 A;  2J7K A;  3B8H A;  3G6E B;  2PLF A;  3WNC A;  3ZZU A;  1FRN A;  4PGO A;  5GV8 A;  2BV3 A;  2BN4 A;  3OZU A;  3VO1 A;  4LBV A;  1VQ8 B;  3WNB A;  1EFU A;  3W2F A;  3ZBU A;  3W5V A;  3CPW B;  2QA4 B;  1J9Z A;  2DCU A;  3J81 k;  4C43 A;  2VNI A;  1FDR A;  2OK7 A;  3CW2 A;  2C77 A;  3AVU A;  1NJI D;  4TN1 A;  3CCU B;  4RJL A;  3U2Q A;  4MYT A;  5TY0 A;  2HDN B;  3WBJ A;  2BGI A;  2C78 A;  3W2I A;  2CRV A;  1CNE A;  1M1K D;  2QTZ A;  3AVW A;  1IJF A;  3OZW A;  4RD0 A;  1YJN B;  4RD1 A;  4YAF A;  2DY1 A;  1QH0 A;  5H59 A;  1JJ2 B;  2OK8 A;  1VQL B;  1G7S A;  1UMK A;  2YWF A;  1QUF A;  2EFG A;  3CCQ B;  1TLL A;  5THX A;  2XNC A;  2VZL A;  5KSW B;  3LO8 A;  3ZBT A;  1QFY A;  1YIT B;  1W35 A;  2RC5 A;  1AMO A;  4F7D A;  2FX3 A;  5FA6 A;  3OJW A;  4ZGQ B;  1KK2 A;  4N3G A;  1TVC A;  1TTT A;  1QGA A;  1M90 D;  1TUI A;  4RCY A;  1VQ7 B;  3CCM B;  2B7B A;  1VQ5 B;  3QFS A;  4M53 A;  1WDT A;  4K1X A;  1ELO A;  2BSA A;  3QFC A;  3CCS B;  3P26 A;  4DQL A;  1K9M D;  4B47 A;  1W87 A;  1YJW B;  1ZUN B;  2AHO A;  2ZIT A;  3W5H A;  4LBY A;  2DEU A;  4M2L A;  4RD2 A;  3AVV A;  4FN5 A;  3CCJ B;  1Q82 D;  2XEX A;  2GQF A;  1VQ9 B;  4PC3 A;  1EFT A;  4IW3 B;  4QHY A;  1I7P A;  3QFT A;  1OGI A;  4AF6 A;  1KRH A;  1QUE A;  1GO2 A;  4ZCL A;  1R5N A;  3B82 A;  1OGJ A;  4AF7 A;  2BF4 A;  1DAR A;  2EIX A;  3CCE B;  3AVX A;  3CME B;  1S0U A;  1GAQ A;  4FWT A;  3E20 A;  4NBS A;  4EH1 A;  4MYU A;  1QVG B;  2YWH A;  1ZM2 A;  4B43 A;  1Q7Y D;  4TMX A;  2BGJ A;  1OB2 A;  4RD3 A;  1QG0 A;  4QFM A;  3QSY A;  1R5B A;  2YWE A;  4YAO A;  1FNM A;  3CRZ A;  3ZZT A;  3JQP A;  1R5O A;  3E1Y E;  3WYA A;  4TMZ A;  3WXM A;  4P6V F;  1OB5 A;  1G7T A;  3G4S B;  2QN6 A;  4BPR A;  2PIA A;  3I56 B;  1B2R A;  4FK8 A;  2QEX B;  1GVH A;  1JA1 A;  3ZZ0 A;  3U6B A;  2XNJ A;  2QDX A;  1F20 A;  3AGP A;  1HA3 A;  3G71 B;  4Q7J B;  1GJR A;  3CC4 B;  1AIP A;  1CNF A;  3VMF A;  3CC7 B;  3CMA B;  3SJZ A;  4HE5 A;  1NDH A;  3AGQ A;  1YHQ B;  3CXC B;  1VQM B;  1K8A D;  1Q81 D;  1YJ9 B;  2PMD A;  5JBQ A;  4P3Y A;  1VQK B;  4YAW A;  1KD1 D;  1JA0 A;  4B44 A;  4YAL A;  4C0S