2CT1A

Solution structure of the zinc finger domain of transcriptional repressor ctcf protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
b'GSSGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor CTCF
publication title Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ct1A01
2YU8A 2EMXA 2YTFA 2EMBA 1G2DC 1X5WA 2MKNA 2YSOA 1RMDA 2WBTA 2EN3A 1DGCA 2EM8A 2YU5A 4R2AA 1KJKA 2EM9A 1X3CA 4R2QA 2EL5A 2JP9A 2EN4A 2EPXA 2EN7A 1A1JA 1ZAAC 2EOZA 2I13A 2WBUA 1BBOA 2RSIA 2CTDA 1B69A 2EPCA 2EQ1A 3M99B 2EM0A 5KL4A 4F6NA 2EN8A 2NABA 3EPHA 2EMLA 1AAYA 2ENHA 2EMWA 2EN2A 1A1HA 5KL5A 2ADRA 3EPKA 2YTOA 4X9JA 2EOYA 3EPJA 2EOMA 2ENCA 2A25A 2EM6A 2EMIA 4WSGA 1A1GA 2YTEA 4R2CA 5KL2A 2EMKA 4F6MA 1JK1A 1G2FC 1BB8A 2PRTA 1UBDC 2MKDA 2EOQA 2EN1A 2RPCA 1A1KA 1A1FA 4R2PA 1ZR9A 2DRPA 4M9VC 2YTQA 5KL7A 3VHTB 2R1FA 2VRDA 2EOFA 2EM2A 1WJPA 1ZU1A 2MDGA 2EQ3A 2LO3A 2YTDA 2DMIA 4IJDA 2ELYA 2LT7A 3MHHC 2EOSA 2YSPA 1TF3A 2YTIA 2EMAA 2DLKA 2LV2A 2EOEA 2YRKA 1X6HA 3MHSC 2DGCA 2EE8A 2EJ4A 2EPZA 1A1LA 2EPUA 4R2DA 2ENAA 2J7JA 2EMCA 2EMYA 1TF6A 2BB8A 4R2SA 1X6EA 1TN9A 1X6FA 1YUIA 2LVHA 2EMFA 2EOHA 2D9HA 2YTPA 2CT1A 2WBSA 2YTJA 2EOJA 1LLMC 4F2JC 2EL6A 1A1IA 2EM4A 2EPRA 2EMZA 2EM3A 4IS1C 4FK5C 1Z1BA 4R2EA 5KL6A 2EQ0A 2LCEA 2DLQA 2EPPA 1F2IG 2EOOA 2YRMA 3UK3C 2EL4A 1YUJA 2EN6A 2ELZA 2HGHA 3EPLA 4R2RA 1NCSA 2WCC3 2E72A 1MEYC 1UN6B 2EMGA 1JK2A 2YRHA 2M9AA 2YTGA 2EM5A 2EORA 4GZNC 2JPAA 2EMHA 1P47A 2EOIA 2GLIA 2YTNA 2EOXA 1YSAC 2CSHA 2EP3A 2GHFA 2EM7A 5KL3A 2EPAA
chains in the Genus database with same CATH superfamily
2UUCE 3J7AG 2LUPB 5LMUE 3HQ1A 1WHNA 4TUIA 1HR0E 2EN3A 5DNYA 1DGCA 2EM8A 1IMUA 1KJKA 4JI8E 1YYOA 4ZYGA 2I13A 4WFTA 2EQ1A 1YZ9A 1J26A 2EMLA 2JY9A 2EWLA 2EMWA 2L33A 1A1HA 1N33E 2DSYA 2V87A 5KL5A 4LF9E 3IWDA 1PKPA 1GZ6A 3EQ1A 4F9BB 4KHPE 4X9JA 3ECRA 3DJWA 4P7DA 4OX9E 2LTSA 3J80C 1NEIA 5CFFE 1IQOA 5AC5A 5KL2A 3JU0A 4F6MA 1G2FC 2PRTA 4BBYA 4L5NC 4YHHE 4F54A 1L4SA 5IXMB 1A1KA 2V85A 1GQEA 