2CT1A

Solution structure of the zinc finger domain of transcriptional repressor ctcf protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
GSSGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional repressor CTCF
publication title Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein
rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ct1A01
2HGHA 1A1FA 2EOZA 4R2SA 2CTDA 4FK5C 2EQ3A 2PRTA 2EMKA 2EOMA 2I13A 4WSGA 2EOOA 2EPAA 2EPUA 2EOQA 2EJ4A 2EM7A 1MEYC 2EMWA 1X3CA 2WBUA 2EN6A 2WBSA 3MHSC 4X9JA 2RSIA 4GZNC 2DMIA 2YTQA 1YUIA 1A1LA 3EPJA 1ZR9A 4IJDA 2MDGA 3MHHC 2ENCA 2EN2A 1A1HA 4R2AA 2YTOA 2YRMA 2ENHA 1UBDC 2BB8A 2YU8A 2YTGA 2EM5A 2GHFA 2GLIA 1UN6B 2DLQA 2EMYA 2EOFA 1KJKA 2EN8A 2EPPA 2LV2A 2EP3A 1LLMC 2EPXA 2VRDA 2EOJA 4R2DA 2EOIA 4F6MA 1YUJA 2YRKA 1A1GA 5KL5A 4IS1C 4F2JC 4R2EA 1X6FA 2ELZA 2WBTA 4F6NA 2EQ1A 2YTNA 3EPLA 1A1KA 4R2PA 2DRPA 2LVHA 2MKNA 5KL3A 5KL4A 1JK1A 2EORA 2EMHA 1F2IG 2EMAA 2ENAA 2LO3A 1BBOA 1RMDA 2EMCA 2ADRA 2EL6A 2WCC3 1TF6A 1ZAAC 2CT1A 2EE8A 2EM2A 1NCSA 2DLKA 2EOYA 1TF3A 1P47A 1A1IA 2EM9A 2EMIA 1G2FC 2EM0A 2YSPA 1JK2A 2YTPA 2EMBA 2YTDA 1TN9A 2A25A 2EMFA 2MKDA 1DGCA 2EOXA 2M9AA 5KL2A 2DGCA 3EPHA 2EMZA 2NABA 2R1FA 2EM8A 2EMXA 2RPCA 2ELYA 2CSHA 2D9HA 2EM6A 2EOHA 4R2CA 2EM3A 5KL6A 3EPKA 2EL4A 2EOSA 4R2RA 2EMGA 2EMLA 1ZU1A 2EL5A 1G2DC 1AAYA 2JP9A 2YTJA 1Z1BA 1X6HA 1X5WA 2YTIA 1BB8A 4M9VC 2YTEA 2EN1A 2EM4A 2LT7A 1B69A 2E72A 4R2QA 2JPAA 2J7JA 1X6EA 2EOEA 2LCEA 2YTFA 2YU5A 2EQ0A 2YSOA 3M99B 3VHTB 5KL7A 1YSAC 2EN3A 2EN7A 1A1JA 3UK3C 2EPCA 1WJPA 2EPRA 2EPZA 2YRHA 2EN4A
chains in the Genus database with same CATH superfamily
2R76A 2LJHA 2L2MA 2EOZA 2RQLA 3L00A 2RS7A 4R2SA 5BR8E 4WPYA 4FK5C 2EQ3A 1RQ0A 4WSGA 2BBGA 4KZSA 2EPUA 4DMIA 4TUIA 2Q8UA 1HNZE 1IBME 2EJ4A 4DV4E 2EMWA 2WBSA 4AQYE 1BBGA 2LE2A 4OOGC 5A2QC 5AE2A 2RSMA 1YUIA 2NUFA 4B3RE 4N4RB 5A6BD 3JU0A 2MC5A 2ENCA 4BC9A 1IMUA 2NA2A 3RMPA 1HNXE 2DIXA 1T4LB 2FV4B 2GLIA 1EH8A 2DLQA 4LF6E 1LLMC 2EPXA 2ZM6E 3C4TA 3HPSA 2EOJA 2IHR1 4R2DA 4F6MA 1L4SA 4LF8E 4F2JC 2ELZA 4F9AB 2EZ6A 2EPMX 2EQ1A 2YTNA 3P1XA 2ODRC 2LVHA 3MSWA 4KWYA 5KL3A 2MKNA 1SFEA 4OX9E 4R8OA 2EMHA 1F2IG 2EMAA 4BC7A 4ZYEA 1WHQA 2LUPB 4DV7E 1HNWE 2EM2A 4NHRA 1XMQE 2JY9A 