2CS4A

Solution structure of n-terminal domain of chromosome 12 open reading frame 2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
GSSGSSGMELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of N-terminal domain of chromosome 12 open reading frame 2
rcsb
source organism Homo sapiens
molecule tags Structural genomics, signaling protein
molecule keywords Protein C12orf2
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cs4A00
3R7QA 5IAAC 2XK5A 2KNBA 2NPTA 4K7WA 1VCBA 4KSLC 5TR5A 2O2VB 3U30A 1H4RA 3OJ4B 4FJYA 5D2MB 4XC2A 3W1SC 1WYWB 1WGYA 3EECA 2D2QA 1T0YA 1EF1A 3KW5B 2GBJA 1J19A 3PHXB 4K7UA 1U4AA 4WJPA 3TBLD 2RPQA 1LFDA 4MGIE 2I1JA 3B0AA 3APFA 2J0MA 3Q3FA 1J8CA 3ECIA 1WGRA 2MP2B 4I6LB 3KYCD 1HE8A 1RFAA 1WMHA 4I6PA 4JGHB 3MHSD 1IPGA 3H9DA 4GDKA 3PRPB 5GMVA 2N9PC 2Z0EB 3ZVVA 2NR2A 2GBRA 1KM7A 5JHBA 3L08A 2DAJA 1Q0WB 4W9CA 2QHOA 3UIOB 3A9JB 4WAAA 1UD7A 2NBVB 4W9LA 2KMAA 2HJ8A 3SDLC 3JSVB 2G4DB 2KC2A 2Z59B 1UBIA 2ZPNA 5LXHA 2LZ6A 3EC8A 2IY1B 3UF8A 2REXA 4HJKA 4LDTD 2L7RA 2LGDA 3RZWC 3OJ3A 5HKHA 2V3SA 3PS6A 4G11A 2PPHA 4MJSA 1KLVA 3H7PB 2KDEB 3VVWB 3N30A 1S1QB 2D11A 1SIFA 2KJHB 3PGEA 2L00B 2FCQA 2AYOB 2K1FA 2KZRA 1E8XA 3B08A 3DOWA 2L3ZA 1V80A 4ICVA 3BY4B 5KHQA 1WZ3A 1WGHA 4M8MA 3QIJA 3ML9A 2FAZA 1WJUA 3QQ8B 3QCAA 3PRMB 4GOCA 2J0JA 4W9GA 2DX5B 3WA0A 3PZDA 4AOFA 2K6QA 2CR5A 2N9EB 3TIXA 1GUAB 3CSFA 1J0GA 3ENEA 2MLBA 2EKEC 3DBLI 2PE9A 4DHZB 4FBJB 1WRDB 2LXCA 1V5OA 2MQJA 4TQ0A 1GJZA 4HLEA 2A4ZA 3DBHI 2JY6A 2KDBA 2BKRB 2KQ7A 3RZFA 3HM3A 1FXTB 4EUTA 4ZYNA 2N7EA 1WXVA 2LI5A 4GIVA 3VUXA 4ZRKA 4LJPB 3V6CB 1R4MI 3VH3B 4DWFA 4NJ6A 3ZDTA 1WR1A 1Z5SB 3V62A 4IWPA 5EDSA 2JRHA 3VUWA 4IM3A 1EF5A 1JRUA 2KWVB 1C3TA 3H6NA 4CYEA 2BYEA 4IW0A 4DXAB 1F9JA 1C1YB 2MWSB 3A1QA 3W1SA 3DQVA 1ISNA 2FUHB 2AEHA 2IBIB 2DZMA 4G50A 5IA7A 2LVPA 3HM6X 3KUCB 3JYUA 3AI5A 2C7NB 2KFKA 2JXXA 3QARA 2MBEA 4ZRJA 2V1YA 3DBSA 5AEKB 4HDOA 3W1YA 3K9PB 2N7DA 3IVFA 3V60A 4HCNB 2D07B 3WIMA 2L8JA 4A3OA 4MGZE 1WJ4A 4E3CA 3R3MA 3VXWA 3RT3B 1S3SG 2CHZA 4MM3A 4DK5A 1V81A 2RR9A 5DCNA 4WJNA 4IUMB 1XT9B 2WWZA 4M0WB 3PSEB 4WWPA 5CTRC 3UGBB 4NQLB 1H8CA 1AARA 3QJZA 1WR6E 2W9NA 3T8MA 3MTNB 3P2BA 4RM8A 3ZTCA 4ANXA 3CMMB 4JQWC 2G45B 2D10A 2LD9A 3L0WB 4II2B 3T9LA 4FA6A 1NBFC 3DPDA 4PS7A 1P0RA 2D3GA 1ZW7A 2XBBC 1TGZB 4AWJA 3CSTA 3MJWA 4B9KA 5AZHA 1WY8A 1E8ZA 4GMVA 5D94A 4PYUA 3VAWA 2KK8A 2JWZA 4W9IA 2KVRA 4TV3A 3L13A 1KJTA 1L7YA 3PLVA 4F1SA 4DBGA 2LXAA 2O6VD 4FULA 4FADA 3RYTA 1YD8U 2KN5A 3WAMA 2PJHA 2C9WB 3EFUA 3LDZE 2NCNA 4GSWA 2MBHA 3ZO5B 3WANA 2YVCA 2GOWA 4EEWA 4ZDVA 3PRZA 3QK0A 2IO0B 3O65B 4MGKE 3RUIB 4CHKA 1CMXB 1E7VA 1SGHA 1UZXB 2RD0A 3APDA 1NI2A 3A33B 3ZTDA 1E8WA 4W9KA 3KH0A 3UQBA 2IY0B 2GBMA 3V61A 3V6EB 1P9DU 3DDCB 5CHWA 4KIKA 2K8CA 1V5TA 2ZCCA 1Y8RC 2LGXA 2J7QB 3N3KB 3QX1A 2NVUI 3APCA 3NZUA 2CU1A 3H7SA 3A9KA 2AL6A 1P1AA 1WX9A 2DZIA 4NAWA 1EUVB 2IO3B 4AP4C 1WM3A 3RULA 2NBUA 4BKSA 4MJSB 2BKFA 5E6OA 4PS3A 5C23A 2KHWB 4BKTA 3A9KB 3IBEA 5D7GA 4GU2A 3N32A 3C0RB 1WZ0A 2OJRA 3ZKJC 2ZVNA 3TMPB 2DAFA 5L83A 1WF9A 2KXJA 2N4FA 2KWUB 3M95A 2MW5A 5BO4B 1WXSA 2K25A 2KTFA 3TL5A 4LCDE 2XEWA 4KSKC 4WJOA 1WE7A 2ZJDA 2RGFA 1WJNA 2B3AA 3DBRI 3VHTC 2NS5A 4NAWB 2K8BA 3M62B 1WH3A 2MSED 4KIKB 2WYQA 2FIDA 5DPSA 4IM0A 4WQOB 4TUUA 4BKSD 2DZKA 4E74A 3R66C 4HVBA 1ZGUB 2KOXA 5AZGA 3L17A 3ONSA 5J2RA 3OAWA 2R2QA 1NDDA 3ALBA 1UH6A 2WX0A 2LUEA 2FNJB 2LVOA 3GOEA 4BBNC 4K81A 1PQSA 4N9F4 3ZUNA 3PREA 2WX1A 5DPWA 2ZEQA 3S2AA 2J0KA 4BOSC 3U8ZA 1D3ZA 1SE9A 4FLHA 4K1RB 4FN2A 2KJRA 3SD5A 4II3B 5DPTA 4TQ1A 3KUZA 3QAQA 4F7ZA 4HPLB 1V6EA 4WWOA 2C60A 4FJZA 4AJWA 1I42A 3DVGX 2JUOA 2N9XA 1TZ1A 4MELA 1MG8A 2DYBA 4DDGD 2L05A 2ZNVB 3PLUA 5D6JB 2XK5B 3AU4A 1A5RA 1OTRB 2KTRB 3PHWB 3VUYA 5CHFA 1XD3B 4X57B 1Q5WB 2BWES 3QC8B 3VFKA 3X23A 4ASWC 2OOBB 1WX7A 1WIAA 2JPHA 1WGGA 1YIWA 1E5WA 2YLMA 1VD2A 3QWZB 1V9JA 2IZVB 4URKA 1TTNA 2BGFA 4LJOB 1E8YA 2Y5BB 1X1MA 3VDZA 3AXCA 1R4NI 2RSUA 1P3QU 3DVNU 2C5LC 2K6DB 3B1LX 4HXDA 4W9HA 2L0TA 4IM2A 3IG3A 4XZ4A 5DPRA 3ZRCA 3VTUA 3K9OB 2G4SA 2PE6B 1OEYJ 2HTHA 3IHPC 3BINA 2KWCA 3R7RA 1QZEA 4G0NB 3ZW3A 2M0XA 4IC7B 5LLIA 2Z0DB 1E7UA 3A4SC 1WMHB 2KC1A 4WJQA 5E6PA 1E90A 4RM9A 5JHAA 3WALA 4BBNF 3JSVA 1GC7A 4JL9A 2IO2B 5G55A 4AJYB 4MSMB 2KX3A 3PTFC 3NHEB 2V4LA 5AZFA 4EZJA 1WM2A 2GMIC 4GB9A 4BFRA 1KOTA 4MH0E 4GGQA 4PS8A 3UQAA 2CHXA 2AL3A 3HIZA 4GDKB 1ZKHA 3A1QB 4W9EA 4DHJB 1YX6B 4IWOA 3PVLA 3I3TB 3HHMA 1IYFA 3GZNI 1EO6A 1IP9A 2JZ3B 3ZLZA 3EHVA 2ZPYA 3L54A 4B6WA 2KX0A 4GDLB 2DZJA 3UINB 1GNUA 2KKCA 2JVCA 1GC6A 4KDIC 2GBKA 3ZRFA 3VQIA 1V2YA 2BF8B 2O2VA 4XX5A 4EOYA 3QA8A 1RAXA 2MX2A 3ZNID 2HE7A 3ML8A 4EZKA 2CHWA 4NNJB 2M8SA 5CX3A 1WX8A 3X0WA 5L95C 3U7DA 3DVNV 2KJ6A 2WDTB 1YJ1A 1I35A 2KD0A 4FHKA 4MEMA 4MGYE 2G3QB 4YL8A 3SU8X 1TBEA 2IO1B 1LXDA 3L16A 3NS8A 1WXMA 4GXBA 1WJ6A 4BVUC 4JIOU 3PV1A 2LRWA 2O6VB 4CO7A 3DVGY 2M1MA 2C7HA 3KUDB 2M17A 3RCZA 2UYZB 2KLCA 4A3PA 1RLFA 2KDIA 2AWTA 4P7IA 2PEAA 3IFWB 4W9FA 4KV2A 2MP2A 2KFKB 2BWFA 2MRPA 3PPAA 4F8CB 5C1ZA 2ZCBA 2MBQA 2DYOA 2MBOA 1LQBA 1OGWA 5JH5C 2KDFB 2I1KA 3PT2B 4WWNA 3WAPA 2L0FA 2ZVOA 2LJ5A 4DHZE 3AULA 1OQYA 3VH4B 1UELA 4E71A 4BKGA 2FCSA 2LVQA 4DDID 1LM8B 2UWQA 2BPSA 2JRIB 3VTVA 3D32A 4EFOA 2LASA 5JZEB 1YX5B 3TJPA 4GN1A 1P98A 1WFYA 4KZCA 2N1WA 4DHJD 2JZZA 1G6JA 2A5UA 2KO3A 2CKHB 2JF5A 4NQKE 4FHJA 3TCAA 1Q1OA 2NBWB 1V49A 2R2OA 4ZRIA 3DCGA 1YQBA 2BYVE 3HK0A 4HDQA 3AU5A 2KFJA 4ICUA 4I6NB 5J18A 4J6IA 4NY0A 2NPTB 1WXAA 4B95A 3LJ3A 3NY5A 4GDLA 4ANUA 1Z2MA 4MSQB 3ZIMA 4BOZB 2MA9B 2EMSA 2FIFA 4HK2A 1OEYA 3VTWA 5E6NA 4PYZA 4HWIB 4ANVA 2LRUA 2M4NA 2LWPA 2KLGA 4LDTB 4NJ7A 5FR6A 2KQSA 4K7SA 3ZNZB 2ASQA 2ZZPB 1WE6A 1V86A 2KANA 4MDKE 4TKNA 2L76A 2CS4A 2DENB 3A4RA 3JW0X 4KZ0A 3OLMD 4IG7B 2FCMA 4EKUA 2KMCA 2BYFA 1RRBA 3H7PA 5J17A 1L2NA 2EMTA 4KDLB 4FJVB 1M94A 5KHOA 3JVZX 2LGYA 2ZNVC 3RD2A 3ZNGC 4AUQC 3UIPB 1BT0A 1UBQA 5G2NA 4EZLA 4A20A 2O6VA 2DHZA 2N1VA 2K8HA 4HCPB 4KVGB 3A9JA 5CHVC 2MBBB 1WGDA 4M8NA 4OVVA 4ANWA 2FCNA 3NOBA 1GG3A 3QHTA 3M63B 3KVFB 1K8RB 3KYDD 3WAOA 4IWQA 4W9JA 3SHQA 3L10B 2GBNA 3Q3JA 1WI0A 4W9DA 1XQQA 2JT4B 2MCNB 3ZNHB 3CF6E 1UGMA 3NZSA 4G3XB 4HPMB 2DYMA 2VRRB 2C7MB 2K39A 4OVUA 3M3JA 2IYDB 4JLCA 5LXIB 4NPNA 3ZDMC 3H1UA 2KTRA 2HD5B 4RMAA
chains in the Genus database with same CATH superfamily
