2CSUA

Crystal structure of ph0766 from pyrococcus horikoshii ot3
Total Genus 144
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
144
sequence length
453
structure length
435
Chain Sequence
MLDYFFNPKGIAVIGASNDPKKLGYEVFKNLKEYKKGKVYPVNIKEEEVQGVKAYKSVKDIPDEIDLAIIVVPKRFVKDTLIQCGEKGVKGVVIITAGFGETGEEGKREEKELVEIAHKYGMRIIGPNCVGIMNTHVDLNATFITVAKKGNVAFISQSGALGAGIVYKTIKEDIGFSKFISVGNMADVDFAELMEYLADTEEDKAIALYIEGVRNGKKFMEVAKRVTKKKPIIALKAGSWKIYEAAFKQSGVLVANTIDEMLSMARAFSQPLPRGNKVAIMTNAGGPGVLTADELDKRGLKLATLEEKTIEELRSFLPPMAAVKNPVDMIASARGEDYYRTAKLLLQDPNVDMLIAICVVPTFAGMTLTEHAEGIIRAVKEVNNEKPVLAMFMAGYVSEKAKELLEKNGIPTYERPEDVASAAYALVEQAKNVGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of PH0766 from Pyrococcus horikoshii OT3
rcsb
source organism Pyrococcus horikoshii
molecule tags Structural genomics, unknown function
molecule keywords 457aa long hypothetical protein
total genus 144
structure length 435
sequence length 453
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13380 CoA_binding_2 CoA binding domain
A PF13607 Succ_CoA_lig Succinyl-CoA ligase like flavodoxin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2csuA02
3.40.50.261 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Succinyl-CoA synthetase domains 2csuA03
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 2csuA01
1E3JA 1TT7A 1Z74A 2Y05A 3GA0A 3K31A 2VT2A 4AJPA 7MDHA 2FWMX 4WE3A 4DQXA 2HJRA 2NADA 3C8MA 1DIRA 2R00C 1U2GA 4Q3NA 1WNTA 1CQJB 2WD7A 2O23A 3ONEA 1GUZA 1DO8A 4YQYA 1BXZA 3WWZA 3PLRA 1GPJA 1LRJA 3VVCA 3FTNA 4CM8A 3AUTA 3OMLA 4YAJA 4JROA 4ONEA 1BVRA 2DBVO 3KUXA 4L74A 1K6XA 3C24A 3KSUA 3ADPA 4A26A 2ZK7A 1MC4A 5T8KC 1HSZA 2WJPA 4J49A 5IZCA 1T1SA 4FFRA 2J3JA 2CF5A 2VHWA 1T2FA 3U3XA 2VUTA 2W2KB 5L51A 5A9SA 3PHLA 1PS8A 5CDGA 1U4OA 4WPGA 1IB6A 3FR7A 2SCUB 1ID1A 3GNTA 3W8FA 2JD2A 3ZCXA 4BNGA 1WDKA 3AUAA 4BQRA 1FDVA 4PLZA 4YEDA 4R9RA 1R0SA 3ON5A 5BNIA 5BSFA 2WD8A 3ZNPA 1O6ZA 4Y6RA 2O4UX 1V3VA 1FF9A 4P4NA 5JPIA 2Y66A 4FD3A 2JAPA 3PHHA 4PLWA 1ZXLA 3ULKA 4YB8A 1RM5A 3ZWOA 1QYWA 2DTXA 1YONA 2QRLA 2J3HA 4FJ2A 3PHIA 4BB6A 2YQ5A 3P7MA 2GN6A 4CM3A 5TRTA 4R68A 2C5EA 2DFDA 3GGOA 3JQDA 2VWGA 5DCUA 5JC1A 1B8UA 4NNJA 1R0KA 2GZ1A 3ROMA 4BGIA 1WP4A 5G0TA 5A9TA 2QZ9A 2BRUA 3U5TA 1G1AA 2PNFA 3TSCA 1XDWA 3PFWO 2XPCA 4Z9FA 3W8DA 1ONOA 3BMOA 5EQDA 1VJ1A 5CAEB 2GD1O 4JXKA 2PK3A 2VQ3A 3AJRA 4P22A 4NPCA 4ALKA 5K6AA 5C7LO 4DLLA 2V6BA 4IDCA 5KKAA 1FDUA 1I8TA 1LA2A 2OHXA 4TKLA 1YE3A 3G79A 1LDMA 3I9OA 3QVOA 1I36A 4IPTA 4Q39A 3D5TA 4MVJP 3ZU5A 1HL3A 3HHPA 4YJHB 1EUDA 3DAPA 3ZV4A 4D79A 2X22A 1NFFA 1WAMA 1GQQA 2PZLA 4IDGA 2I99A 3PZBA 3KO8A 3FI9A 4P8RA 2AQKA 3CUKA 5DZSA 2V6FA 2NACA 5C5IA 2QZZA 1YJQA 4OOEA 3UCXA 4ZQBA 3WYBA 4BNWA 4GPD1 4FFPA 2PV7A 1BRMA 1P0FA 4PLFA 1B7GO 1M76A 2BGLA 1P74A 3IKVA 1MG0A 4Q3CA 4YAGA 5GZ1A 4OQZA 5EINA 4FFMA 2IE0A 1MLDA 3INTA 5L7YA 4B7UA 1CQIA 4RLSA 5MDHA 1SB8A 2GGSA 3RROA 2AHRA 5A5EA 2Y1DA 2ZTUA 4LSWA 4OM8A 4Y8VA 1VL8A 3ZW8A 1BMDA 3E5RA 2HUNA 5EPOA 4IDDA 2G17A 4XGNA 3H9GA 4AJHA 1A5ZA 4JP2A 4MO2A 3VZPA 5JYEA 3GQVA 1P1HA 4WECA 3TN7A 1DPGA 2EKPA 4RPJA 3JQ8B 1A7KA 3RUFA 3PLNA 1HE2A 4AG3A 4CLEA 3H3FA 2JCXA 1ENYA 1BDBA 1GYPA 1HTBA 2BGMA 4R3WA 4DRYA 4S3MA 5EL0A 1J4AA 1EQUA 2OP1A 2B35A 5KOIA 1R66A 3ENNA 3RI3A 5T5QA 3S55A 2ZCVA 1LLCA 4FJ0A 3RUDA 1GUFA 1HYEA 1ZIDA 2RHCA 2NU7B 3I9MA 3H5RA 3ZWNA 2OUIA 4XCVA 3TQHA 3E9NA 1MX3A 3L77A 4E4YA 1ORRA 3CEAA 4QTZA 1VLLA 4WLVA 5H83A 1DC4A 1V3UA 3VZQA 1U8XX 3ETEA 1KY5A 2E82A 2WMDA 3AY3A 4XQGA 2FP4B 4FCCA 2GR9A 1ZKMA 2E49A 3GAFA 4N18A 3U4HA 5DOVA 4R1TA 4JNKA 1T2AA 3N7UA 1FK8A 3QE3A 1HDZA 1RM0A 5EN4A 3RFVA 1H9AA 3VC7A 4CLXA 3ZHZA 3V8BA 3LZ6A 1PGOA 3PYMA 2IZ1A 4R69A 3IIEA 3KM0A 4GQAA 5A5FA 5IDYA 1I10A 5HWSA 3E82A 3ROQA 1DHRA 5AVOA 3U4CA 3ZWWA 2WEKA 4HXYA 3GHYA 4GKVA 1P1KA 4LCJA 3ZWXA 4WCFB 1LEHA 2Q2VA 1LC3A 1Q7GA 4JN6B 3DOCA 4QECA 1Y1PA 2OORA 3UFXB 1QLHA 2Y99A 2Z1MA 5ITVA 1N1EA 2PGLA 3WWYA 4FJ1A 1C0IA 4J6FA 3KRTA 4B4OA 3WICA 1K6IA 4ND1A 4FDAA 4IXWA 3GG9A 1FXSA 4I5FA 4ZJUA 4MP3A 3CZRA 3Q2IA 3ZH2A 1ZO8A 2X0IA 2NU8B 3VKUA 2H63A 1SNYA 3I9LA 2DTDA 1VSVA 2FY8A 4G2NA 1BVUA 3HWRA 2J5QA 3C7CB 4HBGA 2DC1A 3JSAA 4CM5A 1NAIA 4JK3A 4A0SA 4EYEA 4ALLA 1ZZEA 3OH8A 3NTRA 1UP7A 1KY4A 4CM1A 4WOJA 4EUFA 2PD3A 1LQUA 3GVPA 1PZGA 2YV1A 5B37A 3UICA 5TC4A 2ZCUA 4A7PA 1E1KA 4DIFA 1JVBA 2VWPA 4LVCA 5IDWA 2YJZA 3FSRA 1ZXBA 3AY6A 4LSMA 3I4FA 4H16A 5IAAA 3ZHBA 4XD2A 3I52A 4BNKA 3V1UA 3OETA 2P9GA 3WTCA 4CQMD 1PJSA 1WDLA 2BKAA 5LDGA 4E31A 3H4VA 1OOEA 3BHJA 3L6EA 4BGEA 1TI7A 3BMCA 1XKQA 5JXWA 3RC2A 3HFGA 4KUEA 1G0NA 4B8WA 1KEPA 3E8XA 4U0JA 4PCVA 3M2PA 4NZ9A 4ND5A 4IJVA 4CUZA 1KYQA 4O63O 2P4QA 4Q3AA 1UR5A 1I2BA 2GRAA 3L4SO 5BSGA 2NNLD 2CZCA 2O2SA 1XA0A 5DN9A 4W7HA 3WX0A 2GUGA 3DTYA 3DBRB 3UUWA 4CM8B 1UZNA 1XELA 2FMUA 1H93A 1EFKA 1Z82A 2HK8A 3K6JA 1WLYA 1IYZA 1E7MA 1VSUA 4ND2A 2AG8A 2OL4A 3HNPA 4IUYA 4CLRB 4II3A 4LK3A 3NDIA 4BNXA 3EAGA 3GRKA 4HNHA 1EVYA 1NWHA 1E7WA 1Q0HA 3JD0A 1BW9B 2FR8A 1RJWA 1DOHA 3PQFA 5FWNA 3K2EA 3N74A 4IZIA 1ZSVA 1H6CA 3ZI0A 4GX5A 4U0KA 9LDBA 4L4XA 4WCFC 3OF2A 5CEEA 1VJ0A 3WNVA 4R5HA 4D0RA 4OIMA 5DNAA 3EW7A 2GASA 4Q3DA 5GMOA 1Q0QA 4W4TA 