2VRDA 4GKKE 1ZBTA 2EQ3A 2VE7C 2M7QA 2YSPA 2JYAA 2KONA 2DGCA 2EJ4A 2UUAE 2EPZA 2EPUA 3OMLA 4F9CB 4JI4E 2EMYA 2WZOA 1XNRE 3KWRA 2M1SA 3JTZA 1X6FA 1X49A 2BBGA 5LL6R 2D9HA 2YTPA 2B9DA 2IHR1 2EPKX 2LJHA 2YTJA 2WBSA 5IT9C 1AH5A 3BF2A 2EPMX 4M0VA 5BR8E 2HHHE 1WXRA 1Z1BA 1FJGE 1EH8A 4R2EA 5KL6A 2EOOA 2YRMA 4WSPA 4BMJA 4LF6E 1T4LB 1STUA 2ELZA 3J7Yp 4DV2E 4RH8A 4R2RA 1NCSA 4WXDA 2E72A 4JI3E 2YRHA 3ADJA 2YZTA 2EZ6A 2HC5A 4GZNC 1YSAC 3JAMC 1EKZA 3VYXA 4DV5E 2GHFA 2LE2A 4N4RB 2NUEA 2EMBA 3FIGA 3HXLA 4DR1E 1X5WA 2MKNA 4AQYE 2KOUA 1BBGA 3RMPA 1RQ0A 4Q35B 4R03A 4R2AA 5A6JA 4JI7E 5FLXC 2VQEE 2E5LE 2EM9A 4LF4E 5AC4A 2EN4A 2H36X 2JWOA 1A1JA 1T4OA 2WBUA 3BIDA 2I9IA 2RSIA 4JYAE 4B3RE 2ODRC 3M99B 3ADLA 4WPYA 4F6NA 4GEQB 2NABA 3EPHA 1AAYA 1WHQA 2EN2A 3KZZA 1YYKA 4KZSA 4ZYEA 3EPKA 2YTOA 2MDRA 2EOYA 2MC5A 2LTRA 4DUZE 1IBLE 1N36E 4X62E 1PJSA 2YTEA 3T1YE 2E1MA 1HNWE 2CPNA 2EOQA 4NXNE 2K7IA 1ZBQA 2JR1A 1ZR9A 2DRPA 2L2KB 2NUGA 5IWAE 2EPNA 1X48A 4WXCA 2R1FA 3VHTB 2EOFA 2MDGA 1UILA 3BGHA 4IJDA 1XMQE 2LJUA 2FGGA 2EOSA 2V88A 3BBGA 4R8OA 3AV0A 2YTIA 2EMAA 2DLKA 4KWYA 1PJQA 2YRKA 1A1LA 2ENAA 4LF7E 4NXME 2FV4B 3K6QA 4DV1E 1SR9A 2GPIA 1TF6A 4DR6E 2BB8A 3H09A 1SFEA 2L3CA 1IBME 3J81C 1TN9A 2UUBE 4LF5E 3ADGA 5AE1A 2LBSB 3HTXA 2CT1A 1KYQA 4HTGA 4HEIA 2EOJA 1LLMC 1DQ3A 2EM4A 1XNQE 2MC6A 2EMZA 2FTXB 4FK5C 1YFHA 4O5GA 1F2IG 4O4KA 3T1HE 2B3TB 3UK3C 4K0KE 1YUJA 5A69A 4ZYHA 5LMNE 1X47A 3AUZA 2EN6A 2HGHA 2L2MA 3VYYA 4Q28A 2YPNA 1MEYC 2EMGA 4DMIA 4LFAE 2YTGA 4YY3E 2EM5A 2JPAA 2EMHA 2YTNA 4WX9A 4LU9A 2CSHA 3MSWA 2N3GA 4NZVA 2EPAA 2V83A 2V89A 1WRJA 2EMXA 3HPSA 1G2DC 1J5EE 2YSOA 2L3JA 2YT4A 4BC9A 1HNXE 4R2QA 1X3CA 2EL5A 3VK6A 4DUYE 2EPXA 4X8WA 2RSMA 2CTDA 3QG5C 2EPLX 1B69A 1HNZE 1FKAE 4O24A 2N8XA 5KL4A 2EN8A 4B3TE 2HJJA 2ENHA 3THOB 4DR3E 4DKKA 4B3SE 3F6GA 3EPJA 4DR5E 3LLHA 4DV0E 1QU6A 2A25A 1IQSA 3KZYA 4WSGA 1A1GA 1JK1A 2YWQA 1BB8A 2G7HA 4BHCA 2VF1A 2MKDA 2DIXA 2UXBE 5A6KA 2EN1A 2LMZA 1A1FA 2N3HA 3HPZA 4GKJE 