A;  2BM1 A;  1DDI A;  1QFZ A;  4UAJ A;  2RC6 A;  1KTV A;  2BVN A;  1VQP B;  3MHP A;  3JQQ A;  2BMW A;  3WND A;  2E1R A;  1G7C A;  5EMN A;  3AVT A;  2BPO A;  2HCJ B;  1A8P A;  1G7R A;  1KJZ A;  1IB0 A;  4LC0 A;  3W5U A;  2NPF A;  4ZCM A;  3VNV A;  3CD6 B;  1H42 A;  4PC7 A;  3I55 B;  1GR1 A;  4J0Q A;  1S72 B;  1JB9 A;  1XE1 A;  1B23 P;  4B48 A;  1BJK A;  1KC8 D;  4Y9U A;  3FJO A;  4LBW A;  1YIJ B;  1EFC A;  1IJE A;  4PC1 A;  5HXB A;  1E64 A;  2YWG A;  1N8R D;  4M0L A;  3W2G A;  3WBK A;  4DQK A;  1KK1 A;  3OW2 B;  1EXM A;  1YI2 B;  1BQE A;  3QE2 A;  4YAU A;  4YHB A;  4N3N A;  2R6H A;  1EWY A;  4R71 A;  1E63 A;  3MMP A;  3B78 A;  4ZCI A;  2DER A;  1GAW A;  1ZM3 A;  1KK0 A;  3VO2 A;  3ES9 A;  1F60 A;  1QFJ A;  1SKQ A;  2CND A;  1D8T A;  4TMT A;  4Y7C A;  3FPK A;  1N0V C;  3CCV B;  2OTJ B;  4RD4 A;  1EP3 B;  2OTL B; 
#chains in the Genus database with same CATH topology
 3OJX A;  1KQS B;  5GV7 A;  3Q6R A;  1RQP A;  1SM4 A;  3SKB A;  4ZV4 A;  5H5J A;  1KZL A;  2PE3 A;  1FRQ A;  2ZBU A;  4Z1M A;  1E43 A;  5TV2 A;  1W0K A;  2VNJ A;  1N08 A;  1QGZ A;  1WOO A;  3W2H A;  1EP1 B;  2CBX A;  2X6W A;  3AVY A;  1XB2 A;  3FKS A;  4Z4R A;  1UD6 A;  4XR6 A;  3CMM A;  4HE6 A;  2GPJ A;  1D2E A;  2CW5 A;  2ZZQ A;  3Q6Q A;  4XMY A;  5IK2 A;  4PC6 A;  3OFN A;  4B3X A;  3OEH A;  2VBT A;  1JNY A;  3PEN A;  3WY9 A;  1T5E A;  4G5G A;  3H9N A;  3GSI A;  4M1K A;  3V76 A;  4X7D A;  4DNR B;  4II2 A;  2Q6L A;  2VNK A;  4ZGN B;  2HLD A;  1BX1 A;  4XLF A;  1FX0 A;  1VQN B;  1PKV A;  2C4T A;  3CC2 B;  3ZPN A;  3I1F A;  1T6X A;  1FND A;  1V5V A;  4OOS A;  3ASQ A;  4X7E A;  5AN9 A;  2ZZE A;  4PAA A;  4GQN A;  4WZE A;  1Y0Y A;  2DET A;  4WQM A;  2D74 A;  3CB4 A;  4OOV A;  2BM0 A;  4QVA A;  3R6K A;  1FNC A;  1VQ4 B;  1E62 A;  1T6Y A;  2GJR A;  4M4S A;  4Z4T A;  2DOG A;  3CCR B;  3VNU A;  3KEW A;  5KW9 A;  2QTL A;  1E3Z A;  3GVL A;  4TMV A;  4TT3 A;  2WJV A;  3A8J A;  2OBT A;  5DSZ A;  1VQO B;  1W0J A;  4XN0 A;  2C4U A;  3T56 B;  2VYQ A;  2B5O A;  4DK1 A;  1VQ6 B;  4YXW A;  3ASP A;  4TMW A;  2P3M A;  1PJ7 A;  3ZUG A;  1N06 A;  1ZM9 A;  1W2B B;  