3JQ8A 4M87A 3OM9A 3QA9A 5JDIC 3DL2A 3GN1A 4WJZA 5DP2A 2PY6A 1ZK1A 3LT2A 4MINA 4GX1A 3UF0A 3E03A 3H8VA 1YB5A 4IXTA 2C59A 4GLOA 3RAJA 4JBGA 3R0IA 4AJKA 1P1JA 1ZVMA 4FBGA 4TRNA 1PJ3A 3BHMA 3C3XA 3DAGA 2I65A 1Q1NA 3OIFA 1HDCA 2PZMA 2RH4A 4ND4A 4BNZA 2GN9A 4WLEA 4QXMA 2ZATA 3WLEA 4YPOA 4MVJG 4II2A 3LC2O 1K3TA 1Y9EA 3VH1A 1P33A 3WGIA 1C14A 1DSSG 4CM6A 2ZB7A 4MVJF 5CDYA 4U7WA 5A4DA 4UAGA 2OOSA 3TWOA 4AJ2A 1SC6A 3GUYA 1ARZA 1Y8RA 3L07A 1N92A 1N5DA 1DRVA 2Q1UA 3LK7A 2R6JA 4D3FA 5I7VA 4Z0TA 3KLPX 3T7CA 5IFLA 4WEOA 3R3JA 3ETDA 1EUDB 3BAZA 2AQHA 4GGOA 1NASA 4XJSA 1E3WB 3HB5X 4CMEA 1PZHA 2AE1A 3EVTA 1UJMA 3COSA 1E1MA 4QFDA 3WSVA 3SJ7A 3ZZNA 1MB4A 1EUZA 2Y1FA 3PGXA 1ZSYA 1GADO 4OXKA 2WE7A 2WSBA 3WGZA 5CAEA 3IP1A 2CDAA 3TOZA 5K6AC 4CMIB 1LRKA 1C0PA 4NMHA 2UYYA 3FNGA 4Z3KA 5GZ6A 4YAIA 1O8CA 3PRJA 4WEQA 5F1OA 1ZJZA 4R51A 2FP4A 1B8VA 1U9JA 5IDXA 3KYBA 4J3FA 1J5PA 1BTOA 3LF2A 1WWKA 5ER9A 2ZQYA 1LLDA 4XQEA 3MJTA 4XB2A 3MTGA 3CMCO 1VI2A 3L6DA 3SXPA 1SPXA 2G76A 4GI2A 3DAFA 1ZFNA 4RGBA 3FWZA 1K0UA 1D1SA 4FGWA 4PVCA 3FCOA 1I3KA 2C29D 3GGGA 4HNGA 2BELA 4I8XA 3LYLA 3F5QA 4QSMA 4AFNA 2WM3A 3D4OA 3MOGA 2A9FA 2PH5A 4IQ0A 5DBGA 3LVFO 4B7XA 1YQGA 2AXQA 1ZK0A 3QW2A 4J0FA 1M2WA 3PWKA 1LBEA 4L76A 4DA9A 3RU9A 1JKJA 4ALIA 1YBAA 3U9LA 1NP3A 5KJFA 3DHEA 5L45A 2HCTA 2PD6A 1KC3A 4Z0HO 4DIBA 4UEKA 5DOZA 3GT0A 1SEVA 1U4SA 3TOXA 4RVGA 3ZWCA 4W7IA 2UUPA 1DJQA 3U0BA 3DEYX 1UH5A 3RFTA 4YR9A 2FZEA 3JD4A 3NDJA 5CPFA 4AVYA 4QFCA 5KKCA 2VRBA 2G82A 4ZQHA 4HFMA 4C7KA 4YJGB 1TEHA 2EIHA 3D3WA 2FSSA 4NK4A 3MWEA 2X0JA 3ZV3A 2HMUA 2J6IA 4YCAA 4J1NA 2OBNA 2B83A 1LTHR 1MFPA 2A4KA 3OHSX 1C3VA 4ZQFA 4NJOA 4AICA 4CMKA 3H9QA 3O8QB 3JQBC 2O3RA 1PJ4A 4CMAA 2DKNA 1GFSA 3CZMA 2VYND 4FIZA 4J4BA 1ZSNA 3NT2A 3ONDA 4KZPA 5ER6A 2NU8A 1U3UA 4GX2A 4L8VA 4Y98A 1HYGA 4WLNA 3E9QA 4XIYA 4RCVA 4IQGA 1QKIA 3SC4A 2WYUA 3MOIA 5BSHA 1G0OA 4O6VA 3VPSA 4CQMB 2CUKA 4ZICA 4I9UA 1T4DA 4NG5A 1NPYA 4EEXA 4Y9DA 2PKRA 4S1VA 4CMHA 5KWEA 1HE5A 1OMOA 2WWRA 4NH4A 1DJNA 1DC6A 3C1TA 1M67A 1P45A 5A03A 3JQAA 2JHGA 4XYGA 1BGVA 4PLCA 4GL4A 2QX7A 3SVTA 3MWDB 3WBFA 5JFOA 3KYDB 3E48A 5BQFA 1ZH8A 3TZKA 1GR0A 4EUEA 2I3AA 4NIMA 4IGFA 3HSKA 4UULA 1YQDA 5TNXA 1XG5A 2F00A 3FNEA 1RWBA 3OA0A 4J4TA 4YTEA 4F45A 4GAEA 3H5AA 1MXFA 3IJPA 3PIIA 4TQGA 1E7SA 4IIUA 4M54A 5KCZA 1B26A 3QP9A 3HN7A 3Q9UA 1AN9A 1BG6A 2B4TO 4Y6SA 5IG2A 2XXBA 1YB1A 3VOSA 3E1KA 3RIHA 4DBZA 1PR3A 3DMYA 2PKQP 3ZV6A 3WQQA 3DZKA 3HUDA 3QWAA 1YB4A 1IY8A 2EWMA 4EW6A 4E13A 2Y67A 4LN1A 1HYHA 2YUTA 2E48A 2VTEA 4BO6A 1XWFA 3AFMA 5TX7A 3VZRA 4OKIA 1R16A 2EW2A 3VHRA 2NWQA 1KVRA 3JD2A 5IN5A 2D3TA 3PP8A 4MVJA 4DWVA 1Z75A 4MKZA 1CDOA 1BHSA 5DP1A 1C1DA 3OIDA 3JYNA 1IUKA 1XIVA 3L9WA 4MDHA 1ONNA 4LW8A 1E77A 3HDHA 3HN2A 4YT8A 1O0SA 4JCOA 3VVBA 4PG4A 3DZHA 1MGOA 4YJFB 5T8KA 4HADA 1NTOA 3KHUA 1JW9B 5B4TA 3PIDA 5F5NA 4CL3A 4UEJA 3WG9A 1LDGA 1R4NA 2IYPA 3PHGA 1QV7A 4O59O 4TRMA 5K0ZA 2HMVA 5B4UA 1E0DA 3JQ9A 4DQUA 2R00A 2TMDA 4TVOA 5DCWA 1LDYA 2J5KA 2IRWA 2EEZA 2UAGA 3JQ7A 1YRLA 1W4ZA 2I67A 2VOEA 4IY1A 4D44A 4XRGA 2BGKA 3W8EA 3QSGA 1QSGA 4P38A 1E3EA 4LGVA 3PDUA 1N7GA 4PRLA 3F5SA 1ZMTA 2NU6B 2RCYA 3KVOA 4CODB 4ROSA 2NU9A 5JCJA 3KEOA 2NTNA 4OXYA 4U6QA 1Q2XA 3U4DA 3PTZA 1DRUA 1T2EA 4QO8A 4YT5A 1GY8A 3FRJA 3OQ6A 1U3VA 1UAYA 3I23A 3O03A 2HDHA 4ID9A 4PLVA 1YL7A 1O5IA 1PZFA 3A4VA 3P2OA 3ZU4A 2DPGA 4Z0PA 4CJXA 3W4KA 1C0LA 4NU5A 1GEGA 1A4IA 4DUPA 3NUGA 5IXSA 4TWRA 4RVHA 3BHIA 4UVDA 1HETA 3WYEA 3TRIA 1NQOA 5F1KA 4F3YA 1AHHA 4D3SA 5CEJA 1UXGA 4XWYA 3UN1A 4QEDA 2P5YA 3H65A 3EC7A 2B4QA 1ENZA 1IHXA 2HAEA 1TT5B 3DBLA 3A9WA 1HKUA 5KJEA 1GAEO 3GVXA 4XA8A 4FOOA 1XQ6A 1WDMA 1Z6ZA 5GY7A 4I5EA 2C0CA 4KUGA 1I33A 1E3WA 4BNFA 4J1SA 2DTEA 4ND3A 5JO9A 5L7TA 1IPEA 4HKTA 1ENOA 3NJ4A 5KVCA 5ICMA 2JFGA 4GH5A 3K96A 4GLLA 1K6JA 2HMWA 5L3ZA 4E5PA 1NHGA 4D43A 1ZK3A 2YFQA 3BA1A 4TSKA 2BFMA 3EZLA 3OICA 1JWAB 1OFGA 2GERA 4Q3BA 5FF9A 4BL5A 1YKFA 1T1RA 2YV2A 3AI2A 4W99A 3DZGA 4D3DA 2IEDA 2O3TA 3BTSA 3TNLA 3UKOA 4UUNA 1DHTA 3LLVA 3SX2A 3F9IA 1F14A 4W9NC 1Y7TA 3WQSB 3S1LA 5HBRA 2HK7A 4YJDA 3AFNA 3KZVA 3H5NA 4YT4A 3I1JA 2DVMA 4FFOA 4QQRA 2E6UX 4XEHA 2W2KA 2H5LA 3GAZA 3MJCA 2ZB4A 3ORFA 4J7CA 3ST7A 3WGQA 4ITUA 1X14A 4DPLA 3NTOA 3ABIA 2EERA 4YRAA 3KYCB 3AM3A 1HT0A 2DAPA 3W4JA 2YYYA 2P68A 3DB2A 3WXBA 1Z7BA 2VOJA 1KIFA 1ZUD1 2D2IA 1NFRA 2X8LA 6LDHA 3H9UA 2AQIA 2XF8A 3O4RA 3E5MA 2HMSA 4YRDA 3X2EA 3MJ4A 1GCUA 3P2YA 4IJWA 3BMCB 3ICPA 3NRCA 2ZTMA 5TGDA 3HDQA 4XYBA 2IZZA 5EIOA 5AXBA 4L9RA 4E32A 3QJ5A 4RLHA 3U62A 2J8ZA 7ADHA 1EDZA 3GPIA 2DT5A 4HFJA 4YT2A 5IF3A 1GPDG 3L6OO 4BNTA 1NR1A 3JQCA 3I83A 3CSDA 5JDCA 3KV3O 1DXYA 4AJIA 2NV6A 4DMLA 4AJEA 4M8SA 3RVDA 3WSWA 4BNYA 4HFNA 5MGBA 3RBXA 1DFIA 1PL8A 2VHVA 3PHJA 3PPIA 4LISA 1WZEA 4Q9NA 2VT3A 4MP8A 1YO6A 4QO7A 2DUWA 1CRWG 2X5JO 1PS9A 1MC5A 3DTTA 5EESA 5BSEA 5TLSA 1D4FA 4I1IA 5A1TA 1P9LA 6ADHA 4FOSA 1GZ6A 3DOJA 4YWJA 1W73A 4BVAA 4BO4A 5G0WA 3JYQA 3VTFA 4X54A 1U7HA 1RM4A 2O3SA 3F3SA 1EUCA 3D64A 3FF4A 4GVXA 4EGFA 5G4LA 1XU7A 4RQTA 5A06A 5KNLA 4PLTA 1N1GA 2HLPA 1F0YA 4EEZA 2CY0A 2X9NA 5IXYA 3HZZA 1XYGA 3T7EA 4E5YA 1E7RA 5CDTA 1ML3A 3IKTA 2ZYGA 3ZNQA 3OJEA 3ZDFA 3TZHA 3WB9A 3VPGA 4B4VA 1QRRA 5I8ZA 