2CS4A

Solution structure of n-terminal domain of chromosome 12 open reading frame 2
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
95
structure length
95
Chain Sequence
GSSGSSGMELKVWVDGVQRIVCGVTEVTTCQEVVIALAQAIGRTGRYTLIEKWRDTERHLAPHENPIISLNKWGQYASDVQLILRRTGPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of N-terminal domain of chromosome 12 open reading frame 2
rcsb
source organism Homo sapiens
molecule tags Structural genomics, signaling protein
molecule keywords Protein C12orf2
total genus 13
structure length 95
sequence length 95
ec nomenclature
pdb deposition date 2005-05-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00788 RA Ras association (RalGDS/AF-6) domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cs4A00
1GC7A 2DHZA 3DPDA 4MGIE 4ICUA 4E3CA 3A33B 4MJSA 2CKHB 2REXA 3A1QA 2HD5B 4HVBA 3JYUA 4DHJD 4NQKE 3AU4A 2M17A 1WGDA 3TCAA 2ZEQA 3ENEA 5DPWA 1ZW7A 3ZNHB 4BOZB 4WAAA 3CSFA 3IFWB 1LQBA 5LLIA 2BF8B 3Q3JA 3AI5A 4PYZA 2JUOA 4W9LA 2A5UA 2BWFA 5CX3A 2KD0A 3CMMB 4IWPA 3SU8X 2KLGA 5E6PA 4LCDE 1WI0A 2ZJDA 1C3TA 2PE9A 1WFYA 2KANA 4LDTD 1Q5WB 4URKA 4ANVA 2V3SA 3PT2B 4GGQA 3ZTCA 5D6JB 2KLCA 2CS4A 3DDCB 4GB9A 2NCNA 2C7HA 2IY0B 2AL6A 3R7QA 3HHMA 4TKNA 1V2YA 2FIDA 4P7IA 3RULA 2RR9A 3PV1A 1MG8A 2I1JA 1KLVA 4F8CB 2BYVE 2K25A 3IG3A 4NJ7A 4TUUA 5IA7A 1TTNA 3WALA 4II3B 5BO4B 5G2NA 3VH3B 2DAFA 2K1FA 2L00B 2RPQA 2CR5A 2OOBB 4PYUA 3QWZB 2IY1B 4BKGA 4BOSC 2UWQA 2KNBA 3A1QB 2AEHA 4EOYA 3PHXB 3QQ8B 1V49A 3N32A 1E5WA 2ZNVB 4G3XB 3V61A 1WZ0A 3VFKA 1KOTA 3APCA 3M63B 3SD5A 2LJ5A 1YIWA 2KWUB 5J2RA 2DENB 4NAWB 3VTUA 5CHWA 5G55A 2FCSA 2O6VD 3VVWB 4AOFA 2KVRA 3V60A 2C7MB 5FR6A 3ZNZB 2LASA 2G4SA 3QIJA 3V62A 3W1SA 1J19A 2UYZB 1E8YA 4TV3A 4WJPA 2FIFA 4FHJA 3JVZX 1OGWA 3DVNU 3O65B 3GOEA 1QZEA 4ANWA 3PLUA 1WZ3A 3QCAA 2LD9A 3ALBA 3PREA 4MM3A 4NPNA 3U7DA 5L83A 2DYBA 4ZRIA 3TL5A 1RAXA 4AWJA 1WMHA 5L95C 4DDGD 1WX7A 3RZFA 1SE9A 2KWVB 1UELA 2Z0DB 2Z0EB 4G50A 4W9GA 3ZKJC 3QX1A 2KFKB 5TR5A 3ZO5B 4A20A 2LVQA 2N9EB 2XK5A 1UBIA 2LVOA 4EFOA 4IC7B 1V6EA 2KOXA 3MTNB 1E8XA 4W9JA 1OEYJ 1WYWB 4RM8A 4I6PA 1XD3B 4BBNF 4MELA 3PPAA 4GSWA 4MH0E 1GJZA 2NR2A 5EDSA 1ZKHA 2JRHA 3NZUA 4W9FA 1H8CA 2ASQA 3RYTA 4IW0A 3QA8A 4HLEA 1WJUA 2MRPA 3KYCD 4F7ZA 4XC2A 1R4NI 4JIOU 5JZEB 4K7WA 3R66C 3K9OB 1TGZB 2R2QA 1JRUA 3S2AA 2G3QB 3W1YA 4WWPA 3X23A 5D2MB 5AZFA 1NI2A 4KDLB 2N1WA 3A9JB 1PQSA 3JSVA 1P9DU 2D10A 1L2NA 5HKHA 1FXTB 2IBIB 2KTRB 2W9NA 3KUZA 3N3KB 3VTWA 2M4NA 3Q3FA 2RGFA 2ZNVC 2WDTB 1Y8RC 4TQ0A 2DYMA 3OLMD 2BYEA 4W9CA 5J17A 3ML8A 5GMVA 4ASWC 1WH3A 2ZVNA 1LFDA 2O6VA 2XK5B 2I1KA 4TQ1A 3LJ3A 2LGXA 3IHPC 3L16A 1S1QB 4GIVA 2BGFA 3DVNV 3C0RB 4W9EA 2HJ8A 3N30A 3WA0A 2Z59B 2DYOA 2PE6B 4IUMB 5AEKB 3A4SC 3UQAA 3V6EB 3EECA 2FAZA 2GMIC 2KN5A 2KTFA 2KDIA 4DHJB 1WGYA 2LVPA 4B9KA 2LRUA 3KUCB 3VHTC 3EC8A 1Z2MA 1WM3A 2RD0A 1EO6A 4GXBA 4GMVA 3M62B 4IG7B 2AL3A 3PSEB 4GDLA 4FN2A 3TJPA 1J0GA 2J0KA 3ZNGC 3EFUA 1Q1OA 4K7SA 1SIFA 5DPSA 3WAMA 4JGHB 2K6DB 4WQOB 3ZRCA 2FNJB 1CMXB 2L0FA 2BKRB 3APDA 1WIAA 1P0RA 3UQBA 3B1LX 2KO3A 5JH5C 2HTHA 1YJ1A 4OVUA 1G6JA 2FCQA 2K8CA 2EMTA 4B95A 3VUWA 4MGYE 3DCGA 3WAPA 4KIKB 5IAAC 1I35A 2PEAA 3DVGY 3VQIA 3A9KB 1WM2A 3R7RA 2K8BA 4KV2A 2LWPA 2KHWB 2BYFA 5JHAA 2K39A 2JT4B 2L3ZA 2MP2B 3DQVA 3T9LA 2NBVB 1RRBA 4KZ0A 3QJZA 4HPLB 1X1MA 1WGGA 3L10B 1WX8A 1D3ZA 3VUXA 4RMAA 1WX9A 1WR6E 3VDZA 4WJNA 1P3QU 2KX0A 1V86A 2N9XA 2LGDA 2EMSA 2LUEA 4BVUC 2HE7A 1IPGA 2GBNA 1WJ4A 1YX5B 3ZDTA 3TIXA 1UGMA 4KDIC 2D07B 2KFKA 2LXAA 3M3JA 3ONSA 4II2B 5DPRA 4EUTA 1ISNA 3KH0A 2M0XA 1E8WA 1LM8B 4W9KA 2LZ6A 4GDLB 4KSKC 4MSQB 4F1SA 1GG3A 1RFAA 4K1RB 2WX0A 2KDBA 3TBLD 1GC6A 2MW5A 3NY5A 4PS3A 1YD8U 1UBQA 3H1UA 3QHTA 4BKSD 3PGEA 2JRIB 4DXAB 2KMCA 2C60A 4FA6A 2KMAA 3NZSA 1LXDA 4DWFA 2XBBC 4PS7A 3AU5A 2L8JA 3W1SC 4M8MA 1IP9A 4W9HA 3RT3B 5D7GA 3L0WB 5AZHA 2FCMA 4GDKA 2BPSA 4NNJB 2KXJA 2KJHB 2KJRA 3IBEA 1WRDB 2DX5B 3VH4B 2G45B 2RSUA 3P2BA 5KHQA 3DOWA 2KKCA 2B3AA 1Q0WB 2IO2B 1E90A 2CHWA 2MA9B 4EKUA 1ZGUB 1NBFC 2DZIA 3SHQA 3VTVA 2WX1A 2KQ7A 4MGZE 1WGHA 1V5OA 4I6NB 5AZGA 3NS8A 1V5TA 2KTRA 3PRMB 2OJRA 2YVCA 4N9F4 1KJTA 5LXIB 1T0YA 2LI5A 2MWSB 2JY6A 4MSMB 1WE6A 2JZZA 4J6IA 3X0WA 1KM7A 4JLCA 3ZVVA 1IYFA 1VCBA 1A5RA 2IYDB 1Z5SB 3DBLI 1TZ1A 3HM3A 3NHEB 5LXHA 4FBJB 2KZRA 2M8SA 3BY4B 3H9DA 3PRPB 1U4AA 4FJYA 2M1MA 4BBNC 2DAJA 3IVFA 2BWES 4PS8A 2G4DB 4WWOA 2AWTA 2ZCBA 2K6QA 4GDKB 1M94A 2YLMA 5CHFA 2N7DA 3KUDB 3ZIMA 2NPTB 1UD7A 3L08A 4FHKA 4LJOB 1V9JA 2D3GA 2MBEA 2MSED 4HK2A 3OJ4B 4WJOA 2NBWB 3SDLC 2EKEC 2IO3B 4FLHA 4BKSA 2IO1B 3ML9A 2MX2A 2GBRA 2WWZA 3UINB 3VUYA 3CSTA 3WAOA 2MBQA 2J0MA 3B0AA 5CTRC 4MJSB 1YQBA 1GUAB 3ZLZA 2CU1A 4WJQA 3KVFB 3GZNI 4A3PA 3D32A 5DCNA 3DBHI 4MGKE 4DDID 2GOWA 3LDZE 3H7SA 3U30A 1WGRA 1E8ZA 5DPTA 4FULA 4KSLC 1YX6B 3VXWA 3H7PA 3MHSD 1V80A 4FADA 2GBJA 4HXDA 3A4RA 2C5LC 3OAWA 3BINA 4X57B 4BKTA 2MQJA 2O2VA 2KWCA 4AJYB 3U8ZA 3RUIB 2PJHA 4HDQA 2N7EA 2NBUA 3MJWA 2JVCA 1HE8A 2KK8A 1RLFA 1NDDA 1UZXB 2J0JA 3DVGX 3I3TB 3M95A 3H6NA 2NVUI 3WANA 2JF5A 4KIKA 2A4ZA 2LGYA 1XT9B 1WY8A 2WYQA 4IM3A 2MCNB 2NS5A 3UIOB 3UIPB 3VAWA 3ZRFA 4E71A 4ANXA 1EF5A 4IWQA 5KHOA 4B6WA 2ZCCA 2KFJA 2KC1A 3JW0X 2L76A 4MDKE 4M8NA 1EUVB 2N9PC 4RM9A 3UGBB 5D94A 4EEWA 4CYEA 4OVVA 1R4MI 1E7VA 1F9JA 1L7YA 4HCNB 3ECIA 1BT0A 4ZDVA 3L54A 4IM2A 1WE7A 4JL9A 4NY0A 2FUHB 2KX3A 3PS6A 1OTRB 1WXAA 1OQYA 1WXSA 3R3MA 1TBEA 4GU2A 2K8HA 1WJ6A 3A9JA 3HM6X 3JSVB 3WIMA 4E74A 2C9WB 2CHXA 4LDTB 4XX5A 2KDEB 3A9KA 3UF8A 4G11A 3AXCA 4LJPB 4ANUA 3TMPB 4NQLB 3KW5B 1P98A 3KYDD 3L17A 4NJ6A 5CHVC 4HCPB 2MBHA 1SGHA 2N1VA 2KQSA 2GBMA 3OJ3A 2O6VB 4ZRJA 2VRRB 4EZJA 3QK0A 2ZPNA 4IWOA 4HWIB 1WJNA 2IZVB 2LRWA 2MBOA 2QHOA 2XEWA 3PVLA 5E6NA 5C23A 4A3OA 2Y5BB 4JQWC 4EZKA 3L13A 2ZZPB 4HJKA 4DK5A 4ZYNA 3DBRI 1GNUA 1S3SG 1UH6A 3PTFC 2JWZA 3PZDA 4G0NB 4DBGA 3HIZA 4AJWA 2MP2A 2JPHA 2J7QB 4ICVA 3QAQA 1OEYA 4DHZE 4CHKA 2L0TA 4EZLA 2FCNA 2V1YA 3QC8B 3AULA 4AP4C 2AYOB 3ZTDA 3PHWB 2NPTA 4GOCA 1WXMA 4YL8A 1C1YB 2D11A 2N4FA 2DZMA 4KVGB 1J8CA 2DZJA 5JHBA 4BFRA 1XQQA 1EF1A 3RZWC 3V6CB 3ZDMC 2MBBB 1WF9A 3ZW3A 2L7RA 4MEMA 4GN1A 4M0WB 4FJZA 2R2OA 4I6LB 3DBSA 1WR1A 2JXXA 2JZ3B 3HK0A 4NAWA 4DHZB 3B08A 3QARA 4IM0A 2GBKA 4KZCA 3RD2A 4FJVB 1WMHB 4W9IA 2PPHA 4ZRKA 3RCZA 2BKFA 2V4LA 1H4RA 1I42A 2CHZA 4K81A 2LXCA 3PLVA 4W9DA 1VD2A 3PRZA 4CO7A 1WXVA 3EHVA 2ZVOA 1P1AA 4XZ4A 2C7NB 2O2VB 3NOBA 2MLBA 3APFA 1V81A 1E7UA 2D2QA 3H7PB 5J18A 2ZPYA 2KJ6A 5E6OA 4HPMB 1K8RB 5C1ZA 3T8MA 1AARA 4WWNA 3CF6E 2KC2A 3ZUNA 2IO0B 4AUQC 3K9PB 2L05A 4K7UA 2KDFB 3ZNID 4HDOA 2DZKA
chains in the Genus database with same CATH superfamily