2L92A 1MGTA 4DV4E 2ELYA 2ODRD 5F3WA 3MHHC 4X66E 2R76A 1TF3A 5A6AA 4MLQA 2LV2A 2EOEA 2EE8A 4R2DA 2J7JA 2Q8UA 5ADZA 4BCAA 4R2SA 1UHZA 2LVHA 5A6BD 2JOXA 4M30A 1PDAA 3LMLA 5TSEA 2RQLA 1IBKE 5IV8B 1N3GA 1XMOE 1T38A 2EPRA 2EM3A 4IS1C 4DR2E 4B3ME 5T6JA 2DMYA 4NHRA 2EPPA 2EL4A 2F8BA 2NUFA 3C6MA 1PJTA 3OTOE 1DI2A 3EPLA 1QNTA 4DV7E 2V86A 5A6BA 1JK2A 2EORA 4L8NA 2EOXA 5LLQA 2EP3A 2UU9E 5KL3A 1T4NA 2YU8A 4LFBE 2YTFA 4WYQB 4DV6E 4J8ZA 4JI1E 1RMDA 2WBTA 2YU5A 2L2NA 2JP9A 3IWCA 2EN7A 1ZAAC 2EOZA 4ZYDA 1BBOA 4JV5E 4LF8E 1YPNA 4DV3E 2RS6A 2EPCA 2EM0A 4I8OA 4DR7E 5A2QC 2JVAA 4BS9A 2ADRA 2EPOA 2DB2A 4MLVA 2JOBA 2RS7A 2EOMA 5AE2A 2B7VA 2ENCA 2ZM6E 2EM6A 2EMIA 4M2ZA 3DF6A 4DR4E 4BHBA 4JI2E 4R2CA 2EMKA 2V8QB 1UBDC 4JI0E 4OOGC 2RPCA 2B7TA 1N34E 2RTXA 4R2PA 2M4IA 4M9VC 2YTQA 5KL7A 1EH7A 5AASA 2EM2A 1WJPA 1ZU1A 4O43A 2LO3A 3P1XA 2YTDA 2DMIA 2LUQA 2LT7A 2JXPA 4LFCE 4BC7A 2L8TA 2NA2A 1X6HA 3MHSC 5AE3A 2K4VA 2EMCA 3THNA 2VQFE 1X6EA 1YUIA 3ADIA 4TUGA 1GTKA 2EMFA 2EOHA 4RHBB 3ZOQB 3C6KA 4P78A 2EL6A 4F2JC 1T39A 1A1IA 4X65E 4X64E 1N32E 4JI6E 1I94E 2EQ0A 2LCEA 2DLQA 1O0WA 3IWBA 3L00A 1EH6A 4F9AB 1YYWA 4LTYA 2KHXA 3TQMA 3C4BA 2LRSA 2WCC3 2F4VE 1UN6B 2L6MA 2M9AA 3C4TA 4JI5E 1RC7A 1P47A 2EOIA 2GLIA 3F6HA 2UXCE 2EM7A 2UXDE
chains in the Genus database with same CATH topology
2YU8A 2EMXA 2YTFA 2EMBA 1G2DC 1X5WA 2MKNA 2YSOA 1RMDA 2WBTA 2EN3A 1DGCA 2EM8A 2YU5A 4R2AA 1KJKA 2EM9A 1X3CA 4R2QA 2EL5A 2JP9A 2EN4A 2EPXA 2EN7A 1A1JA 1ZAAC 2EOZA 2I13A 2WBUA 1BBOA 2RSIA 2CTDA 1B69A 2EPCA 2EQ1A 3M99B 2EM0A 5KL4A 4F6NA 2EN8A 2NABA 3EPHA 2EMLA 1AAYA 2ENHA 2EMWA 2EN2A 1A1HA 5KL5A 2ADRA 3EPKA 2YTOA 4X9JA 2EOYA 3EPJA 2EOMA 2ENCA 2A25A 2EM6A 2EMIA 4WSGA 1A1GA 2YTEA 4R2CA 5KL2A 2EMKA 4F6MA 1JK1A 1G2FC 1BB8A 2PRTA 1UBDC 2MKDA 2EOQA 2EN1A 2RPCA 1A1KA 1A1FA 4R2PA 1ZR9A 2DRPA 4M9VC 2YTQA 5KL7A 3VHTB 2R1FA 2VRDA 2EOFA 2EM2A 1WJPA 1ZU1A 2MDGA 2EQ3A 2LO3A 2YTDA 2DMIA 4IJDA 2ELYA 2LT7A 3MHHC 2EOSA 2YSPA 1TF3A 2YTIA 