2CT1A

Solution structure of the zinc finger domain of transcriptional repressor ctcf protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
GSSGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcriptional repressor CTCF
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ct1A01
1UBDC 2EPCA 2EN8A 2YTFA 5KL7A 2EOXA 4X9JA 3EPKA 4R2PA 1B69A 2EOIA 1A1LA 2I13A 1F2IG 2EOYA 4WSGA 4R2DA 1ZU1A 2EM0A 1X6FA 2YTEA 2RSIA 2EOZA 2EMCA 2WBTA 1A1IA 2DMIA 2LVHA 1G2FC 2EOJA 2YRKA 2LT7A 1AAYA 4F6MA 1ZAAC 2EMWA 5KL6A 5KL3A 1ZR9A 2EM5A 2EPRA 2NABA 2EM7A 2YTOA 4R2EA 1A1GA 2EPXA 1YUJA 2EMXA 2YTQA 2DRPA 1RMDA 2HGHA 5KL2A 4R2CA 2YTIA 2YRHA 2EOOA 1G2DC 2EN3A 2EOSA 4R2RA 2EPPA 5KL4A 2EMIA 4R2SA 2ENAA 2YU8A 1X5WA 2CTDA 2LO3A 1YUIA 3EPHA 3EPJA 2BB8A 2MKDA 1TN9A 1KJKA 2EP3A 1LLMC 2LCEA 2GHFA 2YSPA 2CT1A 2EMGA 2EM6A 4GZNC 2ADRA 2YTGA 1NCSA 2EOHA 4R2QA 2EQ1A 1JK2A 1X6HA 2M9AA 2EN4A 2YRMA 2EMLA 1BB8A 2EPAA 1A1KA 4IS1C 3MHHC 2YTJA 2YTNA 2WBUA 2EMKA 4IJDA 2DLQA 2EM9A 2LV2A 1JK1A 2EORA 2EM8A 1UN6B 2EJ4A 2EL6A 2ELZA 2EMBA 2EM4A 2EN1A 4F6NA 3VHTB 1WJPA 2DLKA 2EMHA 2E72A 2YTDA 2DGCA 2EOFA 2ELYA 1Z1BA 2CSHA 2R1FA 2EOEA 2VRDA 2EM2A 4FK5C 2JP9A 2EPUA 2EQ0A 2EOQA 2EMFA 4R2AA 2EL4A 2J7JA 2EQ3A 3EPLA 2PRTA 2RPCA 2YTPA 4M9VC 2D9HA 1A1HA 2EN2A 2EN6A 2EOMA 3M99B 2EMZA 2WCC3 3MHSC 2ENCA 1P47A 1A1JA 2MDGA 2EL5A 1YSAC 1X6EA 2YSOA 1BBOA 1TF3A 2EPZA 4F2JC 5KL5A 1DGCA 2ENHA 2EE8A 2EM3A 2EMYA 2MKNA 2EN7A 1MEYC 1TF6A 2JPAA 2YU5A 1A1FA 2A25A 2EMAA 3UK3C 1X3CA 2WBSA 2GLIA
chains in the Genus database with same CATH superfamily
1KYQA 3OTOE 4R2PA 4DV1E 1A1LA 1ZU1A 4DV5E 1T39A 2L33A 4O4KA 3HPSA 5AC5A 1YZ9A 4M0VA 2HC5A 2DMIA 2LVHA 2V83A 2EOJA 2YRKA 3LMLA 2LT7A 1AAYA 1HNXE 2NABA 2EM7A 5T6JA 2EPXA 4O24A 2IHR1 2DRPA 5A6BA 2UXDE 4WFTA 4P7DA 4LFAE 2YRHA 1G2DC 2EOSA 2EPPA 2JOXA 2DSYA 2B7VA 2BB8A 1TN9A 2EP3A 4JI1E 2GHFA 2CT1A 4DUYE 2RQLA 2ADRA 2JWOA 2YTGA 4R2QA 5IT9C 1IQSA 2LTRA 3HXLA 3JAMC 4KHPE 2M9AA 2YRMA 4BC7A 