1UZLA 1CEQA 2ZYAA 1HDXA 1LC0A 2FN7A 1R4MB 1ZEJA 3HDJA 2AA3A 2P5UA 1JKFA 4XGIA 3MEQA 2B0JA 2BF7A 3CKYA 4IIVA 3GG2A 1P31A 3WGHA 4C7JA 3S2IA 2GO1A 4BO8A 2J3IA 4IDEA 1U7TA 2OBYA 4CPDA 4BGVA 4R9SA 3L4BA 5JO0A 1E92A 1GU7A 2JCVA 2IODA 1BXGA 3H9EO 1NXQA 2P9CA 4UVIA 1R4MA 2ZTVA 3Q2KA 5F3RA 4BNVA 3NDRA 4NFHA 3LT1A 1XGKA 2RHRA 2I9PA 4UVEA 1LUAA 4TMFA 3OECA 4PVDA 4AL4A 4CMJA 4MVJI 4Q3EA 3GZNB 1L7EA 3WGTA 4L73A 3CXRA 3MJSA 5F1PA 2X7HA 4M49A 5G0SA 5U4QA 1SCUB 3FBGA 4FB5A 1W0CA 3JQFA 2GZ2A 2EW8A 4KUHA 1DRWA 3K92A 2FPIA 2OFPA 2VYVA 3H9JA 3EY4A 4YA6A 5TQVA 3PJFA 4U8GA 1T2DA 2H1SA 9LDTA 3IAHA 1SB9A 2RIRA 4D7AA 3RUAA 1HDOA 4H3VA 1Y81A 3ASUA 3H3JA 1I3LA 4UREA 4ESOA 1Z45A 1GUYA 3Q0EA 3EGOA 4I08A 3MWDA 4IGEA 2B69A 2CSUA 4NR0A 4IDFA 4UUOA 1PS0A 1O94A 1RM3A 1MXHA 1MA0A 1VKNA 2IZ0A 1H94A 4LRSB 1QXSA 3PQDA 2GZ3A 4CMCA 2X0RA 3GUCA 1NR7A 3HE3A 4JP3A 4DXHA 4A2CA 2E37A 2QYSA 4CQMA 2NVBA 3LQFA 1EE9A 4RF5A 1EVZA 5FEUA 2Y1GA 4CMGA 4WLFA 3VPHA 1S7CA 3PXXA 3WFIA 5ICSA 1KEVA 3UVEA 1PZEA 4PG8A 4M86A 4WLUA 2Y68A 1E1LA 4YRBA 5JAIA 1LSJA 2PKQO 4JQCA 1R0LA 3JYLA 2IEBA 3VPFA 4J4HA 1A27A 4IS3A 1HLPA 5JDCC 4ZRMA 1BSVA 1F17A 3OEWA 2FPGA 1KVQA 3KXDA 3I9NA 1YJ8A 4EJ0A 2DUUA 4DYVA 1NVMB 2EKLA 5JAQA 1SO8A 4CQLA 2D4AA 5JAMA 1V3TA 5JSFA 1H6AA 3BMNA 3KYCA 4PZEA 4CLHA 5I9NA 2FRDA 3ZN2A 3AY7A 3EUWA 3F6YA 5DT9A 3EZYA 4ZA2A 1OBFO 4KQXA 3WFJA 5ADHA 3ROKA 1RPNA 5CDSA 1JAYA 1DB3A 1QYDA 4NHEA 3WS7A 2VRCA 2EJWA 3UXYA 3PJDA 4KWIA 1QMGA 2R2GA 3IC5A 4NFYA 5DDIP 5KIAA 3RQSA 4HV4A 3DBHB 4URFA 2PLAA 2QRJA 4N5LA 1E5LA 1BWSA 1JTVA 1Y5RA 2IXBA 3G17A 3WIDA 4ZQEA 3GFBA 4HUJA 4PZDA 1PQWA 3KBOA 4J16A 3DONA 2GN4A 1PL7A 2HRZA 1NYTA 3QHAA 3OJOA 3EMKA 4HWKA 3FPLA 3WGYA 3AI1A 1N8KA 3JQ6A 5IZ4A 4ILKA 1SBYA 1I32A 1JA9A 4AJ1A 4CMEC 4LMRA 1PWZA 1M6WA 1KBZA 3SBOA 2C7VA 1M6HA 4BNLA 4PG5A 3GNQA 3WOHA 1Z7EA 2BFAA 4R16A 3B6ZA 4DBVO 4JJFA 1B15A 5L7WA 3O26A 2ZB3A 4IM7A 1Y8RB 3GDOA 3R1IA 1I5RA 2Y1EA 4ZHSA 4L4RA 3KLMX 3BZUA 1B3RA 1CERA 1TXGA 2GNAA 4HX5A 8ADHA 2DLDA 2NVUB 1E5QA 1PGPA 4TZKA 1BXKA 2YHUA 3VZSA 4YQZA 1SAYA 3MJVA 3D3WB 3LT0A 2AE2A 5DF1A 4RPHA 3RBVA 1UP6A 3GOHA 1YOVA 5EQFA 1YL5A 3TL3A 1LDNA 1IHYA 3A06A 4BQPA 4L75A 3PYLA 4CLOA 4R5MA 4CV2A 3DFZA 2WDZA 4K1LA 2PR2A 5TT1A 5IDQA 2OGUA 3GVHA 4CLDA 1E6EA 1S6YA 5TSDA 2C2XA 1E6UA 3ZWPA 2Y1OA 2VUSA 2PGJA 2YDYA 3CTMA 3P19A 5JBIA 4BKRA 2YDXA 1Y8QB 5DULA 1T25A 2AW5A 3V5NA 4MKRA 4WCFA 2VNSA 2Q1TA 4BO9A 4MJLA 1VKOA 4DLBA 4YDRA 1HXHA 1NQTA 1EUCB 3F47A 5LCXA 1ISJA 4J2HA 3W1VA 1Y5MA 3WMXA 1I24A 2VTDA 3CIFA 5ILOA 4YAKA 3O9ZA 2TMGA 4IJKA 5EMHA 4OSOA 3PJGA 3BTOA 1E6WA 1FMCA 3GDGA 3GLQA 3FPCA 4R3NA 3H7AA 4NBUA 3RKRA 2AMFA 3GEGA 1JWBB 2YV3A 4NBRA 3BXXA 3GH3A 4DC1A 3JQAD 3INRA 3WQRA 1YOVB 4NBWA 5JS6A 4RPLA 3MTJA 4OMUA 4F46A 2JD0A 4D41A 2O4CA 3RUHA 5JE8A 3FTPA 3BTVA 3RBZA 1X13A 1DC3A 5FYDA 1DLIA 1E7QA 3CH6A 3NAQA 2VHZA 3RWBA 3GVCA 2LDBA 3ZU2A 1EK6A 3MCVA 4B3HA 2BI7A 4OQYA 2VWQA 1CQIB 3QWBA 4TRJA 5G4KA 3JQBA 1NBOA 4NK5A 3JQ7B 3LLSA 1E7YA 4RVDA 4WGGA 1KOLA 4BKQA 5J23A 1LNQA 4DPMA 4DIOA 4XRRA 5BR7A 1R4NB 3GEMA 4XYMA 4ZN6A 5KJCA 4BB5A 1C1XB 1SOVA 1T2CA 2W8ZA 4JJIA 4PN3A 4M1QA 2FOIA 1C0KA 1PGQA 3AUSA 4W6ZA 4OH1A 4ALMA 5L4SA 4BGUA 1HSOA 2A92A 1ZCJA 2W4QA 3OBBA 2DU8A 2B37A 3OP4A 1HE4A 3OJFA 3F46A 1ULUA 3MZ0A 2NTJA 3WGOA 3ONFA 1PJQA 3RJ9A 2NVUA 1N9GB 1J6UA 3AI3A 3U09A 3IS3A 3B20A 1GQYA 4FN4A 4BMSA 2IYOA 4DQVA 3OJ0A 4ZU3A 3TZ6A 3MJEA 4IDAA 4O1MA 1QYXA 2VYNA 3UCEA 3K30A 1RYDA 4D45A 5BNTA 5JC8A 2ZJ1A 3NKLA 4Z6KA 2FSVA 2X5KO 3PVZA 2GLXA 1P1IA 3DZBA 1X0XA 4UUMA 1EQ2A 4J9UE 2DBRA 4XX0A 4Y67A 4IDBA 1KS9A 4BO7A 1N2SA 1XU9A 2AG5A 3W6UA 4DGSA 2VHXA 5EERA 2X9GA 4UVHA 1ADCA 3V2GA 1LRLA 5FI3A 1R12A 1GTMA 2FPPA 1A72A 3IQDB 5DBIA 2BFOA 4R1SA 4YXFA 3Q9NA 3PZRA 5C37A 1X0VA 2NQTA 4FSHA 4A10A 1DBVO 2O3QA 4FQ8A 1LU9A 1LDBA 3NGLA 4ALNA 4BOYA 1P44A 3VH3A 1CWUA 3D1LA 2POQX 1OZAA 5KVQA 5COAA 1VE9A 4KDEA 2IDZA 1FJHA 1ZEMA 2FZWA 1H5QA 3GVIA 2OO5A 2X0NA 4J7UA 4XR9A 3KETA 3UGKA 3T4XA 4CLOB 4RV9A 4CV3A 1VM6A 2QRKA 3AOEA 4XYEA 3V1YA 3ZWYA 4E30A 3GMSA 1PJTA 4BMVA 2AEMA 4YVFA 5CDUA 1B14A 1A7AA 1D8AA 1U3TA 1QYCA 1M75A 1SMKA 1YL6A 2ZB8A 4N5NA 4EUHA 3ZWMA 3CINA 1VL6A 3WNQA 3QLJA 3ANNA 5TJHA 3NTQA 3SLKA 4H15A 4P4LA 1DIGA 5CPBA 1SOWA 2Q4EA 1L1FA 3GK3A 1XCBA 1CYDA 1PJBA 5AXCA 3Q11A 5AXDA 2VYVD 2QYTA 4MPDA 3TL2A 2XOXA 1I3NA 1XQ1A 3ZGYA 1YS4A 1ADBA 2P2SA 1LSOA 1ISGA 2X58A 3G3EA 3GRPA 4INAA 3FN4A 3GN2A 5TIIA 1CQJA 4ZVVA 4W82A 1GCOA 3OSUA 2NUAA 2Z95A 3TF5A 1PU2A 1O95A 1U8FO 2GN8A 3O38A 3P5SA 3K8ZA 3SLGA 3RUIA 1WMAA 2C2YA 4I5DA 4R1NA 3I3OA 3RUCA 1YDEA 1R37A 4E2WA 2GPTA 2W98A 4U5QA 1UXHA 1VPDA 4TROA 1HF3A 4B79A 4CM4A 3KB6A 1P0CA 1YWGO 3KOUA 4NJMA 1DC5A 1QLJA 1BXGB 1X1TA 4A73A 3PI7A 3PDJA 2C5AA 3NT5A 1JKJB 1AXGA 2CF6A 2D1YA 1F12A 2HO5A 5TJ9A 4E6PA 1UXJA 3GC6A 5THKA 1HRDA 3N58A 1DFHA 4NJMB 2WYVA 1ZJYA 2I3GA 4CMIA 3AK4A 2EG9A 4BNNA 5COBA 3F1KA 2Y0CA 2B36A 4XQCA 1NFQA 3WTBA 4E2ZA 2WYWA 3VDRA 2NU7A 3LT4A 1GD1O 1TA4A 2BH9A 4JBHA 3FD8A 1KEWA 4BNHA 3RSHA 3PWSA 2GCGA 3HFSA 4BS9A 2J5RA 4CQLB 3DHNA 1SZJG 3JQGA 1PX0A 2P4HX 1C1XA 2F1KA 4B4UA 4E3ZA 2JFHA 4XQ9A 3UH1A 3GPDG 4BO2A 1V6AA 1A71A 4DTIA 1WMBA 4N7RA 4IBOA 4BHTA 1AHIA 4KMSA 2Q45A 