5IAAC 2XK5A 3FC4A 1C79A 1H4RA 3U30A 1HZ5A 3EECA 1T0YA 2HDEA 3E9SA 1AWDA 4K7UA 1LFDA 2BBCA 4MGIE 2RPVA 1FCCC 3B0AA 1FRDA 3N20C 3KYCD 1WMHA 2NMQA 4I6PA 2KWDA 2LEKA 5GMVA 2N9PC 2Z0EB 2DAJA 1Q0WB 4WAAA 1UD7A 2NBVB 3SDLC 3ZYYX 1JWUD 3UF8A 2SEBD 4XWTA 1E6EB 1JWBD 3NS1A 3VVWB 3N30A 2JZPA 2KJHB 3ZXRA 2AYOB 2FAZA 2NTSA 2GLSA 3PRMB 1QT9A 3AEBB 4AOFA 2K6QA 2MLBA 2EKEC 3DBLI 2PE9A 4RGOS 4FBJB 3DBHI 2BKRB 2DLBA 5HI1A 4ZYNA 2N7EA 1VZ7A 1KF6B 5D3IB 3VUXA 1HTOA 3BK1A 4NJ6A 1KLGD 1Z5SB 2BS2B 4JWSC 2KWVB 3BYTB 4DXAB 3DQVA 1ISNA 1L4ZB 2QDFA 2DZMA 1AYFA 2VH2A 4A6QA 4KGSA 3HM6X 3AI5A 1YQ4B 3DBSA 3DHIC 1N5XA 2N7DA 4IOIE 1XLQA 2WDVB 2D07B 2L8JA 1WJ4A 4P1BC 3R3MA 1S3SG 1QKZA 3AMZA 1MI0A 1SE2A 1TZOA 5DCNA 4WJNA 1XT9B 4WWPA 4NQLB 2BYTA 1C77A 1YN4A 1VJKA 3P2BA 1Q10A 4CQNA 1FRRA 2D10A 2G45B 1WWTA 2J53A 2AQ3B 4AWJA 3CSTA 3MJWA 1E8ZA 5D94A 2KK8A 3HRDD 3L13A 1CJEA 2O6VD 1ZOYB 4L1BA 2JWUA 1YN5A 1E9MA 3PRZA 3QK0A 4CHKA 4OHJA 3P4RB 1UZXB 1SGHA 2K9XA 1M4VA 5GXGB 2WXNA 4KGRA 4P16A 4XYCA 1V5TA 2D3BA 2LGXA 3N3KB 1MFWA 4NAWA 3H7SA 3TSSA 4MJSB 2BKFA 5E6OA 4PS3A 1J7AA 4DQOC 1IBXA 4BKTA 3A9KB 3EA6A 1YN3A 1WZ0A 2GB1A 1HA5A 2KWUB 4YSZB 2K25A 2BVCA 4WJOA 1B1ZA 2RGFA 1GOZA 1WJNA 2B3AA 4NAWB 4RCOA 3RNEC 2MSED 4WQOB 4TUUA 2W54A 1DYQA 1LO5D 1ZGUB 5AZGA 2QC8A 4PT5A 1FNUA 2G9HD 2R2QA 3U4EG 1UH6A 1ZE3D 2WHIA 4S0RA 3PREA 2WX1A 4L23A 1DOYA 4FLHA 4F7ZA 4FJZA 4AJWA 2QILA 3DVGX 2JUOA 2DBYA 1MG8A 4DDGD 3PLUA 2ZNVB 3AU4A 1PFDA 3HVZA 3O13A 4J3OD 1WSPA 3AB5A 3QC8B 2OOBB 3AE1B 3GS2A 1E5WA 1TS5A 4RF1A 1V9JA 4URKA 2MEKA 2C5LC 2Y3AA 3B1LX 1ENFA 4IM2A 3IG3A 3RPFC 4K3BA 1TKEA 4D2KA 1JCKB 2HTHA 3RNGC 3BINA 2KWCA 4MACA 1F1HA 3EUB2 1V97A 3U7ZA 1E90A 1VLBA 2RMMA 4JL9A 3NVYA 4ZYSA 3PTFC 4EZJA 4M01A 2LMCA 4MH0E 4PS8A 3UQAA 3MP9A 4GDKB 4IWOA 3KQ4A 1TS4A 2N9LA 2BQQA 2INCC 3Q3MC 2KX0A 4GDLB 4IKGA 2GBKA 3ZRFA 1FIQA 1V2YA 4XX5A 3QA8A 1RAXA 3ML8A 4RFBA 2CHWA 2M8SA 3H8HA 4WWMA 1WX8A 3X0WA 1V1PB 2SAKA 3DVNV 2PTLA 2WS3B 4MEMA 2G3QB 4YL8A 1TBEA 1WXMA 4JIOU 1K50A 1NENB 5H8YE 1RLFA 3TEWA 1ZDXA 4RH6A 2PEAA 5H92C 2MP2A 1E0ZA 2BTEA 3DBLB 2JYTA 1RWSA 4M02A 4DHZE 3FILA 3AULA 1OQYA 4LLGM 1LM8B 2I2YA 2BPSA 4AQ7A 1YX5B 4GN1A 1WFYA 1WRIA 2N1WA 1Q1OA 2R2OA 1V49A 4Q2JA 3AE3B 3DCGA 4HDQA 5J18A 3LB8C 3LJ3A 1Z2MA 2MA9B 4PYZA 2LRUA 2RDBC 5FR6A 2KYWA 2AX5A 2ZZPB 3R2IA 1N5WA 2DENB 2WXIA 1RM6C 2QJLA 2NTTA 3URYA 3ZNGC 2WXRA 3UIPB 1BT0A 4HCPB 2K8HA 2HTME 4B0EA 1VR9A 5CHVC 5HG2A 4M8NA 1FD6A 4RGMA 2FCNA 1GG3A 3QHTA 4WAFA 3KVFB 1K8RB 3WAOA 4W9JA 2CU3A 2CJNA 3SHQA 4EE2A 2OHFA 1C4CA 1NYRA 4MH8A 3ZGZA 4G3XB 2DYMA 5IO9A 3M3JA 4PK1A 5LXIB 3ZDMC 3H1UA 2X8XX 4C7ZA 3R7QA 4K7WA 1VCBA 2IDYA 4KSLC 2O2VB 1ET6A 5BMHA 1EF1A 1U4AA 3BYYB 3NVVA 2I1JA 3APFA 3Q3FA 1D6EC 1WGRA 3N9YC 1RFAA 2MJDA 3H9DA 1TJEA 3BZDB 3PRPB 3ZVVA 2NR2A 2GBRA 3TEYA 1SE4A 3NVWA 3JSVB 2G4DB 1UBIA 2ZPNA 3LXFA 4OZBA 2LZ6A 2IY1B 2REXA 2LGDA 5BYQA 4G11A 4MJSA 2FUG1 2H89B 4RGTA 1DOIA 4WURA 5C3JB 2KZRA 2J4XA 2L3ZA 1V80A 5EE3A 3BY4B 2AQ1B 3P42A 3AE6B 3ML9A 1WJUA 2ONQA 3QQ8B 1MVKA 2Z8LA 4W9GA 1L6UA 2CR5A 2N9EB 1J0GA 3ENEA 1WRDB 1GJZA 1SIJA 5TSSA 3BWUD 2A4ZA 5D3DA 2WXLA 2KDBA 1L0VB 4HRSA 4M00A 4C56C 4LJPB 1ZXIA 4NAMA 1WR1A 4IWPA 1J7CA 1EF5A 1JRUA 3P63A 2IJ0A 4YTPB 4HPPA 4IW0A 3AEAB 3A1QA 3W1SA 1IGCA 2AEHA 1EWYC 2LVPA 3JYUA 2FE8A 1QOGA 4ZRJA 2V1YA 4HDOA 4OZAA 3K9PB 3IVFA 3V60A 3MHZA 2XN9C 1TS2A 3AEDB 2CHZA 5BMIA 2N9KA 3SR6A 1A70A 1TYGB 5EE9A 5CTRC 3PSEB 2PLPA 3QJZA 1WR6E 4HKQA 3CMMB 4RNAA 3Q8EA 3KWLA 1N62A 3L0WB 4II2B 4FA6A 1WYGA 1NBFC 3DPDA 4PS7A 1P0RA 1JMLA 2MH7A 1FCLA 2V0GA 4PYUA 1EM7A 4GLSC 1L7YA 4F1SA 4FADA 4FULA 4MT5A 2KN5A 3WAMA 2PJHA 2BB6A 3N1XC 3ZO5B 1SB3C 1XO3A 2YVCA 3ZJVA 4EEWA 3RUIB 3ZJTA 1P7FA 4QAYA 2RD0A 1NI2A 3ZTDA 2IY0B 2WXKA 3V6EB 4HEA1 2J7QB 3NZUA 2CU1A 2DZIA 1P7EA 3AM9A 1R4MB 1WM3A 2G1EA 2KVZA 4AP4C 3RULA 5C23A 2KHWB 2ACZB 3IBEA 4GU2A 3N32A 3ZKJC 1WF9A 5BO4B 1WXSA 2KTFA 1IUEA 2H88B 2WXMA 3VRAB 2V4IB 3AE2B 2MHJA 4KIKB 2WYQA 2FIDA 3ABVB 4BKSD 3W9CB 4E74A 1L0YB 4ARIA 1T0QC 3ALBA 1PQSA 3ZUNA 5DPWA 2ZEQA 3S2AA 2J0KA 2AQ2B 1ESFA 4FN2A 4C7YA 3QAQA 1V6EA 3Q2AC 4WWOA 1TY0A 2N9XA 1TZ1A 4MELA 1VDVA 1A5RA 1OTRB 3PHWB 3R8BA 1FFVA 4X57B 2BWES 1XLOA 4ASWC 1WX7A 1FXIA 1WIAA 4NZLB 1YOVB 2IZVB 5EE1A 5BMGA 1TTNA 2Y5BB 4HXDA 1R4NI 2J42A 1I4RA 1Y56A 3VTUA 4O1NA 3IHPC 5G5HA 1GPXA 3R7RA 1QZEA 2K22A 3ZW3A 2M0XA 5LLIA 4YTNB 4US9A 1E7UA 1WMHB 1TKGA 3MJ5A 5JHAA 3JSVA 2E6XA 2IO2B 1T0SC 3NHEB 1UNSA 1WM2A 4BFRA 2X38A 4GGQA 1KH0A 1L6VA 4KGTA 2CHXA 3HIZA 1YX6B 1FPYA 3GZNI 3EHVA 4B6WA 5EE0A 3UINB 2DZJA 3HVDA 2JVCA 4ARCA 3RN9C 2LHDA 3HUIA 4BZAA 2BF8B 1JWAD 1I4HA 2O2VA 2B76B 2MX2A 2HE7A 2V3NA 3NZ3A 4EZKA 5FKAC 3RMKC 5CX3A 1VZ8A 5L95C 3Q8AA 3U7DA 1C76A 2KJ6A 2WDTB 2IGGA 1MHXA 4A8XC 3GE3C 4MGYE 2R61A 5HHDG 3SU8X 1LXDA 3NVZA 2BS3B 4GXBA 2INDC 2LRWA 2O6VB 3DVGY 2M1MA 2C7HA 1UGJA 5AUKA 2Q5WD 3FILB 1V1OA 2WXHA 1JROA 2KDIA 4ZHOA 1SEBD 2K5PA 1N60A 3AECB 4KV2A 2KFKB 2BWFA 4F8CB 2ZCBA 2DYOA 5JH5C 2I1KA 2L0FA 1JRPA 1UELA 4E71A 4K3CA 4DDID 2UWQA 2JRIB 3VTVA 4EFOA 1P98A 4DHJD 1UF0A 3TCAA 4NQKE 3Q14C 4ZRIA 2BYVE 2KFJA 4NY0A 2NPTB 4B95A 1T3QA 3ZIMA 2EMSA 1OEYA 4HWIB 4ANVA 4USAA 3MC8A 2LWPA 1N6ZA 4LDTB 1QOBA 4C00A 4MDKE 2L76A 4US8A 2CJOA 3DWMA 3NRZA 4ITKA 5IP4D 2BYFA 3H7PA 1L2NA 2L83A 3ZXVA 4FJVB 3RD2A 4HROA 4A55A 4JX1C 1UBQA 3Q8BA 3I9V1 3A9JA 1WGDA 2K3UA 4ANWA 1V8CA 2INNE 3EGRA 1DGJA 1TS3A 2BS4B 4YSXB 3Q3JA 1WI0A 1XQQA 4IDIA 1B9RA 1UGMA 2QEJC 3Q69A 3I5JC 2C7MB 1PGXA 3C19A 2EKIA 4NPNA 3N1ZC 4RMAA 3ZNID 2KNBA 2NPTA 2WQYB 4XC2A 1WYWB 1E7PB 3CIRB 1T6BX 1R7SA 3KW5B 2GBJA 3PHXB 3TBLD 2RPQA 3W2DA 2J0MA 1N63A 5AUIA 1VRAB 1UWXA 2MP2B 3OWEB 3P1MA 5LNK1 1HE8A 4JGHB 3MHSD 2INPE 5JHBA 4R3DA 1JQ4A 1KM7A 1WGKA 4W9LA 1QOAA 2HJ8A 2KMAA 5LXHA 1K51A 2L7RA 3OJ3A 5HKHA 1NVID 2V3SA 2UU7A 1PDXA 1KLVA 1S1QB 1C9FA 1SIFA 3PGEA 1C4AA 1SE3A 2L00B 3B08A 3DOWA 3VR8B 2V9HA 2L1AA 1SXTA 4ICVA 2WXGA 5KHQA 1WZ3A 1WGHA 1TKYA 4XWWA 3ZQ4A 3VRBB 4GOCA 3WA0A 3B2FA 3PZDA 3TIXA 1GUAB 3RNCC 4TQ0A 2LXCA 4HLEA 1GAQB 3AE5B 3RZFA 3HM3A 5BYRA 1CQVA 2LI5A 4YTMB 4ZRKA 4XGAB 3VH3B 1FNVA 3N1YC 3GP7A 5IN7A 1NYQA 2MJEA 5JXVA 3IT6B 3H6NA 1FFUA 2BYEA 4CYEA 2MWSB 2WNMA 2YEPB 3QARA 2JXXA 2MBEA 1I4XA 1YQ3B 1SJHD 1SJED 1I4PA 4A3OA 5C2TB 4MGZE 2IGHA 3RT3B 4L2YA 4DK5A 1HZ6A 1V81A 4KX6B 2RR9A 2WWZA 1BMLC 1AARA 4HJGE 1IBXB 4B0MA 2W9NA 3T8MA 2LUMA 1AW7A 2ZW1A 3MTNB 1XCTL 4RM8A 4JQWC 3ZTCA 4ANXA 2LD9A 2Y5CA 2W3SA 1EU3A 4RF0A 1I4GA 1PYWD 4N59A 1TGZB 1FO4A 3V3XA 4NJCA 3I63C 3W5VB 4W9IA 3PO0A 2KVRA 4TV3A 1F2RI 3SFDB 3PLVA 1KJTA 3TEZA 4DBGA 3RYTA 1YD8U 1C4PA 3LDZE 2NCNA 4GSWA 2MBHA 2W3RA 3T3NA 3WANA 4ZDVA 2IO0B 3O65B 4MGKE 3APDA 3A33B 1L0XB 3B2GA 4REZA 3KH0A 4W9KA 2GBMA 3V61A 3DBHB 1P9DU 3DDCB 5CHWA 5G5GA 3T3OA 1Y8RC 4XE0A 2I38A 2M56B 2AL6A 2IO3B 2WXFA 1L5PA 5E6JA 4BKSA 1KFYB 1UWMA 3Q6BA 1OFFA 5D7GA 3C0RB 1F0ZA 1XLPA 1XF5L 2ZVNA 3TMPB 2DAFA 2DNFA 1D5XC 1ZPSA 3CWIA 3AV8A 3WCQA 3DBRI 1ROEA 2XNAC 4OVZA 5DPSA 4IM0A 1ACCA 3NUHB 2ZW0A 3E56A 2DZKA 1JW9D 3R66C 2WLBA 4HVBA 1D5ZC 3L17A 3ONSA 1GB1A 1NDDA 2LUEA 2FNJB 2GRIA 2LVOA 3GOEA 4BBNC 4K81A 4BOSC 3U8ZA 1HTQA 1SE9A 4K1RB 2KJRA 5T8IA 3SD5A 4TQ1A 1LGRA 2PMVA 3GZNB 1D5MC 1I42A 4JWUC 3LYYA 2L05A 2XK5B 2KTRB 1T0RC 3X23A 1I7HA 2JPHA 1WGGA 1YIWA 4JE3B 1ET9A 1VD2A 2LHEA 2LJIA 2BGFA 1E8YA 2DWQA 3VDZA 2OJWA 3AXCA 2RSUA 3DVNU 1MHHE 4W9HA 4XZ4A 1HXYD 2YEPF 3K9OB 1SSNA 4IC7B 2Z0DB 3A4SC 1XLNA 2JYEA 4RM9A 1F2RC 4BBNF 4AJYB 4MSMB 2KX3A 2GMIC 1KOTA 1YNTE 2PW9A 4W9EA 3NG0A 4RGNA 3HHMA 1IYFA 1IP9A 2JZ3B 3ZLZA 1C78A 4XDDA 1TT5B 3L54A 3DHHC 1AN8A 1RYJA 2PVOD 4NNJB 1IGDA 1TY2A 4S17A 1YJ1A 4ZHPA 1UUPA 1YJJA 4FHKA 2JU6X 2IO1B 4C4VA 3NS8A 3MFGA 4BVUC 3PV1A 3P4PB 3R2TA 2M17A 1KLUD 3RCZA 2UYZB 4KKJA 2EELA 1QF6A 1YMHE 4ZRPA 2AWTA 3IFWB 3P4QB 2FBWB 3PPAA 4ZRQA 2MBOA 1LQBA 1OGWA 2QCZA 3PT2B 4WWNA 3J9CA 4AS1A 2M0AA 2PVGC 4BKGA 2FCSA 1ZP0B 3AE4B 1JWMD 3DWGC 3D32A 5JZEB 3TJPA 4KZCA 2JZZA 1G6JA 2A5UA 2KO3A 3BVMA 4LNFA 1YQBA 3AU5A 4ICUA 1WXAA 3NY5A 4MSQB 1ZXHA 4BOZB 4HK2A 3VTWA 5E6NA 5I4DA 2BT6A 2M4NA 1XEEA 2KMMA 4K7SA 4TKNA 1V86A 2HJ1A 1D4BA 