1WRJA 2DMYA 2EMLA 4JI3E 4LF9E 4JI5E 2YTNA 1PDAA 4L5NC 2WBUA 2DB2A 4WXCA 2RS6A 4GKJE 2EORA 2B7TA 4R03A 2V87A 3THOB 2EMBA 4X8WA 2V89A 2EN1A 4DV4E 3VHTB 2EMHA 2YTDA 1I94E 2DGCA 3VYXA 3DJWA 2R1FA 2EOEA 4MLQA 4M30A 4DR5E 2EPNA 2MC6A 3AUZA 2EQ0A 2Q8UA 4JI2E 5A6AA 2J7JA 3EPLA 5A6JA 1YYOA 3HPZA 3JTZA 2YTPA 1XNQE 2VQFE 4L8NA 1A1HA 2EN6A 3M99B 3JU0A 2EPKX 4RH8A 3EQ1A 2ENCA 3MHSC 1FJGE 1PJSA 3BF2A 1YSAC 2YSOA 2F4VE 2EPZA 4DMIA 2FTXB 1RC7A 2ENHA 1DI2A 4DR7E 1J5EE 2JYAA 2BBGA 2F8BA 3RMPA 2VE7C 1TF6A 1A1FA 3HTXA 2EMAA 2A25A 2JY9A 4B3ME 1EH7A 1UBDC 4F9BB 3TQMA 1F2IG 2EOYA 4M2ZA 1X6FA 2LE2A 2EOZA 1XMQE 2WBTA 4GKKE 4F6MA 2EMWA 2ZM6E 4Q35B 5KL6A 1ZR9A 1SFEA 2EM5A 4BS9A 2EMXA 4HEIA 4JI8E 1RMDA 4WXDA 4R2CA 2YTIA 4BCAA 1IBKE 2EN3A 2EMIA 2ENAA 1YUIA 4LU9A 4DR1E 2MKDA 2GPIA 2VF1A 2LCEA 2YSPA 2EMGA 2EM6A 2L3CA 1NCSA 2UU9E 2VQEE 2EN4A 5BR8E 4ZYDA 3L00A 5AE1A 4NXNE 1WXRA 1PKPA 2LMZA 2MDRA 2EMKA 3MSWA 5TSEA 4LF5E 5AC4A 1IBME 2EM9A 4KWYA 2ELZA 4DR4E 4BHCA 4OX9E 2DIXA 2RTXA 4NHRA 2EOFA 1RQ0A 2VRDA 1PJQA 2LJHA 2JP9A 2EPUA 1EKZA 4WX9A 5AE2A 2EOQA 4R2AA 2EL4A 4MLVA 2EQ3A 3F6GA 2PRTA 2NUGA 1QU6A 2N8XA 1X47A 2EZ6A 1T4OA 1WHNA 3K6QA 4M9VC 2EN2A 5FLXC 2WCC3 2NUFA 5DNYA 2EL5A 2L2MA 4ZYGA 4LF4E 1IMUA 3T1HE 3P1XA 1YYWA 4F2JC 1YFHA 1MEYC 3ECRA 4WYQB 2YU5A 2UUCE 4K0KE 2NUEA 4NXME 3UK3C 3ADJA 1X3CA 2E5LE 3IWDA 1DQ3A 4RHBB 4BHBA 5KL7A 2EOXA 4X9JA 3KZZA 4WSPA 1B69A 2EWLA 2EM0A 4HTGA 2RSIA 1A1IA 1BBGA 2L6MA 2M1SA 1G2FC 3KZYA 5F3WA 3IWBA 4B3RE 5KL3A 2EPRA 2YTOA 1A1GA 4LF8E 2MC5A 5LMNE 4Q28A 3F6HA 1N33E 3C6KA 3ADIA 2HGHA 2ODRD 4DV6E 2M7QA 2B9DA 2EOOA 2EPLX 2V88A 3J80C 3OMLA 4NZVA 2LUPB 1SR9A 2RSMA 2FGGA 2EPMX 2LO3A 5ADZA 3EPJA 1KJKA 1LLMC 4GZNC 2K4VA 2JXPA 2EQ1A 3FIGA 4N4RB 1X6HA 4LTYA 4YY3E 4J8ZA 2HJJA 5IV8B 2EPAA 4IS1C 4DR3E 1N32E 3MHHC 1EH8A 2YTJA 2V86A 2KONA 2LTSA 2LBSB 5AASA 1T38A 2DLQA 4B3SE 4BMJA 4LF7E 4BBYA 3J7Yp 2EM8A 1ZBTA 2UXCE 4I8OA 3C4TA 2EL6A 2EM4A 4LFCE 4F6NA 3ZOQB 1T4NA 1T4LB 2ELYA 1Z1BA 