2CSKA

Solution structure of px domain from human snx12
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
146
structure length
146
Chain Sequence
GSSGSSGSNFLEIDIFNPQTVGVGRARFTTYEVRMRTNLPIFKLKESCVRRRYSDFEWLKNELERDSKIVVPPLPGKALKRQLPFRGDEGIFEESFIEERRQGLEQFINKIAGHPLAQNERCLHMFLQEEAIDRNYVPGKSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sorting nexin 12
publication title Solution structure of PX domain from human SNX12
rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 22
structure length 146
sequence length 146
ec nomenclature
pdb deposition date 2005-05-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00787 PX PX domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1520.10 Alpha Beta 2-Layer Sandwich PX Domain Phox-like domain 2cskA00
2REDA 2RAJA 4P2IA 2ETTA 3P0CA 1OCSA 2RAKA 2V14A 1KMDA 2WWEA 4IKBB 3HPCX 1OCUA 2V6VA 4AZ9A 2IWLX 2I4KA 3IQ2A 4OXWA 4PQOA 3HPBA 4IKDA 2REAA 3FOGA 1GD5A 1XTNA 2DYBA 2AR5A 4PZGA 2L73A 1H6HA 1KQ6A 3LUIA 3DYTA 4P2JA 4AKVA 2CZOA 4PQPA 4ON3A 1O7KA 1XTEA 2RAIA 2YPSA 4HASA 4IKBA 4BGJA 2CSKA
chains in the Genus database with same CATH superfamily
2REDA 2RAJA 4P2IA 2ETTA 3P0CA 1OCSA 2RAKA 2V14A 1KMDA 2WWEA 4IKBB 3HPCX 1OCUA 2V6VA 4AZ9A 2IWLX 2I4KA 3IQ2A 4OXWA 4PQOA 3HPBA 4IKDA 2REAA 3FOGA 1GD5A 1XTNA 2DYBA 2AR5A 4PZGA 2L73A 1H6HA 1KQ6A 3LUIA 3DYTA 4P2JA 4AKVA 2CZOA 4PQPA 4ON3A 1O7KA 1XTEA 2RAIA 2YPSA 4HASA 4IKBA 4BGJA 2CSKA
chains in the Genus database with same CATH topology
2REDA 2RAJA 4P2IA 2ETTA 3P0CA 1OCSA 2RAKA 2V14A 1KMDA 2WWEA 4IKBB 3HPCX 1OCUA 2V6VA 4AZ9A 2IWLX 2I4KA 3IQ2A 4OXWA 4PQOA 3HPBA 4IKDA 2REAA 3FOGA 1GD5A 1XTNA 2DYBA 2AR5A 4PZGA 2L73A 1H6HA 1KQ6A 3LUIA 3DYTA 4P2JA 4AKVA 2CZOA 4PQPA 4ON3A 1O7KA 1XTEA 2RAIA 2YPSA 4HASA 4IKBA 4BGJA 2CSKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2RED A;  2RAJ A;  4P2I A;  2ETT A;  3P0C A;  1OCS A;  2RAK A;  2V14 A;  1KMD A;  2WWE A;  4IKB B;  3HPC X;  1OCU A;  2V6V A;  4AZ9 A;  2IWL X;  2I4K A;  3IQ2 A;  4OXW A;  4PQO A;  3HPB A;  4IKD A;  2REA A;  3FOG A;  1GD5 A;  1XTN A;  2DYB A;  2AR5 A;  4PZG A;  2L73 A;  1H6H A;  1KQ6 A;  3LUI A;  3DYT A;  4P2J A;  4AKV A;  2CZO A;  4PQP A;  4ON3 A;  1O7K A;  1XTE A;  2RAI A;  2YPS A;  4HAS A;  4IKB A;  4BGJ A;  2CSK A; 
#chains in the Genus database with same CATH topology
 2RED A;  2RAJ A;  4P2I A;  2ETT A;  3P0C A;  1OCS A;  2RAK A;  2V14 A;  1KMD A;  2WWE A;  4IKB B;  3HPC X;  1OCU A;  2V6V A;  4AZ9 A;  2IWL X;  2I4K A;  3IQ2 A;  4OXW A;  4PQO A;  3HPB A;  4IKD A;  2REA A;  3FOG A;  1GD5 A;  1XTN A;  2DYB A;  2AR5 A;  4PZG A;  2L73 A;  1H6H A;  1KQ6 A;  3LUI A;  3DYT A;  4P2J A;  4AKV A;  2CZO A;  4PQP A;  4ON3 A;  1O7K A;  1XTE A;  2RAI A;  2YPS A;  4HAS A;  4IKB A;  4BGJ A;  2CSK A; 
#chains in the Genus database with same CATH homology
 2RED A;  2RAJ A;  4P2I A;  2ETT A;  3P0C A;  1OCS A;  2RAK A;  2V14 A;  1KMD A;  2WWE A;  4IKB B;  3HPC X;  1OCU A;  2V6V A;  4AZ9 A;  2IWL X;  2I4K A;  3IQ2 A;  4OXW A;  4PQO A;  3HPB A;  4IKD A;  2REA A;  3FOG A;  1GD5 A;  1XTN A;  2DYB A;  2AR5 A;  4PZG A;  2L73 A;  1H6H A;  1KQ6 A;  3LUI A;  3DYT A;  4P2J A;  4AKV A;  2CZO A;  4PQP A;  4ON3 A;  1O7K A;  1XTE A;  2RAI A;  2YPS A;  4HAS A;  4IKB A;  4BGJ A;  2CSK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...