2CS4A 2JQRB 2JX5A 3OLMD 4IG7B 3RNFC 4EKUA 1RRBA 3AEGB 1NI3A 4ZOHC 4KDLB 3JVZX 2LFIA 4AUQC 3W5UB 5G2NA 4EZLA 2N1VA 1ZDVA 2MBBB 4OVVA 3NOBA 2ON8A 3M63B 1QOFA 3KYDD 2IGDA 4IWQA 3ZJUA 2KQ4X 2L52A 1N61A 1DOXA 4W9DA 1JALA 4LNOA 2JT4B 4C80A 2MCNB 1K52A 3CF6E 3FAHA 2E3TA 2VRRB 3GE8C 3BVGA 3TEXA 4OVUA 3RNBC 1I4QA 2HD5B 1VZ6A 4ACFA 5TR5A 1K53A 3OJ4B 4FJYA 5D2MB 2ICIA 3W1SC 1WGYA 2D2QA 4LNKA 1J19A 4WJPA 3AE9B 5BYSA 3Q8CA 1J8CA 1HQRD 3ECIA 4I6LB 2D5GA 2WDQB 3EFCA 1IPGA 4GDKA 1FMAD 1PGAA 2Y5PA 1FEHA 3RI7C 3L08A 3MC0B 4W9CA 3UIOB 2QHOA 3A9JB 3DBRB 2KC2A 2JXTA 2Z59B 3EC8A 4HJKA 4LDTD 3RZWC 3PS6A 2PPHA 3NJTA 3H7PB 2KDEB 2D11A 2QSDA 2FCQA 4A90A 2K1FA 1E8XA 4M8MA 3QIJA 3QCAA 2KDMA 2J0JA 2DX5B 1MG4A 3CSFA 2OEDA 4DHZB 2MQJA 1V5OA 1QQRA 2JY6A 4N58A 2KQ7A 1FXTB 4EUTA 1WXVA 4GIVA 3V6CB 1R4MI 4DWFA 1HEZE 2J52A 3ZDTA 4HKZE 3V62A 5EDSA 2JRHA 3VUWA 4IM3A 1MPEA 1C3TA 2RDHA 1F9JA 1C1YB 2JSVX 4UDUC 2WXPA 2FUHB 2IBIB 3IAM1 4G50A 5IA7A 3KUCB 4YWGG 2C7NB 2KFKA 3AEEB 5AEKB 3W1YA 1ZUD2 4HCNB 3WIMA 2PKOA 4E3CA 3VXWA 4MM3A 1YJIA 4N6EB 1L4DB 4IUMB 4M0WB 1H8CA 3UGBB 3T9LA 1RFKA 3KLSX 4OZCA 4H2AA 2D3GA 1ZW7A 2XBBC 4A9AA 4B9KA 5AZHA 1WY8A 4GMVA 3VAWA 2JWZA 1EU4A 4YT0B 2LXAA 2W55A 2KT7A 2C9WB 3EFUA 3FKYA 2GOWA 1R4NB 2D3CA 1T5XD 1CMXB 1E7VA 3UQBA 1E8WA 3C8YA 4WIPA 4M0WA 4KIKA 2K8CA 2ZCCA 4P1CC 3QX1A 2NVUI 3APCA 3A9KA 1P1AA 1WX9A 1EUVB 2WDRB 2WU2B 2LGSA 2NBUA 2KACA 2TSSA 2OJRA 5L83A 1F52A 2KXJA 2N4FA 3M95A 4MM3B 2N7JA 2MW5A 3OG5A 1WXQA 3TL5A 4LCDE 2WGSA 2XEWA 4KSKC 1WE7A 2BB5A 2ZJDA 3VHTC 2NS5A 2KAJA 2K8BA 3M62B 1WH3A 1E10A 3MC9A 3RNAC 3GB1A 4YSYB 3PZ7A 3RFZB 3IT4B 2KOXA 1XXGA 1MJDA 2QIEB 2VH1A 3OAWA 3AEFB 3I57A 5IOIA 5J2RA 2WX0A 3ETRA 4N9F4 4BAXA 3AE7B 1D3ZA 5FR3A 1F77A 4II3B 5DPTA 3KUZA 2QMTA 4HPLB 2W82A 3DHGC 1XCQL 2C60A 2PIAA 2DYBA 5D6JB 1SBBB 3VUYA 2N0SB 5CHFA 1XD3B 3Q3OC 1Q5WB 3VFKA 2YLMA 3QWZB 3UI3A 4LJOB 1CK1A 1X1MA 2V3PA 2VZKB 1P3QU 2K6DB 2WU5B 2L0TA 5DPRA 4DXGA 3ZRCA 4KKIA 2G4SA 1J7BA 2PE6B 1OEYJ 1FNWA 4G0NB 2KC1A 4WJQA 5E6PA 3WALA 1GC7A 4LNNA 1PUTA 5G55A 5AZFA 2V4LA 4GB9A 2KN4A 2WXJA 2AL3A 3B9JA 1ZKHA 3A1QB 3Q8FA 4DHJB 3PVLA 3I3TB 1EO6A 1V1PA 2ZPYA 3AH7A 4LTUA 2WP9B 1GNUA 1OQRA 2KKCA 1GC6A 4KDIC 3VQIA 2WXOA 3U52E 4EOYA 2LGIA 1FXAA 1QILA 4LNIA 1OQQA 3AN1A 3BVZA 1I35A 1EWCA 2D3AA 2KD0A 2M19A 1CZPA 3L16A 1WJ6A 5HFYA 3TUOA 2RDGA 2VZKD 4CO7A 3KUDB 2KLCA 4A3PA 3Q3NC 4P7IA 1FM0D 3BK2A 4TSSA 4W9FA 1SF0A 2BW2A 2MRPA 5C1ZA 2MBQA 4WH4A 4YXDB 2KDFB 1KRHA 3AE8B 3WAPA 2ZVOA 1STEA 2LJ5A 3VH4B 1NEKB 2MJ3A 2LVQA 2LASA 2L32A 2WXQA 4C4VB 1KTKA 2CKHB 2JF5A 4FHJA 2NBWB 4OW0A 3HK0A 4I6NB 4J6IA 4ANUA 4GDLA 1BXTA 1PGBA 2FIFA 3KWVA 1GB4A 3P4SB 1BUIC 2KLGA 4NJ7A 2KQSA 4XDCA 3ZNZB 2ASQA 5MPOA 1WE6A 4TMAB 2KANA 4P6VF 1JWSD 3JW0X 3A4RA 4KZ0A 2FCMA 2KMCA 5J17A 5FK9C 2EMTA 4DXFA 3IXSA 1M94A 3PZ8A 5KHOA 2LGYA 2ZNVC 3U2SC 4A20A 2O6VA 2DHZA 4KVGB 5IKCM 1QLBB 4WQMA 2K0PA 3IAS1 3L4PA 3V05A 2GI9A 3L10B 2GBNA 2IPKD 3ZNHB 4JPSA 3NZSA 1TIFA 4HPMB 4FXCA 3SFEB 3VR9B 2K39A 3SEBA 2IYDB 4JLCA 3BIID 2KTRA 4LK0M
chains in the Genus database with same CATH topology
3R7QA 5IAAC 2XK5A 2KNBA 2NPTA 4K7WA 1VCBA 4KSLC 5TR5A 2O2VB 3U30A 1H4RA 3OJ4B 4FJYA 5D2MB 4XC2A 3W1SC 1WYWB 1WGYA 3EECA 2D2QA 1T0YA 1EF1A 3KW5B 2GBJA 1J19A 3PHXB 4K7UA 1U4AA 4WJPA 3TBLD 2RPQA 1LFDA 4MGIE 2I1JA 3B0AA 3APFA 2J0MA 3Q3FA 1J8CA 3ECIA 1WGRA 2MP2B 4I6LB 3KYCD 1HE8A 1RFAA 1WMHA 4I6PA 4JGHB 3MHSD 1IPGA 3H9DA 4GDKA 3PRPB 5GMVA 2N9PC 2Z0EB 3ZVVA 2NR2A 2GBRA 1KM7A 5JHBA 3L08A 2DAJA 1Q0WB 4W9CA 2QHOA 3UIOB 3A9JB 4WAAA 1UD7A 2NBVB 4W9LA 2KMAA 2HJ8A 3SDLC 3JSVB 2G4DB 2KC2A 2Z59B 1UBIA 2ZPNA 5LXHA 2LZ6A 3EC8A 2IY1B 3UF8A 2REXA 4HJKA 4LDTD 2L7RA 2LGDA 3RZWC 3OJ3A 5HKHA 2V3SA 3PS6A 4G11A 2PPHA 4MJSA 1KLVA 3H7PB 2KDEB 3VVWB 3N30A 1S1QB 2D11A 1SIFA 2KJHB 3PGEA 2L00B 2FCQA 2AYOB 2K1FA 2KZRA 1E8XA 3B08A 3DOWA 2L3ZA 1V80A 4ICVA 3BY4B 5KHQA 1WZ3A 1WGHA 4M8MA 3QIJA 3ML9A 2FAZA 1WJUA 3QQ8B 3QCAA 3PRMB 4GOCA 2J0JA 4W9GA 2DX5B 3WA0A 3PZDA 4AOFA 2K6QA 2CR5A 2N9EB 3TIXA 1GUAB 3CSFA 1J0GA 3ENEA 2MLBA 2EKEC 3DBLI 2PE9A 4DHZB 4FBJB 1WRDB 2LXCA 1V5OA 2MQJA 4TQ0A 1GJZA 4HLEA 2A4ZA 3DBHI 2JY6A 2KDBA 2BKRB 2KQ7A 3RZFA 3HM3A 1FXTB 4EUTA 4ZYNA 2N7EA 1WXVA 2LI5A 4GIVA 3VUXA 4ZRKA 4LJPB 3V6CB 1R4MI 3VH3B 4DWFA 4NJ6A 3ZDTA 1WR1A 1Z5SB 3V62A 4IWPA 5EDSA 2JRHA 3VUWA 4IM3A 1EF5A 1JRUA 2KWVB 1C3TA 3H6NA 4CYEA 2BYEA 4IW0A 4DXAB 1F9JA 1C1YB 2MWSB 3A1QA 3W1SA 3DQVA 1ISNA 2FUHB 2AEHA 2IBIB 2DZMA 4G50A 5IA7A 2LVPA 3HM6X 3KUCB 3JYUA 3AI5A 2C7NB 2KFKA 2JXXA 3QARA 2MBEA 4ZRJA 2V1YA 3DBSA 5AEKB 4HDOA 3W1YA 3K9PB 2N7DA 3IVFA 3V60A 4HCNB 2D07B 3WIMA 2L8JA 4A3OA 4MGZE 1WJ4A 4E3CA 3R3MA 3VXWA 3RT3B 1S3SG 2CHZA 4MM3A 4DK5A 1V81A 2RR9A 5DCNA 4WJNA 4IUMB 1XT9B 2WWZA 4M0WB 3PSEB 4WWPA 5CTRC 3UGBB 4NQLB 1H8CA 1AARA 3QJZA 1WR6E 2W9NA 3T8MA 3MTNB 3P2BA 4RM8A 3ZTCA 4ANXA 3CMMB 4JQWC 2G45B 2D10A 2LD9A 3L0WB 4II2B 3T9LA 4FA6A 1NBFC 3DPDA 4PS7A 1P0RA 2D3GA 1ZW7A 2XBBC 1TGZB 4AWJA 3CSTA 3MJWA 4B9KA 5AZHA 1WY8A 1E8ZA 4GMVA 5D94A 4PYUA 3VAWA 2KK8A 2JWZA 4W9IA 2KVRA 4TV3A 3L13A 1KJTA 1L7YA 3PLVA 4F1SA 4DBGA 2LXAA 2O6VD 4FULA 4FADA 3RYTA 1YD8U 2KN5A 3WAMA 2PJHA 2C9WB 3EFUA 3LDZE 2NCNA 4GSWA 2MBHA 3ZO5B 3WANA 2YVCA 2GOWA 4EEWA 4ZDVA 3PRZA 3QK0A 2IO0B 3O65B 4MGKE 3RUIB 4CHKA 1CMXB 1E7VA 1SGHA 1UZXB 2RD0A 3APDA 1NI2A 3A33B 3ZTDA 1E8WA 4W9KA 3KH0A 3UQBA 2IY0B 2GBMA 3V61A 3V6EB 1P9DU 3DDCB 5CHWA 4KIKA 2K8CA 1V5TA 2ZCCA 1Y8RC 2LGXA 2J7QB 3N3KB 3QX1A 2NVUI 3APCA 3NZUA 2CU1A 3H7SA 3A9KA 2AL6A 1P1AA 1WX9A 2DZIA 4NAWA 1EUVB 2IO3B 4AP4C 1WM3A 3RULA 2NBUA 4BKSA 4MJSB 2BKFA 5E6OA 4PS3A 5C23A 2KHWB 4BKTA 3A9KB 3IBEA 5D7GA 4GU2A 3N32A 3C0RB 1WZ0A 2OJRA 3ZKJC 2ZVNA 3TMPB 2DAFA 5L83A 1WF9A 2KXJA 2N4FA 2KWUB 3M95A 2MW5A 5BO4B 1WXSA 2K25A 2KTFA 3TL5A 4LCDE 2XEWA 4KSKC 4WJOA 1WE7A 2ZJDA 2RGFA 1WJNA 2B3AA 3DBRI 3VHTC 2NS5A 4NAWB 2K8BA 3M62B 1WH3A 2MSED 4KIKB 2WYQA 2FIDA 5DPSA 4IM0A 4WQOB 4TUUA 4BKSD 2DZKA 4E74A 3R66C 4HVBA 1ZGUB 2KOXA 5AZGA 3L17A 3ONSA 5J2RA 3OAWA 2R2QA 1NDDA 3ALBA 1UH6A 2WX0A 2LUEA 2FNJB 2LVOA 3GOEA 4BBNC 4K81A 1PQSA 4N9F4 3ZUNA 3PREA 2WX1A 5DPWA 2ZEQA 3S2AA 2J0KA 4BOSC 3U8ZA 1D3ZA 1SE9A 4FLHA 4K1RB 4FN2A 2KJRA 3SD5A 4II3B 5DPTA 4TQ1A 3KUZA 3QAQA 4F7ZA 4HPLB 1V6EA 4WWOA 2C60A 4FJZA 4AJWA 1I42A 3DVGX 2JUOA 2N9XA 1TZ1A 4MELA 1MG8A 2DYBA 4DDGD 2L05A 2ZNVB 3PLUA 5D6JB 2XK5B 3AU4A 1A5RA 1OTRB 2KTRB 3PHWB 3VUYA 5CHFA 1XD3B 4X57B 1Q5WB 2BWES 3QC8B 3VFKA 3X23A 4ASWC 2OOBB 1WX7A 1WIAA 2JPHA 1WGGA 1YIWA 1E5WA 2YLMA 1VD2A 3QWZB 1V9JA 2IZVB 4URKA 1TTNA 2BGFA 4LJOB 1E8YA 2Y5BB 1X1MA 3VDZA 3AXCA 1R4NI 2RSUA 1P3QU 3DVNU 2C5LC 2K6DB 3B1LX 4HXDA 4W9HA 2L0TA 4IM2A 3IG3A 4XZ4A 5DPRA 3ZRCA 3VTUA 3K9OB 2G4SA 2PE6B 1OEYJ 2HTHA 3IHPC 3BINA 2KWCA 3R7RA 1QZEA 4G0NB 3ZW3A 2M0XA 4IC7B 5LLIA 2Z0DB 1E7UA 3A4SC 1WMHB 2KC1A 4WJQA 5E6PA 1E90A 4RM9A 5JHAA 3WALA 4BBNF 3JSVA 1GC7A 4JL9A 2IO2B 5G55A 4AJYB 4MSMB 2KX3A 3PTFC 3NHEB 2V4LA 5AZFA 4EZJA 1WM2A 2GMIC 4GB9A 4BFRA 1KOTA 4MH0E 4GGQA 4PS8A 3UQAA 2CHXA 2AL3A 3HIZA 4GDKB 1ZKHA 3A1QB 4W9EA 4DHJB 1YX6B 4IWOA 3PVLA 3I3TB 3HHMA 1IYFA 3GZNI 1EO6A 1IP9A 2JZ3B 3ZLZA 3EHVA 2ZPYA 3L54A 4B6WA 2KX0A 4GDLB 2DZJA 3UINB 1GNUA 2KKCA 2JVCA 1GC6A 