4DR2E 4B3TE 2N3HA 3T1YE 2L3JA 1YPNA 4JI0E 4LFBE 2EMFA 3J7AG 2WZOA 2JOBA 1X48A 2RPCA 1PJTA 4JI4E 2I9IA 5CFFE 2E1MA 2EOMA 1HR0E 1YYKA 3H09A 2YT4A 2UUBE 2ODRC 3J81C 1X6EA 3C4BA 2CPNA 4O43A 2JVAA 1L4SA 5A6BD 4TUIA 1TF3A 1FKAE 1EH6A 1WHQA 1X49A 5KL5A 5LLQA 2EE8A 2EM3A 4F54A 2UXBE 3LLHA 2EN7A 4R8OA 5A69A 2JPAA 1O0WA 4DKKA 2WBSA 5IXMB 4DUZE 2EPCA 2EN8A 2YTFA 2I13A 3EPKA 2EOIA 1HNWE 1GZ6A 4WSGA 3KWRA 4R2DA 2YWQA 2FV4B 4OOGC 2YTEA 4GEQB 2EMCA 2R76A 1GTKA 4X65E 1MGTA 1QNTA 2M4IA 2KHXA 1ZAAC 1GQEA 3BGHA 5IWAE 4TUGA 4R2EA 4LF6E 1N3GA 4ZYHA 2B3TB 3VYYA 1YUJA 2YTQA 4F9AB 2L8TA 5KL2A 1UILA 2HHHE 3HQ1A 4WPYA 4R2RA 5KL4A 4R2SA 2NA2A 2YU8A 1X5WA 4X62E 4AQYE 2CTDA 2YZTA 4DV0E 1IQOA 3EPHA 3BBGA 4JI7E 5A6KA 1ZBQA 2EOHA 1UHZA 1JK2A 4YHHE 1BB8A 1A1KA 4O5GA 4IJDA 2LJUA 2UUAE 2EPOA 3DF6A 5LL6R 4BC9A 2LV2A 1STUA 1JK1A 2L2NA 2YPNA 1UN6B 2EJ4A 2H36X 1J26A 1WJPA 2DLKA 2KOUA 3THNA 4P78A 1XNRE 2E72A 1IBLE 3ADLA 2V8QB 2CSHA 5LMUE 2EM2A 4FK5C 4X64E 4DV2E 4X66E 3QG5C 4JYAE 2LUQA 2K7IA 3ADGA 3BIDA 2N3GA 4DR6E 3C6MA 2D9HA 2V85A 4KZSA 2EMZA 1P47A 1A1JA 1HNZE 2MDGA 1NEIA 2G7HA 5AE3A 4ZYEA 1BBOA 4JV5E 1AH5A 1XMOE 2L92A 1DGCA 4JI6E 2EMYA 2MKNA 2LRSA 2L2KB 4DV3E 2RS7A 1N36E 4F9CB 3VK6A 2JR1A 3AV0A 5A2QC 4DV7E 3IWCA 2GLIA 1N34E
chains in the Genus database with same CATH topology
1UBDC 2EPCA 2EN8A 2YTFA 5KL7A 2EOXA 4X9JA 3EPKA 4R2PA 1B69A 2EOIA 1A1LA 2I13A 1F2IG 2EOYA 4WSGA 4R2DA 1ZU1A 2EM0A 1X6FA 2YTEA 2RSIA 2EOZA 2EMCA 2WBTA 1A1IA 2DMIA 2LVHA 1G2FC 2EOJA 2YRKA 2LT7A 1AAYA 4F6MA 1ZAAC 2EMWA 5KL6A 5KL3A 1ZR9A 2EM5A 2EPRA 2NABA 2EM7A 2YTOA 4R2EA 1A1GA 2EPXA 1YUJA 2EMXA 2YTQA 2DRPA 1RMDA 2HGHA 5KL2A 4R2CA 2YTIA 2YRHA 2EOOA 1G2DC 2EN3A 2EOSA 4R2RA 2EPPA 5KL4A 2EMIA 4R2SA 2ENAA 2YU8A 1X5WA 2CTDA 2LO3A 1YUIA 3EPHA 3EPJA 2BB8A 2MKDA 1TN9A 1KJKA 2EP3A 1LLMC 2LCEA 2GHFA 2YSPA 2CT1A 2EMGA 2EM6A 4GZNC 2ADRA 2YTGA 1NCSA 2EOHA 4R2QA 2EQ1A 1JK2A 1X6HA 2M9AA 2EN4A 2YRMA 2EMLA 1BB8A 2EPAA 1A1KA 4IS1C 3MHHC 2YTJA 