5FL7 A;  2M5S A;  3PUM A;  3U6K A;  1KK3 A;  3JU4 A;  4RPD A;  4XL9 A;  3OEE A;  4PC2 A;  1NB9 A;  1H85 A;  3OE7 A;  1Q86 D;  2HMA A;  3LQ6 A;  3LVB A;  4RCZ A;  2QMU A;  3LQE A;  4ACB A;  4ACA A;  4XLH A;  3BNW A;  1D1N A;  5FNZ A;  3ZC3 A;  3NE5 B;  4UZU A;  1N0U A;  1U2R A;  1DG1 G;  3CCL B;  3BCF A;  4U9U A;  1BPL A;  3P27 A;  4X05 A;  1K73 D;  1W34 A;  4AC9 A;  4B4D A;  3SJP A;  1CQX A;  4Z4Y A;  4X7F A;  4Y9R A;  3W2E A;  3A35 A;  2B7C A;  1BX0 A;  1QX4 A;  4NCN A;  3JQR A;  3OKX A;  2V4D A;  4RD6 A;  3MCA A;  3Q38 A;  1FNB A;  4G1V A;  2VNH A;  5E6T A;  4YEL A;  1XQB A;  1UD4 A;  4G1B A;  1QGY A;  5L46 A;  3QFR A;  3OZV A;  4LBZ A;  1QVF B;  5TR9 A;  4H9G A;  3BH4 A;  1DDG A;  2C5H A;  5DN6 A;  1EP2 B;  2XGJ A;  2X3U A;  1ZM4 A;  2J7K A;  3B8H A;  3G6E B;  2PLF A;  3WNC A;  3ZZU A;  2ZXH A;  1E1Q A;  4Z4U A;  4WZL A;  1FRN A;  4PGO A;  5GV8 A;  2WPD A;  1N05 A;  2BV3 A;  2BN4 A;  2Z6B D;  3OZU A;  4OPS A;  1P4M A;  3VO1 A;  3A8I A;  3CTA A;  4LBV A;  1VQ8 B;  1V0F A;  1EFU A;  4G7W A;  3WNB A;  3D26 A;  3W2F A;  3ZBU A;  3W5V A;  3CPW B;  2QA4 B;  3ASS A;  1J9Z A;  2DCU A;  4B3G A;  3J81 k;  4C43 A;  2ZL5 A;  2Q6I A;  3CP8 A;  2R9V A;  2VNI A;  3PUN A;  1KMH A;  1FDR A;  1NBM A;  4UZF A;  1VF7 A;  2OK7 A;  5IYR A;  4KKT A;  1YX2 A;  3CW2 A;  2C77 A;  3AVU A;  1Q9S A;  1NJI D;  4G7X A;  2VBS A;  3GVJ A;  4TN1 A;  3CCU B;  4RJL A;  3BY2 A;  2OYN A;  3U2Q A;  4MYT A;  4DK0 A;  4Z4W A;  1VHE A;  2JJ2 A;  3OOC A;  1WSR A;  3BY1 A;  5DS0 A;  2HDN B;  5TY0 A;  3WBJ A;  2D3N A;  5BSY A;  2BGI A;  4HIZ A;  2C78 A;  3W2I A;  5IYN A;  1EFR A;  2WZP P;  4X8I A;  3A3B A;  1UD8 A;  1V0E A;  2CRV A;  3ONU A;  1CNE A;  4YEJ A;  4UZE A;  1M1K D;  2QTZ A;  1UD5 A;  3ISX A;  3AVW A;  1IJF A;  2V7U A;  3OZW A;  4RD0 A;  3GIR A;  1YJN B;  1H8H A;  4X7C A;  2CK3 A;  3A1P A;  5B6I A;  4QUZ A;  4RD1 A;  4YAF A;  2DY1 A;  1QH0 A;  2FVG A;  3T53 B;  3HAG A;  3R6J A;  2LZJ A;  5H59 A;  1JJ2 B;  2OK8 A;  1VQL B;  1OB0 A;  2XOK A;  2Q6O A;  1G7S A;  1UMK A;  2YWF A;  1QUF A;  2EFG A;  3CP2 A;  2ZTN A;  2GK6 A;  2ZTG A;  4WZT A;  