4KDIC 2GBKA 3ZRFA 3VQIA 1V2YA 2BF8B 2O2VA 4XX5A 4EOYA 3QA8A 1RAXA 2MX2A 3ZNID 2HE7A 3ML8A 4EZKA 2CHWA 4NNJB 2M8SA 5CX3A 1WX8A 3X0WA 5L95C 3U7DA 3DVNV 2KJ6A 2WDTB 1YJ1A 1I35A 2KD0A 4FHKA 4MEMA 4MGYE 2G3QB 4YL8A 3SU8X 1TBEA 2IO1B 1LXDA 3L16A 3NS8A 1WXMA 4GXBA 1WJ6A 4BVUC 4JIOU 3PV1A 2LRWA 2O6VB 4CO7A 3DVGY 2M1MA 2C7HA 3KUDB 2M17A 3RCZA 2UYZB 2KLCA 4A3PA 1RLFA 2KDIA 2AWTA 4P7IA 2PEAA 3IFWB 4W9FA 4KV2A 2MP2A 2KFKB 2BWFA 2MRPA 3PPAA 4F8CB 5C1ZA 2ZCBA 2MBQA 2DYOA 2MBOA 1LQBA 1OGWA 5JH5C 2KDFB 2I1KA 3PT2B 4WWNA 3WAPA 2L0FA 2ZVOA 2LJ5A 4DHZE 3AULA 1OQYA 3VH4B 1UELA 4E71A 4BKGA 2FCSA 2LVQA 4DDID 1LM8B 2UWQA 2BPSA 2JRIB 3VTVA 3D32A 4EFOA 2LASA 5JZEB 1YX5B 3TJPA 4GN1A 1P98A 1WFYA 4KZCA 2N1WA 4DHJD 2JZZA 1G6JA 2A5UA 2KO3A 2CKHB 2JF5A 4NQKE 4FHJA 3TCAA 1Q1OA 2NBWB 1V49A 2R2OA 4ZRIA 3DCGA 1YQBA 2BYVE 3HK0A 4HDQA 3AU5A 2KFJA 4ICUA 4I6NB 5J18A 4J6IA 4NY0A 2NPTB 1WXAA 4B95A 3LJ3A 3NY5A 4GDLA 4ANUA 1Z2MA 4MSQB 3ZIMA 4BOZB 2MA9B 2EMSA 2FIFA 4HK2A 1OEYA 3VTWA 5E6NA 4PYZA 4HWIB 4ANVA 2LRUA 2M4NA 2LWPA 2KLGA 4LDTB 4NJ7A 5FR6A 2KQSA 4K7SA 3ZNZB 2ASQA 2ZZPB 1WE6A 1V86A 2KANA 4MDKE 4TKNA 2L76A 2CS4A 2DENB 3A4RA 3JW0X 4KZ0A 3OLMD 4IG7B 2FCMA 4EKUA 2KMCA 2BYFA 1RRBA 3H7PA 5J17A 1L2NA 2EMTA 4KDLB 4FJVB 1M94A 5KHOA 3JVZX 2LGYA 2ZNVC 3RD2A 3ZNGC 4AUQC 3UIPB 1BT0A 1UBQA 5G2NA 4EZLA 4A20A 2O6VA 2DHZA 2N1VA 2K8HA 4HCPB 4KVGB 3A9JA 5CHVC 2MBBB 1WGDA 4M8NA 4OVVA 4ANWA 2FCNA 3NOBA 1GG3A 3QHTA 3M63B 3KVFB 1K8RB 3KYDD 3WAOA 4IWQA 4W9JA 3SHQA 3L10B 2GBNA 3Q3JA 1WI0A 4W9DA 1XQQA 2JT4B 2MCNB 3ZNHB 3CF6E 1UGMA 3NZSA 4G3XB 4HPMB 2DYMA 2VRRB 2C7MB 2K39A 4OVUA 3M3JA 2IYDB 4JLCA 5LXIB 4NPNA 3ZDMC 3H1UA 2KTRA 2HD5B 4RMAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3R7Q A;  5IAA C;  2XK5 A;  2KNB A;  2NPT A;  4K7W A;  1VCB A;  4KSL C;  5TR5 A;  2O2V B;  3U30 A;  1H4R A;  3OJ4 B;  4FJY A;  5D2M B;  4XC2 A;  3W1S C;  1WYW B;  1WGY A;  3EEC A;  2D2Q A;  1T0Y A;  1EF1 A;  3KW5 B;  2GBJ A;  1J19 A;  3PHX B;  4K7U A;  1U4A A;  4WJP A;  3TBL D;  2RPQ A;  1LFD A;  4MGI E;  2I1J A;  3B0A A;  3APF A;  2J0M A;  3Q3F A;  1J8C A;  3ECI A;  1WGR A;  2MP2 B;  4I6L B;  3KYC D;  1HE8 A;  1RFA A;  1WMH A;  4I6P A;  4JGH B;  3MHS D;  1IPG A;  3H9D A;  4GDK A;  3PRP B;  5GMV A;  2N9P C;  2Z0E B;  3ZVV A;  2NR2 A;  2GBR A;  1KM7 A;  5JHB A;  3L08 A;  2DAJ A;  1Q0W B;  4W9C A;  2QHO A;  3UIO B;  3A9J B;  4WAA A;  1UD7 A;  2NBV B;  4W9L A;  2KMA A;  2HJ8 A;  3SDL C;  3JSV B;  2G4D B;  2KC2 A;  2Z59 B;  1UBI A;  2ZPN A;  5LXH A;  2LZ6 A;  3EC8 A;  2IY1 B;  3UF8 A;  2REX A;  4HJK A;  4LDT D;  2L7R A;  2LGD A;  3RZW C;  3OJ3 A;  5HKH A;  2V3S A;  3PS6 A;  4G11 A;  2PPH A;  4MJS A;  1KLV A;  3H7P B;  2KDE B;  3VVW B;  3N30 A;  1S1Q B;  2D11 A;  1SIF A;  2KJH B;  3PGE A;  2L00 B;  2FCQ A;  2AYO B;  2K1F A;  2KZR A;  1E8X A;  3B08 A;  3DOW A;  2L3Z A;  1V80 A;  4ICV A;  3BY4 B;  5KHQ A;  1WZ3 A;  1WGH A;  4M8M A;  3QIJ A;  3ML9 A;  2FAZ A;  1WJU A;  3QQ8 B;  3QCA A;  3PRM B;  4GOC A;  2J0J A;  4W9G A;  2DX5 B;  3WA0 A;  3PZD A;  4AOF A;  2K6Q A;  2CR5 A;  2N9E B;  3TIX A;  1GUA B;  3CSF A;  1J0G A;  3ENE A;  2MLB A;  2EKE C;  3DBL I;  2PE9 A;  4DHZ B;  4FBJ B;  1WRD B;  2LXC A;  1V5O A;  2MQJ A;  4TQ0 A;  1GJZ A;  4HLE A;  2A4Z A;  3DBH I;  2JY6 A;  2KDB A;  2BKR B;  2KQ7 A;  3RZF A;  3HM3 A;  1FXT B;  4EUT A;  4ZYN A;  2N7E A;  1WXV A;  2LI5 A;  4GIV A;  3VUX A;  4ZRK A;  4LJP B;  3V6C B;  1R4M I;  3VH3 B;  4DWF A;  4NJ6 A;  3ZDT A;  1WR1 A;  1Z5S B;  3V62 A;  4IWP A;  5EDS A;  2JRH A;  3VUW A;  4IM3 A;  1EF5 A;  1JRU A;  2KWV B;  1C3T A;  3H6N A;  4CYE A;  2BYE A;  4IW0 A;  4DXA B;  1F9J A;  1C1Y B;  2MWS B;  3A1Q A;  3W1S A;  3DQV A;  1ISN A;  2FUH B;  2AEH A;  2IBI B;  2DZM A;  4G50 A;  5IA7 A;  2LVP A;  3HM6 X;  3KUC B;  3JYU A;  3AI5 A;  2C7N B;  2KFK A;  2JXX A;  3QAR A;  2MBE A;  4ZRJ A;  2V1Y A;  3DBS A;  5AEK B;  4HDO A;  3W1Y A;  3K9P B;  2N7D A;  3IVF A;  3V60 A;  4HCN B;  2D07 B;  3WIM A;  2L8J A;  4A3O A;  4MGZ E;  1WJ4 A;  4E3C A;  3R3M A;  3VXW A;  3RT3 B;  1S3S G;  2CHZ A;  4MM3 A;  4DK5 A;  1V81 A;  2RR9 A;  5DCN A;  4WJN A;  4IUM B;  1XT9 B;  2WWZ A;  4M0W B;  3PSE B;  4WWP A;  5CTR C;  3UGB B;  4NQL B;  1H8C A;  1AAR A;  3QJZ A;  1WR6 E;  2W9N A;  3T8M A;  3MTN B;  3P2B A;  4RM8 A;  3ZTC A;  4ANX A;  3CMM B;  4JQW C;  2G45 B;  2D10 A;  2LD9 A;  3L0W B;  4II2 B;  3T9L A;  4FA6 A;  1NBF C;  3DPD A;  4PS7 A;  1P0R A;  2D3G A;  1ZW7 A;  2XBB C;  1TGZ B;  4AWJ A;  3CST A;  3MJW A;  4B9K A;  5AZH A;  1WY8 A;  1E8Z A;  4GMV A;  5D94 A;  4PYU A;  3VAW A;  2KK8 A;  2JWZ A;  4W9I A;  2KVR A;  4TV3 A;  3L13 A;  1KJT A;  1L7Y A;  3PLV A;  4F1S A;  4DBG A;  2LXA A;  2O6V D;  4FUL A;  4FAD A;  3RYT A;  1YD8 U;  2KN5 A;  3WAM A;  2PJH A;  2C9W B;  3EFU A;  3LDZ E;  2NCN A;  4GSW A;  2MBH A;  3ZO5 B;  3WAN A;  2YVC A;  2GOW A;  4EEW A;  4ZDV A;  3PRZ A;  3QK0 A;  2IO0 B;  3O65 B;  4MGK E;  3RUI B;  4CHK A;  1CMX B;  1E7V A;  1SGH A;  1UZX B;  2RD0 A;  3APD A;  1NI2 A;  3A33 B;  3ZTD A;  1E8W A;  4W9K A;  3KH0 A;  3UQB A;  2IY0 B;  2GBM A;  3V61 A;  3V6E B;  1P9D U;  3DDC B;  5CHW A;  4KIK A;  2K8C A;  1V5T A;  2ZCC A;  1Y8R C;  2LGX A;  2J7Q B;  3N3K B;  3QX1 A;  2NVU I;  3APC A;  3NZU A;  2CU1 A;  3H7S A;  3A9K A;  2AL6 A;  1P1A A;  1WX9 A;  2DZI A;  4NAW A;  1EUV B;  2IO3 B;  4AP4 C;  1WM3 A;  3RUL A;  2NBU A;  4BKS A;  4MJS B;  2BKF A;  5E6O A;  4PS3 A;  5C23 A;  2KHW B;  4BKT A;  3A9K B;  3IBE A;  5D7G A;  4GU2 A;  3N32 A;  3C0R B;  1WZ0 A;  2OJR A;  3ZKJ C;  2ZVN A;  3TMP B;  2DAF A;  5L83 A;  1WF9 A;  2KXJ A;  2N4F A;  2KWU B;  3M95 A;  2MW5 A;  5BO4 B;  1WXS A;  2K25 A;  2KTF A;  3TL5 A;  4LCD E;  2XEW A;  4KSK C;  4WJO A;  1WE7 A;  2ZJD A;  2RGF A;  1WJN A;  2B3A A;  3DBR I;  3VHT C;  2NS5 A;  4NAW B;  2K8B A;  3M62 B;  1WH3 A;  2MSE D;  4KIK B;  2WYQ A;  2FID A;  5DPS A;  4IM0 A;  4WQO B;  4TUU A;  4BKS D;  2DZK A;  4E74 A;  3R66 C;  4HVB A;  1ZGU B;  2KOX A;  5AZG A;  3L17 A;  3ONS A;  5J2R A;  3OAW A;  2R2Q A;  1NDD A;  3ALB A;  1UH6 A;  2WX0 A;  2LUE A;  2FNJ B;  2LVO A;  3GOE A;  4BBN C;  4K81 A;  1PQS A;  4N9F 4;  3ZUN A;  3PRE A;  2WX1 A;  5DPW A;  2ZEQ A;  3S2A A;  2J0K A;  4BOS C;  3U8Z A;  1D3Z A;  1SE9 A;  4FLH A;  4K1R B;  4FN2 A;  2KJR A;  3SD5 A;  4II3 B;  5DPT A;  4TQ1 A;  3KUZ A;  3QAQ A;  4F7Z A;  4HPL B;  1V6E A;  4WWO A;  2C60 A;  4FJZ A;  4AJW A;  1I42 A;  3DVG X;  2JUO A;  2N9X A;  1TZ1 A;  4MEL A;  1MG8 A;  2DYB A;  4DDG D;  2L05 A;  2ZNV B;  3PLU A;  5D6J B;  2XK5 B;  3AU4 A;  1A5R A;  1OTR B;  2KTR B;  3PHW B;  3VUY A;  5CHF A;  1XD3 B;  4X57 B;  1Q5W B;  2BWE S;  3QC8 B;  3VFK A;  3X23 A;  4ASW C;  2OOB B;  1WX7 A;  1WIA A;  2JPH A;  1WGG A;  1YIW A;  1E5W A;  2YLM A;  1VD2 A;  3QWZ B;  1V9J A;  2IZV B;  4URK A;  1TTN A;  2BGF A;  4LJO B;  1E8Y A;  2Y5B B;  1X1M A;  3VDZ A;  3AXC A;  1R4N I;  2RSU A;  1P3Q U;  3DVN U;  2C5L C;  2K6D B;  3B1L X;  4HXD A;  4W9H A;  2L0T A;  4IM2 A;  3IG3 A;  4XZ4 A;  5DPR A;  3ZRC A;  3VTU A;  3K9O B;  2G4S A;  2PE6 B;  1OEY J;  2HTH A;  3IHP C;  3BIN A;  2KWC A;  