2DHZA 4E3CA 4P1CC 3A33B 2GRIA 4HVBA 1K53A 1T3QA 3AU4A 1WGDA 3TCAA 1ZW7A 3IFWB 4ITKA 3NS1A 4YSYB 3SR6A 4W9LA 3R8BA 2J53A 5CX3A 2KD0A 4IWPA 1EU3A 4M01A 5BMIA 1C3TA 1IBXA 2PE9A 1HZ5A 4ANVA 4GGQA 3ZTCA 1GAQB 1NVID 1PGXA 4DXFA 2C7HA 3FILB 2AL6A 2BT6A 2WXMA 1V2YA 4KGSA 4EE2A 1FD6A 4RF0A 1KLVA 2BYVE 4C56C 2L00B 4TMAB 3Q3OC 4YTPB 1HXYD 1YJJA 2IY1B 2UWQA 3A1QB 3PHXB 4ZOHC 1DYQA 2ZNVB 3N1XC 1KOTA 1YIWA 2DENB 1UGJA 2GLSA 4P16A 2FCSA 3VVWB 2UU7A 3V60A 1SEBD 3I57A 1XLPA 5TSSA 5BYQA 2LASA 4IOIE 2VH2A 3URYA 1E8YA 3N9YC 1YJIA 1OGWA 1UUPA 1QZEA 3PLUA 3QCAA 3PREA 3U7DA 3IXSA 1ET9A 2DYBA 4ZRIA 1WX7A 1N61A 1D5MC 1ZDVA 1UELA 2Z0DB 4RGOS 3ZKJC 1K50A 3QX1A 3ZO5B 2LVQA 3AE4B 5BMHA 1XLOA 2LVOA 1VZ6A 3MTNB 1QQRA 4RM8A 2D5GA 1YMHE 3R2TA 4BBNF 4MELA 5EDSA 2JRHA 2ASQA 3RYTA 4IW0A 4HLEA 1SE2A 3DBLB 4XC2A 4K7WA 3SEBA 4A90A 3W1YA 2R2QA 3S2AA 2G3QB 2Z8LA 3A9JB 1PQSA 5HKHA 2JQRB 2IBIB 5AUKA 2M4NA 1JWAD 2QIEB 2WDTB 4QAYA 4LNIA 3OLMD 1FXIA 3ML8A 4LLGM 5IP4D 2ZVNA 1LFDA 2O6VA 3NZ3A 1F1HA 3LJ3A 4XGAB 1S1QB 2BGFA 3DVNV 1IGCA 4W9EA 1FM0D 3UQAA 2PE6B 4YTNB 3U52E 2FAZA 4AQ7A 3AH7A 2GMIC 1KF6B 1R4NB 1JWMD 2LRUA 3KUCB 4L1BA 5JXVA 1WM3A 2RD0A 2PW9A 1T0RC 1EO6A 4IG7B 3TJPA 1SJHD 4JPSA 4RGTA 1QT9A 2J0KA 1Q1OA 4K7SA 1SIFA 4WQOB 3ZRCA 5HFYA 2KQ4X 4DQOC 3SFEB 3EA6A 1HEZE 1F52A 2HTHA 3J9CA 2K8CA 2RDBC 5IAAC 1I35A 2H88B 1FMAD 2AQ2B 1JALA 1FFUA 2KHWB 1N6ZA 2RPVA 3DQVA 1RRBA 1WX8A 1WX9A 1WR6E 4WJNA 1F77A 4ZHOA 1P3QU 3L4PA 1VZ7A 4RFBA 2LGDA 2EMSA 2HE7A 1IPGA 2KN4A 1YX5B 4JWUC 1UGMA 2D07B 2KFKA 2LXAA 1EM7A 1E8WA 1LM8B 2WX0A 1ZE3D 1GC6A 5BYRA 3RPFC 3AECB 4PS3A 1OFFA 1UBQA 3H1UA 3QHTA 4BKSD 1KRHA 4FA6A 2XBBC 3W1SC 1IP9A 1TKYA 1WXQA 1LO5D 2DX5B 3VH4B 4N6EB 3P2BA 1YN5A 1MI0A 2RMMA 1ZPSA 2MA9B 2CJOA 2WX1A 3VTVA 4MGZE 1WGHA 4I6NB 2Y5PA 5AZGA 1T0YA 2MWSB 3AN1A 2JY6A 3AE5B 1WE6A 2Y5CA 2VZKB 3X0WA 3BVMA 1VCBA 1SXTA 1J7CA 2YEPB 1Z5SB 3H9DA 2ACZB 3AE1B 3IVFA 1V97A 2G4DB 1TKEA 2ZCBA 2K6QA 1M94A 4HKZE 3AB5A 1I4XA 2N7DA 2L83A 3KUDB 2NPTB 4LJOB 5T8IA 1V1PA 1E7PB 3RNCC 1BXTA 1QOAA 2EKEC 2QCZA 2GBRA 2WWZA 2MBQA 1JWUD 2AQ1B 1ESFA 4MJSB 4M02A 2CU1A 3DWGC 4A3PA 3GZNI 5DCNA 3DBHI 3H7SA 2YEPF 4FULA 1YX6B 3MHSD 1DOXA 2GBJA 2C5LC 2V3NA 2MQJA 4AJYB 3RUIB 2N7EA 2PTLA 3AE6B 2NVUI 3WANA 5D3DA 4WIPA 2LGYA 3NVZA 2NS5A 1N63A 1EF5A 4B6WA 2ZCCA 2KFJA 2KC1A 3JW0X 3UGBB 2HJ1A 1ET6A 1E7VA 1L7YA 3ECIA 2LUMA 5EE0A 4IM2A 4JL9A 2N0SB 1C79A 1OQYA 5FKAC 3RMKC 3R3MA 2AX5A 3HM6X 1XXGA 2WXKA 2CHXA 4XX5A 3A9KA 3AXCA 1FCLA 3TMPB 3L17A 4HCPB 2MBHA 1SGHA 3OJ3A 2ONQA 1STEA 1WJNA 2LRWA 3PVLA 5E6NA 2Y5BB 4JQWC 2PKOA 3WCQA 3DBRI 3AE7B 2WGSA 1TS4A 4KGRA 2JPHA 1TS2A 3QAQA 4CHKA 3FKYA 1SB3C 2V1YA 4AP4C 1L5PA 1TS5A 2AYOB 1DGJA 3AE2B 3NVWA 3IAS1 1UWXA 4JE3B 4HROA 2DZMA 1J8CA 2FE8A 1EF1A 3W5UB 2SAKA 1WF9A 1YOVB 2JZPA 4MEMA 3PZ7A 4FJZA 1WR1A 2WXOA 3U2SC 2MJDA 2QMTA 2BS3B 3RD2A 4AS1A 4FJVB 4MT5A 1J7AA 2VZKD 2CHZA 1C76A 3NOBA 2MLBA 2KYWA 2I38A 1I4PA 3TSSA 2KJ6A 4PT5A 4HPMB 1XF5L 4PK1A 4WWNA 2M19A 1ACCA 4AUQC 3Q8EA 4K7UA 2CKHB 3DPDA 4ICUA 3AEFB 4MJSA 4HEA1 2HD5B 2W55A 3SFDB 4WAAA 2DNFA 2BF8B 2A5UA 4A9AA 2BWFA 3MFGA 3CMMB 2KLGA 1FIQA 1WFYA 1SF0A 4URKA 3PT2B 1C4PA 2L32A 3DDCB 3AM9A 1C4CA 1VDVA 2XN9C 1CQVA 5G2NA 3VH3B 2K1FA 2RPQA 2CR5A 3QWZB 4BKGA 2K3UA 1SIJA 2KNBA 2AEHA 4EOYA 4WAFA 1V49A 3N32A 4G3XB 3V61A 1P7EA 2LJ5A 2QSDA 2M56B 1PGAA 2KVRA 5FR6A 3HUIA 2G4SA 3QIJA 3V62A 3W1SA 2INCC 3OWEB 4FHJA 3DVNU 3O65B 1WZ3A 3ALBA 1MG4A 3TL5A 1RAXA 2QJLA 1SE9A 4B0EA 4A20A 1QILA 3H8HA 2WS3B 4BAXA 1UBIA 3R2IA 3FILA 1V6EA 2KOXA 4W9JA 1OEYJ 2ZW1A 1YN3A 4I6PA 1XD3B 3PPAA 1BMLC 1ZKHA 4RF1A 1H8CA 4US8A 1NYQA 3QA8A 1WYGA 2MRPA 2INNE 3R66C 4IKGA 1TGZB 1JRUA 3X23A 4HPPA 4WWPA 4KDLB 2N1WA 5BMGA 3KUZA 3N3KB 3NRZA 1EWCA 4YT0B 2ZNVC 1Y8RC 4TQ0A 3RI7C 2DYMA 3HVZA 5J17A 2BYEA 2WXNA 4ASWC 1WH3A 4OVZA 2LGXA 3IHPC 1TS3A 1FNUA 3WA0A 1EU4A 2DYOA 2Z59B 4IUMB 5AEKB 1AW7A 2D3CA 2K9XA 3DHHC 2KDIA 1N5XA 1WGYA 3VHTC 1Z2MA 2Y3AA 1SBBB 2AL3A 1TIFA 3ZNGC 5H8YE 3WAMA 4JGHB 2FNJB 2L0FA 3MP9A 2KO3A 1R4MB 1YJ1A 2FCQA 4MH8A 2J4XA 4B95A 3VUWA 3DCGA 1MFWA 2PEAA 1JWSD 3VQIA 3A9KB 1WSPA 2LWPA 5FK9C 3DHGC 5JHAA 1FCCC 4HPLB 2V9HA 1WGGA 1NENB 1TYGB 4RMAA 3VDZA 5IKCM 1V86A 2N9XA 2NMQA 3T3NA 3LXFA 4II2B 1ISNA 1PYWD 4W9KA 3KH0A 3ZJUA 4GDLB 4KSKC 4MSQB 4F1SA 1GG3A 3TBLD 2JYEA 2X38A 3C19A 1YD8U 1T0SC 3IAM1 3PGEA 2KMCA 2KMAA 3NZSA 2LGIA 5EE9A 3KQ4A 3AU5A 4M8MA 3RT3B 2XNAC 3L0WB 2FCMA 4GDKA 5H92C 2ON8A 1JROA 2KJHB 2KJRA 2J42A 3IBEA 1WRDB 3MJ5A 2G45B 3DOWA 1Q0WB 1NI3A 1E90A 2CHWA 4UDUC 3SHQA 3OG5A 2KQ7A 2V0GA 1V5OA 3PRMB 1V5TA 2LI5A 1E10A 2CU3A 4YWGG 4JLCA 2IGDA 3DWMA 3I9V1 2KZRA 3EGRA 4DXGA 4BBNC 1V1OA 2BWES 2AWTA 4GDKB 5CHFA 2WLBA 5GXGB 3KLSX 3ETRA 2JX5A 2MBEA 3BYYB 3OJ4B 2J52A 2NBWB 1TJEA 3SDLC 4J3OD 4RNAA 2IO3B 2LEKA 4BKSA 5IN7A 3ML9A 1Q10A 2MX2A 1D5ZC 3NJTA 3VUYA 3FC4A 3UINB 3CSTA 3WAOA 3AE3B 2J0MA 5CTRC 1GUAB 2LMCA 3ZLZA 5G5GA 2HTME 5EE3A 3HRDD 3TEWA 2GOWA 2K5PA 3NVYA 1WGRA 3BK1A 3VXWA 3H7PA 4HXDA 3A4RA 4BKTA 3BINA 2RDGA 2KWCA 4XDDA 4RH6A 2JVCA 4REZA 1NDDA 1UZXB 3DVGX 2J0JA 3M95A 2LHEA 1KLUD 2WYQA 4A6QA 3UIPB 4ANXA 1FRRA 4EEWA 2N9PC 3FAHA 4RM9A 1D5XC 3ZXRA 2B76B 2WDVB 4ZDVA 3L54A 1WE7A 4NY0A 2FUHB 3PS6A 2WXGA 1WXSA 2WDQB 1YQ3B 3BVZA 3IT4B 4S17A 3N20C 4NJCA 3W5VB 3A9JA 5I4DA 2WXHA 1ZDXA 3UF8A 4NQLB 3KW5B 2N1VA 1WWTA 2O6VB 3E9SA 4IWOA 1FXAA 2IZVB 2MBOA 2XEWA 2N9LA 3L13A 2KVZA 1S3SG 1UH6A 3PTFC 3PZDA 1E6EB 4K3BA 3HIZA 4AJWA 3U4EG 5E6JA 1WGKA 4RCOA 4EZLA 1L0VB 2FCNA 3QC8B 1ZOYB 5IO9A 2ZW0A 1JRPA 1MHXA 1C4AA 1QOFA 2WU5B 4YL8A 3KWVA 2N4FA 5JHBA 4BFRA 2L7RA 4GN1A 4M0WB 3Q8BA 4I6LB 3DBSA 3HK0A 3VRAB 4L23A 4C4VB 1PFDA 2TSSA 4W9IA 2PPHA 3CIRB 3GE3C 2V4LA 1H4RA 1MHHE 4W9DA 1VD2A 1M4VA 1YQ4B 2IJ0A 2C7NB 1V81A 2D2QA 5J18A 2ZPYA 4NAMA 3T8MA 3CF6E 3K9PB 1XCQL 4HDOA 3I5JC 1GC7A 1IUEA 3A1QA 4HJGE 1GB1A 4NQKE 4ZRPA 2W3SA 2FBWB 2ZEQA 3ENEA 2BBCA 4M00A 3ZNHB 4BOZB 3CSFA 3Q3JA 3AI5A 1V1PB 4PYZA 4WQMA 1J7BA 3LB8C 4XWTA 3P4SB 2QEJC 3MC9A 3SU8X 5E6PA 4LCDE 1WI0A 1FO4A 2KANA 4LDTD 1Q5WB 5D6JB 4N58A 4GB9A 2L1AA 2NCNA 2AQ3B 2IY0B 3VRBB 3HHMA 3Q69A 1T0QC 4TKNA 3ZJTA 3PV1A 1MG8A 2I1JA 2BW2A 2BS2B 4NJ7A 5IA7A 3WALA 1NEKB 5G5HA 5BO4B 3GP7A 3BVGA 2BTEA 1KFYB 2OOBB 3P1MA 4P1BC 4BOSC 4LK0M 2E3TA 3QQ8B 3IT6B 1E5WA 3APCA 3M63B 2KWUB 5J2RA 4NAWB 1K51A 5G55A 2C7MB 2DBYA 1JMLA 1J19A 2UYZB 2IPKD 1UNSA 4USAA 3Q6BA 4TV3A 1FNWA 2FIFA 3ZJVA 4ANWA 1UWMA 4NPNA 1WMHA 1KTKA 3ZQ4A 5L95C 2Z0EB 4C4VA 2KFKB 5TR5A 2GB1A 2XK5A 1R7SA 4EFOA 4IC7B 1CZPA 1WYWB 2WP9B 1GJZA 4W9FA 2OHFA 2INPE 3Q14C 4O1NA 4OZAA 4MACA 4F7ZA 4D2KA 4WWMA 1R4NI 2W82A 1AYFA 2M0AA 1WRIA 5AZFA 3JSVA 2WXQA 1P9DU 2D10A 1FXTB 3VTWA 1JQ4A 2JU6X 2WXIA 3BWUD 3Q3FA 4YSZB 2RGFA 3W9CB 1A70A 2I1KA 4TQ1A 3C0RB 1CK1A 2LGSA 3N30A 1GOZA 3A4SC 3V6EB 1TZOA 2KTFA 3CWIA 4B9KA 4FXCA 4WURA 3RN9C 4GMVA 1QOGA 3M62B 2WXJA 3PSEB 3U7ZA 1J0GA 3EFCA 4HRSA 4K3CA 1CMXB 2BKRB 3TEYA 1WIAA 1P0RA 3UQBA 3B1LX 5JH5C 1G6JA 2EMTA 1VZ8A 1I7HA 5LNK1 1C77A 3DVGY 1K52A 3AE8B 4KZ0A 1X1MA 1XLNA 3AE9B 3VUXA 2KX0A 4BVUC 4XWWA 4ARCA 1WJ4A 4ZYSA 3ZDTA 2DLBA 3TIXA 4JX1C 3M3JA 3ONSA 4EUTA 1FPYA 4RGNA 2LZ6A 3MC0B 1RFAA 4K1RB 1PUTA 2MW5A 2WXLA 2LJIA 4DXAB 1LXDA 1HZ6A 5D7GA 5AZHA 4YSXB 2N7JA 2PLPA 2BPSA 2NTTA 2RSUA 3UI3A 2B3AA 2KKCA 4EKUA 1NBFC 1I4QA 3NS8A 2KTRA 2YVCA 4N9F4 1KJTA 4MSMB 2JZZA 4J6IA 4S0RA 1KM7A 2H89B 2WXRA 1OQQA 2IYDB 3DBLI 2WXFA 3HM3A 2M8SA 3PRPB 4LNNA 1U4AA 2JSVX 4FJYA 2WQYB 2M1MA 1F2RI 4WWOA 1CJEA 1HTQA 1ZP0B 3BIID 3V05A 4LNKA 1N62A 2YLMA 1PGBA 3L08A 1T5XD 1QF6A 2WHIA 1V9JA 2D3GA 1HTOA 2QDFA 2PMVA 3MC8A 3TUOA 4YXDB 3VR8B 4OHJA 2GI9A 2LHDA 3B0AA 4C7YA 2DWQA 4HKQA 1FRDA 4L2YA 4WJQA 3GS2A 3HVDA 4C00A 3D32A 4MGKE 2K0PA 3U30A 4ZHPA 1E8ZA 5DPTA 4KSLC 2MH7A 1L6UA 2KACA 5HI1A 1D4BA 3OAWA 4X57B 2O2VA 3I63C 1ENFA 3U8ZA 2PJHA 1RM6C 2W54A 1MVKA 4BZAA 2KK8A 1RLFA 3H6NA 