2YTNA 2WBUA 2EMKA 4IJDA 2DLQA 2EM9A 2LV2A 1JK1A 2EORA 2EM8A 1UN6B 2EJ4A 2EL6A 2ELZA 2EMBA 2EM4A 2EN1A 4F6NA 3VHTB 1WJPA 2DLKA 2EMHA 2E72A 2YTDA 2DGCA 2EOFA 2ELYA 1Z1BA 2CSHA 2R1FA 2EOEA 2VRDA 2EM2A 4FK5C 2JP9A 2EPUA 2EQ0A 2EOQA 2EMFA 4R2AA 2EL4A 2J7JA 2EQ3A 3EPLA 2PRTA 2RPCA 2YTPA 4M9VC 2D9HA 1A1HA 2EN2A 2EN6A 2EOMA 3M99B 2EMZA 2WCC3 3MHSC 2ENCA 1P47A 1A1JA 2MDGA 2EL5A 1YSAC 1X6EA 2YSOA 1BBOA 1TF3A 2EPZA 4F2JC 5KL5A 1DGCA 2ENHA 2EE8A 2EM3A 2EMYA 2MKNA 2EN7A 1MEYC 1TF6A 2JPAA 2YU5A 1A1FA 2A25A 2EMAA 3UK3C 1X3CA 2WBSA 2GLIA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UBD C;  2EPC A;  2EN8 A;  2YTF A;  5KL7 A;  2EOX A;  4X9J A;  3EPK A;  4R2P A;  1B69 A;  2EOI A;  1A1L A;  2I13 A;  1F2I G;  2EOY A;  4WSG A;  4R2D A;  1ZU1 A;  2EM0 A;  1X6F A;  2YTE A;  2RSI A;  2EOZ A;  2EMC A;  2WBT A;  1A1I A;  2DMI A;  2LVH A;  1G2F C;  2EOJ A;  2YRK A;  2LT7 A;  1AAY A;  4F6M A;  1ZAA C;  2EMW A;  5KL6 A;  5KL3 A;  1ZR9 A;  2EM5 A;  2EPR A;  2NAB A;  2EM7 A;  2YTO A;  4R2E A;  1A1G A;  2EPX A;  1YUJ A;  2EMX A;  2YTQ A;  2DRP A;  1RMD A;  2HGH A;  5KL2 A;  4R2C A;  2YTI A;  2YRH A;  2EOO A;  1G2D C;  2EN3 A;  2EOS A;  4R2R A;  2EPP A;  5KL4 A;  2EMI A;  4R2S A;  2ENA A;  2YU8 A;  1X5W A;  2CTD A;  2LO3 A;  1YUI A;  3EPH A;  3EPJ A;  2BB8 A;  2MKD A;  1TN9 A;  1KJK A;  2EP3 A;  1LLM C;  2LCE A;  2GHF A;  2YSP A;  2CT1 A;  2EMG A;  2EM6 A;  4GZN C;  2ADR A;  2YTG A;  1NCS A;  2EOH A;  4R2Q A;  2EQ1 A;  1JK2 A;  1X6H A;  2M9A A;  2EN4 A;  2YRM A;  2EML A;  1BB8 A;  2EPA A;  1A1K A;  4IS1 C;  3MHH C;  2YTJ A;  2YTN A;  2WBU A;  2EMK A;  4IJD A;  2DLQ A;  2EM9 A;  2LV2 A;  1JK1 A;  2EOR A;  2EM8 A;  1UN6 B;  2EJ4 A;  2EL6 A;  2ELZ A;  2EMB A;  2EM4 A;  2EN1 A;  4F6N A;  3VHT B;  1WJP A;  2DLK A;  2EMH A;  2E72 A;  2YTD A;  2DGC A;  2EOF A;  2ELY A;  1Z1B A;  2CSH A;  2R1F A;  2EOE A;  2VRD A;  2EM2 A;  4FK5 C;  2JP9 A;  2EPU A;  2EQ0 A;  2EOQ A;  2EMF A;  4R2A A;  