4OHUA 3B1FA 2A94A 4KTVE 4QT0A 2EHDA 4FC7A 1P1RA 1AXEA 3C85A 3DZFA 5G4KB 3QVTA 2CNBA 1U3WA 4YJHA 1AE1A 1H0KA 1OI7A 3ZWAA 2Q46A 4BKUA 2Q49A 3B1JA 2CVZA 1NX6A 4J1QA 3BIOA 2NVWA 2O50A 2JHFA 3U4IA 4DMMA 1N9GA 2G0TA 1ONPA 2PFGA 4OYRA 2D5AA 3A28A 4M55A 1DIHA 2BFPA 1K5HA 4BO0A 4R1UA 1E1NA 3FHLA 1XR3A 3IP3A 3VKVA 1MV8A 2DBQA 2BI8A 2DQ4A 4GGPA 4PLPA 3FWNA 3HADA 5JY1A 2I5PO 5EJ2A 5B1YA 1WVGA 3PK0A 4ALJA 2CD9A 2CDBA 2PD4A 3U49A 1JAXA 4EDFA 3JQAB 5L4NA 3JQ9C 1JKIA 1X7GA 4ZGWA 5TT0A 1UXKA 3PQEA 4GKBA 5A04A 4B3IA 4BKPA 5A02A 4MP6A 1VJTA 2VZ0A 1GEEA 3WJ7A 1IZ9A 4GMFA 5T57A 3JQFC 4YBZA 3WMWA 4W9NA 4WUVA 3SJUA 2JAHA 4CMBA 3ITDA 1VC2A 3GDFA 1QORA 1LDEA 1PJLA 2QIOA 1YVEI 2QQ5A 3D4PA 4E5KA 5HA5A 4E5NA 1HEUA 3KSDO 4FPXA 5I9MA 1PJ2A 3X2FA 4F6CA 1LSUA 1DAPA 2O48X 2VN8A 3AU8A 4YJFA 1H6BA 4J2OA 4PLYA 4WNIA 4E33A 1A4UA 2UUOA 1YQXA 4NBTA 3DBRA 3IOYA 1VL0A 1DEHA 4PFJA 1A9YA 2PTGA 2HMTA 4XKJA 5FI5A 5KJ6A 3WLFA 1HZJA 1EK5A 3VTZA 2Q1WA 1DLJA 1V35A 5F21A 1GYQA 4GSLA 1TLTA 3Q1LA 4AJJA 4ZD6A 2JD1A 3GEDA 4AJLA 3HG7A 3ZWVA 3TJRA 1OC4A 1KVUA 1AGNA 2VZ8A 1GQ2A 2Z1NA 1GZ3A 3OIGA 1C1DB 2DBZA 1I30A 1NAHA 3LF1A 4OAQA 2X6TA 5T6BA 4RPGA 1IULA 3PFFA 1P1FA 4XB1A 3OFSA 1E3LA 1EBFA 4CV1A 4J91A 4CUKA 4DYDA 3T4EA 4N54A 3HDYA 1NHWA 3HJAA 2EJVA 3GF4A 1Q7BA 1ISHA 1JU9A 5ENVA 1PTJA 3LSYA 3R6DA 3IUSA 2B5VA 2BD0A 4CM4B 3CE6A 1ULSA 4OXNA 4M89A 4B3JA 5JCXA 4TVBA 5LDHA 2SCUA 5L95A 4HFRA 5CP8A 1ZMOA 1NPDA 3UCFA 3DHYA 3WGGA 5A9SB 4PLHA 2B4RO 3LC7O 1YGYA 2JFFA 1PEDA 5CHEA 5HS4A 2YZ7A 3CMMA 5T64A 3PWZA 1TVEA 1K89A 2PA3A 1NWCA 4JX8A 4O0LA 1X15A 3SC6A 1U28A 5C3MA 2UDPA 1D3AA 4QX6A 2PZJA 2EGHA 2RH8A 1UUFA 5HTOA 2E4AA 1NPTO 1YXMA 3BMOB 4PLGA 4RORA 1NNUA 1LJ8A 4RO0A 1ZK4A 2Q2WA 1H2HA 1MUUA 1W6UA 1HWYA 2AEJA 2RAFA 2O3UA 3QVXA 1GL3A 2ZYDA 4XGKA 2X9VA 4MKXA 3KTDA 4AJNA 4OL9A 2XXJA 4YACA 5IZCC 4D42A 3RC9A 1U1IA 1I0ZA 1ADFA 1FDTA 1UDBA 1DAOA 5JCJD 1ADGA 2BHLA 2FPGB 4OGWA 5DBFA 3QWHA 1YDWA 2FR1A 3EHEA 3E6AA 1PR9A 4DL9A 1QR6A 4DPKA 1EVIA 4WKGA 2PH3A 3QV1A 1XHLA 5AXAA 1LI4A 5I8WA 4JGBA 5IN4A 3O8QA 1T4BA 1DIBA 2O7QA 4E21A 1MFZA 2J3KA 2O2YA 4FR5A 4BO1A 3DZIA 3RKUA 4EJMA 4MVJE 2X5OA 2BMAA 2ILTA 3H2SA 3NT4A 3M1AA 3PGJA 2GSDA 1Q0LA 1NQAO 1X7HA 2XAAA 1HDYA 4CR8A 1R15A 2VHYA 4UUPA 5JDIA 1O9BA 5H81A 2IXAA 3I9JA 4XJTA 1KETA 5I7FA 2DFVA 3HQ4O 5GZ3A 4U6SA 5G2OA 3ZW9A 2OMEA 4B7CA 4ZRNA 4Z9XA 4G81A 2OZPA 3RD5A 4DVJA 1EEHA 4CM9A 4LRTB 4FS3A 1T24A 3RC7A 4OOFA 3EYWA 5BNFA 4R4JA 3UOGA 5C7OO 4RZIA 5L53A 1NM5A 1PQUA 2WD7B 3EVNA 2H9IA 1U2DA 4RVFA 4RPKA 5U1PA 3W4IA 1Y6JA 4UVGA 1ZW1A 1WZIA 2ZIZA 3ZV5A 3RU7A 5KTKA 3DXFA 1BDMA 2HQ1A 3GNSA 3LDHA 3TFOA 2NU9B 2DPHA 3VH4A 4MVJM 5LC1A 4K6FA 3CPSA 4MIEA 1GYRA 4EZBA 3C1AA 1CF2O 1XLTA 4FGSA 3ZHYA 4MOWA 2HRBA 3JV7A 2OP0A 1EFLA 1UXIA 3WYCA 1QYVA 1EDOA 4XX0B 3DZJA 3NGXA 4H7PA 4Z9YA 2Q3EA 4RQUA 2EF1A 1PL6A 2A35A 3Q3CA 2HK9A 4E0BA 4BNJA 1B8PA 3AW9A 2FPIB 2EV9A 2X4GA 3VAZA 3VPXA 3LC1O 1M66A 4IINA 2OXIA 1UDCA 1EE2A 1B16A 3WR5A 4D46A 2NQ8A 1JN0A 4IMRA 1MG5A 4E2YA 2Q50A 2B5WA 3DOOA 2EXXA 3L4BC 4GVLA 4KTTE 4KQWA 3S2GA 1U5AA 3PYXA 4GMGA 1ENPA 2QHXA 1ISMA 1TT5A 2JKVA 2Q4BA 2NLOA 1NVGA 3EDMA 3G0OA 4EITA 3PJEA 5CG1A 1PQPA 2UV8A 1KVSA 1NQ5A 2YW9A 1HE3A 5A05A 3S2FA 5L40A 3RUEA 4L4SA 4RF2A 3WBBA 2ZKLA 2C20A 3H6KA 5T67A 3AUUA 2ZJ0A 5A9RA 4A27A 3TDKA 1B2LA 1PWXA 4LMPA 5U9CA 3M1LA 3DQPA 3RASA 4BUCA 2H6EA 4E2XA 1I3MA 2CDCA 3TZCA 3OA2A 3DMTA 3DFUA 4CM9D 4EJ6A 2W2LD 3GGPA 3ANLA 3K9QO 3JQGB 5ILGA 1K2WA 4J90A 4XZ3A 1ISFA 1DFGA 2VUUA 4XDYA 5KVVA 4E5MA 2D0IA 4PGFA 3FR8A 1X7DA 4CR6A 1LX6A 4EI2A 3GZ4A 2W2LA 3KYDA 3DBLB 2QG4A 2Y0EA 1FDSA 4KP7A 3F4LA 2V6MA 1AUPA 2DM6A 1F8GA 1Y8QA 1TB4A 3JYPA 3FNFA 2X86A 3A14A 3AWDA 3KSZO 4IS2A 4RVUA 3IUPA 3GY0A 1GV0A 2UVDA 3BYZA 4JLWA 4CLRA 4MIOA 3ICCA 4TRRA 5B4VA 3M2TA 2C82A 4I5GA 4PZCA 3AOGA 2CMDA 2VZ9A 4OSPA 2V65A 4QUKA 2AEFA 4RL6A 4PG7A 2V7PA 3F1LA 3G49A 1DIAA 4IMPA 3BMQB 3ZU3A 5JY6A 1KVTA 3DDNA 3OQBA 3QVSA 3V2UA 5AQ1A 1CETA 4NBVA 3S8MA 3NJ8A 5KVSA 3L9XA 2C7GA 4B4WA 3QWIA 2VWHA 1JDJA 2QW8A 4BV9A 1IL0A 4LCEA 1I01A 2W90A 2D5CA 4MVJD 1PGNA 4WK6A 2VRCD 5CEFA 1V0JA 4WASA 3ASVA 1BW9A 2C07A 4CL8A 5COQA 5JNLA 4NQZA 4XYLA 4J1TA 4DC0A 1JLLB 1XEAA 2Q1SA 1ZBQA 4Y6PA 1ISIA 3BTUA 1X1EA 2GF2A 4R54A 4BKOA 5JYDA 1WXDA 4O5OA 1EZ4A 1F8FA 1FDWA 1W8DA 3BMQA 3TFQA 4BNIA 3TZQA 3A1NA 3DMTC 3K5PA 4G65A 5I7EA 4YAEA 4WOKA 2JJYA 4I9NA 2PWZA 1I2ZA 5JAZA 4HY3A 3GHHA 4OKNA 4P4GA 1R6DA 1WPQA 2AQ8A 3D5QA 1J0XO 5JMWA 3H2ZA 3DBHA 5DCYA 1JLLA 4FW8A 1F06A 3D0OA 4WLOA 3DBVO 3I5MA 5TF4A 3UHAA 4L0QA 1VRWA 5AYVA 4JBIA 5I9LA 2YFHA 4RF3A 1HDGO 5FFFA 1UDAA 5CFZA 3V1TC 2FHSA 3HB4X 4R41A 4K28A 2EP5A 5IJZA 4RZHA 3C7DB 3OJLA 3QY9A 3ADOA 1G6KA 3B70A 4Z3DA 3D3EA 5G0UA 5ITWA 1IE3A 2FPPB 2JL1A 4WCDA 4FFLA 3FBTA 5ES3A 4GWGA 3BMNB 3C1OA 3K73O 1PGJA 2CFCA 4LVUA 1QG6A 2X1HA 5THQA 1LQTA 2YY7A 4XDZA 1IOLA 3I9KA 2NUAB 2RBEA 3NV9A 2HU2A 1H9BA 1H6DA 2G1UA 2ZQZA 3I4CA 5AOVA 4UEOA 3JQEA 4NDNE 3PEFA 1HZZA 1E3SA 1RYEA 2HJSA 3UFXA 2I66A 2CVOA 3DR3A 5A3VA 3VH2A 4J43A 1NVTA 4BO3A 2EKQA 3AM4A 5KJ1A 3I6QA 1KERA 3B1KA 3IJRA 2YHIB 3MWEB 3G1TA 3VDQA 4OO3A 4K9DA 3GR6A 3JD3A 4AJ4A 3V2HA 3RCBA 1IPFA 3C7AA 2Z5LA 2VNAA 2C54A 2BLLA 4J7XA 1D7OA 