2EMAA 2DLKA 2LV2A 2EOEA 2YRKA 1X6HA 3MHSC 2DGCA 2EE8A 2EJ4A 2EPZA 1A1LA 2EPUA 4R2DA 2ENAA 2J7JA 2EMCA 2EMYA 1TF6A 2BB8A 4R2SA 1X6EA 1TN9A 1X6FA 1YUIA 2LVHA 2EMFA 2EOHA 2D9HA 2YTPA 2CT1A 2WBSA 2YTJA 2EOJA 1LLMC 4F2JC 2EL6A 1A1IA 2EM4A 2EPRA 2EMZA 2EM3A 4IS1C 4FK5C 1Z1BA 4R2EA 5KL6A 2EQ0A 2LCEA 2DLQA 2EPPA 1F2IG 2EOOA 2YRMA 3UK3C 2EL4A 1YUJA 2EN6A 2ELZA 2HGHA 3EPLA 4R2RA 1NCSA 2WCC3 2E72A 1MEYC 1UN6B 2EMGA 1JK2A 2YRHA 2M9AA 2YTGA 2EM5A 2EORA 4GZNC 2JPAA 2EMHA 1P47A 2EOIA 2GLIA 2YTNA 2EOXA 1YSAC 2CSHA 2EP3A 2GHFA 2EM7A 5KL3A 2EPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YU8 A;  2EMX A;  2YTF A;  2EMB A;  1G2D C;  1X5W A;  2MKN A;  2YSO A;  1RMD A;  2WBT A;  2EN3 A;  1DGC A;  2EM8 A;  2YU5 A;  4R2A A;  1KJK A;  2EM9 A;  1X3C A;  4R2Q A;  2EL5 A;  2JP9 A;  2EN4 A;  2EPX A;  2EN7 A;  1A1J A;  1ZAA C;  2EOZ A;  2I13 A;  2WBU A;  1BBO A;  2RSI A;  2CTD A;  1B69 A;  2EPC A;  2EQ1 A;  3M99 B;  2EM0 A;  5KL4 A;  4F6N A;  2EN8 A;  2NAB A;  3EPH A;  2EML A;  1AAY A;  2ENH A;  2EMW A;  2EN2 A;  1A1H A;  5KL5 A;  2ADR A;  3EPK A;  2YTO A;  4X9J A;  2EOY A;  3EPJ A;  2EOM A;  2ENC A;  2A25 A;  2EM6 A;  2EMI A;  4WSG A;  1A1G A;  2YTE A;  4R2C A;  5KL2 A;  2EMK A;  4F6M A;  1JK1 A;  1G2F C;  1BB8 A;  2PRT A;  1UBD C;  2MKD A;  2EOQ A;  2EN1 A;  2RPC A;  1A1K A;  1A1F A;  4R2P A;  1ZR9 A;  2DRP A;  4M9V C;  2YTQ A;  5KL7 A;  3VHT B;  2R1F A;  2VRD A;  2EOF A;  2EM2 A;  1WJP A;  1ZU1 A;  2MDG A;  2EQ3 A;  2LO3 A;  2YTD A;  2DMI A;  4IJD A;  2ELY A;  2LT7 A;  3MHH C;  2EOS A;  2YSP A;  1TF3 A;  2YTI A;  2EMA A;  2DLK A;  2LV2 A;  2EOE A;  2YRK A;  1X6H A;  3MHS C;  2DGC A;  2EE8 A;  2EJ4 A;  2EPZ A;  1A1L A;  2EPU A;  4R2D A;  2ENA A;  2J7J A;  2EMC A;  2EMY A;  1TF6 A;  2BB8 A;  4R2S A;  1X6E A;  1TN9 A;  1X6F A;  1YUI A;  2LVH A;  2EMF A;  2EOH A;  2D9H A;  2YTP A;  2CT1 A;  2WBS A;  2YTJ A;  2EOJ A;  1LLM C;  4F2J C;  2EL6 A;  1A1I A;  2EM4 A;  2EPR A;  2EMZ A;  