3R7R A;  1QZE A;  4G0N B;  3ZW3 A;  2M0X A;  4IC7 B;  5LLI A;  2Z0D B;  1E7U A;  3A4S C;  1WMH B;  2KC1 A;  4WJQ A;  5E6P A;  1E90 A;  4RM9 A;  5JHA A;  3WAL A;  4BBN F;  3JSV A;  1GC7 A;  4JL9 A;  2IO2 B;  5G55 A;  4AJY B;  4MSM B;  2KX3 A;  3PTF C;  3NHE B;  2V4L A;  5AZF A;  4EZJ A;  1WM2 A;  2GMI C;  4GB9 A;  4BFR A;  1KOT A;  4MH0 E;  4GGQ A;  4PS8 A;  3UQA A;  2CHX A;  2AL3 A;  3HIZ A;  4GDK B;  1ZKH A;  3A1Q B;  4W9E A;  4DHJ B;  1YX6 B;  4IWO A;  3PVL A;  3I3T B;  3HHM A;  1IYF A;  3GZN I;  1EO6 A;  1IP9 A;  2JZ3 B;  3ZLZ A;  3EHV A;  2ZPY A;  3L54 A;  4B6W A;  2KX0 A;  4GDL B;  2DZJ A;  3UIN B;  1GNU A;  2KKC A;  2JVC A;  1GC6 A;  4KDI C;  2GBK A;  3ZRF A;  3VQI A;  1V2Y A;  2BF8 B;  2O2V A;  4XX5 A;  4EOY A;  3QA8 A;  1RAX A;  2MX2 A;  3ZNI D;  2HE7 A;  3ML8 A;  4EZK A;  2CHW A;  4NNJ B;  2M8S A;  5CX3 A;  1WX8 A;  3X0W A;  5L95 C;  3U7D A;  3DVN V;  2KJ6 A;  2WDT B;  1YJ1 A;  1I35 A;  2KD0 A;  4FHK A;  4MEM A;  4MGY E;  2G3Q B;  4YL8 A;  3SU8 X;  1TBE A;  2IO1 B;  1LXD A;  3L16 A;  3NS8 A;  1WXM A;  4GXB A;  1WJ6 A;  4BVU C;  4JIO U;  3PV1 A;  2LRW A;  2O6V B;  4CO7 A;  3DVG Y;  2M1M A;  2C7H A;  3KUD B;  2M17 A;  3RCZ A;  2UYZ B;  2KLC A;  4A3P A;  1RLF A;  2KDI A;  2AWT A;  4P7I A;  2PEA A;  3IFW B;  4W9F A;  4KV2 A;  2MP2 A;  2KFK B;  2BWF A;  2MRP A;  3PPA A;  4F8C B;  5C1Z A;  2ZCB A;  2MBQ A;  2DYO A;  2MBO A;  1LQB A;  1OGW A;  5JH5 C;  2KDF B;  2I1K A;  3PT2 B;  4WWN A;  3WAP A;  2L0F A;  2ZVO A;  2LJ5 A;  4DHZ E;  3AUL A;  1OQY A;  3VH4 B;  1UEL A;  4E71 A;  4BKG A;  2FCS A;  2LVQ A;  4DDI D;  1LM8 B;  2UWQ A;  2BPS A;  2JRI B;  3VTV A;  3D32 A;  4EFO A;  2LAS A;  5JZE B;  1YX5 B;  3TJP A;  4GN1 A;  1P98 A;  1WFY A;  4KZC A;  2N1W A;  4DHJ D;  2JZZ A;  1G6J A;  2A5U A;  2KO3 A;  2CKH B;  2JF5 A;  4NQK E;  4FHJ A;  3TCA A;  1Q1O A;  2NBW B;  1V49 A;  2R2O A;  4ZRI A;  3DCG A;  1YQB A;  2BYV E;  3HK0 A;  4HDQ A;  3AU5 A;  2KFJ A;  4ICU A;  4I6N B;  5J18 A;  4J6I A;  4NY0 A;  2NPT B;  1WXA A;  4B95 A;  3LJ3 A;  3NY5 A;  4GDL A;  4ANU A;  1Z2M A;  4MSQ B;  3ZIM A;  4BOZ B;  2MA9 B;  2EMS A;  2FIF A;  4HK2 A;  1OEY A;  3VTW A;  5E6N A;  4PYZ A;  4HWI B;  4ANV A;  2LRU A;  2M4N A;  2LWP A;  2KLG A;  4LDT B;  4NJ7 A;  5FR6 A;  2KQS A;  4K7S A;  3ZNZ B;  2ASQ A;  2ZZP B;  1WE6 A;  1V86 A;  2KAN A;  4MDK E;  4TKN A;  2L76 A;  2CS4 A;  2DEN B;  3A4R A;  3JW0 X;  4KZ0 A;  3OLM D;  4IG7 B;  2FCM A;  4EKU A;  2KMC A;  2BYF A;  1RRB A;  3H7P A;  5J17 A;  1L2N A;  2EMT A;  4KDL B;  4FJV B;  1M94 A;  5KHO A;  3JVZ X;  2LGY A;  2ZNV C;  3RD2 A;  3ZNG C;  4AUQ C;  3UIP B;  1BT0 A;  1UBQ A;  5G2N A;  4EZL A;  4A20 A;  2O6V A;  2DHZ A;  2N1V A;  2K8H A;  4HCP B;  4KVG B;  3A9J A;  5CHV C;  2MBB B;  1WGD A;  4M8N A;  4OVV A;  4ANW A;  2FCN A;  3NOB A;  1GG3 A;  3QHT A;  3M63 B;  3KVF B;  1K8R B;  3KYD D;  3WAO A;  4IWQ A;  4W9J A;  3SHQ A;  3L10 B;  2GBN A;  3Q3J A;  1WI0 A;  4W9D A;  1XQQ A;  2JT4 B;  2MCN B;  3ZNH B;  3CF6 E;  1UGM A;  3NZS A;  4G3X B;  4HPM B;  2DYM A;  2VRR B;  2C7M B;  2K39 A;  4OVU A;  3M3J A;  2IYD B;  4JLC A;  5LXI B;  4NPN A;  3ZDM C;  3H1U A;  2KTR A;  2HD5 B;  4RMA A; 
#chains in the Genus database with same CATH topology
 5IAA C;  2XK5 A;  3FC4 A;  1C79 A;  1H4R A;  3U30 A;  1HZ5 A;  3EEC A;  1T0Y A;  2HDE A;  3E9S A;  1AWD A;  4K7U A;  1LFD A;  2BBC A;  4MGI E;  2RPV A;  1FCC C;  3B0A A;  1FRD A;  3N20 C;  3KYC D;  1WMH A;  2NMQ A;  4I6P A;  2KWD A;  2LEK A;  5GMV A;  2N9P C;  2Z0E B;  2DAJ A;  1Q0W B;  4WAA A;  1UD7 A;  2NBV B;  3SDL C;  3ZYY X;  1JWU D;  3UF8 A;  2SEB D;  4XWT A;  1E6E B;  1JWB D;  3NS1 A;  3VVW B;  3N30 A;  2JZP A;  2KJH B;  3ZXR A;  2AYO B;  2FAZ A;  2NTS A;  2GLS A;  3PRM B;  1QT9 A;  3AEB B;  4AOF A;  2K6Q A;  2MLB A;  2EKE C;  3DBL I;  2PE9 A;  4RGO S;  4FBJ B;  3DBH I;  2BKR B;  2DLB A;  5HI1 A;  4ZYN A;  2N7E A;  1VZ7 A;  1KF6 B;  5D3I B;  3VUX A;  1HTO A;  3BK1 A;  4NJ6 A;  1KLG D;  1Z5S B;  2BS2 B;  4JWS C;  2KWV B;  3BYT B;  4DXA B;  3DQV A;  1ISN A;  1L4Z B;  2QDF A;  2DZM A;  1AYF A;  2VH2 A;  4A6Q A;  4KGS A;  3HM6 X;  3AI5 A;  1YQ4 B;  3DBS A;  3DHI C;  1N5X A;  2N7D A;  4IOI E;  1XLQ A;  2WDV B;  2D07 B;  2L8J A;  1WJ4 A;  4P1B C;  3R3M A;  1S3S G;  1QKZ A;  3AMZ A;  1MI0 A;  1SE2 A;  1TZO A;  5DCN A;  4WJN A;  1XT9 B;  4WWP A;  4NQL B;  2BYT A;  1C77 A;  1YN4 A;  1VJK A;  3P2B A;  1Q10 A;  4CQN A;  1FRR A;  2D10 A;  2G45 B;  1WWT A;  2J53 A;  2AQ3 B;  4AWJ A;  3CST A;  3MJW A;  1E8Z A;  5D94 A;  2KK8 A;  3HRD D;  3L13 A;  1CJE A;  2O6V D;  1ZOY B;  4L1B A;  2JWU A;  1YN5 A;  1E9M A;  3PRZ A;  3QK0 A;  4CHK A;  4OHJ A;  3P4R B;  1UZX B;  1SGH A;  2K9X A;  1M4V A;  5GXG B;  2WXN A;  4KGR A;  4P16 A;  4XYC A;  1V5T A;  2D3B A;  2LGX A;  3N3K B;  1MFW A;  4NAW A;  3H7S A;  3TSS A;  4MJS B;  2BKF A;  5E6O A;  4PS3 A;  1J7A A;  4DQO C;  1IBX A;  4BKT A;  3A9K B;  3EA6 A;  1YN3 A;  1WZ0 A;  2GB1 A;  1HA5 A;  2KWU B;  4YSZ B;  2K25 A;  2BVC A;  4WJO A;  1B1Z A;  2RGF A;  1GOZ A;  1WJN A;  2B3A A;  4NAW B;  4RCO A;  3RNE C;  2MSE D;  4WQO B;  4TUU A;  2W54 A;  1DYQ A;  1LO5 D;  1ZGU B;  5AZG A;  2QC8 A;  4PT5 A;  1FNU A;  2G9H D;  2R2Q A;  3U4E G;  1UH6 A;  1ZE3 D;  2WHI A;  4S0R A;  3PRE A;  2WX1 A;  4L23 A;  1DOY A;  4FLH A;  4F7Z A;  4FJZ A;  4AJW A;  2QIL A;  3DVG X;  2JUO A;  2DBY A;  1MG8 A;  4DDG D;  3PLU A;  2ZNV B;  3AU4 A;  1PFD A;  3HVZ A;  3O13 A;  4J3O D;  1WSP A;  3AB5 A;  3QC8 B;  2OOB B;  3AE1 B;  3GS2 A;  1E5W A;  1TS5 A;  4RF1 A;  1V9J A;  4URK A;  2MEK A;  2C5L C;  2Y3A A;  3B1L X;  1ENF A;  4IM2 A;  3IG3 A;  3RPF C;  4K3B A;  1TKE A;  4D2K A;  1JCK B;  2HTH A;  3RNG C;  3BIN A;  2KWC A;  4MAC A;  1F1H A;  3EUB 2;  1V97 A;  3U7Z A;  1E90 A;  1VLB A;  2RMM A;  4JL9 A;  3NVY A;  4ZYS A;  3PTF C;  4EZJ A;  4M01 A;  2LMC A;  4MH0 E;  4PS8 A;  3UQA A;  3MP9 A;  4GDK B;  4IWO A;  3KQ4 A;  1TS4 A;  2N9L A;  2BQQ A;  2INC C;  3Q3M C;  2KX0 A;  4GDL B;  4IKG A;  2GBK A;  3ZRF A;  1FIQ A;  1V2Y A;  4XX5 A;  3QA8 A;  1RAX A;  3ML8 A;  4RFB A;  2CHW A;  2M8S A;  3H8H A;  4WWM A;  1WX8 A;  3X0W A;  1V1P B;  2SAK A;  3DVN V;  2PTL A;  2WS3 B;  4MEM A;  2G3Q B;  4YL8 A;  1TBE A;  1WXM A;  4JIO U;  1K50 A;  1NEN B;  5H8Y E;  1RLF A;  3TEW A;  1ZDX A;  4RH6 A;  2PEA A;  5H92 C;  2MP2 A;  1E0Z A;  2BTE A;  3DBL B;  2JYT A;  1RWS A;  4M02 A;  4DHZ E;  3FIL A;  3AUL A;  1OQY A;  4LLG M;  1LM8 B;  2I2Y A;  2BPS A;  4AQ7 A;  1YX5 B;  4GN1 A;  1WFY A;  1WRI A;  2N1W A;  1Q1O A;  2R2O A;  1V49 A;  4Q2J A;  3AE3 B;  3DCG A;  4HDQ A;  5J18 A;  3LB8 C;  3LJ3 A;  1Z2M A;  2MA9 B;  4PYZ A;  2LRU A;  2RDB C;  5FR6 A;  2KYW A;  2AX5 A;  2ZZP B;  3R2I A;  1N5W A;  2DEN B;  2WXI A;  1RM6 C;  2QJL A;  2NTT A;  3URY A;  3ZNG C;  2WXR A;  3UIP B;  1BT0 A;  4HCP B;  2K8H A;  2HTM E;  4B0E A;  1VR9 A;  5CHV C;  5HG2 A;  4M8N A;  1FD6 A;  4RGM A;  2FCN A;  1GG3 A;  3QHT A;  4WAF A;  3KVF B;  1K8R B;  3WAO A;  4W9J A;  2CU3 A;  2CJN A;  3SHQ A;  4EE2 A;  2OHF A;  1C4C A;  1NYR A;  4MH8 A;  3ZGZ A;  4G3X B;  2DYM A;  5IO9 A;  3M3J A;  