3CCQ B;  2D9R A;  2WYR A;  2V7Q A;  3T51 B;  3BC9 A;  1TLL A;  2GK7 A;  5THX A;  4XM3 A;  2XNC A;  2WZN A;  4P22 A;  5IYW A;  2VZL A;  5KSW B;  3LO8 A;  4P9S A;  1VLO A;  3ZBT A;  1QFY A;  1YIT B;  1W35 A;  2RC5 A;  2V7W A;  4F7D A;  1AMO A;  3WQZ A;  2FX3 A;  5F4J A;  1E1R A;  3BCD A;  5IYP A;  4RDK A;  2ZBV A;  5FIU A;  5FA6 A;  3GQB A;  3OJW A;  4ZGQ B;  3VR6 A;  1HZE A;  1KK2 A;  4N3G A;  5HZB A;  2F1M A;  1TVC A;  1UD2 A;  2F1L A;  1TTT A;  5F4O A;  1QGA A;  4X07 A;  1M90 D;  1TUI A;  4RCY A;  1VQ7 B;  3CCM B;  2B7B A;  1VQ5 B;  2X0K A;  2V7T A;  3QFS A;  1NB0 A;  3BQJ A;  4M53 A;  4RLZ A;  1WDT A;  4P2N A;  4NNJ A;  4K1X A;  4TSF A;  1ELO A;  2BSA A;  3QFC A;  3CCS B;  3V7A A;  2X6Y A;  3P26 A;  4DQL A;  4G6I A;  1K9M D;  4RPB A;  4B47 A;  1W87 A;  3Q39 A;  1YJW B;  1ZUN B;  5F4M A;  4FXU A;  2AHO A;  2ZIT A;  3W5H A;  4Z4V A;  2VJJ A;  4LBY A;  4RDJ A;  2DEU A;  4M2L A;  4RD2 A;  3AVV A;  4FN5 A;  5CDF A;  1MRZ A;  3CCJ B;  1Q82 D;  2XEX A;  4L8J A;  2GQF A;  2X53 S;  1VQ9 B;  2V7V A;  4PC3 A;  1EFT A;  4IW3 B;  4XOT A;  4QHY A;  1I7P A;  4X06 A;  3QFT A;  1OGI A;  2V7X A;  4AF6 A;  2JJ1 A;  1KRH A;  3H94 A;  3AST A;  1QUE A;  1GO2 A;  4ZCL A;  1R5N A;  3B82 A;  1OGJ A;  4AF7 A;  2BF4 A;  3SLD A;  5LMZ A;  1N07 A;  1DAR A;  2EIX A;  4XOP A;  1WOR A;  3CCE B;  5FO0 A;  3AVX A;  3CME B;  1S4M A;  1S0U A;  4P3I A;  2VBU A;  1GAQ A;  4FWT A;  2D3L A;  4X0C A;  4XLA A;  3E20 A;  1E79 A;  4NBS A;  4EH1 A;  2WR8 A;  5IYQ A;  2GJK A;  4MYU A;  1QVG B;  2DYI A;  3OP1 A;  2QE7 A;  2YWH A;  1PJ6 A;  3G05 A;  1ZM2 A;  1K28 D;  4RDL A;  1WOP A;  1VJS A;  4XLC A;  2W6I A;  4OPV A;  4B43 A;  1Q7Y D;  3GVK A;  4TMX A;  2BGJ A;  1OB2 A;  4RD3 A;  1QG0 A;  4QFM A;  3QSY A;  1R5B A;  2ZL6 A;  2OBR A;  2YWE A;  4YAO A;  1E3X A;  1FNM A;  3CRZ A;  5J35 A;  3ZZT A;  3JQP A;  1R5O A;  3E1Y E;  2W6J A;  5FO1 A;  3WYA A;  4Z4Z A;  4TMZ A;  2GRE A;  4P6V F;  3WXM A;  1OB5 A;  2X8K A;  3OAA A;  4JMQ A;  3OPO A;  1G7T A;  3G4S B;  2QN6 A;  1WPC A;  4OP7 A;  4TKO B;  2PIA A;  4BPR A;  3I56 B;  1B2R A;  4PAB A;  2DIE A;  4FK8 A;  