2I2YA 2IDYA 2JF5A 4KIKA 1WY8A 2MCNB 3VAWA 3ZRFA 3AEGB 4M0WA 2ICIA 2L76A 3V3XA 1EUVB 3B2FA 5D94A 1ROEA 2BYTA 4CYEA 4OVVA 1R4MI 1F9JA 1PDXA 2V4IB 4HCNB 1JWBD 1BT0A 3PZ8A 1WXAA 1TY0A 3E56A 4GU2A 2K8HA 4E74A 1F2RC 2KDEB 1RYJA 4G11A 4LJPB 3GZNB 1AWDA 1P98A 3KYDD 4NJ6A 5CHVC 2JYTA 2WXPA 3GE8C 2VRRB 4EZJA 5C23A 4EZKA 3GB1A 2ZZPB 4ZYNA 1GNUA 4Q2JA 1FFVA 2JWZA 4KX6B 4LNFA 4DBGA 4XE0A 2J7QB 1TT5B 4ICVA 4DHZE 2BVCA 2KAJA 3AULA 4LTUA 3P42A 2G9HD 3ZTDA 3PHWB 3B9JA 1C1YB 2D11A 2DZJA 3RZWC 3ZDMC 2MBBB 2D3BA 4DHZB 2R2OA 4NAWA 5C3JB 3QARA 2K22A 4IM0A 2GBKA 4KZCA 4KKIA 2BKFA 4OZBA 1B1ZA 2MJEA 4K81A 2LXCA 3PLVA 4CO7A 3RNGC 1VRAB 2ZVOA 1E9MA 3P4PB 1E7UA 1QKZA 1T6BX 5E6OA 1K8RB 1AARA 2KC2A 2IO0B 3ZXVA 3ZNID 3RNEC 1VR9A 4MGIE 1F0ZA 2LFIA 2REXA 4IDIA 2IGHA 3JYUA 4DHJD 2OJWA 1HA5A 2M17A 5DPWA 2SEBD 1LQBA 5LLIA 2JUOA 1XEEA 2PVGC 1P7FA 3TEZA 1GPXA 2ZJDA 3W2DA 3NUHB 2V3SA 1I4RA 2KLCA 2CS4A 3R7QA 1B9RA 3RULA 2FIDA 4P7IA 1Y56A 2RR9A 3BK2A 4F8CB 3AEDB 3T3OA 2K25A 3IG3A 2R61A 4TUUA 1TTNA 2N9KA 4II3B 2DAFA 3N1ZC 1ZXHA 1JCKB 4PYUA 2QILA 1SE4A 1I4GA 1YN4A 3AEEB 1L6VA 3N1YC 3VFKA 1WZ0A 2MHJA 3SD5A 3VTUA 1HQRD 5CHWA 1L4DB 2O6VD 1SSNA 4AOFA 2IGGA 1ZXIA 3ZNZB 1C78A 2EELA 2OEDA 4WJPA 3JVZX 4XYCA 2W3RA 3GOEA 4P6VF 2LD9A 4MM3A 3P4QB 5L83A 4AWJA 4DDGD 3RZFA 2KWVB 1NYRA 3C8YA 4W9GA 4G50A 3ZYYX 2KMMA 2N9EB 2V3PA 1E8XA 1IBXB 4GSWA 4MH0E 2QC8A 2NR2A 3NZUA 1E0ZA 1JW9D 2X8XX 1WJUA 3KYCD 4JIOU 5JZEB 3K9OB 4ZRQA 5D2MB 1NI2A 3Q8CA 1L2NA 2MEKA 3P63A 2KTRB 2W9NA 3AV8A 1KH0A 4C7ZA 3DBHB 3AEAB 3AMZA 4W9CA 5GMVA 2PIAA 2XK5B 1AN8A 4GLSC 4XDCA 4GIVA 3L16A 4CQNA 1RWSA 2HJ8A 3EUB2 2HDEA 2NTSA 3EECA 2KDMA 3ZGZA 2KN5A 2FUG1 4DHJB 2LVPA 3EC8A 4GXBA 4GDLA 4FN2A 3DHIC 3EFUA 3MHZA 4WH4A 1BUIC 5DPSA 1L0XB 2K6DB 5EE1A 3APDA 2L52A 4OVUA 5C2TB 3TEXA 4MGYE 3RNAC 3WAPA 5IOIA 2BS4B 4KIKB 2E6XA 1XLQA 1WM2A 3R7RA 2K8BA 4KV2A 1DOYA 4LNOA 2BYFA 2K39A 2JT4B 2L3ZA 2MP2B 1XO3A 3T9LA 2NBVB 1N5WA 3QJZA 3L10B 3RNBC 1D3ZA 2LUEA 2GBNA 3BZDB 4KDIC 2WU2B 5DPRA 1UF0A 4TSSA 2M0XA 1QLBB 2KDBA 2WNMA 3RFZB 4KGTA 2Q5WD 3NY5A 4ACFA 4MM3B 2BQQA 2JWUA 2JRIB 2C60A 3Q3NC 3P4RB 4DWFA 4PS7A 2L8JA 4W9HA 4ARIA 3NVVA 4NNJB 2KXJA 2VH1A 5KHQA 2IO2B 3AEBB 1ZGUB 2DZIA 1GB4A 2G1EA 2OJRA 1DOIA 5LXIB 3Q2AC 1D6EC 3ABVB 1IGDA 3ZVVA 1IYFA 1A5RA 2MJ3A 1TZ1A 3NHEB 5LXHA 2BB5A 4FBJB 3BY4B 3Q8FA 1SJED 2DAJA 4N59A 4PS8A 1XCTL 3ZIMA 1MPEA 1UD7A 4FHKA 1C9FA 4A8XC 2MSED 4HK2A 1VJKA 2D3AA 4WJOA 1LGRA 4FLHA 2IO1B 2PVOD 4B0MA 5AUIA 2JXTA 1KLGD 5HG2A 1YQBA 3KVFB 3BYTB 4DDID 1OQRA 3VR9B 3LDZE 5MPOA 4C80A 4YTMB 1V80A 4FADA 1I4HA 3Q8AA 5HHDG 4HDQA 4RGMA 2NBUA 3MJWA 2KWDA 1HE8A 3I3TB 2A4ZA 1XT9B 4E71A 4IM3A 3UIOB 1VLBA 3O13A 4IWQA 5KHOA 2BB6A 4M8NA 4MDKE 1RFKA 3KWLA 4US9A 1L4ZB 2KX3A 1OTRB 1TBEA 1WJ6A 3JSVB 3WIMA 2C9WB 4LDTB 4ANUA 5FR3A 2INDC 2KQSA 2GBMA 4ZRJA 3QK0A 2ZPNA 2KT7A 5BYSA 4HWIB 4A3OA 2QHOA 3RNFC 4HJKA 4DK5A 4G0NB 3Q3MC 4R3DA 2MP2A 5D3IB 3LYYA 1QOBA 1OEYA 4OZCA 2L0TA 1FEHA 4H2AA 1SE3A 2EKIA 1ZUD2 3NG0A 1MJDA 1V8CA 1TKGA 2NPTA 4GOCA 1WXMA 4KVGB 2RDHA 1XQQA 1FNVA 3V6CB 3ZW3A 2JXXA 2JZ3B 3B08A 1EWYC 3B2GA 4JWSC 4KKJA 1L0YB 1WMHB 4ZRKA 3RCZA 1TY2A 1I42A 1YNTE 3PRZA 1WXVA 3EHVA 1P1AA 4XZ4A 1N60A 2O2VB 4A55A 3APFA 2WDRB 3H7PB 3DBRB 2CJNA 5C1ZA 3PO0A 2L05A 4NZLB 2KDFB 3ZUNA 2DZKA 4OW0A
chains in the Genus database with same CATH topology
1GC7A 2DHZA 3DPDA 4MGIE 4ICUA 4E3CA 3A33B 4MJSA 2CKHB 2REXA 3A1QA 2HD5B 4HVBA 3JYUA 4DHJD 4NQKE 3AU4A 2M17A 1WGDA 3TCAA 2ZEQA 3ENEA 5DPWA 1ZW7A 3ZNHB 4BOZB 4WAAA 3CSFA 3IFWB 1LQBA 5LLIA 2BF8B 3Q3JA 3AI5A 4PYZA 2JUOA 4W9LA 2A5UA 2BWFA 5CX3A 2KD0A 3CMMB 4IWPA 3SU8X 2KLGA 5E6PA 4LCDE 1WI0A 2ZJDA 1C3TA 2PE9A 1WFYA 2KANA 4LDTD 1Q5WB 4URKA 4ANVA 2V3SA 3PT2B 4GGQA 3ZTCA 5D6JB 2KLCA 2CS4A 3DDCB 4GB9A 2NCNA 2C7HA 2IY0B 2AL6A 3R7QA 3HHMA 4TKNA 1V2YA 2FIDA 4P7IA 3RULA 2RR9A 3PV1A 1MG8A 2I1JA 1KLVA 4F8CB 2BYVE 2K25A 3IG3A 4NJ7A 4TUUA 5IA7A 1TTNA 3WALA 4II3B 5BO4B 5G2NA 3VH3B 2DAFA 2K1FA 2L00B 2RPQA 2CR5A 2OOBB 4PYUA 3QWZB 2IY1B 4BKGA 4BOSC 2UWQA 2KNBA 3A1QB 2AEHA 4EOYA 3PHXB 3QQ8B 1V49A 3N32A 1E5WA 2ZNVB 4G3XB 3V61A 1WZ0A 3VFKA 1KOTA 3APCA 3M63B 3SD5A 2LJ5A 1YIWA 2KWUB 5J2RA 2DENB 4NAWB 3VTUA 5CHWA 5G55A 2FCSA 2O6VD 3VVWB 4AOFA 2KVRA 3V60A 2C7MB 5FR6A 3ZNZB 2LASA 2G4SA 3QIJA 3V62A 3W1SA 1J19A 2UYZB 1E8YA 4TV3A 4WJPA 2FIFA 4FHJA 3JVZX 1OGWA 3DVNU 3O65B 3GOEA 1QZEA 4ANWA 3PLUA 1WZ3A 3QCAA 2LD9A 3ALBA 3PREA 4MM3A 4NPNA 3U7DA 5L83A 2DYBA 4ZRIA 3TL5A 1RAXA 4AWJA 1WMHA 5L95C 4DDGD 1WX7A 3RZFA 1SE9A 2KWVB 1UELA 2Z0DB 2Z0EB 4G50A 4W9GA 3ZKJC 3QX1A 2KFKB 5TR5A 3ZO5B 4A20A 2LVQA 2N9EB 2XK5A 1UBIA 2LVOA 4EFOA 4IC7B 1V6EA 2KOXA 3MTNB 1E8XA 4W9JA 1OEYJ 1WYWB 4RM8A 4I6PA 1XD3B 4BBNF 4MELA 3PPAA 4GSWA 4MH0E 1GJZA 2NR2A 5EDSA 1ZKHA 2JRHA 3NZUA 4W9FA 1H8CA 2ASQA 3RYTA 4IW0A 3QA8A 4HLEA 1WJUA 2MRPA 3KYCD 4F7ZA 4XC2A 1R4NI 4JIOU 5JZEB 4K7WA 3R66C 3K9OB 1TGZB 2R2QA 1JRUA 3S2AA 2G3QB 3W1YA 4WWPA 3X23A 5D2MB 5AZFA 1NI2A 4KDLB 2N1WA 3A9JB 1PQSA 3JSVA 1P9DU 2D10A 1L2NA 5HKHA 1FXTB 2IBIB 2KTRB 2W9NA 3KUZA 3N3KB 3VTWA 2M4NA 3Q3FA 2RGFA 2ZNVC 2WDTB 1Y8RC 4TQ0A 2DYMA 3OLMD 2BYEA 4W9CA 5J17A 3ML8A 5GMVA 4ASWC 1WH3A 2ZVNA 1LFDA 2O6VA 2XK5B 2I1KA 4TQ1A 3LJ3A 2LGXA 3IHPC 3L16A 1S1QB 4GIVA 2BGFA 3DVNV 3C0RB 4W9EA 2HJ8A 3N30A 3WA0A 2Z59B 2DYOA 2PE6B 4IUMB 5AEKB 3A4SC 3UQAA 3V6EB 3EECA 2FAZA 2GMIC 2KN5A 2KTFA 2KDIA 4DHJB 1WGYA 2LVPA 4B9KA 2LRUA 3KUCB 3VHTC 3EC8A 1Z2MA 1WM3A 2RD0A 1EO6A 4GXBA 4GMVA 3M62B 4IG7B 2AL3A 3PSEB 4GDLA 4FN2A 3TJPA 1J0GA 2J0KA 3ZNGC 3EFUA 1Q1OA 4K7SA 1SIFA 5DPSA 3WAMA 4JGHB 2K6DB 4WQOB 3ZRCA 2FNJB 1CMXB 2L0FA 2BKRB 3APDA 1WIAA 1P0RA 3UQBA 3B1LX 2KO3A 5JH5C 2HTHA 1YJ1A 4OVUA 1G6JA 2FCQA 2K8CA 2EMTA 4B95A 3VUWA 4MGYE 3DCGA 3WAPA 4KIKB 5IAAC 1I35A 2PEAA 3DVGY 3VQIA 3A9KB 1WM2A 3R7RA 2K8BA 4KV2A 2LWPA 2KHWB 2BYFA 5JHAA 2K39A 2JT4B 2L3ZA 2MP2B 3DQVA 3T9LA 2NBVB 1RRBA 4KZ0A 3QJZA 4HPLB 1X1MA 1WGGA 3L10B 1WX8A 1D3ZA 3VUXA 4RMAA 1WX9A 1WR6E 3VDZA 4WJNA 1P3QU 2KX0A 1V86A 2N9XA 2LGDA 2EMSA 2LUEA 4BVUC 2HE7A 1IPGA 2GBNA 1WJ4A 1YX5B 3ZDTA 3TIXA 1UGMA 4KDIC 2D07B 2KFKA 2LXAA 3M3JA 3ONSA 4II2B 5DPRA 4EUTA 1ISNA 3KH0A 2M0XA 1E8WA 1LM8B 4W9KA 2LZ6A 4GDLB 4KSKC 4MSQB 4F1SA 1GG3A 1RFAA 4K1RB 2WX0A 2KDBA 3TBLD 1GC6A 2MW5A 3NY5A 4PS3A 1YD8U 1UBQA 3H1UA 3QHTA 4BKSD 3PGEA 2JRIB 4DXAB 2KMCA 2C60A 4FA6A 2KMAA 3NZSA 1LXDA 4DWFA 2XBBC 4PS7A 3AU5A 2L8JA 3W1SC 4M8MA 1IP9A 4W9HA 3RT3B 5D7GA 3L0WB 5AZHA 2FCMA 4GDKA 2BPSA 4NNJB 2KXJA 2KJHB 2KJRA 3IBEA 1WRDB 2DX5B 3VH4B 2G45B 2RSUA 3P2BA 5KHQA 3DOWA 2KKCA 2B3AA 1Q0WB 2IO2B 1E90A 2CHWA 2MA9B 4EKUA 1ZGUB 1NBFC 2DZIA 3SHQA 3VTVA 2WX1A 2KQ7A 4MGZE 1WGHA 1V5OA 4I6NB 5AZGA 3NS8A 1V5TA 2KTRA 3PRMB 2OJRA 2YVCA 4N9F4 1KJTA 5LXIB 1T0YA 2LI5A 2MWSB 2JY6A 4MSMB 1WE6A 2JZZA 4J6IA 3X0WA 1KM7A 4JLCA 3ZVVA 1IYFA 1VCBA 1A5RA 2IYDB 1Z5SB 3DBLI 1TZ1A 3HM3A 3NHEB 5LXHA 4FBJB 2KZRA 2M8SA 3BY4B 3H9DA 3PRPB 1U4AA 4FJYA 2M1MA 4BBNC 2DAJA 3IVFA 2BWES 4PS8A 2G4DB 4WWOA 2AWTA 2ZCBA 2K6QA 4GDKB 1M94A 2YLMA 5CHFA 2N7DA 3KUDB 3ZIMA 2NPTB 1UD7A 3L08A 4FHKA 4LJOB 1V9JA 2D3GA 2MBEA 2MSED 4HK2A 3OJ4B 4WJOA 2NBWB 3SDLC 2EKEC 2IO3B 4FLHA 4BKSA 2IO1B 3ML9A 2MX2A 2GBRA 2WWZA 3UINB 3VUYA 3CSTA 3WAOA 2MBQA 2J0MA 3B0AA 5CTRC 4MJSB 1YQBA 