2EL4 A;  2J7J A;  2EQ3 A;  3EPL A;  2PRT A;  2RPC A;  2YTP A;  4M9V C;  2D9H A;  1A1H A;  2EN2 A;  2EN6 A;  2EOM A;  3M99 B;  2EMZ A;  2WCC 3;  3MHS C;  2ENC A;  1P47 A;  1A1J A;  2MDG A;  2EL5 A;  1YSA C;  1X6E A;  2YSO A;  1BBO A;  1TF3 A;  2EPZ A;  4F2J C;  5KL5 A;  1DGC A;  2ENH A;  2EE8 A;  2EM3 A;  2EMY A;  2MKN A;  2EN7 A;  1MEY C;  1TF6 A;  2JPA A;  2YU5 A;  1A1F A;  2A25 A;  2EMA A;  3UK3 C;  1X3C A;  2WBS A;  2GLI A; 
#chains in the Genus database with same CATH topology
 1KYQ A;  3OTO E;  4R2P A;  4DV1 E;  1A1L A;  1ZU1 A;  4DV5 E;  1T39 A;  2L33 A;  4O4K A;  3HPS A;  5AC5 A;  1YZ9 A;  4M0V A;  2HC5 A;  2DMI A;  2LVH A;  2V83 A;  2EOJ A;  2YRK A;  3LML A;  2LT7 A;  1AAY A;  1HNX E;  2NAB A;  2EM7 A;  5T6J A;  2EPX A;  4O24 A;  2IHR 1;  2DRP A;  5A6B A;  2UXD E;  4WFT A;  4P7D A;  4LFA E;  2YRH A;  1G2D C;  2EOS A;  2EPP A;  2JOX A;  2DSY A;  2B7V A;  2BB8 A;  1TN9 A;  2EP3 A;  4JI1 E;  2GHF A;  2CT1 A;  4DUY E;  2RQL A;  2ADR A;  2JWO A;  2YTG A;  4R2Q A;  5IT9 C;  1IQS A;  2LTR A;  3HXL A;  3JAM C;  4KHP E;  2M9A A;  2YRM A;  4BC7 A;  1WRJ A;  2DMY A;  2EML A;  4JI3 E;  4LF9 E;  4JI5 E;  2YTN A;  1PDA A;  4L5N C;  2WBU A;  2DB2 A;  4WXC A;  2RS6 A;  4GKJ E;  2EOR A;  2B7T A;  4R03 A;  2V87 A;  3THO B;  2EMB A;  4X8W A;  2V89 A;  2EN1 A;  4DV4 E;  3VHT B;  2EMH A;  2YTD A;  1I94 E;  2DGC A;  3VYX A;  3DJW A;  2R1F A;  2EOE A;  4MLQ A;  4M30 A;  4DR5 E;  2EPN A;  2MC6 A;  3AUZ A;  2EQ0 A;  2Q8U A;  4JI2 E;  5A6A A;  2J7J A;  3EPL A;  5A6J A;  1YYO A;  3HPZ A;  3JTZ A;  2YTP A;  1XNQ E;  2VQF E;  4L8N A;  1A1H A;  2EN6 A;  3M99 B;  3JU0 A;  2EPK X;  4RH8 A;  3EQ1 A;  2ENC A;  3MHS C;  1FJG E;  1PJS A;  3BF2 A;  1YSA C;  2YSO A;  2F4V E;  2EPZ A;  4DMI A;  2FTX B;  1RC7 A;  2ENH A;  1DI2 A;  4DR7 E;  1J5E E;  2JYA A;  2BBG A;  2F8B A;  3RMP A;  2VE7 C;  1TF6 A;  1A1F A;  3HTX A;  2EMA A;  2A25 A;  2JY9 A;  4B3M E;  1EH7 A;  1UBD C;  4F9B B;  3TQM A;  