3D4NA 4KOAA 3G1UA 3OEYA 1XSEA 4NU6A 1EBUA 1QP8A 4GWKA 4NI5A 4BV8A 4PG6A 3S2EA 1D1TA 1YBMA 5I7SA 3JTMA 3I6IA 4XIJA 1IZ0A 4KWHA 1LLUA 1T26A 3AU9A 1PJCA 1UZMA 3ZNOA 5L9AA 2PGDA 1QV6A 3NEPX 3JCZA 4NFSA 1J49A 4G5HA 4TZTA 2D59A 1B3BA 4XR4A 4OJNA 5HM8A 4PIVA 2GYYA 4EBFA 1I2CA 3LU1A 1LSSA 3QRWA 1LLQA 3TPCA 2NU6A 2Y93A 4YJGA 1HLDA 3JYOA 4JIGA 5JLAA 4WNCA 5TS3A 1E3IA 1Z73A 5H82A 3QQPA 4CM7A 2Q99A 2ZTLA 5B12A 3IMFA 4A03A 4CR7A 3AOEC 3M6IA 4GBJA 2HSDA 4GSKA 4F6LA 1SEPA 4IQ8A 3ITKA 3ETGA 2Y1CA 2P91A 3E9MA 4GX0A 2Q2QA 2CVQA 1JQBA 2WE8A 4MIYA 1Y9AA 2G5CA 4BNUA 1GV1A 3E18A 3JD1A 2X23A 3ANMA 3K2BA 2ET6A 4CUJA 3SEFA 1UAGA 1L7DA 1EMDA 4BMNA 5A3JA 1ZNQO 4PRKA 1CIVA 1OC2A 1WW8A 4K26A 3RJ5A 1O89A 5JMPA 2Y0DA 4FC6A 5HS6A 5HRUA 4RVSA 1PIWA 5BT9A 1H2BA 2I6TA 4IJUA 5ENDA 3F4BA 3R3SA 3L0DA 3ZWBA 4D0SA 1SCUA 2PZKA 3UW3A 1V8BA 3D7LA 4J0EA 4RF4A 3ROPA 1U5CA 1YH3A 5K9ZA 3RC1A 1V9LA 5F5LA 3EK2A 4RDIA 5C7IO 3W6ZA 1GDHA 1P77A 1HDRA 4I9HA 8LDHA 4R01A 3ENKA 5JW6A 2YHIA 1A9ZA 3QIVA 1N7HA 3QWFA 3GZNA 5G0VA 4E12A 2D8AA 1P3DA 3WJAA 2NM0A 4TKMA 4DREA 1JVSA 5L4LA 3Q6IA 3WDSA 4N5MA 2JCYA 3INGA 1MP0A 4B8ZA 4RDHA 1RKXA 2EGGA 3GMDA 3NX4A 3IDSA 2I76A 1KEUA 2EP7A 4FFNA 1YBVA 3KEQA 2O7SA 3FNHA 4BO5A 4HP8A 3DC2A 4DLAA 1DDOA 4K6CA 4RJTA 3NYWA 4MVJH 2LDXA 4A5OA 4YYZA 2NTVA 3AM5A 4IZHA 1OAAA 3OQ1A 1PSDA 3DWFA 4BIIA 1EVJA 1CJCA 1B0AA 1GZ4A 1ZK2A 1Q7CA 2WTBA 3RFXA 4C4OA 1LXCA 2GDZA 4KDFA 4CV0A 2NSDA 4ZQGA 3ZNNA 5CG2A 2O3JA 3DO5A 4JJGA 1UP4A 4AJOA 2P9EA 4J9VA 2VCYA 3WIEA 3UAGA 4BNMA 3ZHXA 2V6GA 2YQ4A 3QVWA 2FR0A 3STHA 3GFGA 3IL2A 2HKIA 1KC1A
chains in the Genus database with same CATH superfamily
1E3JA 3DKRA 1TT7A 2EBUA 4HLUC 3RHTA 3BK2A 3HGQA 3SXUA 1Z74A 3ZGOA 1XYVA 1GCAA 4BZPA 3ECCA 5IWCA 3K31A 2H5EA 1RHMA 4F4JA 2FWMX 2ZI6A 5LBUA 4GZ6A 2XKJE 5F52A 2R1ZA 2G06A 1ATZA 1QIEA 2ODWA 2WHPA 1WNTA 2XLBA 2Q4TA 3FYHA 4KFSA 4Q3NA 1QKJA 1TEVA 4YRCA 2IZ7A 4AZ3B 2FPWA 2I3BA 1IJFA 1GUZA 3IEUA 4KAXA 4ND6A 4N39A 4QAJA 1BXZA 1KTVA 1L5GB 4EMBA 3O8CA 4OI0A 1Y6RA 2I54A 3IMCA 1JZQA 4IX9A 3WL6A 3BE6A 4ZO6A 4CCYA 4MW1A 3OZUA 4X63A 1PBTA 4DAOA 2PH7A 4TVKA 1I9GA 3AUTA 1V41E 5EXXA 2Z1DA 3AF4A 5TEWA 1BVRA 2DBVO 3KUXA 4M99A 1KJ8A 3QE4A 1K7EB 2Z8YA 4KRXA 3T3MB 4A26A 3NXKA 3JVVA 2GBPA 4MDEA 4B3GA 3RGGA 2JRCA 2AMVA 4ED9A 2G6TA 1O5OA 2JH8A 4JXZA 4W5QA 1T1SA 4V0QA 3BKXA 4X84A 4MW4A 2J3JA 2BONA 4N3NA 3TJMA 1FS4A 1S9HA 3LUCA 4JJ6A 2W2KB 4HN4B 1YGPA 2CMHA 3PHLA 4D9MA 2RHWA 4WMLA 2ECQA 3RM3A 3RU2A 2PMCA 1ID1A 1Y89A 2A78A 4ZARA 3GNTA 3M6VA 4F6RA 1A76A 1JR3E 2JD2A 1JEQB 4JGIA 3ZCXA 4C4SA 1K97A 2WILA 4PLZA 4BQEA 1E96A 3HCDA 3BK1A 1R0SA 4ER6A 1X1DA 4LE1A 5E6RA 1PTKA 4TUYF 2WD8A 3ZNPA 4I4IA 4OIFA 4Y6RA 2O2JA 2O4UX 1QQAA 1RDFA 4P4NA 1KBQA 1E4YA 4GSYA 4UBLA 5E7IA 1TVKA 4FD3A 1EDDA 1ZUNB 4KWEA 4AMZA 2C78A 4A91A 3HXOA 1KDVA 2NP6A 4PLWA 3QXJA 2ZB2A 4YB8A 1RM5A 2QUAA 1W88B 2L0XA 5FWAA 2ID7A 2DTXA 3TO5A 4DT1B 1E89A 2J3HA 1GT6A 1VYTA 3ESCA 4MRMA 3U60B 4WESA 1E2JA 4BB6A 3TOSA 1T5LA 1G6Q1 1Y1LA 3DVAB 4HMPA 4BRWA 1F2TA 5IKEA 3GGOA 4N3BA 4ECEA 2VDVE 3B2EA 4UTXA 4R1LA 5E6SA 3PNKA 3ZVMA 1EM8A 1R0KA 2PNJA 1UPXA 1KI4A 3FOCA 4D9JA 3F7MA 3H6HA 3Q7PA 1MEJA 2WYHA 1EINA 2N1MA 5HJ2A 4F9EA 5KUTA 3U5TA 1MHPA 2YXPX 2HYDA 3P2MA 3Q88A 3QXXA 4CCYB 3PFWO 3UWMA 4POOA 3V33A 1R1DA 5IJ0A 3KJNA 1NMEA 3BMOA 3G85A 4QARA 3T1OA 3WIBA 5CAEB 1YMQA 3PJRA 4FOTA 4J2TA 1WSBA 2GD1O 2GM3A 3A36A 3PG5A 2JIZA 3R6TA 4P22A 4DY4A 5KNDA 3RTAA 2V6BA 2QMOA 3KQUA 3EPLA 4DG5A 2Q4OA 3TGWA 3MGKA 1MC8A 3L7LA 2NZVG 5LBIA 4WZBE 1VIDA 1I36A 3QVOA 1MBZA 4FCTA 4IPTA 4Q39A 5DN6A 4MVJP 1GAQA 3UMGA 2BKLA 3AVYA 1FVHA 4YJHB 3D02A 3KQNA 3THYA 3PXGA 1VKRA 1NFFA 1PDOA 3KP1A 3OUTA 4B3TB 3EXIB 1CB7A 4PE5B 2I99A 1T3ZA 1YFJA 5AVVA 3IAS6 1R8XA 3SS7X 2AQKA 3HVIA 4C3VA 2UZ4A 2LGJA 5C5IA 5AVTA 2ZP1A 2MR6A 1WMEA 4CIDA 5EXDA 2VHCA 2QTFA 3ZD6A 5DNEA 1K7SN 1G9XA 3NHYA 4I1PA 2ZPAA 5KNDH 4GYKA 2QK4A 4PXSA 4ZHQB 4LYDA 4OQZA 3ETNA 5EZ5A 1YR7A 3FZYA 4FFMA 7ABPA 1SUPA 2IE0A 2AD1A 2ZIWB 3EGCA 5AJXA 5J2TF 3QW4B 4HTAA 3HCBA 3F49S 4I81A 1T0PA 1JPVA 4Q24A 4O0MA 4B71A 4KLCA 3IQGX 3BJIC 2CNWA 4ZMBA 1OGIA 4MA0A 3AINA 5DISB 4OM8A 1ZCAA 3RJZA 1G59A 4GICA 1EUQA 1EYZA 2GEUA 1ACLA 3QBJA 1WCIB 3BWEA 1MJGA 2EWVA 2ZT8A 1A5ZA 4RTJA 3HYTA 4DYHA 1P1HA 5JVDF 1LWOA 4GBGA 1FS6A 1GPYA 2EKPA 3DBIA 4F11A 1RI2A 4C0WA 5KWIA 2RGGA 1A7KA 2PLWA 4I1YA 1KOGA 3M4ZA 4NCHA 1VGRA 4YRRA 1PQ4A 2AIRA 2XQFA 4DRYA 2BGMA 3AR8A 1RWMA 1L5YA 2P7HA 4MNTA 4V1CI 4UMVA 4BZZA 3WLHA 1EQUA 4R2KA 2B35A 2NMVA 1LZLA 2MMCA 3LHFA 1R66A 5LQKA 3O4FA 1DWPA 2EJUA 2JIOA 1UMCB 1XQWA 2WTAA 3IELA 5CVEA 2Y6VA 4ZVMA 4DLYA 4TMTA 1T3SA 1ZIDA 4MGIR 2IW1A 2NU7B 2YXNA 4H3SA 2Y92A 3BE4A 1OLUB 4B6SA 1LW7A 1GGVA 2E3JA 3TQHA 3UK6A 5D2CA 3VPDA 3VU9B 2ZBUA 2ADOA 2IL1A 1U0SY 4D8VA 2BH2A 3DW3X 4D8XA 3KQMA 4F56A 5HDBB 4HGZA 2PSEA 1HUQA 1Z4PX 4G24A 1ZH0A 5HKKD 2D6FA 2YIDA 4JELA 3DDUA 4PYNA 4B80A 2V5AA 3ZIAD 7GPBA 5JD5A 1MHTA 2MINB 2VHTA 2RGNC 3IB3A 4IG4A 1Z37A 1XQXA 4XQGA 4FCCA 4PRYA 3GAFA 2E49A 1HFEL 4KKVA 1QIKA 3PQCA 4HXFB 4JNKA 4G9GA 3N7UA 4X1OA 4UUQA 1J24A 3RFVA 1O94C 3VC7A 3ZEIA 1M8JA 1O03A 1AS0A 3A6KA 2O8BA 2BE9A 2W00A 1PGOA 5LMNB 3AY0A 3VUFA 2IZ1A 2VHUA 2QEQA 2VLBA 3IIEA 