1GUAB 3ZLZA 2CU1A 4WJQA 3KVFB 3GZNI 4A3PA 3D32A 5DCNA 3DBHI 4MGKE 4DDID 2GOWA 3LDZE 3H7SA 3U30A 1WGRA 1E8ZA 5DPTA 4FULA 4KSLC 1YX6B 3VXWA 3H7PA 3MHSD 1V80A 4FADA 2GBJA 4HXDA 3A4RA 2C5LC 3OAWA 3BINA 4X57B 4BKTA 2MQJA 2O2VA 2KWCA 4AJYB 3U8ZA 3RUIB 2PJHA 4HDQA 2N7EA 2NBUA 3MJWA 2JVCA 1HE8A 2KK8A 1RLFA 1NDDA 1UZXB 2J0JA 3DVGX 3I3TB 3M95A 3H6NA 2NVUI 3WANA 2JF5A 4KIKA 2A4ZA 2LGYA 1XT9B 1WY8A 2WYQA 4IM3A 2MCNB 2NS5A 3UIOB 3UIPB 3VAWA 3ZRFA 4E71A 4ANXA 1EF5A 4IWQA 5KHOA 4B6WA 2ZCCA 2KFJA 2KC1A 3JW0X 2L76A 4MDKE 4M8NA 1EUVB 2N9PC 4RM9A 3UGBB 5D94A 4EEWA 4CYEA 4OVVA 1R4MI 1E7VA 1F9JA 1L7YA 4HCNB 3ECIA 1BT0A 4ZDVA 3L54A 4IM2A 1WE7A 4JL9A 4NY0A 2FUHB 2KX3A 3PS6A 1OTRB 1WXAA 1OQYA 1WXSA 3R3MA 1TBEA 4GU2A 2K8HA 1WJ6A 3A9JA 3HM6X 3JSVB 3WIMA 4E74A 2C9WB 2CHXA 4LDTB 4XX5A 2KDEB 3A9KA 3UF8A 4G11A 3AXCA 4LJPB 4ANUA 3TMPB 4NQLB 3KW5B 1P98A 3KYDD 3L17A 4NJ6A 5CHVC 4HCPB 2MBHA 1SGHA 2N1VA 2KQSA 2GBMA 3OJ3A 2O6VB 4ZRJA 2VRRB 4EZJA 3QK0A 2ZPNA 4IWOA 4HWIB 1WJNA 2IZVB 2LRWA 2MBOA 2QHOA 2XEWA 3PVLA 5E6NA 5C23A 4A3OA 2Y5BB 4JQWC 4EZKA 3L13A 2ZZPB 4HJKA 4DK5A 4ZYNA 3DBRI 1GNUA 1S3SG 1UH6A 3PTFC 2JWZA 3PZDA 4G0NB 4DBGA 3HIZA 4AJWA 2MP2A 2JPHA 2J7QB 4ICVA 3QAQA 1OEYA 4DHZE 4CHKA 2L0TA 4EZLA 2FCNA 2V1YA 3QC8B 3AULA 4AP4C 2AYOB 3ZTDA 3PHWB 2NPTA 4GOCA 1WXMA 4YL8A 1C1YB 2D11A 2N4FA 2DZMA 4KVGB 1J8CA 2DZJA 5JHBA 4BFRA 1XQQA 1EF1A 3RZWC 3V6CB 3ZDMC 2MBBB 1WF9A 3ZW3A 2L7RA 4MEMA 4GN1A 4M0WB 4FJZA 2R2OA 4I6LB 3DBSA 1WR1A 2JXXA 2JZ3B 3HK0A 4NAWA 4DHZB 3B08A 3QARA 4IM0A 2GBKA 4KZCA 3RD2A 4FJVB 1WMHB 4W9IA 2PPHA 4ZRKA 3RCZA 2BKFA 2V4LA 1H4RA 1I42A 2CHZA 4K81A 2LXCA 3PLVA 4W9DA 1VD2A 3PRZA 4CO7A 1WXVA 3EHVA 2ZVOA 1P1AA 4XZ4A 2C7NB 2O2VB 3NOBA 2MLBA 3APFA 1V81A 1E7UA 2D2QA 3H7PB 5J18A 2ZPYA 2KJ6A 5E6OA 4HPMB 1K8RB 5C1ZA 3T8MA 1AARA 4WWNA 3CF6E 2KC2A 3ZUNA 2IO0B 4AUQC 3K9PB 2L05A 4K7UA 2KDFB 3ZNID 4HDOA 2DZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GC7 A;  2DHZ A;  3DPD A;  4MGI E;  4ICU A;  4E3C A;  3A33 B;  4MJS A;  2CKH B;  2REX A;  3A1Q A;  2HD5 B;  4HVB A;  3JYU A;  4DHJ D;  4NQK E;  3AU4 A;  2M17 A;  1WGD A;  3TCA A;  2ZEQ A;  3ENE A;  5DPW A;  1ZW7 A;  3ZNH B;  4BOZ B;  4WAA A;  3CSF A;  3IFW B;  1LQB A;  5LLI A;  2BF8 B;  3Q3J A;  3AI5 A;  4PYZ A;  2JUO A;  4W9L A;  2A5U A;  2BWF A;  5CX3 A;  2KD0 A;  3CMM B;  4IWP A;  3SU8 X;  2KLG A;  5E6P A;  4LCD E;  1WI0 A;  2ZJD A;  1C3T A;  2PE9 A;  1WFY A;  2KAN A;  4LDT D;  1Q5W B;  4URK A;  4ANV A;  2V3S A;  3PT2 B;  4GGQ A;  3ZTC A;  5D6J B;  2KLC A;  2CS4 A;  3DDC B;  4GB9 A;  2NCN A;  2C7H A;  2IY0 B;  2AL6 A;  3R7Q A;  3HHM A;  4TKN A;  1V2Y A;  2FID A;  4P7I A;  3RUL A;  2RR9 A;  3PV1 A;  1MG8 A;  2I1J A;  1KLV A;  4F8C B;  2BYV E;  2K25 A;  3IG3 A;  4NJ7 A;  4TUU A;  5IA7 A;  1TTN A;  3WAL A;  4II3 B;  5BO4 B;  5G2N A;  3VH3 B;  2DAF A;  2K1F A;  2L00 B;  2RPQ A;  2CR5 A;  2OOB B;  4PYU A;  3QWZ B;  2IY1 B;  4BKG A;  4BOS C;  2UWQ A;  2KNB A;  3A1Q B;  2AEH A;  4EOY A;  3PHX B;  3QQ8 B;  1V49 A;  3N32 A;  1E5W A;  2ZNV B;  4G3X B;  3V61 A;  1WZ0 A;  3VFK A;  1KOT A;  3APC A;  3M63 B;  3SD5 A;  2LJ5 A;  1YIW A;  2KWU B;  5J2R A;  2DEN B;  4NAW B;  3VTU A;  5CHW A;  5G55 A;  2FCS A;  2O6V D;  3VVW B;  4AOF A;  2KVR A;  3V60 A;  2C7M B;  5FR6 A;  3ZNZ B;  2LAS A;  2G4S A;  3QIJ A;  3V62 A;  3W1S A;  1J19 A;  2UYZ B;  1E8Y A;  4TV3 A;  4WJP A;  2FIF A;  4FHJ A;  3JVZ X;  1OGW A;  3DVN U;  3O65 B;  3GOE A;  1QZE A;  4ANW A;  3PLU A;  1WZ3 A;  3QCA A;  2LD9 A;  3ALB A;  3PRE A;  4MM3 A;  4NPN A;  3U7D A;  5L83 A;  2DYB A;  4ZRI A;  3TL5 A;  1RAX A;  4AWJ A;  1WMH A;  5L95 C;  4DDG D;  1WX7 A;  3RZF A;  1SE9 A;  2KWV B;  1UEL A;  2Z0D B;  2Z0E B;  4G50 A;  4W9G A;  3ZKJ C;  3QX1 A;  2KFK B;  5TR5 A;  3ZO5 B;  4A20 A;  2LVQ A;  2N9E B;  2XK5 A;  1UBI A;  2LVO A;  4EFO A;  4IC7 B;  1V6E A;  2KOX A;  3MTN B;  1E8X A;  4W9J A;  1OEY J;  1WYW B;  4RM8 A;  4I6P A;  1XD3 B;  4BBN F;  4MEL A;  3PPA A;  4GSW A;  4MH0 E;  1GJZ A;  2NR2 A;  5EDS A;  1ZKH A;  2JRH A;  3NZU A;  4W9F A;  1H8C A;  2ASQ A;  3RYT A;  4IW0 A;  3QA8 A;  4HLE A;  1WJU A;  2MRP A;  3KYC D;  4F7Z A;  4XC2 A;  1R4N I;  4JIO U;  5JZE B;  4K7W A;  3R66 C;  3K9O B;  1TGZ B;  2R2Q A;  1JRU A;  3S2A A;  2G3Q B;  3W1Y A;  4WWP A;  3X23 A;  5D2M B;  5AZF A;  1NI2 A;  4KDL B;  2N1W A;  3A9J B;  1PQS A;  3JSV A;  1P9D U;  2D10 A;  1L2N A;  5HKH A;  1FXT B;  2IBI B;  2KTR B;  2W9N A;  3KUZ A;  3N3K B;  3VTW A;  2M4N A;  3Q3F A;  2RGF A;  2ZNV C;  2WDT B;  1Y8R C;  4TQ0 A;  2DYM A;  3OLM D;  2BYE A;  4W9C A;  5J17 A;  3ML8 A;  5GMV A;  4ASW C;  1WH3 A;  2ZVN A;  1LFD A;  2O6V A;  2XK5 B;  2I1K A;  4TQ1 A;  3LJ3 A;  2LGX A;  3IHP C;  3L16 A;  1S1Q B;  4GIV A;  2BGF A;  3DVN V;  3C0R B;  4W9E A;  2HJ8 A;  3N30 A;  3WA0 A;  2Z59 B;  2DYO A;  2PE6 B;  4IUM B;  5AEK B;  3A4S C;  3UQA A;  3V6E B;  3EEC A;  2FAZ A;  2GMI C;  2KN5 A;  2KTF A;  2KDI A;  4DHJ B;  1WGY A;  2LVP A;  4B9K A;  2LRU A;  3KUC B;  3VHT C;  3EC8 A;  1Z2M A;  1WM3 A;  2RD0 A;  1EO6 A;  4GXB A;  4GMV A;  3M62 B;  4IG7 B;  2AL3 A;  3PSE B;  4GDL A;  4FN2 A;  3TJP A;  1J0G A;  2J0K A;  3ZNG C;  3EFU A;  1Q1O A;  4K7S A;  1SIF A;  5DPS A;  3WAM A;  4JGH B;  2K6D B;  4WQO B;  3ZRC A;  2FNJ B;  1CMX B;  2L0F A;  2BKR B;  3APD A;  1WIA A;  1P0R A;  3UQB A;  3B1L X;  2KO3 A;  5JH5 C;  2HTH A;  1YJ1 A;  4OVU A;  1G6J A;  2FCQ A;  2K8C A;  2EMT A;  4B95 A;  3VUW A;  4MGY E;  3DCG A;  3WAP A;  4KIK B;  5IAA C;  1I35 A;  2PEA A;  3DVG Y;  3VQI A;  3A9K B;  1WM2 A;  3R7R A;  2K8B A;  4KV2 A;  2LWP A;  2KHW B;  2BYF A;  5JHA A;  2K39 A;  2JT4 B;  2L3Z A;  2MP2 B;  3DQV A;  3T9L A;  2NBV B;  1RRB A;  4KZ0 A;  3QJZ A;  4HPL B;  1X1M A;  1WGG A;  3L10 B;  1WX8 A;  1D3Z A;  3VUX A;  4RMA A;  1WX9 A;  1WR6 E;  3VDZ A;  4WJN A;  1P3Q U;  2KX0 A;  1V86 A;  2N9X A;  2LGD A;  2EMS A;  2LUE A;  4BVU C;  2HE7 A;  1IPG A;  2GBN A;  1WJ4 A;  1YX5 B;  3ZDT A;  3TIX A;  1UGM A;  4KDI C;  2D07 B;  2KFK A;  2LXA A;  3M3J A;  3ONS A;  4II2 B;  5DPR A;  4EUT A;  1ISN A;  3KH0 A;  2M0X A;  1E8W A;  1LM8 B;  4W9K A;  2LZ6 A;  4GDL B;  4KSK C;  4MSQ B;  4F1S A;  1GG3 A;  1RFA A;  4K1R B;  2WX0 A;  2KDB A;  3TBL D;  1GC6 A;  2MW5 A;  3NY5 A;  4PS3 A;  1YD8 U;  1UBQ A;  3H1U A;  3QHT A;  4BKS D;  3PGE A;  2JRI B;  4DXA B;  2KMC A;  2C60 A;  4FA6 A;  2KMA A;  3NZS A;  1LXD A;  4DWF A;  2XBB C;  4PS7 A;  3AU5 A;  2L8J A;  3W1S C;  4M8M A;  1IP9 A;  4W9H A;  3RT3 B;  5D7G A;  3L0W B;  5AZH A;  2FCM A;  4GDK A;  2BPS A;  4NNJ B;  2KXJ A;  2KJH B;  2KJR A;  3IBE A;  1WRD B;  2DX5 B;  3VH4 B;  2G45 B;  2RSU A;  3P2B A;  5KHQ A;  3DOW A;  2KKC A;  2B3A A;  1Q0W B;  2IO2 B;  1E90 A;  2CHW A;  2MA9 B;  4EKU A;  1ZGU B;  1NBF C;  2DZI A;  3SHQ A;  3VTV A;  2WX1 A;  2KQ7 A;  4MGZ E;  1WGH A;  1V5O A;  4I6N B;  5AZG A;  3NS8 A;  1V5T A;  2KTR A;  3PRM B;  2OJR A;  2YVC A;  4N9F 4;  1KJT A;  5LXI B;  1T0Y A;  2LI5 A;  2MWS B;  2JY6 A;  4MSM B;  1WE6 A;  2JZZ A;  4J6I A;  3X0W A;  1KM7 A;  4JLC A;  3ZVV A;  1IYF A;  1VCB A;  1A5R A;  2IYD B;  1Z5S B;  3DBL I;  1TZ1 A;  3HM3 A;  3NHE B;  5LXH A;  4FBJ B;  2KZR A;  2M8S A;  