2EM3 A;  4IS1 C;  4FK5 C;  1Z1B A;  4R2E A;  5KL6 A;  2EQ0 A;  2LCE A;  2DLQ A;  2EPP A;  1F2I G;  2EOO A;  2YRM A;  3UK3 C;  2EL4 A;  1YUJ A;  2EN6 A;  2ELZ A;  2HGH A;  3EPL A;  4R2R A;  1NCS A;  2WCC 3;  2E72 A;  1MEY C;  1UN6 B;  2EMG A;  1JK2 A;  2YRH A;  2M9A A;  2YTG A;  2EM5 A;  2EOR A;  4GZN C;  2JPA A;  2EMH A;  1P47 A;  2EOI A;  2GLI A;  2YTN A;  2EOX A;  1YSA C;  2CSH A;  2EP3 A;  2GHF A;  2EM7 A;  5KL3 A;  2EPA A; 
#chains in the Genus database with same CATH topology
 2UUC E;  3J7A G;  2LUP B;  5LMU E;  3HQ1 A;  1WHN A;  4TUI A;  1HR0 E;  2EN3 A;  5DNY A;  1DGC A;  2EM8 A;  1IMU A;  1KJK A;  4JI8 E;  1YYO A;  4ZYG A;  2I13 A;  4WFT A;  2EQ1 A;  1YZ9 A;  1J26 A;  2EML A;  2JY9 A;  2EWL A;  2EMW A;  2L33 A;  1A1H A;  1N33 E;  2DSY A;  2V87 A;  5KL5 A;  4LF9 E;  3IWD A;  1PKP A;  1GZ6 A;  3EQ1 A;  4F9B B;  4KHP E;  4X9J A;  3ECR A;  3DJW A;  4P7D A;  4OX9 E;  2LTS A;  3J80 C;  1NEI A;  5CFF E;  1IQO A;  5AC5 A;  5KL2 A;  3JU0 A;  4F6M A;  1G2F C;  2PRT A;  4BBY A;  4L5N C;  4YHH E;  4F54 A;  1L4S A;  5IXM B;  1A1K A;  2V85 A;  1GQE A;  2VRD A;  4GKK E;  1ZBT A;  2EQ3 A;  2VE7 C;  2M7Q A;  2YSP A;  2JYA A;  2KON A;  2DGC A;  2EJ4 A;  2UUA E;  2EPZ A;  2EPU A;  3OML A;  4F9C B;  4JI4 E;  2EMY A;  2WZO A;  1XNR E;  3KWR A;  2M1S A;  3JTZ A;  1X6F A;  1X49 A;  2BBG A;  5LL6 R;  2D9H A;  2YTP A;  2B9D A;  2IHR 1;  2EPK X;  2LJH A;  2YTJ A;  2WBS A;  5IT9 C;  1AH5 A;  3BF2 A;  2EPM X;  4M0V A;  5BR8 E;  2HHH E;  1WXR A;  1Z1B A;  1FJG E;  1EH8 A;  4R2E A;  5KL6 A;  2EOO A;  2YRM A;  4WSP A;  4BMJ A;  4LF6 E;  1T4L B;  1STU A;  2ELZ A;  3J7Y p;  4DV2 E;  4RH8 A;  4R2R A;  1NCS A;  4WXD A;  2E72 A;  4JI3 E;  2YRH A;  3ADJ A;  2YZT A;  2EZ6 A;  2HC5 A;  4GZN C;  1YSA C;  3JAM C;  1EKZ A;  3VYX A;  4DV5 E;  2GHF A;  2LE2 A;  4N4R B;  2NUE A;  2EMB A;  3FIG A;  3HXL A;  4DR1 E;  1X5W A;  2MKN A;  4AQY E;  2KOU A;  1BBG A;  3RMP A;  1RQ0 A;  4Q35 B;  4R03 