2QEX B;  3LNN A;  4XKW A;  1GVH A;  2ZL7 A;  1JA1 A;  1XFO A;  3ZZ0 A;  2XNJ A;  2QDX A;  3U6B A;  1F20 A;  3AGP A;  1OHH A;  1VHO A;  4II3 A;  1HA3 A;  4XOR A;  4XN3 A;  2X6X A;  3PA2 A;  3G71 B;  2WJY A;  4KKS A;  2NV4 A;  3A3G A;  4Q7J B;  1GJR A;  3CC4 B;  1AIP A;  1I18 A;  2VBV A;  1CNF A;  3VMF A;  3A8K A;  3CC7 B;  3CMA B;  2JIZ A;  4HE5 A;  1NDH A;  1BLI A;  3AGQ A;  3SJZ A;  1YHQ B;  3RY8 A;  3CXC B;  4P12 A;  4ASU A;  1VQM B;  1K8A D;  2V31 A;  1Q81 D;  2KVO A;  1YJ9 B;  2PMD A;  2QGG A;  5TRD A;  5JBQ A;  4OOX A;  5J3O A;  2XZL A;  4P3Y A;  1VQK B;  3Q3A A;  4CQJ A;  3ONY A;  3OW7 A;  4YAW A;  1W9X A;  2ZXI A;  4KKU A;  3CES A;  1WOS A;  1KD1 D;  2CC2 A;  1JA0 A;  4B44 A;  5A89 A;  1WTH D;  4YAL A;  4C0S A;  2BM1 A;  4QV2 A;  4P6Y A;  1DDI A;  1QFZ A;  4UAJ A;  2RC6 A;  2VJI A;  1KTV A;  2BVN A;  1HVX A;  1MAB A;  1VQP B;  3MHP A;  2OBS A;  3JQQ A;  2BMW A;  3WND A;  5BSX A;  2E1R A;  3KL9 A;  1G7C A;  2ZZG A;  5EMN A;  2WSS A;  2BPO A;  3PA1 A;  2HCJ B;  3AVT A;  1A8P A;  1G7R A;  4ROX A;  3SEJ A;  1KJZ A;  2CF4 A;  1IB0 A;  4LC0 A;  1VLY A;  3SLN A;  3W5U A;  1H8E A;  2NPF A;  4ZCM A;  3VNV A;  1T6Z A;  2C5B A;  3CD6 B;  1H42 A;  4PC7 A;  3I55 B;  2GJP A;  1GR1 A;  4J0Q A;  2XZP A;  4Z4S A;  1S72 B;  1JB9 A;  1I8D A;  1XE1 A;  3ASR A;  1B23 P;  1WU8 A;  1BJK A;  4B48 A;  5A88 A;  1SKY B;  4Y9U A;  1KC8 D;  3FJO A;  1NRK A;  4LBW A;  5KNL A;  3CPX A;  2Q6K A;  2F43 A;  1YIJ B;  5HZA A;  1EFC A;  3PVD A;  1IJE A;  4PC1 A;  3ZIA A;  4B3F X;  4XKV A;  5A8A A;  4QVJ A;  5HXB A;  3DDY A;  1E64 A;  2YWG A;  1N8R D;  4M0L A;  3W2G A;  1PJ5 A;  3WBK A;  4DNT B;  4DQK A;  1KK1 A;  3OW2 B;  2XZO A;  1EXM A;  1YI2 B;  2I1L A;  1BQE A;  3QE2 A;  4YAU A;  4XLE A;  4YHB A;  4N3N A;  2R6H A;  1EWY A;  2X85 A;  2JDI A;  4R71 A;  1E63 A;  3MMP A;  4OPO A;  1YLO A;  2E1B A;  4WZK A;  3B78 A;  4XNF A;  4ZCI A;  2ZZF A;  1UD3 A;  4P25 A;  2OTL B;  2C2W A;  2XND A;  2DER A;  1GAW A;  1ZM3 A;  1BMF A;  4XD7 A;  1KK0 A;  3VO2 A;  4E0F A;  3ES9 A;  1F60 A;  4P1V A;  1WP6 A;  1QFJ A;  1SKQ A;  1WSV A;  2CND A;  1COW A;  1D8T A;  1Y0R A;  4XON A;  4XQF A;  4TMT A;  4Y7C A;  3FPK A;  4P26 A;  4AVZ A;  5HKK A;  1N0V C;  3FPP A;  4WWV A;  1IHM A;  1RQR A;  4RM0 A;  3CCV B;  2JN9 A;  2OTJ B;  4RD4 A;  1EP3 B;  2F4N A; 