3BY4 B;  3H9D A;  3PRP B;  1U4A A;  4FJY A;  2M1M A;  4BBN C;  2DAJ A;  3IVF A;  2BWE S;  4PS8 A;  2G4D B;  4WWO A;  2AWT A;  2ZCB A;  2K6Q A;  4GDK B;  1M94 A;  2YLM A;  5CHF A;  2N7D A;  3KUD B;  3ZIM A;  2NPT B;  1UD7 A;  3L08 A;  4FHK A;  4LJO B;  1V9J A;  2D3G A;  2MBE A;  2MSE D;  4HK2 A;  3OJ4 B;  4WJO A;  2NBW B;  3SDL C;  2EKE C;  2IO3 B;  4FLH A;  4BKS A;  2IO1 B;  3ML9 A;  2MX2 A;  2GBR A;  2WWZ A;  3UIN B;  3VUY A;  3CST A;  3WAO A;  2MBQ A;  2J0M A;  3B0A A;  5CTR C;  4MJS B;  1YQB A;  1GUA B;  3ZLZ A;  2CU1 A;  4WJQ A;  3KVF B;  3GZN I;  4A3P A;  3D32 A;  5DCN A;  3DBH I;  4MGK E;  4DDI D;  2GOW A;  3LDZ E;  3H7S A;  3U30 A;  1WGR A;  1E8Z A;  5DPT A;  4FUL A;  4KSL C;  1YX6 B;  3VXW A;  3H7P A;  3MHS D;  1V80 A;  4FAD A;  2GBJ A;  4HXD A;  3A4R A;  2C5L C;  3OAW A;  3BIN A;  4X57 B;  4BKT A;  2MQJ A;  2O2V A;  2KWC A;  4AJY B;  3U8Z A;  3RUI B;  2PJH A;  4HDQ A;  2N7E A;  2NBU A;  3MJW A;  2JVC A;  1HE8 A;  2KK8 A;  1RLF A;  1NDD A;  1UZX B;  2J0J A;  3DVG X;  3I3T B;  3M95 A;  3H6N A;  2NVU I;  3WAN A;  2JF5 A;  4KIK A;  2A4Z A;  2LGY A;  1XT9 B;  1WY8 A;  2WYQ A;  4IM3 A;  2MCN B;  2NS5 A;  3UIO B;  3UIP B;  3VAW A;  3ZRF A;  4E71 A;  4ANX A;  1EF5 A;  4IWQ A;  5KHO A;  4B6W A;  2ZCC A;  2KFJ A;  2KC1 A;  3JW0 X;  2L76 A;  4MDK E;  4M8N A;  1EUV B;  2N9P C;  4RM9 A;  3UGB B;  5D94 A;  4EEW A;  4CYE A;  4OVV A;  1R4M I;  1E7V A;  1F9J A;  1L7Y A;  4HCN B;  3ECI A;  1BT0 A;  4ZDV A;  3L54 A;  4IM2 A;  1WE7 A;  4JL9 A;  4NY0 A;  2FUH B;  2KX3 A;  3PS6 A;  1OTR B;  1WXA A;  1OQY A;  1WXS A;  3R3M A;  1TBE A;  4GU2 A;  2K8H A;  1WJ6 A;  3A9J A;  3HM6 X;  3JSV B;  3WIM A;  4E74 A;  2C9W B;  2CHX A;  4LDT B;  4XX5 A;  2KDE B;  3A9K A;  3UF8 A;  4G11 A;  3AXC A;  4LJP B;  4ANU A;  3TMP B;  4NQL B;  3KW5 B;  1P98 A;  3KYD D;  3L17 A;  4NJ6 A;  5CHV C;  4HCP B;  2MBH A;  1SGH A;  2N1V A;  2KQS A;  2GBM A;  3OJ3 A;  2O6V B;  4ZRJ A;  2VRR B;  4EZJ A;  3QK0 A;  2ZPN A;  4IWO A;  4HWI B;  1WJN A;  2IZV B;  2LRW A;  2MBO A;  2QHO A;  2XEW A;  3PVL A;  5E6N A;  5C23 A;  4A3O A;  2Y5B B;  4JQW C;  4EZK A;  3L13 A;  2ZZP B;  4HJK A;  4DK5 A;  4ZYN A;  3DBR I;  1GNU A;  1S3S G;  1UH6 A;  3PTF C;  2JWZ A;  3PZD A;  4G0N B;  4DBG A;  3HIZ A;  4AJW A;  2MP2 A;  2JPH A;  2J7Q B;  4ICV A;  3QAQ A;  1OEY A;  4DHZ E;  4CHK A;  2L0T A;  4EZL A;  2FCN A;  2V1Y A;  3QC8 B;  3AUL A;  4AP4 C;  2AYO B;  3ZTD A;  3PHW B;  2NPT A;  4GOC A;  1WXM A;  4YL8 A;  1C1Y B;  2D11 A;  2N4F A;  2DZM A;  4KVG B;  1J8C A;  2DZJ A;  5JHB A;  4BFR A;  1XQQ A;  1EF1 A;  3RZW C;  3V6C B;  3ZDM C;  2MBB B;  1WF9 A;  3ZW3 A;  2L7R A;  4MEM A;  4GN1 A;  4M0W B;  4FJZ A;  2R2O A;  4I6L B;  3DBS A;  1WR1 A;  2JXX A;  2JZ3 B;  3HK0 A;  4NAW A;  4DHZ B;  3B08 A;  3QAR A;  4IM0 A;  2GBK A;  4KZC A;  3RD2 A;  4FJV B;  1WMH B;  4W9I A;  2PPH A;  4ZRK A;  3RCZ A;  2BKF A;  2V4L A;  1H4R A;  1I42 A;  2CHZ A;  4K81 A;  2LXC A;  3PLV A;  4W9D A;  1VD2 A;  3PRZ A;  4CO7 A;  1WXV A;  3EHV A;  2ZVO A;  1P1A A;  4XZ4 A;  2C7N B;  2O2V B;  3NOB A;  2MLB A;  3APF A;  1V81 A;  1E7U A;  2D2Q A;  3H7P B;  5J18 A;  2ZPY A;  2KJ6 A;  5E6O A;  4HPM B;  1K8R B;  5C1Z A;  3T8M A;  1AAR A;  4WWN A;  3CF6 E;  2KC2 A;  3ZUN A;  2IO0 B;  4AUQ C;  3K9P B;  2L05 A;  4K7U A;  2KDF B;  3ZNI D;  4HDO A;  2DZK A; 
#chains in the Genus database with same CATH topology
 2DHZ A;  4E3C A;  4P1C C;  3A33 B;  2GRI A;  4HVB A;  1K53 A;  1T3Q A;  3AU4 A;  1WGD A;  3TCA A;  1ZW7 A;  3IFW B;  4ITK A;  3NS1 A;  4YSY B;  3SR6 A;  4W9L A;  3R8B A;  2J53 A;  5CX3 A;  2KD0 A;  4IWP A;  1EU3 A;  4M01 A;  5BMI A;  1C3T A;  1IBX A;  2PE9 A;  1HZ5 A;  4ANV A;  4GGQ A;  3ZTC A;  1GAQ B;  1NVI D;  1PGX A;  4DXF A;  2C7H A;  3FIL B;  2AL6 A;  2BT6 A;  2WXM A;  1V2Y A;  4KGS A;  4EE2 A;  1FD6 A;  4RF0 A;  1KLV A;  2BYV E;  4C56 C;  2L00 B;  4TMA B;  3Q3O C;  4YTP B;  1HXY D;  1YJJ A;  2IY1 B;  2UWQ A;  3A1Q B;  3PHX B;  4ZOH C;  1DYQ A;  2ZNV B;  3N1X C;  1KOT A;  1YIW A;  2DEN B;  1UGJ A;  2GLS A;  4P16 A;  2FCS A;  3VVW B;  2UU7 A;  3V60 A;  1SEB D;  3I57 A;  1XLP A;  5TSS A;  5BYQ A;  2LAS A;  4IOI E;  2VH2 A;  3URY A;  1E8Y A;  3N9Y C;  1YJI A;  1OGW A;  1UUP A;  1QZE A;  3PLU A;  3QCA A;  3PRE A;  3U7D A;  3IXS A;  1ET9 A;  2DYB A;  4ZRI A;  1WX7 A;  1N61 A;  1D5M C;  1ZDV A;  1UEL A;  2Z0D B;  4RGO S;  3ZKJ C;  1K50 A;  3QX1 A;  3ZO5 B;  2LVQ A;  3AE4 B;  5BMH A;  1XLO A;  2LVO A;  1VZ6 A;  3MTN B;  1QQR A;  4RM8 A;  2D5G A;  1YMH E;  3R2T A;  4BBN F;  4MEL A;  5EDS A;  2JRH A;  2ASQ A;  3RYT A;  4IW0 A;  4HLE A;  1SE2 A;  3DBL B;  4XC2 A;  4K7W A;  3SEB A;  4A90 A;  3W1Y A;  2R2Q A;  3S2A A;  2G3Q B;  2Z8L A;  3A9J B;  1PQS A;  5HKH A;  2JQR B;  2IBI B;  5AUK A;  2M4N A;  1JWA D;  2QIE B;  2WDT B;  4QAY A;  4LNI A;  3OLM D;  1FXI A;  3ML8 A;  4LLG M;  5IP4 D;  2ZVN A;  1LFD A;  2O6V A;  3NZ3 A;  1F1H A;  3LJ3 A;  4XGA B;  1S1Q B;  2BGF A;  3DVN V;  1IGC A;  4W9E A;  1FM0 D;  3UQA A;  2PE6 B;  4YTN B;  3U52 E;  2FAZ A;  4AQ7 A;  3AH7 A;  2GMI C;  1KF6 B;  1R4N B;  1JWM D;  2LRU A;  3KUC B;  4L1B A;  5JXV A;  1WM3 A;  2RD0 A;  2PW9 A;  1T0R C;  1EO6 A;  4IG7 B;  3TJP A;  1SJH D;  4JPS A;  4RGT A;  1QT9 A;  2J0K A;  1Q1O A;  4K7S A;  1SIF A;  4WQO B;  3ZRC A;  5HFY A;  2KQ4 X;  4DQO C;  3SFE B;  3EA6 A;  1HEZ E;  1F52 A;  2HTH A;  3J9C A;  2K8C A;  2RDB C;  5IAA C;  1I35 A;  2H88 B;  1FMA D;  2AQ2 B;  1JAL A;  1FFU A;  2KHW B;  1N6Z A;  2RPV A;  3DQV A;  1RRB A;  1WX8 A;  1WX9 A;  1WR6 E;  4WJN A;  1F77 A;  4ZHO A;  1P3Q U;  3L4P A;  1VZ7 A;  4RFB A;  2LGD A;  2EMS A;  2HE7 A;  1IPG A;  2KN4 A;  1YX5 B;  4JWU C;  1UGM A;  2D07 B;  2KFK A;  2LXA A;  1EM7 A;  1E8W A;  1LM8 B;  2WX0 A;  1ZE3 D;  1GC6 A;  5BYR A;  3RPF C;  3AEC B;  4PS3 A;  1OFF A;  1UBQ A;  3H1U A;  3QHT A;  4BKS D;  1KRH A;  4FA6 A;  2XBB C;  3W1S C;  1IP9 A;  1TKY A;  1WXQ A;  1LO5 D;  2DX5 B;  3VH4 B;  4N6E B;  3P2B A;  1YN5 A;  1MI0 A;  2RMM A;  1ZPS A;  2MA9 B;  2CJO A;  2WX1 A;  3VTV A;  4MGZ E;  1WGH A;  4I6N B;  2Y5P A;  5AZG A;  1T0Y A;  2MWS B;  3AN1 A;  2JY6 A;  3AE5 B;  1WE6 A;  2Y5C A;  2VZK B;  3X0W A;  3BVM A;  1VCB A;  1SXT A;  1J7C A;  2YEP B;  1Z5S B;  3H9D A;  2ACZ B;  3AE1 B;  3IVF A;  1V97 A;  2G4D B;  1TKE A;  2ZCB A;  2K6Q A;  1M94 A;  4HKZ E;  3AB5 A;  1I4X A;  2N7D A;  2L83 A;  3KUD B;  2NPT B;  4LJO B;  5T8I A;  1V1P A;  1E7P B;  3RNC C;  1BXT A;  1QOA A;  2EKE C;  2QCZ A;  2GBR A;  2WWZ A;  2MBQ A;  1JWU D;  2AQ1 B;  1ESF A;  4MJS B;  4M02 A;  2CU1 A;  3DWG C;  4A3P A;  3GZN I;  5DCN A;  3DBH I;  3H7S A;  2YEP F;  4FUL A;  1YX6 B;  3MHS D;  1DOX A;  2GBJ A;  2C5L C;  2V3N A;  2MQJ A;  4AJY B;  3RUI B;  2N7E A;  2PTL A;  3AE6 B;  2NVU I;  3WAN A;  5D3D A;  4WIP A;  2LGY A;  3NVZ A;  2NS5 A;  1N63 A;  1EF5 A;  4B6W A;  2ZCC A;  2KFJ A;  2KC1 A;  3JW0 X;  3UGB B;  2HJ1 A;  1ET6 A;  1E7V A;  1L7Y A;  3ECI A;  2LUM A;  5EE0 A;  4IM2 A;  4JL9 A;  2N0S B;  1C79 A;  1OQY A;  5FKA C;  3RMK C;  3R3M A;  2AX5 A;  3HM6 X;  1XXG A;  2WXK A;  2CHX A;  4XX5 A;  3A9K A;  3AXC A;  1FCL A;  3TMP B;  3L17 A;  4HCP B;  2MBH