3KM0A 1WETA 1XEWX 1FXWF 5HWSA 4U5XA 1C1HA 1K8ZB 3E82A 4TOIA 3U4CA 4KHZA 3ZWWA 1X80B 1BH2A 4HXYA 3P0IA 3N3BC 3PIRA 4DDHA 1P1KA 2WKPA 1CY4A 3ZWXA 5LQAA 2B99A 1TUIA 1LEHA 1VG9B 1X3SA 1RPTA 3VV2A 1K7FB 2I80A 4P81A 3J81k 4BX8A 1Y1PA 3VVMA 4YV0A 4OL0A 4MRAA 1GKIA 4KO1S 3AG5A 4BE9A 1XJ5A 1N1EA 2AN4A 3HL4A 1JA1A 5ALMA 3WWYA 5JSZA 2PRZA 3ILYA 3M82A 3S4YA 2OFFA 1GPNA 1C0IA 4HMQA 2CJWB 1KU6A 3LBFA 4E6EA 1MB3A 3WICA 4FDAA 4IXWA 4XWTA 3EA4A 5F3WB 1YZFA 3P9IA 4AM8A 3AT1A 4PIPA 2G7ZA 2A58A 4ZJUA 1L4GA 2QRVB 2JCSA 3BXPA 4HNVA 5FI1B 5CFRA 5JEDA 2XB8A 3W6NA 1SCAA 2PUTA 2Q1YA 3DTVD 1SR8A 4GEGA 4OJTA 4DDMA 5CD9A 1G19A 1V8OA 4LDJA 3I73A 4MV4A 4IO0A 3WL3A 3QUCA 2EZTA 1RR6A 3L0OA 4PCUA 1IATA 3LYUA 5FUMA 4IOJA 1BVUA 5BSRA 3U7QA 1Q17A 2B8WA 4FWIB 3KVVA 4X3CA 1VECA 1V16A 2RSLA 3B36A 5TY0A 4F06A 1TAGA 3JSAA 2GVNA 5HIAA 4E11A 3QPVA 2G63A 4EYEA 2GDJA 2BN4A 1F8XA 3ZJ5A 5LP6B 4ZOLF 3GJ4A 3MHTA 1GUBA 2Z3VA 1Y6QA 1CBUA 4CM1A 1MH1A 1F0NA 2FSFA 5AM3A 1ZP6A 5JS7A 3GJZA 1K8QA 3C14C 1LQUA 4BXOB 4ZYXA 3W2HA 1W76A 2E87A 2YV1A 3EIQA 5CK4A 5B37A 1ABEA 3UICA 1COZA 3FJYA 3L8CA 1YQWA 3VPBA 4YCMA 2VWPA 3WLRA 1Q3TA 2R5WA 4LXUA 4LVCA 2YJZA 5I4BA 3CLRD 1E60A 4UCWA 4B6GA 2HFJA 1IOZA 4HWTA 1QH1B 4P3YA 1NJ2A 3BE5A 3OIVA 4LSMA 1JQEA 4RIFA 3SXUB 4RTSA 2ZWAA 4H16A 4IF6A 3V48A 1BH6A 1NJ5A 2JGMA 4N3GA 1UDWA 1QGOA 5ITZB 4FMPA 4PFSA 3V1UA 1HI9A 1WIWA 3GJ7A 2PVSA 1R50A 4Z3OA 3WTCA 1QO0D 5PNTA 3IEKA 4N0QA 3PCTA 3C8UA 2PTHA 2QSYA 4WDQA 3UB3A 4OBXA 3H4VA 4LYJA 4E31A 4JFRA 1QIJA 3BMCA 1KYYA 1XKQA 4U7FA 4ARSA 4KUEA 4DARA 1P19A 3CZCA 3CW8X 3PS9A 1E3QA 1JPUA 2XB9A 4PCVA 2CDRA 3M2PA 4MQEA 1PP4A 1TCCA 4EPVA 3CUTA 1H8HA 1MO4A 4AWBA 2ONYA 3MLAA 3H97A 2RK4A 1IMJA 1E1QD 1KR2A 1KYQA 4QGBA 4Y2TA 5IW8A 3ZDEA 4ZEMA 5KO2A 1O0BA 4L28A 3CR3C 4OEHA 4RSHA 1I2BA 1Y8AA 1UC9A 4DQDA 5CFOA 3HB9A 3G82C 3S81A 3OX1A 3WGMA 5DX0A 2ZGVA 5DN9A 2OBLA 2ZUSA 1FTWA 2UKDA 1Y1QA 2FK8A 4MR7B 4KXNA 4ZAFA 3SHVA 1UZNA 1IY9A 3IJEB 1XELA 5JISA 2EQAA 5T4BA 3ELDA 2AG6A 2GBIA 1D7AA 1V37A 2HLDD 2ZBRA 3K6JA 5CVVA 2PUCA 3FOAA 1IYZA 1E7MA 1VSUA 3PDWA 3TOCA 1R00A 2JI8A 1O9HA 3F2IA 2AG8A 3NB0A 2RHLA 3P9NA 4LBVA 3HUEA 4HH0A 1NUPA 2X9LA 5P21A 3RWOA 2XITA 4GQBA 3O2NA 4EY5A 1C2TA 4HH3C 2BBWA 4HNHA 3RRJA 1EFRA 1ZH6A 2RDMA 1E7WA 1PYGA 4LOLA 3O4IA 2HF2A 2IHZA 3X1MA 4EO4A 1DXHA 1L5QA 1K5DA 5AP9A 1JQLB 4QQKA 1BW9B 4UW9A 1XFAA 4ZVQA 5ADUS 1XRRA 5AJTA 2GCOB 4R8MA 5DK4A 1DOHA 1GLGA 2IP4A 3N74A 1V11B 3K4QA 1FTQA 3B5JA 2NO9A 3HU2A 1BN7A 4AKHA 3K8OE 1B0ZA 1WCYA 3I39X 2VQ6A 1NJFA 4R5HA 4D0RA 1EXDA 4JI8B 4TSFD 5GMOA 3BWXA 4I50F 4LIPD 1JIVA 1S2IA 2H31A 2YZKA 1U3DA 5E4YA 3SF8B 3OM9A 1ZL0A 2ATEA 2ODNA 5JDIC 3DL2A 3I42A 1P0MA 3C7KA 4WJZA 5EG5A 4E09A 3KX2A 3LQQA 3VC2A 3ZHUA 2V7EA 1XN4A 4PHHA 3E03A 3H8VA 3LX4A 4IXTA 5AJHA 5LYJF 2C59A 2QZSA 4GLOA 1XV5A 4OHWA 1DELA 1IIBA 3R0IA 2J7KA 2HC9A 3KJIA 5CJ2A 1T9ZA 2B78A 3SNKA 2DHDA 5KINB 1PJ3A 5FNZA 1M1YA 3OQOA 1XPOA 3BHMA 3C3XA 4ZC1A 1B8NA 1YI8A 2X7JA 4PXAA 4EKYA 2FUCA 4HQ6A 1BJKA 1GGKA 3C6QA 3NWBA 1MQ8B 4Q19A 2WJGA 1ABFA 1N7IA 4AZ0B 4BNZA 3I09A 4W5OA 4BLTA 4QXMA 3IEIA 5AK5A 1NMQA 1G63A 1TRHA 5B58C 2XB4A 4CFZA 3T06B 2J33A 3R7FA 1Y9EA 3VH1A 2BCJQ 1XU4A 4UFPA 3T95A 3ND7A 4MVJF 4KO4S 4WTOA 3BGDA 3BCSA 2HHJA 5FBVB 2WWWA 4BB0A 3Q40A 3I2HA 3TB6A 4AJ2A 2GCPA 5FTWA 1Y8RA 4JL6A 1IEXA 1N5DA 4OJMX 2QVYX 4ER3A 3WV4A 1K27A 2H4JA 3C8ZA 3W9SA 4JVMA 1DGQA 1H8EA 4FZJA 4FHZA 1E69A 4WEOA 2PE5A 1TFUA 2K2WA 4JB2A 4DGSA 2I91A 1F6DA 1J8FA 3F73A 1RI5A 3STYA 4OP2A 2AQHA 3CPHA 4GGOA 1NI5A 1KDYA 3QBTA 1JIIA 2AUMA 1E3WB 2GX6A 4Q4HA 4F3TA 1TCAA 4I50B 4OX9B 1E1MA 3HP4A 2UUBB 1QQ6A 3LL7A 3SJ7A 6Q21A 4JA2A 4O1HA 4Z0NA 1TYAE 3PGXA 2H65A 4OJQA 4HPJB 2O2CA 3ICWA 5M34A 1ZGCA 2QSUA 1T8WA 3TOZA 2WSIA 3S29A 3D0QA 4K9OA 1QH8B 4AX8A 2BM0A 2UYYA 3FNGA 3WYDA 4Z3KA 9GPBA 3O2QB 4IGKA 1QRSA 4YAIA 1O8CA 3T3OA 3IBYA 3PRJA 4RD4A 4WEQA 3RFFA 1BC5A 3WC4A 3PQ5A 4R51A 4B2PA 2FP4A 3EYAA 1B8VA 3IPCA 2BI4A 4J3FA 4HTFA 3C0KA 2BEWB 2O2GA 5J2UB 1Q1GA 1WWKA 3FUCA 4KQCA 4RV5A 1JR6A 2ZQYA 3DE5X 1JHMA 3PD0A 1V7CA 2BFCB 2OB2A 3MJTA 1CPYA 3MTGA 4FCWA 4Q3KA 4QYIA 4XQEA 3SXPA 4GM0A 2G76A 2XMQA 5TMBA 1B4DA 4MI9A 4GI2A 2XGMA 3RNOA 4O25A 3AJAA 2CXPA 2C5BA 1EFPB 3B6KA 2RK3A 4IF4A 4M6WB 3QSYA 4HGQA 2CLCX 4LY9A 3O0DA 2BELA 4I8XA 5BN4A 1WBBA 1P5JA 1V5WA 1BOOA 3P0RA 1ZJ6A 3W34A 4DTCA 1Q2UA 3ABRB 3D4OA 4P7JA 2UXBB 3AETB 3IULA 4Z2YA 1GUDA 4YGXB 5TQ0B 2PH5A 3OOYA 3EBLA 4B7XA 3RAEC 4R8RA 1CIJA 2X8WA 3UK7A 1ZK0A 3RRMA 4MV7A 2DB3A 1NXXA 3T54A 3FCUB 1LBEA 4HQOA 3QFSA 1NOJA 1RC8A 4WOPA 3HMKA 2N75A 4RD1A 4RWZA 2WLSA 1NXVA 3U9LA 4BE4A 4ZAWA 1NP3A 5FAKA 4NZOA 3T1TA 1X1QA 5K3DA 1K5PA 1JHZA 3B12A 2ZE5A 5HIIA 1QHHA 8AT1A 1V1JA 3CLTD 4F72A 2FVYA 1KC3A 5F35A 3T8YA 1N6PA 2ZI5A 5A6VA 5AHOA 1U4SA 2BDUA 2ZRFA 3ZWCA 4B3RB 4W7IA 1A82A 2HV8A 2PMDA 2UUPA 2WIKA 3U0BA 4BX3A 3K0CA 5KQPA 3II6X 1EVLA 2WR8A 3RFTA 3FCXA 3U6BA 3NDJA 5KC9A 2ORIA 3R7SA 3Q7RA 2PBLA 4UBNA 3THRA 3P94A 4W5WA 4ZQHA 4YJGB 1Z5ZA 3BQMB 4JJEA 1ORDA 1JFRA 3D3WA 2FSSA 4FU0A 2B4YA 3TLMA 2X0JA 2XDQB 2ZRCA 1JEYB 4F1WA 2I71A 2MYNA 2QVBA 3COZA 1PK9A 4A6EA 3H8WA 1C3VA 2G5PA 5FBWB 2DFLA 3WYAA 3VBEA 1N6NA 1T1IA 1GU1A 1L1EA 3H9QA 1NE2A 3L6BA 3TDMA 1Y98A 