A;  4R2A A;  5A6J A;  4JI7 E;  5FLX C;  2VQE E;  2E5L E;  2EM9 A;  4LF4 E;  5AC4 A;  2EN4 A;  2H36 X;  2JWO A;  1A1J A;  1T4O A;  2WBU A;  3BID A;  2I9I A;  2RSI A;  4JYA E;  4B3R E;  2ODR C;  3M99 B;  3ADL A;  4WPY A;  4F6N A;  4GEQ B;  2NAB A;  3EPH A;  1AAY A;  1WHQ A;  2EN2 A;  3KZZ A;  1YYK A;  4KZS A;  4ZYE A;  3EPK A;  2YTO A;  2MDR A;  2EOY A;  2MC5 A;  2LTR A;  4DUZ E;  1IBL E;  1N36 E;  4X62 E;  1PJS A;  2YTE A;  3T1Y E;  2E1M A;  1HNW E;  2CPN A;  2EOQ A;  4NXN E;  2K7I A;  1ZBQ A;  2JR1 A;  1ZR9 A;  2DRP A;  2L2K B;  2NUG A;  5IWA E;  2EPN A;  1X48 A;  4WXC A;  2R1F A;  3VHT B;  2EOF A;  2MDG A;  1UIL A;  3BGH A;  4IJD A;  1XMQ E;  2LJU A;  2FGG A;  2EOS A;  2V88 A;  3BBG A;  4R8O A;  3AV0 A;  2YTI A;  2EMA A;  2DLK A;  4KWY A;  1PJQ A;  2YRK A;  1A1L A;  2ENA A;  4LF7 E;  4NXM E;  2FV4 B;  3K6Q A;  4DV1 E;  1SR9 A;  2GPI A;  1TF6 A;  4DR6 E;  2BB8 A;  3H09 A;  1SFE A;  2L3C A;  1IBM E;  3J81 C;  1TN9 A;  2UUB E;  4LF5 E;  3ADG A;  5AE1 A;  2LBS B;  3HTX A;  2CT1 A;  1KYQ A;  4HTG A;  4HEI A;  2EOJ A;  1LLM C;  1DQ3 A;  2EM4 A;  1XNQ E;  2MC6 A;  2EMZ A;  2FTX B;  4FK5 C;  1YFH A;  4O5G A;  1F2I G;  4O4K A;  3T1H E;  2B3T B;  3UK3 C;  4K0K E;  1YUJ A;  5A69 A;  4ZYH A;  5LMN E;  1X47 A;  3AUZ A;  2EN6 A;  2HGH A;  2L2M A;  3VYY A;  4Q28 A;  2YPN A;  1MEY C;  2EMG A;  4DMI A;  4LFA E;  2YTG A;  4YY3 E;  2EM5 A;  2JPA A;  2EMH A;  2YTN A;  4WX9 A;  4LU9 A;  2CSH A;  3MSW A;  2N3G A;  4NZV A;  2EPA A;  2V83 A;  2V89 A;  1WRJ A;  2EMX A;  3HPS A;  1G2D C;  1J5E E;  2YSO A;  2L3J A;  2YT4 A;  4BC9 A;  1HNX E;  4R2Q A;  1X3C A;  2EL5 A;  3VK6 A;  4DUY E;  2EPX A;  4X8W A;  2RSM A;  2CTD A;  3QG5 C;  2EPL X;  1B69 A;  1HNZ E;  1FKA E;  4O24 A;  2N8X A;  5KL4 A;  2EN8 A;  4B3T E;  2HJJ A;  2ENH A;  3THO B;  4DR3 E;  4DKK A;  4B3S E;  3F6G A;  3EPJ A;  4DR5 E;  3LLH A;  4DV0 E;  1QU6 A;  2A25 A;  1IQS A;  3KZY A;  4WSG A;  1A1G A;  1JK1 A;  2YWQ A;  1BB8 