A;  1SGH A;  3OJ3 A;  2ONQ A;  1STE A;  1WJN A;  2LRW A;  3PVL A;  5E6N A;  2Y5B B;  4JQW C;  2PKO A;  3WCQ A;  3DBR I;  3AE7 B;  2WGS A;  1TS4 A;  4KGR A;  2JPH A;  1TS2 A;  3QAQ A;  4CHK A;  3FKY A;  1SB3 C;  2V1Y A;  4AP4 C;  1L5P A;  1TS5 A;  2AYO B;  1DGJ A;  3AE2 B;  3NVW A;  3IAS 1;  1UWX A;  4JE3 B;  4HRO A;  2DZM A;  1J8C A;  2FE8 A;  1EF1 A;  3W5U B;  2SAK A;  1WF9 A;  1YOV B;  2JZP A;  4MEM A;  3PZ7 A;  4FJZ A;  1WR1 A;  2WXO A;  3U2S C;  2MJD A;  2QMT A;  2BS3 B;  3RD2 A;  4AS1 A;  4FJV B;  4MT5 A;  1J7A A;  2VZK D;  2CHZ A;  1C76 A;  3NOB A;  2MLB A;  2KYW A;  2I38 A;  1I4P A;  3TSS A;  2KJ6 A;  4PT5 A;  4HPM B;  1XF5 L;  4PK1 A;  4WWN A;  2M19 A;  1ACC A;  4AUQ C;  3Q8E A;  4K7U A;  2CKH B;  3DPD A;  4ICU A;  3AEF B;  4MJS A;  4HEA 1;  2HD5 B;  2W55 A;  3SFD B;  4WAA A;  2DNF A;  2BF8 B;  2A5U A;  4A9A A;  2BWF A;  3MFG A;  3CMM B;  2KLG A;  1FIQ A;  1WFY A;  1SF0 A;  4URK A;  3PT2 B;  1C4P A;  2L32 A;  3DDC B;  3AM9 A;  1C4C A;  1VDV A;  2XN9 C;  1CQV A;  5G2N A;  3VH3 B;  2K1F A;  2RPQ A;  2CR5 A;  3QWZ B;  4BKG A;  2K3U A;  1SIJ A;  2KNB A;  2AEH A;  4EOY A;  4WAF A;  1V49 A;  3N32 A;  4G3X B;  3V61 A;  1P7E A;  2LJ5 A;  2QSD A;  2M56 B;  1PGA A;  2KVR A;  5FR6 A;  3HUI A;  2G4S A;  3QIJ A;  3V62 A;  3W1S A;  2INC C;  3OWE B;  4FHJ A;  3DVN U;  3O65 B;  1WZ3 A;  3ALB A;  1MG4 A;  3TL5 A;  1RAX A;  2QJL A;  1SE9 A;  4B0E A;  4A20 A;  1QIL A;  3H8H A;  2WS3 B;  4BAX A;  1UBI A;  3R2I A;  3FIL A;  1V6E A;  2KOX A;  4W9J A;  1OEY J;  2ZW1 A;  1YN3 A;  4I6P A;  1XD3 B;  3PPA A;  1BML C;  1ZKH A;  4RF1 A;  1H8C A;  4US8 A;  1NYQ A;  3QA8 A;  1WYG A;  2MRP A;  2INN E;  3R66 C;  4IKG A;  1TGZ B;  1JRU A;  3X23 A;  4HPP A;  4WWP A;  4KDL B;  2N1W A;  5BMG A;  3KUZ A;  3N3K B;  3NRZ A;  1EWC A;  4YT0 B;  2ZNV C;  1Y8R C;  4TQ0 A;  3RI7 C;  2DYM A;  3HVZ A;  5J17 A;  2BYE A;  2WXN A;  4ASW C;  1WH3 A;  4OVZ A;  2LGX A;  3IHP C;  1TS3 A;  1FNU A;  3WA0 A;  1EU4 A;  2DYO A;  2Z59 B;  4IUM B;  5AEK B;  1AW7 A;  2D3C A;  2K9X A;  3DHH C;  2KDI A;  1N5X A;  1WGY A;  3VHT C;  1Z2M A;  2Y3A A;  1SBB B;  2AL3 A;  1TIF A;  3ZNG C;  5H8Y E;  3WAM A;  4JGH B;  2FNJ B;  2L0F A;  3MP9 A;  2KO3 A;  1R4M B;  1YJ1 A;  2FCQ A;  4MH8 A;  2J4X A;  4B95 A;  3VUW A;  3DCG A;  1MFW A;  2PEA A;  1JWS D;  3VQI A;  3A9K B;  1WSP A;  2LWP A;  5FK9 C;  3DHG C;  5JHA A;  1FCC C;  4HPL B;  2V9H A;  1WGG A;  1NEN B;  1TYG B;  4RMA A;  3VDZ A;  5IKC M;  1V86 A;  2N9X A;  2NMQ A;  3T3N A;  3LXF A;  4II2 B;  1ISN A;  1PYW D;  4W9K A;  3KH0 A;  3ZJU A;  4GDL B;  4KSK C;  4MSQ B;  4F1S A;  1GG3 A;  3TBL D;  2JYE A;  2X38 A;  3C19 A;  1YD8 U;  1T0S C;  3IAM 1;  3PGE A;  2KMC A;  2KMA A;  3NZS A;  2LGI A;  5EE9 A;  3KQ4 A;  3AU5 A;  4M8M A;  3RT3 B;  2XNA C;  3L0W B;  2FCM A;  4GDK A;  5H92 C;  2ON8 A;  1JRO A;  2KJH B;  2KJR A;  2J42 A;  3IBE A;  1WRD B;  3MJ5 A;  2G45 B;  3DOW A;  1Q0W B;  1NI3 A;  1E90 A;  2CHW A;  4UDU C;  3SHQ A;  3OG5 A;  2KQ7 A;  2V0G A;  1V5O A;  3PRM B;  1V5T A;  2LI5 A;  1E10 A;  2CU3 A;  4YWG G;  4JLC A;  2IGD A;  3DWM A;  3I9V 1;  2KZR A;  3EGR A;  4DXG A;  4BBN C;  1V1O A;  2BWE S;  2AWT A;  4GDK B;  5CHF A;  2WLB A;  5GXG B;  3KLS X;  3ETR A;  2JX5 A;  2MBE A;  3BYY B;  3OJ4 B;  2J52 A;  2NBW B;  1TJE A;  3SDL C;  4J3O D;  4RNA A;  2IO3 B;  2LEK A;  4BKS A;  5IN7 A;  3ML9 A;  1Q10 A;  2MX2 A;  1D5Z C;  3NJT A;  3VUY A;  3FC4 A;  3UIN B;  3CST A;  3WAO A;  3AE3 B;  2J0M A;  5CTR C;  1GUA B;  2LMC A;  3ZLZ A;  5G5G A;  2HTM E;  5EE3 A;  3HRD D;  3TEW A;  2GOW A;  2K5P A;  3NVY A;  1WGR A;  3BK1 A;  3VXW A;  3H7P A;  4HXD A;  3A4R A;  4BKT A;  3BIN A;  2RDG A;  2KWC A;  4XDD A;  4RH6 A;  2JVC A;  4REZ A;  1NDD A;  1UZX B;  3DVG X;  2J0J A;  3M95 A;  2LHE A;  1KLU D;  2WYQ A;  4A6Q A;  3UIP B;  4ANX A;  1FRR A;  4EEW A;  2N9P C;  3FAH A;  4RM9 A;  1D5X C;  3ZXR A;  2B76 B;  2WDV B;  4ZDV A;  3L54 A;  1WE7 A;  4NY0 A;  2FUH B;  3PS6 A;  2WXG A;  1WXS A;  2WDQ B;  1YQ3 B;  3BVZ A;  3IT4 B;  4S17 A;  3N20 C;  4NJC A;  3W5V B;  3A9J A;  5I4D A;  2WXH A;  1ZDX A;  3UF8 A;  4NQL B;  3KW5 B;  2N1V A;  1WWT A;  2O6V B;  3E9S A;  4IWO A;  1FXA A;  2IZV B;  2MBO A;  2XEW A;  2N9L A;  3L13 A;  2KVZ A;  1S3S G;  1UH6 A;  3PTF C;  3PZD A;  1E6E B;  4K3B A;  3HIZ A;  4AJW A;  3U4E G;  5E6J A;  1WGK A;  4RCO A;  4EZL A;  1L0V B;  2FCN A;  3QC8 B;  1ZOY B;  5IO9 A;  2ZW0 A;  1JRP A;  1MHX A;  1C4A A;  1QOF A;  2WU5 B;  4YL8 A;  3KWV A;  2N4F A;  5JHB A;  4BFR A;  2L7R A;  4GN1 A;  4M0W B;  3Q8B A;  4I6L B;  3DBS A;  3HK0 A;  3VRA B;  4L23 A;  4C4V B;  1PFD A;  2TSS A;  4W9I A;  2PPH A;  3CIR B;  3GE3 C;  2V4L A;  1H4R A;  1MHH E;  4W9D A;  1VD2 A;  1M4V A;  1YQ4 B;  2IJ0 A;  2C7N B;  1V81 A;  2D2Q A;  5J18 A;  2ZPY A;  4NAM A;  3T8M A;  3CF6 E;  3K9P B;  1XCQ L;  4HDO A;  3I5J C;  1GC7 A;  1IUE A;  3A1Q A;  4HJG E;  1GB1 A;  4NQK E;  4ZRP A;  2W3S A;  2FBW B;  2ZEQ A;  3ENE A;  2BBC A;  4M00 A;  3ZNH B;  4BOZ B;  3CSF A;  3Q3J A;  3AI5 A;  1V1P B;  4PYZ A;  4WQM A;  1J7B A;  3LB8 C;  4XWT A;  3P4S B;  2QEJ C;  3MC9 A;  3SU8 X;  5E6P A;  4LCD E;  1WI0 A;  1FO4 A;  2KAN A;  4LDT D;  1Q5W B;  5D6J B;  4N58 A;  4GB9 A;  2L1A A;  2NCN A;  2AQ3 B;  2IY0 B;  3VRB B;  3HHM A;  3Q69 A;  1T0Q C;  4TKN A;  3ZJT A;  3PV1 A;  1MG8 A;  2I1J A;  2BW2 A;  2BS2 B;  4NJ7 A;  5IA7 A;  3WAL A;  1NEK B;  5G5H A;  5BO4 B;  3GP7 A;  3BVG A;  2BTE A;  1KFY B;  2OOB B;  3P1M A;  4P1B C;  4BOS C;  4LK0 M;  2E3T A;  3QQ8 B;  3IT6 B;  1E5W A;  3APC A;  3M63 B;  2KWU B;  5J2R A;  4NAW B;  1K51 A;  5G55 A;  2C7M B;  2DBY A;  1JML A;  1J19 A;  2UYZ B;  2IPK D;  1UNS A;  4USA A;  3Q6B A;  4TV3 A;  1FNW A;  2FIF A;  3ZJV A;  4ANW A;  1UWM A;  4NPN A;  1WMH A;  1KTK A;  3ZQ4 A;  5L95 C;  2Z0E B;  4C4V A;  2KFK B;  5TR5 A;  2GB1 A;  2XK5 A;  1R7S A;  4EFO A;  4IC7 B;  1CZP A;  1WYW B;  2WP9 B;  1GJZ A;  4W9F A;  2OHF A;  2INP E;  3Q14 C;  4O1N A;  4OZA A;  4MAC A;  4F7Z A;  4D2K A;  4WWM A;  1R4N I;  2W82 A;  1AYF A;  2M0A A;  1WRI A;  5AZF A;  3JSV A;  2WXQ A;  1P9D U;  2D10 A;  1FXT B;  3VTW A;  1JQ4 A;  2JU6 X;  2WXI A;  3BWU D;  3Q3F A;  4YSZ B;  2RGF A;  3W9C B;  1A70 A;  2I1K A;  4TQ1 A;  3C0R B;  1CK1 A;  2LGS A;  3N30 A;  1GOZ A;  3A4S C;  3V6E B;  1TZO A;  2KTF A;  3CWI A;  4B9K A;  4FXC A;  4WUR A;  3RN9 C;  4GMV A;  1QOG A;  3M62 B;  2WXJ A;  3PSE B;  3U7Z A;  1J0G A;  3EFC A;  4HRS A;  4K3C A;  1CMX B;  2BKR B;  3TEY A;  1WIA A;  1P0R A;  3UQB A;  3B1L X;  5JH5 C;  1G6J A;  2EMT A;  1VZ8 A;  1I7H A;  5LNK 1;  1C77 A;  3DVG Y;  1K52 A;  3AE8 B;  4KZ0 A;  1X1M A;  1XLN A;  3AE9 B;  3VUX A;  2KX0 A;  4BVU C;  4XWW A;  4ARC A;  1WJ4 A;  4ZYS A;  3ZDT A;  2DLB A;  3TIX A;  4JX1 C;  3M3J A;  3ONS A;  4EUT A;  1FPY A;  4RGN A;  2LZ6 A;  3MC0 B;  1RFA A;  4K1R B;  1PUT A;  2MW5 A;  2WXL A;  2LJI A;  4DXA B;  1LXD A;  1HZ6 A;  5D7G A;  5AZH A;  4YSX B;  2N7J A;  2PLP A;  2BPS A;  2NTT A;  2RSU A;  3UI3 A;  2B3A A;  2KKC A;  4EKU A;  1NBF C;  1I4Q A;  3NS8 A;  2KTR A;  2YVC A;  4N9F 4;  1KJT A;  4MSM B;  2JZZ A;  4J6I A;  4S0R A;  1KM7 A;  2H89 B;  2WXR