4E4RA 1DKQA 1JXOA 1S1CA 3INYA 4CMAA 2XH8A 1CR4A 5BNZA 4U3JA 2AC4A 3QKIA 4J4BA 3TRKA 4EQZA 4LHVA 2P5SA 4FFWA 1EHCA 2F64A 3G2LA 3G9UA 1KSFX 2NU8A 1QF6A 1U3UA 1NOIA 4ZQIA 4Y98A 1HYGA 5IUKC 1FU4A 1H69A 3SK0A 4ENTA 3E9QA 1YZQA 4LX0A 2FPOA 2WYUA 2Z8ZA 3MOIA 4KWTA 4RVOA 5JNRA 1ZM9A 1BE6A 1X9HA 3QFHA 3ASZA 3DKVA 4W5HA 5JXIA 4R2MA 4KFRA 4ZZ0A 1QYIA 1IEVA 1AMNA 2KBEA 1CEXA 5JJCA 1M2KA 4ZYTA 3EB9A 1PFQA 3OCJA 1C8LA 3L7CA 4HZGA 3MJFA 4J16C 4S1VA 1HE5A 1OMOA 1QR2A 3OOJA 2WWRA 4A0FA 5AW3A 4EB6B 3PBKA 3GLIE 1DJNA 1W36D 4FFBB 1DC6A 2A9VA 2WUFA 3G0DA 3GELA 2FSHA 5A03A 1SC4A 2Q28A 1BGVA 1G7RA 2X8JB 4G1MB 4FYJA 3B8EA 2QPAA 3KYDB 3E48A 4QLAA 3TZKA 4EUEA 4TVSA 1CS0B 3WRXC 5KYWB 1J2JA 3CNEA 2X8AA 3E9YA 3H4TA 3I6ZA 3IUEA 3QTLA 4KLAA 4LSGA 3V7WA 4ZKEA 5C8XA 2EG5A 2QI9F 3DE4X 1XG5A 2F00A 3TRJA 1RWBA 4F45A 1Q0RA 3MWYW 4M54A 1W0JA 2AFHE 2P9BA 5FJIA 1E1QA 2RI6A 4N6NA 3KTAA 3Q9UA 3G5UA 3QI2A 4NECA 1AN9A 3E4DA 3OQMA 4JI4B 5ULLA 3T7IA 4EFNA 3E1KA 3RIHA 3EEYA 4C2BA 1KMHA 3KQPA 1QDEA 4TGLA 4G6ZA 3UJ9A 3QWAA 3V7NA 1YB4A 1IY8A 3DLAA 4F5ZA 1CDZA 4EHHA 4MK4A 4U7JA 2CXHA 1PNVA 1I2DA 1ZGHA 4KC0A 1DMRA 3RQIA 2JIZD 4I1VA 3UUEA 3ZBPA 2X3YA 3VZRA 2WWIA 4F7DA 3F2VA 2AN1A 1YMUA 2YFYA 3VHRA 2DOKA 2J32A 3B85A 2NWQA 1JLRA 2EL9A 4FYMA 3JD2A 4JEMA 4N65A 1FIUA 2G5TA 2FG5A 2D3TA 1OZHA 2D1RA 4PF1A 2R8ZA 5JNSA 2XOEA 4HVTA 4M38A 3ZQUA 2QENA 4WFQA 5IH7A 1HM5A 3JYNA 2QMUA 3OQPA 1Z2OX 5SICE 1KGSA 2HTEA 4KPUA 4LXYA 4FOLA 3AQIA 4Y1EA 4FIDA 1RU3A 2Q5IA 2MHCA 3LCRA 3VVBA 4X0EA 4PG4A 1PDWA 5FOQA 2WM9B 4TM7A 4QYSA 1WUHS 3P71T 1T0HB 1DKLA 1JW9B 1G60A 1XZAA 2HR1A 5C5EA 4F3NA 3PIDA 1XZGA 4AULA 1EK0A 1EIZA 3WG9A 4LRWA 1A8PA 1OZGA 5K0ZA 4GW3A 4TRMA 1AC5A 3H5IA 3FKQA 4WY5A 1T3TA 4AG6A 2CFRA 4OUKX 3JQ9A 5B4UA 3ZHQA 2GPSA 3WB0A 1WXHA 2B82A 2IRWA 3KR9A 4XRGA 1N5RA 3OY2A 5CVTA 1E2BA 3WO1A 2BGKA 1RHUA 3AKEA 4MV8A 2OT3B 2F2TA 3HCCA 5HCUA 1I7SB 3SQXA 3OLQA 2Z4RA 4JI6B 5K09A 4DNPA 2XZDA 4RZSA 2JGDA 5AW4A 3LV8A 5CLGA 3EQZA 2A5LA 4M1TA 4GXTA 1FLNA 1SIUA 2OGZA 2R85A 3RREA 3KVOA 4DV1B 3MMPA 1FJ2A 2NU9A 1FW8A 4ROSA 5JCJA 1SUIA 5KEIA 1NG9A 3BFPA 5KQGA 1B2RA 5FHQA 3O90A 3PFCA 4N8EA 2A6PA 2ZSEA 1DRUA 1E59A 3L7BA 3E35A 4YT5A 1GY8A 2ZT5A 4QULA 1H23A 1L4KA 1G16A 1U3VA 2PMFA 4P3KA 3I23A 3TG8A 2HDHA 1YL7A 2LKDA 4U1RA 5K2MA 1AK1A 1PG0A 4FZRA 1JH8A 2IYFA 2SNIE 4Z0PA 3CVUA 4CJXA 3TECE 4DCMA 2QOEA 4NU5A 4RA9A 1GEGA 1EHIA 2CC2A 2Q0SA 4M2LA 4ML3A 2C4HA 1U4NA 5F1KA 1X19A 5ARBA 3N8HA 4QEZA 5IHPA 2FPXA 4UPEA 3GIWA 2IYYA 5I4IA 2QYHA 1TX4B 1YSCA 1XD2B 4HDQB 2CFTA 4KGXA 1UK6A 4PV7A 2Q7OE 5DM0A 2JI4A 3LBIA 4EABA 3DBLA 4G1FA 4QHYA 5EI5A 2P9QA 2OWDA 5KJEA 2H0QA 5ALUA 2I6GA 4CU2A 5T41A 1T4CB 4FOOA 2QT9A 4FKBA 3E0QA 1EGMB 1XQ6A 3IQIX 3L1VA 4XUGB 3FGPA 4KFCA 2ZLBA 4PQYA 3GA5A 3DAHA 3O75A 5HKKA 2DTEA 5JBNA 4AUEA 2OKCA 4TMZA 2C2KA 4KR0A 4LYFA 4ND3A 5L7TA 2JKZA 2PQ0A 1ENOA 3RVLA 5IBPA 4IIJB 5KVCA 4B3DA 2JFGA 3FFAA 2HMAA 4S12A 3RB8A 4CG0A 4O3MA 3RVJA 3HVKA 3K9CA 5L3ZA 1XWWA 1T9HA 4EZEA 3ZTTA 4K6MA 2FOLA 4YH1A 3MD0A 1RJ9B 3U0VA 3WLQA 5C80A 4D1YA 3T41A 3OICA 3LW7A 1GRRA 1WUIS 2P9ZA 1UFQA 4BN4A 4BL5A 3BFXA 4Q93A 1G3QA 1TJ3A 2YV2A 1RPAA 3DZGA 1DAHA 2XZOA 4HQFA 3UKOA 4UUNA 4LX8A 4PM4A 3LLVA 1JV2B 2YOFA 3QJGA 3SX2A 3F9IA 1EGVB 1KZ4A 2EFEB 4UD6A 3KT8A 4CKCB 3S1LA 4HL6A 1QU2A 4YJDA 1UJBA 4KLNA 1UM8A 4U9UA 3I05A 5D7NA 3N8GA 2P7IA 3U4QA 4PQRA 2DVMA 4Q05A 4QQRA 2E6UX 2AI3A 2Q6KA 3A7EA 4XEHA 4YLGA 2ZB4A 1STOA 3JR7A 4BBZA 4FYKA 5EMKA 3WGQA 3M6UA 2J09A 4G9EA 4DPLA 2FPMA 2FEMA 3IQEA 4D9HA 1GOTA 1VRVA 1VIVA 1DT3A 2EERA 2Q4DA 2XR1A 3KYCB 4H3HB 3VU1A 3AM3A 3N39C 5ERYA 5J40A 4LECA 4MLZA 8MHTA 8ATCA 3RYTC 1XT6A 3HCOA 3W4JA 1SC3A 4G0QA 3K6RA 3WXBA 4BWVA 1Z7BA 2OO5C 4EG3A 1ZUD1 2D2IA 1DUSA 1Q14A 5EZSA 1ITZA 4HUQA 3CRQA 3O6VA 1M73E 2X8LA 1E58A 1TVKB 3H9UA 3HTXA 2XF8A 2EJTA 3UXEA 4DW8A 3ZU6A 1AIPA 2QR5A 3IBTA 4IJQA 3JYHA 2H3EA 4FLMA 4KO3S 4YRDA 3T9AA 3HR4A 5M5BA 1RZRD 1WBJB 3OX3A 3MJ4A 3O94A 4KNWA 1LS6A 3M9LA 3NNSA 4JT2A 4NMWA 4R8LA 3SYRA 1CQZA 2H5JA 2IC5A 3DT6A 3N8DA 4RCYA 1U5BA 5LXTB 3SWWA 1CF4A 2HZ7A 1EFUA 3HDQA 2VF5X 2OCLA 3CLVA 2ZJ2A 1SCJA 4FS8A 5AXBA 3QFTA 1QP4A 3U62A 5JROA 1P6XA 5KNBH 4M7OA 4YT2A 3C6ZA 3VNSA 5IF3A 1GPDG 5CGZA 4BRZA 1FVFA 1QDUA 1NI3A 1Z5WA 1ZOIA 1WXGA 5GGXA 3P0JA 4JL5A 2QMEA 3LWNA 3QE0A 6NULA 2ORWA 4DB4A 3ND6A 5JDCA 4OKSA 1U0FA 4LBYA 3PX7A 1J20A 2EZ8A 2FUNB 1R7RA 1ZI6A 3ENQA 4QYXA 3W7VA 2XRYA 3RVDA 3WZLA 4AJEA 2QMYA 2C5HA 2BSAA 4Q4JB 4LISA 1W5EA 3MGGA 2PX8A 1WZEA 4LY0A 3DCNA 4MP8A 1N57A 5C1OA 3ZOKA 4QO7A 1P4HA 1CRWG 2DUWA 4ESVA 1MC5A 1L1RA 1RZUA 1SKYE 3HJCA 1FFYA 2XXAB 4AZ3A 2JVJA 1U8CB 5A1TA 1WMFA 2ZIVB 2IHKA 2Q3BA 1UMCA 1GZ6A 2QG6A 3DOJA 2AKYA 1Q0UA 4W1RA 4BVAA 3TRHA 2BEJA 4YECA 3DTNA 2FFJA 4BO4A 1Z7YA 2GXSA 4DILA 1K63A 3E9EA 3FVTA 1ZQ1A 2WW8A 1V1MB 3GJ3A 5BSKA 2PT6A 1FFWA 1SQ5A 1EUCA 2B6HA 1YS9A 2GBLA 3D64A 4GVXA 5FO1A 2WZCA 3IEXA 4IMIB 3HA7A 2RHOA 5LZ5A 4C0KA 5AVWA 1UWKA 1N1GA 2HLPA 4OQXA 4MITA 2CY0A 2OHOA 2V3CC 1DKMA 1U3FA 2O7RA 4L15A 1LBTA 1J7JA 3I2YX 2NSLA 3GCWA 5AW8A 2J9GA 3UANA 2FW0A 3U9SA 1WPGA 3V3TA 4C4YA 2ZJ7A 4B35A 4LZNA 2OFWA 4H6XA 3A58B 4MUAA 1M8GA 3I5AA 1KAEA 3O8LA 4I36A 1X42A 4AUNA 1HG0A 3WL5A 4WV3A 2FW6A 4TTAA 