4PK1 A;  5LXI B;  3ZDM C;  3H1U A;  2X8X X;  4C7Z A;  3R7Q A;  4K7W A;  1VCB A;  2IDY A;  4KSL C;  2O2V B;  1ET6 A;  5BMH A;  1EF1 A;  1U4A A;  3BYY B;  3NVV A;  2I1J A;  3APF A;  3Q3F A;  1D6E C;  1WGR A;  3N9Y C;  1RFA A;  2MJD A;  3H9D A;  1TJE A;  3BZD B;  3PRP B;  3ZVV A;  2NR2 A;  2GBR A;  3TEY A;  1SE4 A;  3NVW A;  3JSV B;  2G4D B;  1UBI A;  2ZPN A;  3LXF A;  4OZB A;  2LZ6 A;  2IY1 B;  2REX A;  2LGD A;  5BYQ A;  4G11 A;  4MJS A;  2FUG 1;  2H89 B;  4RGT A;  1DOI A;  4WUR A;  5C3J B;  2KZR A;  2J4X A;  2L3Z A;  1V80 A;  5EE3 A;  3BY4 B;  2AQ1 B;  3P42 A;  3AE6 B;  3ML9 A;  1WJU A;  2ONQ A;  3QQ8 B;  1MVK A;  2Z8L A;  4W9G A;  1L6U A;  2CR5 A;  2N9E B;  1J0G A;  3ENE A;  1WRD B;  1GJZ A;  1SIJ A;  5TSS A;  3BWU D;  2A4Z A;  5D3D A;  2WXL A;  2KDB A;  1L0V B;  4HRS A;  4M00 A;  4C56 C;  4LJP B;  1ZXI A;  4NAM A;  1WR1 A;  4IWP A;  1J7C A;  1EF5 A;  1JRU A;  3P63 A;  2IJ0 A;  4YTP B;  4HPP A;  4IW0 A;  3AEA B;  3A1Q A;  3W1S A;  1IGC A;  2AEH A;  1EWY C;  2LVP A;  3JYU A;  2FE8 A;  1QOG A;  4ZRJ A;  2V1Y A;  4HDO A;  4OZA A;  3K9P B;  3IVF A;  3V60 A;  3MHZ A;  2XN9 C;  1TS2 A;  3AED B;  2CHZ A;  5BMI A;  2N9K A;  3SR6 A;  1A70 A;  1TYG B;  5EE9 A;  5CTR C;  3PSE B;  2PLP A;  3QJZ A;  1WR6 E;  4HKQ A;  3CMM B;  4RNA A;  3Q8E A;  3KWL A;  1N62 A;  3L0W B;  4II2 B;  4FA6 A;  1WYG A;  1NBF C;  3DPD A;  4PS7 A;  1P0R A;  1JML A;  2MH7 A;  1FCL A;  2V0G A;  4PYU A;  1EM7 A;  4GLS C;  1L7Y A;  4F1S A;  4FAD A;  4FUL A;  4MT5 A;  2KN5 A;  3WAM A;  2PJH A;  2BB6 A;  3N1X C;  3ZO5 B;  1SB3 C;  1XO3 A;  2YVC A;  3ZJV A;  4EEW A;  3RUI B;  3ZJT A;  1P7F A;  4QAY A;  2RD0 A;  1NI2 A;  3ZTD A;  2IY0 B;  2WXK A;  3V6E B;  4HEA 1;  2J7Q B;  3NZU A;  2CU1 A;  2DZI A;  1P7E A;  3AM9 A;  1R4M B;  1WM3 A;  2G1E A;  2KVZ A;  4AP4 C;  3RUL A;  5C23 A;  2KHW B;  2ACZ B;  3IBE A;  4GU2 A;  3N32 A;  3ZKJ C;  1WF9 A;  5BO4 B;  1WXS A;  2KTF A;  1IUE A;  2H88 B;  2WXM A;  3VRA B;  2V4I B;  3AE2 B;  2MHJ A;  4KIK B;  2WYQ A;  2FID A;  3ABV B;  4BKS D;  3W9C B;  4E74 A;  1L0Y B;  4ARI A;  1T0Q C;  3ALB A;  1PQS A;  3ZUN A;  5DPW A;  2ZEQ A;  3S2A A;  2J0K A;  2AQ2 B;  1ESF A;  4FN2 A;  4C7Y A;  3QAQ A;  1V6E A;  3Q2A C;  4WWO A;  1TY0 A;  2N9X A;  1TZ1 A;  4MEL A;  1VDV A;  1A5R A;  1OTR B;  3PHW B;  3R8B A;  1FFV A;  4X57 B;  2BWE S;  1XLO A;  4ASW C;  1WX7 A;  1FXI A;  1WIA A;  4NZL B;  1YOV B;  2IZV B;  5EE1 A;  5BMG A;  1TTN A;  2Y5B B;  4HXD A;  1R4N I;  2J42 A;  1I4R A;  1Y56 A;  3VTU A;  4O1N A;  3IHP C;  5G5H A;  1GPX A;  3R7R A;  1QZE A;  2K22 A;  3ZW3 A;  2M0X A;  5LLI A;  4YTN B;  4US9 A;  1E7U A;  1WMH B;  1TKG A;  3MJ5 A;  5JHA A;  3JSV A;  2E6X A;  2IO2 B;  1T0S C;  3NHE B;  1UNS A;  1WM2 A;  4BFR A;  2X38 A;  4GGQ A;  1KH0 A;  1L6V A;  4KGT A;  2CHX A;  3HIZ A;  1YX6 B;  1FPY A;  3GZN I;  3EHV A;  4B6W A;  5EE0 A;  3UIN B;  2DZJ A;  3HVD A;  2JVC A;  4ARC A;  3RN9 C;  2LHD A;  3HUI A;  4BZA A;  2BF8 B;  1JWA D;  1I4H A;  2O2V A;  2B76 B;  2MX2 A;  2HE7 A;  2V3N A;  3NZ3 A;  4EZK A;  5FKA C;  3RMK C;  5CX3 A;  1VZ8 A;  5L95 C;  3Q8A A;  3U7D A;  1C76 A;  2KJ6 A;  2WDT B;  2IGG A;  1MHX A;  4A8X C;  3GE3 C;  4MGY E;  2R61 A;  5HHD G;  3SU8 X;  1LXD A;  3NVZ A;  2BS3 B;  4GXB A;  2IND C;  2LRW A;  2O6V B;  3DVG Y;  2M1M A;  2C7H A;  1UGJ A;  5AUK A;  2Q5W D;  3FIL B;  1V1O A;  2WXH A;  1JRO A;  2KDI A;  4ZHO A;  1SEB D;  2K5P A;  1N60 A;  3AEC B;  4KV2 A;  2KFK B;  2BWF A;  4F8C B;  2ZCB A;  2DYO A;  5JH5 C;  2I1K A;  2L0F A;  1JRP A;  1UEL A;  4E71 A;  4K3C A;  4DDI D;  2UWQ A;  2JRI B;  3VTV A;  4EFO A;  1P98 A;  4DHJ D;  1UF0 A;  3TCA A;  4NQK E;  3Q14 C;  4ZRI A;  2BYV E;  2KFJ A;  4NY0 A;  2NPT B;  4B95 A;  1T3Q A;  3ZIM A;  2EMS A;  1OEY A;  4HWI B;  4ANV A;  4USA A;  3MC8 A;  2LWP A;  1N6Z A;  4LDT B;  1QOB A;  4C00 A;  4MDK E;  2L76 A;  4US8 A;  2CJO A;  3DWM A;  3NRZ A;  4ITK A;  5IP4 D;  2BYF A;  3H7P A;  1L2N A;  2L83 A;  3ZXV A;  4FJV B;  3RD2 A;  4HRO A;  4A55 A;  4JX1 C;  1UBQ A;  3Q8B A;  3I9V 1;  3A9J A;  1WGD A;  2K3U A;  4ANW A;  1V8C A;  2INN E;  3EGR A;  1DGJ A;  1TS3 A;  2BS4 B;  4YSX B;  3Q3J A;  1WI0 A;  1XQQ A;  4IDI A;  1B9R A;  1UGM A;  2QEJ C;  3Q69 A;  3I5J C;  2C7M B;  1PGX A;  3C19 A;  2EKI A;  4NPN A;  3N1Z C;  4RMA A;  3ZNI D;  2KNB A;  2NPT A;  2WQY B;  4XC2 A;  1WYW B;  1E7P B;  3CIR B;  1T6B X;  1R7S A;  3KW5 B;  2GBJ A;  3PHX B;  3TBL D;  2RPQ A;  3W2D A;  2J0M A;  1N63 A;  5AUI A;  1VRA B;  1UWX A;  2MP2 B;  3OWE B;  3P1M A;  5LNK 1;  1HE8 A;  4JGH B;  3MHS D;  2INP E;  5JHB A;  4R3D A;  1JQ4 A;  1KM7 A;  1WGK A;  4W9L A;  1QOA A;  2HJ8 A;  2KMA A;  5LXH A;  1K51 A;  2L7R A;  3OJ3 A;  5HKH A;  1NVI D;  2V3S A;  2UU7 A;  1PDX A;  1KLV A;  1S1Q B;  1C9F A;  1SIF A;  3PGE A;  1C4A A;  1SE3 A;  2L00 B;  3B08 A;  3DOW A;  3VR8 B;  2V9H A;  2L1A A;  1SXT A;  4ICV A;  2WXG A;  5KHQ A;  1WZ3 A;  1WGH A;  1TKY A;  4XWW A;  3ZQ4 A;  3VRB B;  4GOC A;  3WA0 A;  3B2F A;  3PZD A;  3TIX A;  1GUA B;  3RNC C;  4TQ0 A;  2LXC A;  4HLE A;  1GAQ B;  3AE5 B;  3RZF A;  3HM3 A;  5BYR A;  1CQV A;  2LI5 A;  4YTM B;  4ZRK A;  4XGA B;  3VH3 B;  1FNV A;  3N1Y C;  3GP7 A;  5IN7 A;  1NYQ A;  2MJE A;  5JXV A;  3IT6 B;  3H6N A;  1FFU A;  2BYE A;  4CYE A;  2MWS B;  2WNM A;  2YEP B;  3QAR A;  2JXX A;  2MBE A;  1I4X A;  1YQ3 B;  1SJH D;  1SJE D;  1I4P A;  4A3O A;  5C2T B;  4MGZ E;  2IGH A;  3RT3 B;  4L2Y A;  4DK5 A;  1HZ6 A;  1V81 A;  4KX6 B;  2RR9 A;  2WWZ A;  1BML C;  1AAR A;  4HJG E;  1IBX B;  4B0M A;  2W9N A;  3T8M A;  2LUM A;  1AW7 A;  2ZW1 A;  3MTN B;  1XCT L;  4RM8 A;  4JQW C;  3ZTC A;  4ANX A;  2LD9 A;  2Y5C A;  2W3S A;  1EU3 A;  4RF0 A;  1I4G A;  1PYW D;  4N59 A;  1TGZ B;  1FO4 A;  3V3X A;  4NJC A;  3I63 C;  3W5V B;  4W9I A;  3PO0 A;  2KVR A;  4TV3 A;  1F2R I;  3SFD B;  3PLV A;  1KJT A;  3TEZ A;  4DBG A;  3RYT A;  1YD8 U;  1C4P A;  3LDZ E;  2NCN A;  4GSW A;  2MBH A;  2W3R A;  3T3N A;  3WAN A;  4ZDV A;  2IO0 B;  3O65 B;  4MGK E;  3APD A;  3A33 B;  1L0X B;  3B2G A;  4REZ A;  3KH0 A;  4W9K A;  2GBM A;  3V61 A;  3DBH B;  1P9D U;  3DDC B;  5CHW A;  5G5G A;  3T3O A;  1Y8R C;  4XE0 A;  2I38 A;  2M56 B;  2AL6 A;  2IO3 B;  2WXF A;  1L5P A;  5E6J A;  4BKS A;  1KFY B;  1UWM A;  3Q6B A;  1OFF A;  5D7G A;  3C0R B;  1F0Z A;  1XLP A;  1XF5 L;  2ZVN A;  3TMP B;  2DAF A;  2DNF A;  1D5X C;  1ZPS A;  3CWI A;  3AV8 A;  3WCQ A;  3DBR I;  1ROE A;  2XNA C;  4OVZ A;  5DPS A;  4IM0 A;  1ACC A;  3NUH B;  2ZW0 A;  3E56 A;  2DZK A;  1JW9 D;  3R66 C;  2WLB A;  4HVB A;  1D5Z C;  3L17 A;  3ONS A;  1GB1 A;  1NDD A;  2LUE A;  2FNJ B;  2GRI A;  2LVO A;  3GOE A;  4BBN C;  4K81 A;  4BOS C;  3U8Z A;  1HTQ A;  1SE9 A;  4K1R B;  2KJR A;  5T8I A;  3SD5 A;  4TQ1 A;  1LGR A;  2PMV A;  3GZN B;  1D5M C;  1I42 A;  4JWU C;  3LYY A;  2L05 A;  2XK5 B;  2KTR B;  1T0R C;  3X23 A;  1I7H A;  2JPH A;  1WGG A;  1YIW A;  4JE3 B;  1ET9 A;  1VD2 A;  2LHE A;  2LJI A;  2BGF A;  1E8Y A;  2DWQ A;  3VDZ A;  2OJW A;  3AXC A;  2RSU A;  3DVN U;  1MHH E;  4W9H A;  4XZ4 A;  1HXY D;  2YEP F;  3K9O B;  1SSN A;  4IC7 B;  2Z0D B;  3A4S C;  1XLN