A;  2G7H A;  4BHC A;  2VF1 A;  2MKD A;  2DIX A;  2UXB E;  5A6K A;  2EN1 A;  2LMZ A;  1A1F A;  2N3H A;  3HPZ A;  4GKJ E;  2L92 A;  1MGT A;  4DV4 E;  2ELY A;  2ODR D;  5F3W A;  3MHH C;  4X66 E;  2R76 A;  1TF3 A;  5A6A A;  4MLQ A;  2LV2 A;  2EOE A;  2EE8 A;  4R2D A;  2J7J A;  2Q8U A;  5ADZ A;  4BCA A;  4R2S A;  1UHZ A;  2LVH A;  5A6B D;  2JOX A;  4M30 A;  1PDA A;  3LML A;  5TSE A;  2RQL A;  1IBK E;  5IV8 B;  1N3G A;  1XMO E;  1T38 A;  2EPR A;  2EM3 A;  4IS1 C;  4DR2 E;  4B3M E;  5T6J A;  2DMY A;  4NHR A;  2EPP A;  2EL4 A;  2F8B A;  2NUF A;  3C6M A;  1PJT A;  3OTO E;  1DI2 A;  3EPL A;  1QNT A;  4DV7 E;  2V86 A;  5A6B A;  1JK2 A;  2EOR A;  4L8N A;  2EOX A;  5LLQ A;  2EP3 A;  2UU9 E;  5KL3 A;  1T4N A;  2YU8 A;  4LFB E;  2YTF A;  4WYQ B;  4DV6 E;  4J8Z A;  4JI1 E;  1RMD A;  2WBT A;  2YU5 A;  2L2N A;  2JP9 A;  3IWC A;  2EN7 A;  1ZAA C;  2EOZ A;  4ZYD A;  1BBO A;  4JV5 E;  4LF8 E;  1YPN A;  4DV3 E;  2RS6 A;  2EPC A;  2EM0 A;  4I8O A;  4DR7 E;  5A2Q C;  2JVA A;  4BS9 A;  2ADR A;  2EPO A;  2DB2 A;  4MLV A;  2JOB A;  2RS7 A;  2EOM A;  5AE2 A;  2B7V A;  2ENC A;  2ZM6 E;  2EM6 A;  2EMI A;  4M2Z A;  3DF6 A;  4DR4 E;  4BHB A;  4JI2 E;  4R2C A;  2EMK A;  2V8Q B;  1UBD C;  4JI0 E;  4OOG C;  2RPC A;  2B7T A;  1N34 E;  2RTX A;  4R2P A;  2M4I A;  4M9V C;  2YTQ A;  5KL7 A;  1EH7 A;  5AAS A;  2EM2 A;  1WJP A;  1ZU1 A;  4O43 A;  2LO3 A;  3P1X A;  2YTD A;  2DMI A;  2LUQ A;  2LT7 A;  2JXP A;  4LFC E;  4BC7 A;  2L8T A;  2NA2 A;  1X6H A;  3MHS C;  5AE3 A;  2K4V A;  2EMC A;  3THN A;  2VQF E;  1X6E A;  1YUI A;  3ADI A;  4TUG A;  1GTK A;  2EMF A;  2EOH A;  4RHB B;  3ZOQ B;  3C6K A;  4P78 A;  2EL6 A;  4F2J C;  1T39 A;  1A1I A;  4X65 E;  4X64 E;  1N32 E;  4JI6 E;  1I94 E;  2EQ0 A;  2LCE A;  2DLQ A;  1O0W A;  3IWB A;  3L00 A;  1EH6 A;  4F9A B;  1YYW A;  4LTY A;  2KHX A;  3TQM A;  3C4B A;  2LRS A;  2WCC 3;  2F4V E;  1UN6 B;  2L6M A;  2M9A A;  3C4T A;  4JI5 E;  1RC7 A;  1P47 A;  2EOI A;  2GLI A;  3F6H A;  2UXC E;  2EM7 A;  2UXD E; 