4RKEA 4YP5A 4EYGA 2NXNA 3GLTA 4LKOA 1BYUA 4WN3A 2R60A 2WAMA 1RLJA 2JIBA 4IIVA 4DVGA 5DHQA 3OQIA 4NEHB 2OMKA 3GG2A 4CG1A 3S2IA 3LWBA 1NMZA 1ORHA 4G4SP 1JIUA 3CVWA 3W7AA 2QNIA 4JU8A 1AQIA 3K4HA 3L4BA 1RBQA 1Z08A 4AO7A 1D2EA 1KJNA 1W1WA 2F1JA 3TRFA 2IYLD 4G2TA 4XB6B 4BMCA 4FYIA 1NXQA 5AKIA 2DF8A 2V8OA 4KJXA 4R1PA 4TQ9A 1XGKA 5M04A 2I9PA 3HUUA 4TMFA 4AWXA 2I87A 1DBRA 4O4LF 3EXHC 3PX2A 1NN0A 1SIWA 3BIXA 3ETJA 3GZNB 4N9QA 4R7GA 4EK9A 3CXRA 5EOVA 4M49A 4ARVA 1G5QA 5G0SA 4BZQA 3JAMA 1XCGB 5HG0A 2R7NA 3GBPA 1UEJA 4FXOA 4UARA 4GWLA 4EX6A 1VG0B 3JQFA 2GZ2A 3WK5A 1Q6YA 2EW8A 3BFVA 4BBJA 3O3NB 4KUHA 4UZFA 5LOVA 3AM1A 3KAKA 1FFXA 3B13B 2FPIA 3CN7A 4W9RA 4RPCA 4EP1A 3H9JA 4C0SA 3ND8A 4IMJB 1P4SA 4NDAA 3PJFA 4RH0A 1J06A 1YACA 2P3LA 4OHOA 1T2DA 2H1SA 3NPMA 2A4MA 5CVUA 3RT7A 4UQLA 4YREA 3RUAA 3EMDA 2AFRA 4WFKA 1Y81A 3I12A 1QQ5A 2OECA 3H3JA 1TD9A 4HAOA 5JNUA 1KP3A 1LBSA 1P75A 5ALYA 2FPLA 1MENA 2YJ5A 1N2XA 2WKRA 2MDTA 4G0ZA 1KI9A 1MJNA 4PTYA 5KTRA 4I8DA 4JLBA 2CSUA 4NR0A 5KYKA 1QLWA 1PS0A 5DV9A 1V2GA 1H3EA 1F7VA 1GILA 2BUBA 4LRSB 3WISA 3BXFA 3H2BA 4UM5A 2GZ3A 4ZGGA 3WKAA 4OK6A 2ZIAA 5JWHA 5H16A 1W5FA 2AOUB 2D13A 1QO7A 2RG1A 4B6QA 1K6EA 3U7RA 4A2CA 2E37A 2QYSA 3TMYA 1KK0A 1H66A 3IOEA 4CQMA 1GZ7A 1G5IA 4FFDA 4YWHA 1D4ZA 2DUNA 1EVZA 4NYMQ 2GWRA 1HFKA 3GRRA 4S04A 2DFNA 1CUEA 3KU1A 3GP8A 1TIKA 1UM9B 4AYTA 1H1LA 5AVXA 3GLIA 2VYFA 3I37X 3PXXA 4K9SA 3B38A 1WOYA 5CA1A 4MRRA 2Y68A 2DECA 4YRBA 1UKBA 3W04A 4RKFA 1J1UA 4FW9A 3LHSA 1LGYA 4JQCA 5FIUA 3U26A 2MCFA 2C3OA 3VPFA 3WHIA 4NF2A 1F38A 1J0BA 4EKGA 1A27A 2W83A 2BBTA 4PYOA 1Q19A 3U7FB 3E15A 4HDOB 4ZV7A 2O9JA 3PDIA 2QAGC 2FPGA 2YIJA 1SHLA 3KXDA 3I9NA 2JJ2A 1UBJS 4L95C 3PC2A 2OBMA 4DIMA 5A4AA 4DYVA 3IFSA 3TQOA 2EKLA 1TM2A 1SO8A 4CQLA 2D4AA 1CLUA 2O8FB 1T0JB 2CXUA 3MAJA 4IP0A 1PNTA 1H6AA 1T8UA 4PZEA 5A4JA 2BIFA 2CMGA 2BSQA 4BU0A 4HVCA 4FP9A 1F0PA 1UM9A 3NOOA 2D7CA 2G80A 3BSWA 3WFJA 2VDNB 4X6XA 2IS6A 2Q0QA 2WM2A 5ADHA 4INPA 3IQZA 4G0XA 3TL6A 2P9JA 4IHQA 2WHQA 4KBYA 4G26A 4CKCA 4D82A 1PI3A 3FPHA 3ROKA 3COJA 2AMYA 1T5OA 4JQOA 1DB3A 2IP1A 1X1CA 1OJ7A 5JLJA 3FMVA 4C87A 1OTHA 1Y37A 2BGTA 4I0WB 1NNLA 1Q1AA 1T91A 4ZP1A 2LP4Y 5K4AA 3TM5A 2FDRA 3KZMA 4REMA 5DDIP 3GLHE 3RQSA 4URFA 2PLAA 1O87A 3V42A 1AQJA 2RD2A 3FUTA 3X0DA 1Y5RA 1JTVA 4ZI7A 4B5KA 4Q1VA 3QLEA 4LNUA 4B3MB 1PQWA 3U81A 2G1JA 4RM3A 3Q7QA 3W6OA 3PTAA 3EX7C 5AVYA 1PL7A 2HRZA 3EZNA 3ITEA 1ZD2P 1NYTA 2AOVA 3CX6A 1YZKA 4KH1A 5EVCA 3EMKA 5GV8A 1MTOA 3WGYA 2C3UA 4GRDA 4NNPA 4IVRA 1FTSA 3W3ZB 1JA9A 4EYSA 1Y4ZA 4K0KB 4Z4FA 1Z7WA 4TS1A 1JSLA 2Z83A 4L8LA 4V3CA 4BNLA 1SUEA 3OPMA 3CC8A 2P6NA 2BFAA 2PRJA 3O3OB 1GVHA 2GRUA 2P2YA 1Z36A 1WHTB 3A6DA 3EF1A 4IM7A 2ZUFA 5I9TA 3L1KA 3L05A 5IYZA 1I5RA 2GYUA 2SHKA 2Y1EA 4AQYB 3TI7A 4I55A 4L4RA 2J3EA 2QY9A 4AECA 2E5FA 3M7IA 4M0UA 1U28C 1DIOB 3UV3A 4CF5A 1D6JA 2GNAA 2UZIR 2XDWA 5LA6B 4D3ZA 2DLDA 5BN1A 2A1TS 1TM5E 3D43A 3MQFA 3EXFA 3K71B 2SECE 3SR3A 4DCOA 5FPSA 3A9UA 2GO7A 1JFFA 1PGPA 1BXKA 4TZKA 2W6ID 2YHUA 3A6PC 4WZ6A 3W2EA 3LT0A 4EJSC 2AE2A 3PUJA 1SG6A 3AUJB 3VBCA 4ZODA 4P92A 3M9WA 1Y3FE 4GBMA 1XUOA 3BGIA 1YL5A 3TL3A 3A06A 3ZC3A 3MINA 3PYLA 4EFLA 4V0RA 4R5MA 3TR5A 2ZIGA 2PR2A 4Q02A 5TT1A 3GVHA 4ZANA 5LQUA 1NLMA 1KI7A 1E6EA 4H31A 1TRKA 2PLRA 1PRYA 3M89A 4IIJA 5IAGA 3ZWPA 2Y1OA 1LPNA 2C4UA 3GLVA 3O83A 4P4TA 4X6UA 3P19A 4WD3A 5AO9A 4BKRA 2C7OA 1Y8QB 3G9XA 2Q8QA 5IM4F 1QAOA 2WHXA 5SZJA 2LRHA 1F6WA 2OGTA 1X70A 4MKRA 5ILQA 4QGFA 3N6RA 3L82B 2VP3A 5DBOA 2O2ZA 4PYQA 5DHAA 3TW8B 2IOYA 1EFCA 2POCA 1M1NA 3BRCA 1MNQA 4RU1A 3IVXA 4D4KA 1WABA 1Y7IA 4NE2A 1EUCB 3FTQA 4RETA 1QCCA 2WIJA 4E1BA 2ODPA 1Y5MA 1I24A 3QVLA 3V97A 5C8DA 3P0FA 3A6GA 2QTBA 3OE5A 2PEYA 4IJKA 4OSOA 5EIWA 5EMHA 2R2AA 1ZMBA 1FMCA 5A4IS 3C3DA 4R3NA 3H7AA 1OI2A 3TZEA 5E3JA 4EJFA 1JWBB 1NNI1 4YCBA 2R84A 2YNMA 3BD9A 3NM4A 1YK1A 2FA9A 3TEJA 3FMOB 4XTRA 3FYSA 2QN2A 2X13A 3NIBA 3INRA 5E8JA 3WL7A 3MTJA 4OMUA 3WA7A 3T7TA 1M6VB 2AN3A 5BV7A 2O4CA 1Z5VA 3UJAA 5JE8A 2ZYHA 4ER5A 3BTVA 4QOIA 2VRNA 3OD1A 1FX0A 1C4WA 3E7PA 4TTRA 5ETJA 4RNDB 4ASUD 1AN0A 1NLZA 3U7HB 2VHZA 1RLUA 1E0SA 1TK3A 4N9WA 2ZUEA 1NVUQ 2YQZA 3E3LA 4XOIA 2C97A 3KKQA 1A4XA 3M5PA 3PT9A 4XUCA 2IUUA 3JPWA 4OLFA 1CQIB 2W70A 3UV7A 4BVEA 5KHLB 3QEOA 4P98A 4HB0A 2FPUA 3SQDA 4CEIA 4UU0A 4PC3A 1LJUA 1PR5A 3VU8A 2H85A 2HSJA 4DIOA 8ABPA 5BR7A 2JBAB 1OBCA 5B3LA 3DOHA 4ZN6A 2XCLA 1A8HA 4YMGA 3J7AC 1IDOA 1TF5A 2AFIE 1B1AA 1C1XB 1SOVA 4CKEB 2AF4C 4PN3A 1FB5A 2GTPA 3E7DA 4HPWA 3AUSA 2QNRA 5F77A 1E9DA 1HSOA 3R2JA 3HU5A 1XRJA 5IMSA 1NL3A 1WDWB 5AW6A 4RFSA 3T3DA 2IUYA 3NNDA 4FNGA 1YOBA 3U4GA 1GTRA 4KFUA 2W93A 3UW1A 2O5EA 4R1OA 1E98A 3DULA 4BFWA 2PLFA 1PJQA 3SEAA 2IKQA 5LQNA 2NVUA 4F4FA 2B61A 5LB4A 1P60A 5C2JB 3U09A 3L7OA 4FYXA 3VKHA 1GQYA 4FN4A 5K0TA 4YHHB 2LCFA 4P82A 4XH9B 1SVKA 3WHKA 4NHOA 2IX3A 1N3BA 1XXLA 4IDAA 2PJDA 3TM4A 1ZCBA 4PAWA 2VBIA 2O5CA 1ZA2A 1BX1A 2J67A 1UOPA 2ZM6B 3DVQX 1I13A 1LI7A 3NKLA 4Z6KA 4H08A 1JKXA 1YE8A 2GLXA 2IPAB 4QLBA 5ED4A 2EDCA 4UUMA 5AKZA 4FR2A 2R97A 1N6KA 1V5EA 3AVVA 4QUJA 4AF8A 3CH4B 1DKOA 3JS5A 1DJOA 1E0KA 3V2GA 3S5UA 2FPPA 1A72A 2GMWA 2OCBA 4MWTA 2QX8A 5DBIA 4YXFA 3WL8A 3NASA 3GFVA 1JSXA 4JVOA 3IDAA 2B7CA