#chains in the Genus database with same CATH homology
 3OJX A;  1KQS B;  5GV7 A;  1SM4 A;  4ZV4 A;  5H5J A;  1FRQ A;  5TV2 A;  2VNJ A;  1QGZ A;  3W2H A;  1EP1 B;  3AVY A;  1XB2 A;  4HE6 A;  2GPJ A;  1D2E A;  4PC6 A;  4B3X A;  3PEN A;  1JNY A;  3WY9 A;  4G5G A;  4M1K A;  3V76 A;  2VNK A;  4ZGN B;  1BX1 A;  1VQN B;  3CC2 B;  3I1F A;  1FND A;  5AN9 A;  2DET A;  4WQM A;  2D74 A;  3CB4 A;  2BM0 A;  1VQ4 B;  1FNC A;  1E62 A;  4M4S A;  3CCR B;  3VNU A;  2QTL A;  4TMV A;  5DSZ A;  1VQO B;  2VYQ A;  2B5O A;  1VQ6 B;  4TMW A;  1ZM9 A;  1W2B B;  3U6K A;  1KK3 A;  4PC2 A;  1H85 A;  1Q86 D;  2HMA A;  3LVB A;  4RCZ A;  2QMU A;  4ACB A;  4ACA A;  1D1N A;  3ZC3 A;  1N0U A;  1U2R A;  1DG1 G;  3CCL B;  4U9U A;  1K73 D;  3P27 A;  1W34 A;  4AC9 A;  4B4D A;  1CQX A;  4Y9R A;  3W2E A;  2B7C A;  1BX0 A;  1QX4 A;  4NCN A;  3JQR A;  4RD6 A;  3MCA A;  1FNB A;  4G1V A;  2VNH A;  4G1B A;  1QGY A;  3QFR A;  3OZV A;  4LBZ A;  1QVF B;  5TR9 A;  4H9G A;  1DDG A;  1EP2 B;  2X3U A;  1ZM4 A;  2J7K A;  3B8H A;  3G6E B;  2PLF A;  3WNC A;  3ZZU A;  1FRN A;  4PGO A;  5GV8 A;  2BV3 A;  2BN4 A;  3OZU A;  3VO1 A;  4LBV A;  1VQ8 B;  3WNB A;  1EFU A;  3W2F A;  3ZBU A;  3W5V A;  3CPW B;  2QA4 B;  1J9Z A;  2DCU A;  3J81 k;  4C43 A;  2VNI A;  1FDR A;  2OK7 A;  3CW2 A;  2C77 A;  3AVU A;  1NJI D;  4TN1 A;  3CCU B;  4RJL A;  3U2Q A;  4MYT A;  5TY0 A;  2HDN B;  3WBJ A;  2BGI A;  2C78 A;  3W2I A;  2CRV A;  1CNE A;  1M1K D;  2QTZ A;  3AVW A;  1IJF A;  3OZW A;  4RD0 A;  1YJN B;  4RD1 A;  4YAF A;  2DY1 A;  1QH0 A;  5H59 A;  1JJ2 B;  2OK8 A;  1VQL B;  1G7S A;  1UMK A;  2YWF A;  1QUF A;  2EFG A;  3CCQ B;  1TLL A;  5THX A;  2XNC A;  2VZL A;  5KSW B;  3LO8 A;  3ZBT A;  1QFY A;  1YIT B;  1W35 A;  2RC5 A;  1AMO A;  4F7D A;  2FX3 A;  5FA6 A;  3OJW A;  4ZGQ B;  1KK2 A;  4N3G A;  1TVC A;  1TTT A;  1QGA A;  1M90 D;  1TUI A;  4RCY A;  1VQ7 B;  3CCM B;  2B7B A;  1VQ5 B;  3QFS A;  4M53 A;  1WDT A;  4K1X A;  1ELO A;  2BSA A;  3QFC A;  3CCS B;  3P26 A;  4DQL A;  1K9M D;  4B47 A;  1W87 A;  1YJW B;  1ZUN B;  2AHO A;  2ZIT A;  3W5H A;  4LBY A;  2DEU A;  4M2L A;  4RD2 A;  3AVV A;  4FN5 A;  3CCJ B;  1Q82 D;  2XEX A;  2GQF A;  1VQ9 B;  4PC3 A;  1EFT A;  4IW3 B;  4QHY A;  1I7P A;  3QFT A;  1OGI A;  4AF6 A;  1KRH A;  1QUE A;  1GO2 A;  4ZCL A;  1R5N A;  3B82 A;  1OGJ A;  4AF7 A;  2BF4 A;  1DAR A;  2EIX A;  3CCE B;  3AVX A;  3CME B;  1S0U A;  1GAQ A;  4FWT A;  3E20 A;  4NBS A;  4EH1 A;  4MYU A;  1QVG B;  2YWH A;  1ZM2 A;  4B43 A;  1Q7Y D;  4TMX A;  2BGJ A;  1OB2 A;  4RD3 A;  1QG0 A;  4QFM A;  3QSY A;  1R5B A;  2YWE A;  4YAO A;  1FNM A;  3CRZ A;  3ZZT A;  3JQP A;  1R5O A;  3E1Y E;  3WYA A;  4TMZ A;  3WXM A;  4P6V F;  1OB5 A;  1G7T A;  3G4S B;  2QN6 A;  4BPR A;  2PIA A;  3I56 B;  1B2R A;  4FK8 A;  2QEX B;  1GVH A;  1JA1 A;  3ZZ0 A;  3U6B A;  2XNJ A;  2QDX A;  1F20 A;  3AGP A;  1HA3 A;  3G71 B;  4Q7J B;  1GJR A;  3CC4 B;  1AIP A;  1CNF A;  3VMF A;  3CC7 B;  3CMA B;  3SJZ A;  4HE5 A;  1NDH A;  3AGQ A;  1YHQ B;  3CXC B;  1VQM B;  1K8A D;  1Q81 D;  1YJ9 B;  2PMD A;  5JBQ A;  4P3Y A;  1VQK B;  4YAW A;  1KD1 D;  1JA0 A;  4B44 A;  4YAL A;  4C0S A;  2BM1 A;  1DDI A;  1QFZ A;  4UAJ A;  2RC6 A;  1KTV A;  2BVN A;  1VQP B;  3MHP A;  3JQQ A;  2BMW A;  3WND A;  2E1R A;  1G7C A;  5EMN A;  3AVT A;  2BPO A;  2HCJ B;  1A8P A;  1G7R A;  1KJZ A;  1IB0 A;  4LC0 A;  3W5U A;  2NPF A;  4ZCM A;  3VNV A;  3CD6 B;  1H42 A;  4PC7 A;  3I55 B;  1GR1 A;  4J0Q A;  1S72 B;  1JB9 A;  1XE1 A;  1B23 P;  4B48 A;  1BJK A;  1KC8 D;  4Y9U A;  3FJO A;  4LBW A;  1YIJ B;  1EFC A;  1IJE A;  4PC1 A;  5HXB A;  1E64 A;  2YWG A;  1N8R D;  4M0L A;  3W2G A;  3WBK A;  4DQK A;  1KK1 A;  3OW2 B;  1EXM A;  1YI2 B;  1BQE A;  3QE2 A;  4YAU A;  4YHB A;  4N3N A;  2R6H A;  1EWY A;  4R71 A;  1E63 A;  3MMP A;  3B78 A;  4ZCI A;  2DER A;  1GAW A;  1ZM3 A;  1KK0 A;  3VO2 A;  3ES9 A;  1F60 A;  1QFJ A;  1SKQ A;  2CND A;  1D8T A;  4TMT A;  4Y7C A;  3FPK A;  1N0V C;  3CCV B;  2OTJ B;  4RD4 A;  1EP3 B;  2OTL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...