A;  1OQQ A;  2IYD B;  3DBL I;  2WXF A;  3HM3 A;  2M8S A;  3PRP B;  4LNN A;  1U4A A;  2JSV X;  4FJY A;  2WQY B;  2M1M A;  1F2R I;  4WWO A;  1CJE A;  1HTQ A;  1ZP0 B;  3BII D;  3V05 A;  4LNK A;  1N62 A;  2YLM A;  1PGB A;  3L08 A;  1T5X D;  1QF6 A;  2WHI A;  1V9J A;  2D3G A;  1HTO A;  2QDF A;  2PMV A;  3MC8 A;  3TUO A;  4YXD B;  3VR8 B;  4OHJ A;  2GI9 A;  2LHD A;  3B0A A;  4C7Y A;  2DWQ A;  4HKQ A;  1FRD A;  4L2Y A;  4WJQ A;  3GS2 A;  3HVD A;  4C00 A;  3D32 A;  4MGK E;  2K0P A;  3U30 A;  4ZHP A;  1E8Z A;  5DPT A;  4KSL C;  2MH7 A;  1L6U A;  2KAC A;  5HI1 A;  1D4B A;  3OAW A;  4X57 B;  2O2V A;  3I63 C;  1ENF A;  3U8Z A;  2PJH A;  1RM6 C;  2W54 A;  1MVK A;  4BZA A;  2KK8 A;  1RLF A;  3H6N A;  2I2Y A;  2IDY A;  2JF5 A;  4KIK A;  1WY8 A;  2MCN B;  3VAW A;  3ZRF A;  3AEG B;  4M0W A;  2ICI A;  2L76 A;  3V3X A;  1EUV B;  3B2F A;  5D94 A;  1ROE A;  2BYT A;  4CYE A;  4OVV A;  1R4M I;  1F9J A;  1PDX A;  2V4I B;  4HCN B;  1JWB D;  1BT0 A;  3PZ8 A;  1WXA A;  1TY0 A;  3E56 A;  4GU2 A;  2K8H A;  4E74 A;  1F2R C;  2KDE B;  1RYJ A;  4G11 A;  4LJP B;  3GZN B;  1AWD A;  1P98 A;  3KYD D;  4NJ6 A;  5CHV C;  2JYT A;  2WXP A;  3GE8 C;  2VRR B;  4EZJ A;  5C23 A;  4EZK A;  3GB1 A;  2ZZP B;  4ZYN A;  1GNU A;  4Q2J A;  1FFV A;  2JWZ A;  4KX6 B;  4LNF A;  4DBG A;  4XE0 A;  2J7Q B;  1TT5 B;  4ICV A;  4DHZ E;  2BVC A;  2KAJ A;  3AUL A;  4LTU A;  3P42 A;  2G9H D;  3ZTD A;  3PHW B;  3B9J A;  1C1Y B;  2D11 A;  2DZJ A;  3RZW C;  3ZDM C;  2MBB B;  2D3B A;  4DHZ B;  2R2O A;  4NAW A;  5C3J B;  3QAR A;  2K22 A;  4IM0 A;  2GBK A;  4KZC A;  4KKI A;  2BKF A;  4OZB A;  1B1Z A;  2MJE A;  4K81 A;  2LXC A;  3PLV A;  4CO7 A;  3RNG C;  1VRA B;  2ZVO A;  1E9M A;  3P4P B;  1E7U A;  1QKZ A;  1T6B X;  5E6O A;  1K8R B;  1AAR A;  2KC2 A;  2IO0 B;  3ZXV A;  3ZNI D;  3RNE C;  1VR9 A;  4MGI E;  1F0Z A;  2LFI A;  2REX A;  4IDI A;  2IGH A;  3JYU A;  4DHJ D;  2OJW A;  1HA5 A;  2M17 A;  5DPW A;  2SEB D;  1LQB A;  5LLI A;  2JUO A;  1XEE A;  2PVG C;  1P7F A;  3TEZ A;  1GPX A;  2ZJD A;  3W2D A;  3NUH B;  2V3S A;  1I4R A;  2KLC A;  2CS4 A;  3R7Q A;  1B9R A;  3RUL A;  2FID A;  4P7I A;  1Y56 A;  2RR9 A;  3BK2 A;  4F8C B;  3AED B;  3T3O A;  2K25 A;  3IG3 A;  2R61 A;  4TUU A;  1TTN A;  2N9K A;  4II3 B;  2DAF A;  3N1Z C;  1ZXH A;  1JCK B;  4PYU A;  2QIL A;  1SE4 A;  1I4G A;  1YN4 A;  3AEE B;  1L6V A;  3N1Y C;  3VFK A;  1WZ0 A;  2MHJ A;  3SD5 A;  3VTU A;  1HQR D;  5CHW A;  1L4D B;  2O6V D;  1SSN A;  4AOF A;  2IGG A;  1ZXI A;  3ZNZ B;  1C78 A;  2EEL A;  2OED A;  4WJP A;  3JVZ X;  4XYC A;  2W3R A;  3GOE A;  4P6V F;  2LD9 A;  4MM3 A;  3P4Q B;  5L83 A;  4AWJ A;  4DDG D;  3RZF A;  2KWV B;  1NYR A;  3C8Y A;  4W9G A;  4G50 A;  3ZYY X;  2KMM A;  2N9E B;  2V3P A;  1E8X A;  1IBX B;  4GSW A;  4MH0 E;  2QC8 A;  2NR2 A;  3NZU A;  1E0Z A;  1JW9 D;  2X8X X;  1WJU A;  3KYC D;  4JIO U;  5JZE B;  3K9O B;  4ZRQ A;  5D2M B;  1NI2 A;  3Q8C A;  1L2N A;  2MEK A;  3P63 A;  2KTR B;  2W9N A;  3AV8 A;  1KH0 A;  4C7Z A;  3DBH B;  3AEA B;  3AMZ A;  4W9C A;  5GMV A;  2PIA A;  2XK5 B;  1AN8 A;  4GLS C;  4XDC A;  4GIV A;  3L16 A;  4CQN A;  1RWS A;  2HJ8 A;  3EUB 2;  2HDE A;  2NTS A;  3EEC A;  2KDM A;  3ZGZ A;  2KN5 A;  2FUG 1;  4DHJ B;  2LVP A;  3EC8 A;  4GXB A;  4GDL A;  4FN2 A;  3DHI C;  3EFU A;  3MHZ A;  4WH4 A;  1BUI C;  5DPS A;  1L0X B;  2K6D B;  5EE1 A;  3APD A;  2L52 A;  4OVU A;  5C2T B;  3TEX A;  4MGY E;  3RNA C;  3WAP A;  5IOI A;  2BS4 B;  4KIK B;  2E6X A;  1XLQ A;  1WM2 A;  3R7R A;  2K8B A;  4KV2 A;  1DOY A;  4LNO A;  2BYF A;  2K39 A;  2JT4 B;  2L3Z A;  2MP2 B;  1XO3 A;  3T9L A;  2NBV B;  1N5W A;  3QJZ A;  3L10 B;  3RNB C;  1D3Z A;  2LUE A;  2GBN A;  3BZD B;  4KDI C;  2WU2 B;  5DPR A;  1UF0 A;  4TSS A;  2M0X A;  1QLB B;  2KDB A;  2WNM A;  3RFZ B;  4KGT A;  2Q5W D;  3NY5 A;  4ACF A;  4MM3 B;  2BQQ A;  2JWU A;  2JRI B;  2C60 A;  3Q3N C;  3P4R B;  4DWF A;  4PS7 A;  2L8J A;  4W9H A;  4ARI A;  3NVV A;  4NNJ B;  2KXJ A;  2VH1 A;  5KHQ A;  2IO2 B;  3AEB B;  1ZGU B;  2DZI A;  1GB4 A;  2G1E A;  2OJR A;  1DOI A;  5LXI B;  3Q2A C;  1D6E C;  3ABV B;  1IGD A;  3ZVV A;  1IYF A;  1A5R A;  2MJ3 A;  1TZ1 A;  3NHE B;  5LXH A;  2BB5 A;  4FBJ B;  3BY4 B;  3Q8F A;  1SJE D;  2DAJ A;  4N59 A;  4PS8 A;  1XCT L;  3ZIM A;  1MPE A;  1UD7 A;  4FHK A;  1C9F A;  4A8X C;  2MSE D;  4HK2 A;  1VJK A;  2D3A A;  4WJO A;  1LGR A;  4FLH A;  2IO1 B;  2PVO D;  4B0M A;  5AUI A;  2JXT A;  1KLG D;  5HG2 A;  1YQB A;  3KVF B;  3BYT B;  4DDI D;  1OQR A;  3VR9 B;  3LDZ E;  5MPO A;  4C80 A;  4YTM B;  1V80 A;  4FAD A;  1I4H A;  3Q8A A;  5HHD G;  4HDQ A;  4RGM A;  2NBU A;  3MJW A;  2KWD A;  1HE8 A;  3I3T B;  2A4Z A;  1XT9 B;  4E71 A;  4IM3 A;  3UIO B;  1VLB A;  3O13 A;  4IWQ A;  5KHO A;  2BB6 A;  4M8N A;  4MDK E;  1RFK A;  3KWL A;  4US9 A;  1L4Z B;  2KX3 A;  1OTR B;  1TBE A;  1WJ6 A;  3JSV B;  3WIM A;  2C9W B;  4LDT B;  4ANU A;  5FR3 A;  2IND C;  2KQS A;  2GBM A;  4ZRJ A;  3QK0 A;  2ZPN A;  2KT7 A;  5BYS A;  4HWI B;  4A3O A;  2QHO A;  3RNF C;  4HJK A;  4DK5 A;  4G0N B;  3Q3M C;  4R3D A;  2MP2 A;  5D3I B;  3LYY A;  1QOB A;  1OEY A;  4OZC A;  2L0T A;  1FEH A;  4H2A A;  1SE3 A;  2EKI A;  1ZUD 2;  3NG0 A;  1MJD A;  1V8C A;  1TKG A;  2NPT A;  4GOC A;  1WXM A;  4KVG B;  2RDH A;  1XQQ A;  1FNV A;  3V6C B;  3ZW3 A;  2JXX A;  2JZ3 B;  3B08 A;  1EWY C;  3B2G A;  4JWS C;  4KKJ A;  1L0Y B;  1WMH B;  4ZRK A;  3RCZ A;  1TY2 A;  1I42 A;  1YNT E;  3PRZ A;  1WXV A;  3EHV A;  1P1A A;  4XZ4 A;  1N60 A;  2O2V B;  4A55 A;  3APF A;  2WDR B;  3H7P B;  3DBR B;  2CJN A;  5C1Z A;  3PO0 A;  2L05 A;  4NZL B;  2KDF B;  3ZUN A;  2DZK A;  4OW0 A; 
#chains in the Genus database with same CATH homology
 1GC7 A;  2DHZ A;  3DPD A;  4MGI E;  4ICU A;  4E3C A;  3A33 B;  4MJS A;  2CKH B;  2REX A;  3A1Q A;  2HD5 B;  4HVB A;  3JYU A;  4DHJ D;  4NQK E;  3AU4 A;  2M17 A;  1WGD A;  3TCA A;  2ZEQ A;  3ENE A;  5DPW A;  1ZW7 A;  3ZNH B;  4BOZ B;  4WAA A;  3CSF A;  3IFW B;  1LQB A;  5LLI A;  2BF8 B;  3Q3J A;  3AI5 A;  4PYZ A;  2JUO A;  4W9L A;  2A5U A;  2BWF A;  5CX3 A;  2KD0 A;  3CMM B;  4IWP A;  3SU8 X;  2KLG A;  5E6P A;  4LCD E;  1WI0 A;  2ZJD A;  1C3T A;  2PE9 A;  1WFY A;  2KAN A;  4LDT D;  1Q5W B;  4URK A;  4ANV A;  2V3S A;  3PT2 B;  4GGQ A;  3ZTC A;  5D6J B;  2KLC A;  2CS4 A;  3DDC B;  4GB9 A;  2NCN A;  2C7H A;  2IY0 B;  2AL6 A;  3R7Q A;  3HHM A;  4TKN A;  1V2Y A;  2FID A;  4P7I A;  3RUL A;  2RR9 A;  3PV1 A;  1MG8 A;  2I1J A;  1KLV A;  4F8C B;  2BYV E;  2K25 A;  3IG3 A;  4NJ7 A;  4TUU A;  5IA7 A;  1TTN A;  3WAL A;  4II3 B;  5BO4 B;  5G2N A;  3VH3 B;  2DAF A;  2K1F A;  2L00 B;  2RPQ A;  2CR5 A;  2OOB B;  4PYU A;  3QWZ B;  2IY1 B;  4BKG A;  4BOS C;  2UWQ A;  2KNB A;  3A1Q B;  2AEH A;  4EOY A;  3PHX B;  3QQ8 B;  1V49 A;  3N32 A;  1E5W A;  2ZNV B;  4G3X B;  3V61 A;  1WZ0 A;  3VFK A;  1KOT A;  3APC A;  3M63 B;  3SD5 A;  2LJ5 A;  1YIW A;  2KWU B;  5J2R A;  2DEN B;  4NAW B;  3VTU A;  5CHW A;  5G55 A;  2FCS A;  2O6V D;  3VVW B;  4AOF A;  2KVR A;  3V60 A;  2C7M B;  5FR6 A;  3ZNZ B;  2LAS A;  2G4S A;  3QIJ A;  3V62 A;  3W1S A;  1J19 A;  2UYZ B;  1E8Y A;  4TV3 A;  4WJP A;  2FIF A;  4FHJ A;  3JVZ X;  