A;  2JYE A;  4RM9 A;  1F2R C;  4BBN F;  4AJY B;  4MSM B;  2KX3 A;  2GMI C;  1KOT A;  1YNT E;  2PW9 A;  4W9E A;  3NG0 A;  4RGN A;  3HHM A;  1IYF A;  1IP9 A;  2JZ3 B;  3ZLZ A;  1C78 A;  4XDD A;  1TT5 B;  3L54 A;  3DHH C;  1AN8 A;  1RYJ A;  2PVO D;  4NNJ B;  1IGD A;  1TY2 A;  4S17 A;  1YJ1 A;  4ZHP A;  1UUP A;  1YJJ A;  4FHK A;  2JU6 X;  2IO1 B;  4C4V A;  3NS8 A;  3MFG A;  4BVU C;  3PV1 A;  3P4P B;  3R2T A;  2M17 A;  1KLU D;  3RCZ A;  2UYZ B;  4KKJ A;  2EEL A;  1QF6 A;  1YMH E;  4ZRP A;  2AWT A;  3IFW B;  3P4Q B;  2FBW B;  3PPA A;  4ZRQ A;  2MBO A;  1LQB A;  1OGW A;  2QCZ A;  3PT2 B;  4WWN A;  3J9C A;  4AS1 A;  2M0A A;  2PVG C;  4BKG A;  2FCS A;  1ZP0 B;  3AE4 B;  1JWM D;  3DWG C;  3D32 A;  5JZE B;  3TJP A;  4KZC A;  2JZZ A;  1G6J A;  2A5U A;  2KO3 A;  3BVM A;  4LNF A;  1YQB A;  3AU5 A;  4ICU A;  1WXA A;  3NY5 A;  4MSQ B;  1ZXH A;  4BOZ B;  4HK2 A;  3VTW A;  5E6N A;  5I4D A;  2BT6 A;  2M4N A;  1XEE A;  2KMM A;  4K7S A;  4TKN A;  1V86 A;  2HJ1 A;  1D4B A;  2CS4 A;  2JQR B;  2JX5 A;  3OLM D;  4IG7 B;  3RNF C;  4EKU A;  1RRB A;  3AEG B;  1NI3 A;  4ZOH C;  4KDL B;  3JVZ X;  2LFI A;  4AUQ C;  3W5U B;  5G2N A;  4EZL A;  2N1V A;  1ZDV A;  2MBB B;  4OVV A;  3NOB A;  2ON8 A;  3M63 B;  1QOF A;  3KYD D;  2IGD A;  4IWQ A;  3ZJU A;  2KQ4 X;  2L52 A;  1N61 A;  1DOX A;  4W9D A;  1JAL A;  4LNO A;  2JT4 B;  4C80 A;  2MCN B;  1K52 A;  3CF6 E;  3FAH A;  2E3T A;  2VRR B;  3GE8 C;  3BVG A;  3TEX A;  4OVU A;  3RNB C;  1I4Q A;  2HD5 B;  1VZ6 A;  4ACF A;  5TR5 A;  1K53 A;  3OJ4 B;  4FJY A;  5D2M B;  2ICI A;  3W1S C;  1WGY A;  2D2Q A;  4LNK A;  1J19 A;  4WJP A;  3AE9 B;  5BYS A;  3Q8C A;  1J8C A;  1HQR D;  3ECI A;  4I6L B;  2D5G A;  2WDQ B;  3EFC A;  1IPG A;  4GDK A;  1FMA D;  1PGA A;  2Y5P A;  1FEH A;  3RI7 C;  3L08 A;  3MC0 B;  4W9C A;  3UIO B;  2QHO A;  3A9J B;  3DBR B;  2KC2 A;  2JXT A;  2Z59 B;  3EC8 A;  4HJK A;  4LDT D;  3RZW C;  3PS6 A;  2PPH A;  3NJT A;  3H7P B;  2KDE B;  2D11 A;  2QSD A;  2FCQ A;  4A90 A;  2K1F A;  1E8X A;  4M8M A;  3QIJ A;  3QCA A;  2KDM A;  2J0J A;  2DX5 B;  1MG4 A;  3CSF A;  2OED A;  4DHZ B;  2MQJ A;  1V5O A;  1QQR A;  2JY6 A;  4N58 A;  2KQ7 A;  1FXT B;  4EUT A;  1WXV A;  4GIV A;  3V6C B;  1R4M I;  4DWF A;  1HEZ E;  2J52 A;  3ZDT A;  4HKZ E;  3V62 A;  5EDS A;  2JRH A;  3VUW A;  4IM3 A;  1MPE A;  1C3T A;  2RDH A;  1F9J A;  1C1Y B;  2JSV X;  4UDU C;  2WXP A;  2FUH B;  2IBI B;  3IAM 1;  4G50 A;  5IA7 A;  3KUC B;  4YWG G;  2C7N B;  2KFK A;  3AEE B;  5AEK B;  3W1Y A;  1ZUD 2;  4HCN B;  3WIM A;  2PKO A;  4E3C A;  3VXW A;  4MM3 A;  1YJI A;  4N6E B;  1L4D B;  4IUM B;  4M0W B;  1H8C A;  3UGB B;  3T9L A;  1RFK A;  3KLS X;  4OZC A;  4H2A A;  2D3G A;  1ZW7 A;  2XBB C;  4A9A A;  4B9K A;  5AZH A;  1WY8 A;  4GMV A;  3VAW A;  2JWZ A;  1EU4 A;  4YT0 B;  2LXA A;  2W55 A;  2KT7 A;  2C9W B;  3EFU A;  3FKY A;  2GOW A;  1R4N B;  2D3C A;  1T5X D;  1CMX B;  1E7V A;  3UQB A;  1E8W A;  3C8Y A;  4WIP A;  4M0W A;  4KIK A;  2K8C A;  2ZCC A;  4P1C C;  3QX1 A;  2NVU I;  3APC A;  3A9K A;  1P1A A;  1WX9 A;  1EUV B;  2WDR B;  2WU2 B;  2LGS A;  2NBU A;  2KAC A;  2TSS A;  2OJR A;  5L83 A;  1F52 A;  2KXJ A;  2N4F A;  3M95 A;  4MM3 B;  2N7J A;  2MW5 A;  3OG5 A;  1WXQ A;  3TL5 A;  4LCD E;  2WGS A;  2XEW A;  4KSK C;  1WE7 A;  2BB5 A;  2ZJD A;  3VHT C;  2NS5 A;  2KAJ A;  2K8B A;  3M62 B;  1WH3 A;  1E10 A;  3MC9 A;  3RNA C;  3GB1 A;  4YSY B;  3PZ7 A;  3RFZ B;  3IT4 B;  2KOX A;  1XXG A;  1MJD A;  2QIE B;  2VH1 A;  3OAW A;  3AEF B;  3I57 A;  5IOI A;  5J2R A;  2WX0 A;  3ETR A;  4N9F 4;  4BAX A;  3AE7 B;  1D3Z A;  5FR3 A;  1F77 A;  4II3 B;  5DPT A;  3KUZ A;  2QMT A;  4HPL B;  2W82 A;  3DHG C;  1XCQ L;  2C60 A;  2PIA A;  2DYB A;  5D6J B;  1SBB B;  3VUY A;  2N0S B;  5CHF A;  1XD3 B;  3Q3O C;  1Q5W B;  3VFK A;  2YLM A;  3QWZ B;  3UI3 A;  4LJO B;  1CK1 A;  1X1M A;  2V3P A;  2VZK B;  1P3Q U;  2K6D B;  2WU5 B;  2L0T A;  5DPR A;  4DXG A;  3ZRC A;  4KKI A;  2G4S A;  1J7B A;  2PE6 B;  1OEY J;  1FNW A;  4G0N B;  2KC1 A;  4WJQ A;  5E6P A;  3WAL A;  1GC7 A;  4LNN A;  1PUT A;  5G55 A;  5AZF A;  2V4L A;  4GB9 A;  2KN4 A;  2WXJ A;  2AL3 A;  3B9J A;  1ZKH A;  3A1Q B;  3Q8F A;  4DHJ B;  3PVL A;  3I3T B;  1EO6 A;  1V1P A;  2ZPY A;  3AH7 A;  4LTU A;  2WP9 B;  1GNU A;  1OQR A;  2KKC A;  1GC6 A;  4KDI C;  3VQI A;  2WXO A;  3U52 E;  4EOY A;  2LGI A;  1FXA A;  1QIL A;  4LNI A;  1OQQ A;  3AN1 A;  3BVZ A;  1I35 A;  1EWC A;  2D3A A;  2KD0 A;  2M19 A;  1CZP A;  3L16 A;  1WJ6 A;  5HFY A;  3TUO A;  2RDG A;  2VZK D;  4CO7 A;  3KUD B;  2KLC A;  4A3P A;  3Q3N C;  4P7I A;  1FM0 D;  3BK2 A;  4TSS A;  4W9F A;  1SF0 A;  2BW2 A;  2MRP A;  5C1Z A;  2MBQ A;  4WH4 A;  4YXD B;  2KDF B;  1KRH A;  3AE8 B;  3WAP A;  2ZVO A;  1STE A;  2LJ5 A;  3VH4 B;  1NEK B;  2MJ3 A;  2LVQ A;  2LAS A;  2L32 A;  2WXQ A;  4C4V B;  1KTK A;  2CKH B;  2JF5 A;  4FHJ A;  2NBW B;  4OW0 A;  3HK0 A;  4I6N B;  4J6I A;  4ANU A;  4GDL A;  1BXT A;  1PGB A;  2FIF A;  3KWV A;  1GB4 A;  3P4S B;  1BUI C;  2KLG A;  4NJ7 A;  2KQS A;  4XDC A;  3ZNZ B;  2ASQ A;  5MPO A;  1WE6 A;  4TMA B;  2KAN A;  4P6V F;  1JWS D;  3JW0 X;  3A4R A;  4KZ0 A;  2FCM A;  2KMC A;  5J17 A;  5FK9 C;  2EMT A;  4DXF A;  3IXS A;  1M94 A;  3PZ8 A;  5KHO A;  2LGY A;  2ZNV C;  3U2S C;  4A20 A;  2O6V A;  2DHZ A;  4KVG B;  5IKC M;  1QLB B;  4WQM A;  2K0P A;  3IAS 1;  3L4P A;  3V05 A;  2GI9 A;  3L10 B;  2GBN A;  2IPK D;  3ZNH B;  4JPS A;  3NZS A;  1TIF A;  4HPM B;  4FXC A;  3SFE B;  3VR9 B;  2K39 A;  3SEB A;  2IYD B;  4JLC A;  3BII D;  2KTR A;  4LK0 M; 
#chains in the Genus database with same CATH homology
 3R7Q A;  5IAA C;  2XK5 A;  2KNB A;  2NPT A;  4K7W A;  1VCB A;  4KSL C;  5TR5 A;  2O2V B;  3U30 A;  1H4R A;  3OJ4 B;  4FJY A;  5D2M B;  4XC2 A;  3W1S C;  1WYW B;  1WGY A;  3EEC A;  2D2Q A;  1T0Y A;  1EF1 A;  3KW5 B;  2GBJ A;  1J19 A;  3PHX B;  4K7U A;  1U4A A;  4WJP A;  3TBL D;  2RPQ A;  1LFD A;  4MGI E;  2I1J A;  3B0A A;  3APF A;  2J0M A;  3Q3F A;  1J8C A;  3ECI A;  1WGR A;  2MP2 B;  4I6L B;  3KYC D;  1HE8 A;  1RFA A;  1WMH A;  4I6P A;  4JGH B;  3MHS D;  1IPG A;  3H9D A;  4GDK A;  3PRP B;  5GMV A;  2N9P C;  2Z0E B;  3ZVV A;  2NR2 A;  2GBR A;  1KM7 A;  5JHB A;  3L08 A;  2DAJ A;  1Q0W B;  4W9C A;  2QHO A;  3UIO B;  3A9J B;  4WAA A;  1UD7 A;  2NBV B;  4W9L A;  2KMA A;  2HJ8 A;  3SDL C;  3JSV B;  2G4D B;  2KC2 A;  2Z59 B;  1UBI A;  2ZPN A;  5LXH A;  2LZ6 A;  3EC8 A;  2IY1 B;  3UF8 A;  2REX A;  4HJK A;  4LDT D;  2L7R A;  2LGD A;  3RZW C;  3OJ3 A;  5HKH A;  2V3S A;  3PS6 A;  4G11 A;  2PPH A;  4MJS A;  1KLV A;  3H7P B;  2KDE B;  3VVW B;  3N30 A;  1S1Q B;  2D11 A;  1SIF A;  2KJH B;  3PGE A;  2L00 B;  2FCQ A;  2AYO B;  2K1F A;  2KZR A;  1E8X A;  3B08 A;  3DOW A;  2L3Z A;  1V80 A;  4ICV A;  3BY4 B;  5KHQ A;  1WZ3 A;  1WGH A;  4M8M A;  3QIJ A;  3ML9 A;  2FAZ A;  1WJU A;  3QQ8 B;  3QCA A;  3PRM B;  4GOC A;  2J0J A;  4W9G A;  2DX5 B;  3WA0 A;  3PZD A;  4AOF A;  2K6Q A;  2CR5 A;  2N9E B;  3TIX A;  1GUA B;  3CSF A;  1J0G A;  3ENE A;  2MLB A;  2EKE C;  3DBL I;  2PE9 A;  4DHZ B;  4FBJ B;  1WRD B;  2LXC A;  1V5O A;  2MQJ A;  4TQ0 A;  1GJZ A;  4HLE A;  2A4Z A;  3DBH I;  2JY6 A;  2KDB A;  2BKR B;  2KQ7 A;  3RZF A;  3HM3 A;  1FXT B;  4EUT A;  4ZYN A;  2N7E A;  1WXV A;  2LI5 A;  4GIV A;  3VUX A;  4ZRK A;  4LJP B;  3V6C B;  1R4M I;  3VH3 B;  4DWF A;  4NJ6 A;  3ZDT A;  1WR1 A;  1Z5S B;  3V62 A;  4IWP A;  5EDS A;  2JRH A;  3VUW A;  4IM3 A;  1EF5 A;  1JRU A;  2KWV B;  1C3T A;  3H6N A;  4CYE A;  2BYE A;  4IW0 A;  4DXA B;  1F9J A;  1C1Y B;  2MWS B;  3A1Q A;  3W1S A;  3DQV A;  1ISN A;  2FUH B;  2AEH A;  2IBI B;  2DZM A;  4G50 A;  5IA7 A;  2LVP A;  3HM6 X;  3KUC B;  3JYU A;  3AI5 A;  2C7N B;  2KFK A;  2JXX A;  3QAR A;  2MBE A;  4ZRJ A;  2V1Y A;  3DBS A;  5AEK B;  4HDO A;  3W1Y A;  3K9P B;  2N7D A;  3IVF A;  3V60 A;  4HCN B;  2D07 B;  3WIM A;  2L8J A;  4A3O A;  4MGZ E;  1WJ4 A;  4E3C A;  3R3M A;  3VXW A;  3RT3 B;  1S3S G;  2CHZ A;  4MM3 A;  4DK5 A;  1V81 A;  2RR9 A;  5DCN A;  4WJN A;  4IUM B;  1XT9 B;  2WWZ A;  4M0W B;  3PSE B;  4WWP A;  5CTR C;  3UGB B;  4NQL B;  1H8C A;  1AAR A;  3QJZ A;  1WR6 E;  2W9N A;  3T8M A;  3MTN B;  3P2B A;  4RM8 A;  3ZTC A;  4ANX A;  3CMM B;  4JQW C;  2G45 B;  2D10 A;  2LD9 A;  3L0W B;  4II2 B;  3T9L A;  4FA6 A;  1NBF C;  3DPD A;  4PS7 A;  1P0R A;  2D3G A;  1ZW7 A;  2XBB C;  1TGZ B;  4AWJ A;  3CST A;  3MJW A;  4B9K A;  5AZH A;  1WY8 A;  1E8Z A;  4GMV A;  5D94 A;  4PYU A;  3VAW A;  2KK8 A;  2JWZ A;  4W9I A;  2KVR A;  4TV3 A;  3L13 A;  1KJT A;  1L7Y A;  3PLV A;  4F1S A;  4DBG A;  2LXA A;  2O6V D;  4FUL A;  4FAD A;  3RYT A;  1YD8 U;  2KN5 A;  3WAM A;  2PJH A;  2C9W B;  3EFU A;  3LDZ E;  2NCN A;  4GSW A;  2MBH A;  3ZO5 B;  3WAN A;  2YVC A;  2GOW A;  4EEW A;  4ZDV A;  3PRZ A;  3QK0 A;  2IO0 B;  3O65 B;  4MGK E;  3RUI B;  4CHK A;  1CMX B;  1E7V A;  1SGH A;  1UZX B;  2RD0 A;  3APD A;  1NI2 A;  3A33 B;  3ZTD A;  1E8W A;  4W9K A;  3KH0 A;  3UQB A;  2IY0 B;  2GBM A;  3V61 A;  3V6E B;  1P9D U;  3DDC B;  5CHW A;  4KIK A;  2K8C A;  1V5T A;  2ZCC A;  1Y8R C;  2LGX A;  2J7Q B;  3N3K B;  3QX1 A;  2NVU I;  3APC A;  3NZU A;  2CU1 A;  3H7S A;  3A9K A;  2AL6 A;  1P1A A;  1WX9 A;  2DZI A;  4NAW A;  1EUV B;  2IO3 B;  4AP4 C;  1WM3 A;  3RUL A;  2NBU A;  4BKS A;  4MJS B;  2BKF A;  5E6O A;  4PS3 A;  5C23 A;  2KHW B;  4BKT A;  3A9K B;  3IBE A;  5D7G A;  4GU2 A;  3N32 A;  3C0R B;  1WZ0 A;  2OJR A;  3ZKJ C;  2ZVN A;  3TMP B;  2DAF A;  5L83 A;  1WF9 A;  2KXJ A;  2N4F A;  2KWU B;  3M95 A;  2MW5 A;  5BO4 B;  1WXS A;  2K25 A;  2KTF A;  3TL5 A;  4LCD E;  2XEW A;  4KSK C;  4WJO A;  1WE7 A;  2ZJD A;  2RGF A;  1WJN A;  2B3A A;  3DBR I;  3VHT C;  2NS5 A;  4NAW B;  2K8B A;  3M62 B;  1WH3 A;  2MSE D;  4KIK B;  2WYQ A;  2FID A;  5DPS A;  4IM0 A;  4WQO B;  4TUU A;  4BKS D;  2DZK A;  4E74 A;  3R66 C;  4HVB A;  1ZGU B;  2KOX A;  5AZG A;  3L17 A;  3ONS A;  5J2R A;  3OAW A;  2R2Q A;  1NDD A;  3ALB A;  1UH6 A;  2WX0 A;  2LUE A;  2FNJ B;  2LVO A;  3GOE A;  4BBN C;  4K81 A;  1PQS A;  4N9F 4;  3ZUN A;  3PRE A;  2WX1 A;  5DPW A;  2ZEQ A;  3S2A A;  2J0K A;  4BOS C;  3U8Z A;  1D3Z A;  1SE9 A;  4FLH A;  4K1R B;  4FN2 A;  2KJR A;  3SD5 A;  4II3 B;  5DPT A;  4TQ1 A;  3KUZ A;  3QAQ A;  4F7Z A;  4HPL B;  1V6E A;  4WWO A;  2C60 A;  4FJZ A;  4AJW A;  1I42 A;  3DVG X;  2JUO A;  2N9X A;  1TZ1 A;  4MEL A;  1MG8 A;  2DYB A;  4DDG D;  2L05 A;  2ZNV B;  3PLU A;  5D6J B;  2XK5 B;  3AU4 A;  1A5R A;  1OTR B;  2KTR B;  3PHW B;  3VUY A;  5CHF A;  1XD3 B;  4X57 B;  1Q5W B;  2BWE S;  3QC8 B;  3VFK A;  3X23 A;  4ASW C;  2OOB B;  1WX7 A;  1WIA A;  2JPH A;  1WGG A;  1YIW A;  1E5W A;  2YLM A;  1VD2 A;  3QWZ B;  1V9J A;  2IZV B;  4URK A;  1TTN A;  2BGF A;  4LJO B;  1E8Y A;  2Y5B B;  1X1M A;  3VDZ A;  3AXC A;  1R4N I;  2RSU A;  1P3Q U;  3DVN U;  2C5L C;  2K6D B;  3B1L X;  4HXD A;  4W9H A;  2L0T A;  4IM2 A;  3IG3 A;  4XZ4 A;  5DPR A;  3ZRC A;  3VTU A;  3K9O B;  2G4S A;  2PE6 B;  1OEY J;  2HTH A;  3IHP C;  3BIN A;  2KWC A;  3R7R A;  1QZE A;  4G0N B;  3ZW3 A;  2M0X A;  4IC7 B;  5LLI A;  2Z0D B;  1E7U A;  3A4S C;  1WMH B;  2KC1 A;  4WJQ A;  5E6P A;  1E90 A;  4RM9 A;  5JHA A;  3WAL A;  4BBN F;  3JSV A;  1GC7 A;  4JL9 A;  2IO2 B;  5G55 A;  4AJY B;  4MSM B;  2KX3 A;  3PTF C;  3NHE B;  2V4L A;  5AZF A;  4EZJ A;  1WM2 A;  2GMI C;  4GB9 A;  4BFR A;  1KOT A;  4MH0 E;  4GGQ A;  4PS8 A;  3UQA A;  2CHX A;  2AL3 A;  3HIZ A;  4GDK B;  1ZKH A;  3A1Q B;  4W9E A;  4DHJ B;  1YX6 B;  4IWO A;  3PVL A;  3I3T B;  3HHM A;  1IYF A;  3GZN I;  1EO6 A;  1IP9 A;  2JZ3 B;  3ZLZ A;  3EHV A;  2ZPY A;  3L54 A;  4B6W A;  2KX0 A;  4GDL B;  2DZJ A;  3UIN B;  1GNU A;  2KKC A;  2JVC A;  1GC6 A;  4KDI C;  2GBK A;  3ZRF A;  3VQI A;  1V2Y A;  2BF8 B;  2O2V A;  4XX5 A;  4EOY A;  3QA8 A;  1RAX A;  2MX2 A;  3ZNI D;  2HE7 A;  3ML8 A;  4EZK A;  2CHW A;  4NNJ B;  2M8S A;  5CX3 A;  1WX8 A;  3X0W A;  5L95 C;  3U7D A;  3DVN V;  2KJ6 A;  2WDT B;  1YJ1 A;  1I35 A;  2KD0 A;  4FHK A;  4MEM A;  4MGY E;  2G3Q B;  4YL8 A;  3SU8 X;  1TBE A;  2IO1 B;  1LXD A;  3L16 A;  3NS8 A;  1WXM A;  4GXB A;  1WJ6 A;  4BVU C;  4JIO U;  3PV1 A;  2LRW A;  2O6V B;  4CO7 A;  3DVG Y;  2M1M A;  2C7H A;  3KUD B;  2M17 A;  3RCZ A;  2UYZ B;  2KLC A;  4A3P A;  1RLF A;  2KDI A;  2AWT A;  4P7I A;  2PEA A;  3IFW B;  4W9F A;  4KV2 A;  2MP2 A;  2KFK B;  2BWF A;  2MRP A;  3PPA A;  4F8C B;  5C1Z A;  2ZCB A;  2MBQ A;  2DYO A;  2MBO A;  1LQB A;  1OGW A;  5JH5 C;  2KDF B;  2I1K A;  3PT2 B;  4WWN A;  3WAP A;  2L0F A;  2ZVO A;  2LJ5 A;  4DHZ E;  3AUL A;  1OQY A;  3VH4 B;  1UEL A;  4E71 A;  4BKG A;  2FCS A;  2LVQ A;  4DDI D;  1LM8 B;  2UWQ A;  2BPS A;  2JRI B;  3VTV A;  3D32 A;  4EFO A;  2LAS A;  5JZE B;  1YX5 B;  3TJP A;  4GN1 A;  1P98 A;  1WFY A;  4KZC A;  2N1W A;  4DHJ D;  2JZZ A;  1G6J A;  2A5U A;  2KO3 A;  2CKH B;  2JF5 A;  4NQK E;  4FHJ A;  3TCA A;  1Q1O A;  2NBW B;  1V49 A;  2R2O A;  4ZRI A;  3DCG A;  1YQB A;  2BYV E;  3HK0 A;  4HDQ A;  3AU5 A;  2KFJ A;  4ICU A;  4I6N B;  5J18 A;  4J6I A;  4NY0 A;  2NPT B;  1WXA A;  4B95 A;  3LJ3 A;  3NY5 A;  4GDL A;  4ANU A;  1Z2M A;  4MSQ B;  3ZIM A;  4BOZ B;  2MA9 B;  2EMS A;  2FIF A;  4HK2 A;  1OEY A;  3VTW A;  5E6N A;  4PYZ A;  4HWI B;  4ANV A;  2LRU A;  2M4N A;  2LWP A;  2KLG A;  4LDT B;  4NJ7 A;  5FR6 A;  2KQS A;  4K7S A;  3ZNZ B;  2ASQ A;  2ZZP B;  1WE6 A;  1V86 A;  2KAN A;  4MDK E;  4TKN A;  2L76 A;  2CS4 A;  2DEN B;  3A4R A;  3JW0 X;  4KZ0 A;  3OLM D;  4IG7 B;  2FCM A;  4EKU A;  2KMC A;  2BYF A;  1RRB A;  3H7P A;  5J17 A;  1L2N A;  2EMT A;  4KDL B;  4FJV B;  1M94 A;  5KHO A;  3JVZ X;  2LGY A;  2ZNV C;  3RD2 A;  3ZNG C;  4AUQ C;  3UIP B;  1BT0 A;  1UBQ A;  5G2N A;  4EZL A;  4A20 A;  2O6V A;  2DHZ A;  2N1V A;  2K8H A;  4HCP B;  4KVG B;  3A9J A;  5CHV C;  2MBB B;  1WGD A;  4M8N A;  4OVV A;  4ANW A;  2FCN A;  3NOB A;  1GG3 A;  3QHT A;  3M63 B;  3KVF B;  1K8R B;  3KYD D;  3WAO A;  4IWQ A;  4W9J A;  3SHQ A;  3L10 B;  2GBN A;  3Q3J A;  1WI0 A;  4W9D A;  1XQQ A;  2JT4 B;  2MCN B;  3ZNH B;  3CF6 E;  1UGM A;  3NZS A;  4G3X B;  4HPM B;  2DYM A;  2VRR B;  2C7M B;  2K39 A;  4OVU A;  3M3J A;  2IYD B;  4JLC A;  5LXI B;  4NPN A;  3ZDM C;  3H1U A;  2KTR A;  2HD5 B;  4RMA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...