1F2I G;  2EOY A;  4M2Z A;  1X6F A;  2LE2 A;  2EOZ A;  1XMQ E;  2WBT A;  4GKK E;  4F6M A;  2EMW A;  2ZM6 E;  4Q35 B;  5KL6 A;  1ZR9 A;  1SFE A;  2EM5 A;  4BS9 A;  2EMX A;  4HEI A;  4JI8 E;  1RMD A;  4WXD A;  4R2C A;  2YTI A;  4BCA A;  1IBK E;  2EN3 A;  2EMI A;  2ENA A;  1YUI A;  4LU9 A;  4DR1 E;  2MKD A;  2GPI A;  2VF1 A;  2LCE A;  2YSP A;  2EMG A;  2EM6 A;  2L3C A;  1NCS A;  2UU9 E;  2VQE E;  2EN4 A;  5BR8 E;  4ZYD A;  3L00 A;  5AE1 A;  4NXN E;  1WXR A;  1PKP A;  2LMZ A;  2MDR A;  2EMK A;  3MSW A;  5TSE A;  4LF5 E;  5AC4 A;  1IBM E;  2EM9 A;  4KWY A;  2ELZ A;  4DR4 E;  4BHC A;  4OX9 E;  2DIX A;  2RTX A;  4NHR A;  2EOF A;  1RQ0 A;  2VRD A;  1PJQ A;  2LJH A;  2JP9 A;  2EPU A;  1EKZ A;  4WX9 A;  5AE2 A;  2EOQ A;  4R2A A;  2EL4 A;  4MLV A;  2EQ3 A;  3F6G A;  2PRT A;  2NUG A;  1QU6 A;  2N8X A;  1X47 A;  2EZ6 A;  1T4O A;  1WHN A;  3K6Q A;  4M9V C;  2EN2 A;  5FLX C;  2WCC 3;  2NUF A;  5DNY A;  2EL5 A;  2L2M A;  4ZYG A;  4LF4 E;  1IMU A;  3T1H E;  3P1X A;  1YYW A;  4F2J C;  1YFH A;  1MEY C;  3ECR A;  4WYQ B;  2YU5 A;  2UUC E;  4K0K E;  2NUE A;  4NXM E;  3UK3 C;  3ADJ A;  1X3C A;  2E5L E;  3IWD A;  1DQ3 A;  4RHB B;  4BHB A;  5KL7 A;  2EOX A;  4X9J A;  3KZZ A;  4WSP A;  1B69 A;  2EWL A;  2EM0 A;  4HTG A;  2RSI A;  1A1I A;  1BBG A;  2L6M A;  2M1S A;  1G2F C;  3KZY A;  5F3W A;  3IWB A;  4B3R E;  5KL3 A;  2EPR A;  2YTO A;  1A1G A;  4LF8 E;  2MC5 A;  5LMN E;  4Q28 A;  3F6H A;  1N33 E;  3C6K A;  3ADI A;  2HGH A;  2ODR D;  4DV6 E;  2M7Q A;  2B9D A;  2EOO A;  2EPL X;  2V88 A;  3J80 C;  3OML A;  4NZV A;  2LUP B;  1SR9 A;  2RSM A;  2FGG A;  2EPM X;  2LO3 A;  5ADZ A;  3EPJ A;  1KJK A;  1LLM C;  4GZN C;  2K4V A;  2JXP A;  2EQ1 A;  3FIG A;  4N4R B;  1X6H A;  4LTY A;  4YY3 E;  4J8Z A;  2HJJ A;  5IV8 B;  2EPA A;  4IS1 C;  4DR3 E;  1N32 E;  3MHH C;  1EH8 A;  2YTJ A;  2V86 A;  2KON A;  2LTS A;  2LBS B;  5AAS A;  1T38 A;  2DLQ A;  4B3S E;  4BMJ A;  4LF7 E;  4BBY A;  3J7Y p;  2EM8 