#chains in the Genus database with same CATH homology
 2YU8 A;  2EMX A;  2YTF A;  2EMB A;  1G2D C;  1X5W A;  2MKN A;  2YSO A;  1RMD A;  2WBT A;  2EN3 A;  1DGC A;  2EM8 A;  2YU5 A;  4R2A A;  1KJK A;  2EM9 A;  1X3C A;  4R2Q A;  2EL5 A;  2JP9 A;  2EN4 A;  2EPX A;  2EN7 A;  1A1J A;  1ZAA C;  2EOZ A;  2I13 A;  2WBU A;  1BBO A;  2RSI A;  2CTD A;  1B69 A;  2EPC A;  2EQ1 A;  3M99 B;  2EM0 A;  5KL4 A;  4F6N A;  2EN8 A;  2NAB A;  3EPH A;  2EML A;  1AAY A;  2ENH A;  2EMW A;  2EN2 A;  1A1H A;  5KL5 A;  2ADR A;  3EPK A;  2YTO A;  4X9J A;  2EOY A;  3EPJ A;  2EOM A;  2ENC A;  2A25 A;  2EM6 A;  2EMI A;  4WSG A;  1A1G A;  2YTE A;  4R2C A;  5KL2 A;  2EMK A;  4F6M A;  1JK1 A;  1G2F C;  1BB8 A;  2PRT A;  1UBD C;  2MKD A;  2EOQ A;  2EN1 A;  2RPC A;  1A1K A;  1A1F A;  4R2P A;  1ZR9 A;  2DRP A;  4M9V C;  2YTQ A;  5KL7 A;  3VHT B;  2R1F A;  2VRD A;  2EOF A;  2EM2 A;  1WJP A;  1ZU1 A;  2MDG A;  2EQ3 A;  2LO3 A;  2YTD A;  2DMI A;  4IJD A;  2ELY A;  2LT7 A;  3MHH C;  2EOS A;  2YSP A;  1TF3 A;  2YTI A;  2EMA A;  2DLK A;  2LV2 A;  2EOE A;  2YRK A;  1X6H A;  3MHS C;  2DGC A;  2EE8 A;  2EJ4 A;  2EPZ A;  1A1L A;  2EPU A;  4R2D A;  2ENA A;  2J7J A;  2EMC A;  2EMY A;  1TF6 A;  2BB8 A;  4R2S A;  1X6E A;  1TN9 A;  1X6F A;  1YUI A;  2LVH A;  2EMF A;  2EOH A;  2D9H A;  2YTP A;  2CT1 A;  2WBS A;  2YTJ A;  2EOJ A;  1LLM C;  4F2J C;  2EL6 A;  1A1I A;  2EM4 A;  2EPR A;  2EMZ A;  2EM3 A;  4IS1 C;  4FK5 C;  1Z1B A;  4R2E A;  5KL6 A;  2EQ0 A;  2LCE A;  2DLQ A;  2EPP A;  1F2I G;  2EOO A;  2YRM A;  3UK3 C;  2EL4 A;  1YUJ A;  2EN6 A;  2ELZ A;  2HGH A;  3EPL A;  4R2R A;  1NCS A;  2WCC 3;  2E72 A;  1MEY C;  1UN6 B;  2EMG A;  1JK2 A;  2YRH A;  2M9A A;  2YTG A;  2EM5 A;  2EOR A;  4GZN C;  2JPA A;  2EMH A;  1P47 A;  2EOI A;  2GLI A;  2YTN A;  2EOX A;  1YSA C;  2CSH A;  2EP3 A;  2GHF A;  2EM7 A;  5KL3 A;  2EPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...