1OGW A;  3DVN U;  3O65 B;  3GOE A;  1QZE A;  4ANW A;  3PLU A;  1WZ3 A;  3QCA A;  2LD9 A;  3ALB A;  3PRE A;  4MM3 A;  4NPN A;  3U7D A;  5L83 A;  2DYB A;  4ZRI A;  3TL5 A;  1RAX A;  4AWJ A;  1WMH A;  5L95 C;  4DDG D;  1WX7 A;  3RZF A;  1SE9 A;  2KWV B;  1UEL A;  2Z0D B;  2Z0E B;  4G50 A;  4W9G A;  3ZKJ C;  3QX1 A;  2KFK B;  5TR5 A;  3ZO5 B;  4A20 A;  2LVQ A;  2N9E B;  2XK5 A;  1UBI A;  2LVO A;  4EFO A;  4IC7 B;  1V6E A;  2KOX A;  3MTN B;  1E8X A;  4W9J A;  1OEY J;  1WYW B;  4RM8 A;  4I6P A;  1XD3 B;  4BBN F;  4MEL A;  3PPA A;  4GSW A;  4MH0 E;  1GJZ A;  2NR2 A;  5EDS A;  1ZKH A;  2JRH A;  3NZU A;  4W9F A;  1H8C A;  2ASQ A;  3RYT A;  4IW0 A;  3QA8 A;  4HLE A;  1WJU A;  2MRP A;  3KYC D;  4F7Z A;  4XC2 A;  1R4N I;  4JIO U;  5JZE B;  4K7W A;  3R66 C;  3K9O B;  1TGZ B;  2R2Q A;  1JRU A;  3S2A A;  2G3Q B;  3W1Y A;  4WWP A;  3X23 A;  5D2M B;  5AZF A;  1NI2 A;  4KDL B;  2N1W A;  3A9J B;  1PQS A;  3JSV A;  1P9D U;  2D10 A;  1L2N A;  5HKH A;  1FXT B;  2IBI B;  2KTR B;  2W9N A;  3KUZ A;  3N3K B;  3VTW A;  2M4N A;  3Q3F A;  2RGF A;  2ZNV C;  2WDT B;  1Y8R C;  4TQ0 A;  2DYM A;  3OLM D;  2BYE A;  4W9C A;  5J17 A;  3ML8 A;  5GMV A;  4ASW C;  1WH3 A;  2ZVN A;  1LFD A;  2O6V A;  2XK5 B;  2I1K A;  4TQ1 A;  3LJ3 A;  2LGX A;  3IHP C;  3L16 A;  1S1Q B;  4GIV A;  2BGF A;  3DVN V;  3C0R B;  4W9E A;  2HJ8 A;  3N30 A;  3WA0 A;  2Z59 B;  2DYO A;  2PE6 B;  4IUM B;  5AEK B;  3A4S C;  3UQA A;  3V6E B;  3EEC A;  2FAZ A;  2GMI C;  2KN5 A;  2KTF A;  2KDI A;  4DHJ B;  1WGY A;  2LVP A;  4B9K A;  2LRU A;  3KUC B;  3VHT C;  3EC8 A;  1Z2M A;  1WM3 A;  2RD0 A;  1EO6 A;  4GXB A;  4GMV A;  3M62 B;  4IG7 B;  2AL3 A;  3PSE B;  4GDL A;  4FN2 A;  3TJP A;  1J0G A;  2J0K A;  3ZNG C;  3EFU A;  1Q1O A;  4K7S A;  1SIF A;  5DPS A;  3WAM A;  4JGH B;  2K6D B;  4WQO B;  3ZRC A;  2FNJ B;  1CMX B;  2L0F A;  2BKR B;  3APD A;  1WIA A;  1P0R A;  3UQB A;  3B1L X;  2KO3 A;  5JH5 C;  2HTH A;  1YJ1 A;  4OVU A;  1G6J A;  2FCQ A;  2K8C A;  2EMT A;  4B95 A;  3VUW A;  4MGY E;  3DCG A;  3WAP A;  4KIK B;  5IAA C;  1I35 A;  2PEA A;  3DVG Y;  3VQI A;  3A9K B;  1WM2 A;  3R7R A;  2K8B A;  4KV2 A;  2LWP A;  2KHW B;  2BYF A;  5JHA A;  2K39 A;  2JT4 B;  2L3Z A;  2MP2 B;  3DQV A;  3T9L A;  2NBV B;  1RRB A;  4KZ0 A;  3QJZ A;  4HPL B;  1X1M A;  1WGG A;  3L10 B;  1WX8 A;  1D3Z A;  3VUX A;  4RMA A;  1WX9 A;  1WR6 E;  3VDZ A;  4WJN A;  1P3Q U;  2KX0 A;  1V86 A;  2N9X A;  2LGD A;  2EMS A;  2LUE A;  4BVU C;  2HE7 A;  1IPG A;  2GBN A;  1WJ4 A;  1YX5 B;  3ZDT A;  3TIX A;  1UGM A;  4KDI C;  2D07 B;  2KFK A;  2LXA A;  3M3J A;  3ONS A;  4II2 B;  5DPR A;  4EUT A;  1ISN A;  3KH0 A;  2M0X A;  1E8W A;  1LM8 B;  4W9K A;  2LZ6 A;  4GDL B;  4KSK C;  4MSQ B;  4F1S A;  1GG3 A;  1RFA A;  4K1R B;  2WX0 A;  2KDB A;  3TBL D;  1GC6 A;  2MW5 A;  3NY5 A;  4PS3 A;  1YD8 U;  1UBQ A;  3H1U A;  3QHT A;  4BKS D;  3PGE A;  2JRI B;  4DXA B;  2KMC A;  2C60 A;  4FA6 A;  2KMA A;  3NZS A;  1LXD A;  4DWF A;  2XBB C;  4PS7 A;  3AU5 A;  2L8J A;  3W1S C;  4M8M A;  1IP9 A;  4W9H A;  3RT3 B;  5D7G A;  3L0W B;  5AZH A;  2FCM A;  4GDK A;  2BPS A;  4NNJ B;  2KXJ A;  2KJH B;  2KJR A;  3IBE A;  1WRD B;  2DX5 B;  3VH4 B;  2G45 B;  2RSU A;  3P2B A;  5KHQ A;  3DOW A;  2KKC A;  2B3A A;  1Q0W B;  2IO2 B;  1E90 A;  2CHW A;  2MA9 B;  4EKU A;  1ZGU B;  1NBF C;  2DZI A;  3SHQ A;  3VTV A;  2WX1 A;  2KQ7 A;  4MGZ E;  1WGH A;  1V5O A;  4I6N B;  5AZG A;  3NS8 A;  1V5T A;  2KTR A;  3PRM B;  2OJR A;  2YVC A;  4N9F 4;  1KJT A;  5LXI B;  1T0Y A;  2LI5 A;  2MWS B;  2JY6 A;  4MSM B;  1WE6 A;  2JZZ A;  4J6I A;  3X0W A;  1KM7 A;  4JLC A;  3ZVV A;  1IYF A;  1VCB A;  1A5R A;  2IYD B;  1Z5S B;  3DBL I;  1TZ1 A;  3HM3 A;  3NHE B;  5LXH A;  4FBJ B;  2KZR A;  2M8S A;  3BY4 B;  3H9D A;  3PRP B;  1U4A A;  4FJY A;  2M1M A;  4BBN C;  2DAJ A;  3IVF A;  2BWE S;  4PS8 A;  2G4D B;  4WWO A;  2AWT A;  2ZCB A;  2K6Q A;  4GDK B;  1M94 A;  2YLM A;  5CHF A;  2N7D A;  3KUD B;  3ZIM A;  2NPT B;  1UD7 A;  3L08 A;  4FHK A;  4LJO B;  1V9J A;  2D3G A;  2MBE A;  2MSE D;  4HK2 A;  3OJ4 B;  4WJO A;  2NBW B;  3SDL C;  2EKE C;  2IO3 B;  4FLH A;  4BKS A;  2IO1 B;  3ML9 A;  2MX2 A;  2GBR A;  2WWZ A;  3UIN B;  3VUY A;  3CST A;  3WAO A;  2MBQ A;  2J0M A;  3B0A A;  5CTR C;  4MJS B;  1YQB A;  1GUA B;  3ZLZ A;  2CU1 A;  4WJQ A;  3KVF B;  3GZN I;  4A3P A;  3D32 A;  5DCN A;  3DBH I;  4MGK E;  4DDI D;  2GOW A;  3LDZ E;  3H7S A;  3U30 A;  1WGR A;  1E8Z A;  5DPT A;  4FUL A;  4KSL C;  1YX6 B;  3VXW A;  3H7P A;  3MHS D;  1V80 A;  4FAD A;  2GBJ A;  4HXD A;  3A4R A;  2C5L C;  3OAW A;  3BIN A;  4X57 B;  4BKT A;  2MQJ A;  2O2V A;  2KWC A;  4AJY B;  3U8Z A;  3RUI B;  2PJH A;  4HDQ A;  2N7E A;  2NBU A;  3MJW A;  2JVC A;  1HE8 A;  2KK8 A;  1RLF A;  1NDD A;  1UZX B;  2J0J A;  3DVG X;  3I3T B;  3M95 A;  3H6N A;  2NVU I;  3WAN A;  2JF5 A;  4KIK A;  2A4Z A;  2LGY A;  1XT9 B;  1WY8 A;  2WYQ A;  4IM3 A;  2MCN B;  2NS5 A;  3UIO B;  3UIP B;  3VAW A;  3ZRF A;  4E71 A;  4ANX A;  1EF5 A;  4IWQ A;  5KHO A;  4B6W A;  2ZCC A;  2KFJ A;  2KC1 A;  3JW0 X;  2L76 A;  4MDK E;  4M8N A;  1EUV B;  2N9P C;  4RM9 A;  3UGB B;  5D94 A;  4EEW A;  4CYE A;  4OVV A;  1R4M I;  1E7V A;  1F9J A;  1L7Y A;  4HCN B;  3ECI A;  1BT0 A;  4ZDV A;  3L54 A;  4IM2 A;  1WE7 A;  4JL9 A;  4NY0 A;  2FUH B;  2KX3 A;  3PS6 A;  1OTR B;  1WXA A;  1OQY A;  1WXS A;  3R3M A;  1TBE A;  4GU2 A;  2K8H A;  1WJ6 A;  3A9J A;  3HM6 X;  3JSV B;  3WIM A;  4E74 A;  2C9W B;  2CHX A;  4LDT B;  4XX5 A;  2KDE B;  3A9K A;  3UF8 A;  4G11 A;  3AXC A;  4LJP B;  4ANU A;  3TMP B;  4NQL B;  3KW5 B;  1P98 A;  3KYD D;  3L17 A;  4NJ6 A;  5CHV C;  4HCP B;  2MBH A;  1SGH A;  2N1V A;  2KQS A;  2GBM A;  3OJ3 A;  2O6V B;  4ZRJ A;  2VRR B;  4EZJ A;  3QK0 A;  2ZPN A;  4IWO A;  4HWI B;  1WJN A;  2IZV B;  2LRW A;  2MBO A;  2QHO A;  2XEW A;  3PVL A;  5E6N A;  5C23 A;  4A3O A;  2Y5B B;  4JQW C;  4EZK A;  3L13 A;  2ZZP B;  4HJK A;  4DK5 A;  4ZYN A;  3DBR I;  1GNU A;  1S3S G;  1UH6 A;  3PTF C;  2JWZ A;  3PZD A;  4G0N B;  4DBG A;  3HIZ A;  4AJW A;  2MP2 A;  2JPH A;  2J7Q B;  4ICV A;  3QAQ A;  1OEY A;  4DHZ E;  4CHK A;  2L0T A;  4EZL A;  2FCN A;  2V1Y A;  3QC8 B;  3AUL A;  4AP4 C;  2AYO B;  3ZTD A;  3PHW B;  2NPT A;  4GOC A;  1WXM A;  4YL8 A;  1C1Y B;  2D11 A;  2N4F A;  2DZM A;  4KVG B;  1J8C A;  2DZJ A;  5JHB A;  4BFR A;  1XQQ A;  1EF1 A;  3RZW C;  3V6C B;  3ZDM C;  2MBB B;  1WF9 A;  3ZW3 A;  2L7R A;  4MEM A;  4GN1 A;  4M0W B;  4FJZ A;  2R2O A;  4I6L B;  3DBS A;  1WR1 A;  2JXX A;  2JZ3 B;  3HK0 A;  4NAW A;  4DHZ B;  3B08 A;  3QAR A;  4IM0 A;  2GBK A;  4KZC A;  3RD2 A;  4FJV B;  1WMH B;  4W9I A;  2PPH A;  4ZRK A;  3RCZ A;  2BKF A;  2V4L A;  1H4R A;  1I42 A;  2CHZ A;  4K81 A;  2LXC A;  3PLV A;  4W9D A;  1VD2 A;  3PRZ A;  4CO7 A;  1WXV A;  3EHV A;  2ZVO A;  1P1A A;  4XZ4 A;  2C7N B;  2O2V B;  3NOB A;  2MLB A;  3APF A;  1V81 A;  1E7U A;  2D2Q A;  3H7P B;  5J18 A;  2ZPY A;  2KJ6 A;  5E6O A;  4HPM B;  1K8R B;  5C1Z A;  3T8M A;  1AAR A;  4WWN A;  3CF6 E;  2KC2 A;  3ZUN A;  2IO0 B;  4AUQ C;  3K9P B;  2L05 A;  4K7U A;  2KDF B;  3ZNI D;  4HDO A;  2DZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...