A;  1ZBT A;  2UXC E;  4I8O A;  3C4T A;  2EL6 A;  2EM4 A;  4LFC E;  4F6N A;  3ZOQ B;  1T4N A;  1T4L B;  2ELY A;  1Z1B A;  4DR2 E;  4B3T E;  2N3H A;  3T1Y E;  2L3J A;  1YPN A;  4JI0 E;  4LFB E;  2EMF A;  3J7A G;  2WZO A;  2JOB A;  1X48 A;  2RPC A;  1PJT A;  4JI4 E;  2I9I A;  5CFF E;  2E1M A;  2EOM A;  1HR0 E;  1YYK A;  3H09 A;  2YT4 A;  2UUB E;  2ODR C;  3J81 C;  1X6E A;  3C4B A;  2CPN A;  4O43 A;  2JVA A;  1L4S A;  5A6B D;  4TUI A;  1TF3 A;  1FKA E;  1EH6 A;  1WHQ A;  1X49 A;  5KL5 A;  5LLQ A;  2EE8 A;  2EM3 A;  4F54 A;  2UXB E;  3LLH A;  2EN7 A;  4R8O A;  5A69 A;  2JPA A;  1O0W A;  4DKK A;  2WBS A;  5IXM B;  4DUZ E;  2EPC A;  2EN8 A;  2YTF A;  2I13 A;  3EPK A;  2EOI A;  1HNW E;  1GZ6 A;  4WSG A;  3KWR A;  4R2D A;  2YWQ A;  2FV4 B;  4OOG C;  2YTE A;  4GEQ B;  2EMC A;  2R76 A;  1GTK A;  4X65 E;  1MGT A;  1QNT A;  2M4I A;  2KHX A;  1ZAA C;  1GQE A;  3BGH A;  5IWA E;  4TUG A;  4R2E A;  4LF6 E;  1N3G A;  4ZYH A;  2B3T B;  3VYY A;  1YUJ A;  2YTQ A;  4F9A B;  2L8T A;  5KL2 A;  1UIL A;  2HHH E;  3HQ1 A;  4WPY A;  4R2R A;  5KL4 A;  4R2S A;  2NA2 A;  2YU8 A;  1X5W A;  4X62 E;  4AQY E;  2CTD A;  2YZT A;  4DV0 E;  1IQO A;  3EPH A;  3BBG A;  4JI7 E;  5A6K A;  1ZBQ A;  2EOH A;  1UHZ A;  1JK2 A;  4YHH E;  1BB8 A;  1A1K A;  4O5G A;  4IJD A;  2LJU A;  2UUA E;  2EPO A;  3DF6 A;  5LL6 R;  4BC9 A;  2LV2 A;  1STU A;  1JK1 A;  2L2N A;  2YPN A;  1UN6 B;  2EJ4 A;  2H36 X;  1J26 A;  1WJP A;  2DLK A;  2KOU A;  3THN A;  4P78 A;  1XNR E;  2E72 A;  1IBL E;  3ADL A;  2V8Q B;  2CSH A;  5LMU E;  2EM2 A;  4FK5 C;  4X64 E;  4DV2 E;  4X66 E;  3QG5 C;  4JYA E;  2LUQ A;  2K7I A;  3ADG A;  3BID A;  2N3G A;  4DR6 E;  3C6M A;  2D9H A;  2V85 A;  4KZS A;  2EMZ A;  1P47 A;  1A1J A;  1HNZ E;  2MDG A;  1NEI A;  2G7H A;  5AE3 A;  4ZYE A;  1BBO A;  4JV5 E;  1AH5 A;  1XMO E;  2L92 A;  1DGC A;  4JI6 E;  2EMY A;  2MKN A;  2LRS A;  2L2K B;  4DV3 E;  2RS7 A;  1N36 E;  4F9C B;  3VK6 A;  2JR1 A;  3AV0 A;  5A2Q C;  4DV7 E;  3IWC A;  2GLI A;  1N34 E; 
#chains in the Genus database with same CATH homology
 1UBD C;  2EPC A;  2EN8 A;  2YTF A;  5KL7 A;  2EOX A;  4X9J A;  3EPK A;  4R2P A;  1B69 A;  2EOI A;  1A1L A;  2I13 A;  1F2I G;  2EOY A;  4WSG A;  4R2D A;  1ZU1 A;  2EM0 A;  1X6F A;  2YTE A;  2RSI A;  2EOZ A;  2EMC A;  2WBT A;  1A1I A;  2DMI A;  2LVH A;  1G2F C;  2EOJ A;  2YRK A;  2LT7 A;  1AAY A;  4F6M A;  1ZAA C;  2EMW A;  5KL6 A;  5KL3 A;  1ZR9 A;  2EM5 A;  2EPR A;  2NAB A;  2EM7 A;  2YTO A;  4R2E A;  1A1G A;  2EPX A;  1YUJ A;  2EMX A;  2YTQ A;  2DRP A;  1RMD A;  2HGH A;  5KL2 A;  4R2C A;  2YTI A;  2YRH A;  2EOO A;  1G2D C;  2EN3 A;  2EOS A;  4R2R A;  2EPP A;  5KL4 A;  2EMI A;  4R2S A;  2ENA A;  2YU8 A;  1X5W A;  2CTD A;  2LO3 A;  1YUI A;  3EPH A;  3EPJ A;  2BB8 A;  2MKD A;  1TN9 A;  1KJK A;  2EP3 A;  1LLM C;  2LCE A;  2GHF A;  2YSP A;  2CT1 A;  2EMG A;  2EM6 A;  4GZN C;  2ADR A;  2YTG A;  1NCS A;  2EOH A;  4R2Q A;  2EQ1 A;  1JK2 A;  1X6H A;  2M9A A;  2EN4 A;  2YRM A;  2EML A;  1BB8 A;  2EPA A;  1A1K A;  4IS1 C;  3MHH C;  2YTJ A;  2YTN A;  2WBU A;  2EMK A;  4IJD A;  2DLQ A;  2EM9 A;  2LV2 A;  1JK1 A;  2EOR A;  2EM8 A;  1UN6 B;  2EJ4 A;  2EL6 A;  2ELZ A;  2EMB A;  2EM4 A;  2EN1 A;  4F6N A;  3VHT B;  1WJP A;  2DLK A;  2EMH A;  2E72 A;  2YTD A;  2DGC A;  2EOF A;  2ELY A;  1Z1B A;  2CSH A;  2R1F A;  2EOE A;  2VRD A;  2EM2 A;  4FK5 C;  2JP9 A;  2EPU A;  2EQ0 A;  2EOQ A;  2EMF A;  4R2A A;  2EL4 A;  2J7J A;  2EQ3 A;  3EPL A;  2PRT A;  2RPC A;  2YTP A;  4M9V C;  2D9H A;  1A1H A;  2EN2 A;  2EN6 A;  2EOM A;  3M99 B;  2EMZ A;  2WCC 3;  3MHS C;  2ENC A;  1P47 A;  1A1J A;  2MDG A;  2EL5 A;  1YSA C;  1X6E A;  2YSO A;  1BBO A;  1TF3 A;  2EPZ A;  4F2J C;  5KL5 A;  1DGC A;  2ENH A;  2EE8 A;  2EM3 A;  2EMY A;  2MKN A;  2EN7 A;  1MEY C;  1TF6 A;  2JPA A;  2YU5 A;  1A1F A;  2A25 A;  2EMA A;  3UK3 C;  1X3C A;  2WBS A;  2GLI A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...