3KWRA 4NXME 1DI2A 2UXDE 2DLKA 2JWOA 1TF3A 2B3TB 4JV5E 1A1IA 5DNYA 4JI4E 2EMBA 2UXBE 1TN9A 4BMJA 4DR3E 4JI2E 2MKDA 4DUYE 1DGCA 2EOXA 4J8ZA 4TUGA 2UUBE 2F8BA 2L2KB 2YWQA 2NABA 2EM8A 2EMXA 4JI1E 2ELYA 2EM6A 2D9HA 5F3WA 2EOHA 2EPKX 5KL6A 2K7IA 2EL4A 3AV0A 5IT9C 5LMUE 4LFBE 4B3ME 1N34E 4JI6E 1YYKA 2YTEA 2EN1A 3IWBA 1X6EA 2EQ0A 2EN7A 2LMZA 3UK3C 2EPCA 2E1MA 4DR5E 1X48A 2I9IA 2EWLA 1T39A 1IBLE 3ADIA 2WZOA 2L33A 1N3GA 1GTKA 2EOMA 3C6MA 2UUAE 2EPAA 3T1YE 4YHHE 2UU9E 4LF7E 1MGTA 1X47A 2MDRA 1MEYC 5IV8B 1X3CA 2JR1A 2YPNA 4F54A 4WYQB 4DR7E 2YT4A 2EPLX 1A1LA 3EPJA 3TQMA 4IJDA 2MDGA 3QG5C 4HTGA 3THNA 5IWAE 3K6QA 5A6BA 1FKAE 1A1HA 1O0WA 2YTOA 2V8QB 2ENHA 1UBDC 1I94E 2B7VA 1ZBQA 2BB8A 2YTGA 5AC4A 5A6AA 2EMYA 1KJKA 2EN8A 1YUJA 1T4NA 2EOIA 1A1GA 5KL5A 4IS1C 3ADLA 4GKJE 2DMYA 2JYAA 2WBTA 1X49A 3KZYA 3VK6A 4I8OA 4JI8E 4R2PA 2L2NA 2YZTA 4BS9A 1WXRA 4B3SE 1SR9A 2LO3A 3AUZA 1IQSA 2V87A 4X65E 2CT1A 2E5LE 5AE3A 1ZBTA 1EKZA 2EOYA 1P47A 2EM9A 3J7Yp 1G2FC 3BBGA 4DR2E 1JK2A 2YTPA 5ADZA 4X66E 4M0VA 3ADGA 1QNTA 2N8XA 3JAMC 2H36X 4BBYA 2RPCA 2EM3A 2RTXA 2V85A 3J81C 3EPKA 4JI5E 4R2RA 2EMGA 4DKKA 2EL5A 1G2DC 5IXMB 4JI3E 1PDAA 1PJTA 2M1SA 4L5NC 4DV0E 4F9CB 4R2QA 3ADJA 4Q28A 2J7JA 4YY3E 5KL7A 3VHTB 2YSOA 1GZ6A 3J80C 1A1JA 4WX9A 2LTSA 2EN4A 2HGHA 2N3HA 1PJSA 2L8TA 3HXLA 2CTDA 2KOUA 4DR4E 2EMKA 4LU9A 3DF6A 2I13A 2EOOA 4KHPE 4O5GA 3VYYA 4DV2E 3BF2A 1AH5A 1EH6A 2WBUA 1YYOA 4X9JA 2RS6A 5FLXC 4GZNC 2DMIA 4M2ZA 5T6JA 2M4IA 1ZR9A 4BCAA 5A69A 2JVAA 2EN2A 2V83A 3H09A 2YRMA 1FJGE 2M7QA 4RH8A 2YU8A 4WXCA 1YPNA 2EM5A 2EPOA 2GHFA 2V86A 2LTRA 2LV2A 2EP3A 3HPZA 2VRDA 1HR0E 2YRKA 2DSYA 1X6FA 3IWCA 1STUA 1A1KA 2DRPA 5KL4A 1JK1A 4ZYDA 4JI7E 1WHNA 3BGHA 2ENAA 2VQEE 1T38A 5AE1A 3ZOQB 2EL6A 2JOXA 5CFFE 2WCC3 1TF6A 1ZAAC 2HHHE 1J5EE 1XNRE 1NCSA 4WXDA 3T1HE 1QU6A 2L6MA 4M30A 2DB2A 2YSPA 2NUGA 2YTDA 2N3GA 2LBSB 2EMFA 3FIGA 4DV1E 1T4OA 2GPIA 2M9AA 2DGCA 3EPHA 5A6KA 4JI0E 4O24A 1AAYA 1GQEA 2CPNA 2JP9A 2MC6A 2V88A 2YTJA 4LF9E 1X6HA 1BB8A 2YTIA 4GEQB 5LLQA 3HQ1A 4O43A 4M9VC 4X64E 2VF1A 2EM4A 1B69A 3OMLA 1N36E 2JPAA 2YU5A 3LLHA 4NZVA 4X8WA 4LF4E 2EPRA 4L8NA 5AC5A 2ODRD 2YRHA 2B9DA 4WFTA 1A1FA 1N33E 4GKKE 4Q35B 2PRTA 1UILA 4NXNE 2F4VE 1NEIA 4MLQA 2EOQA 4DV5E 1XNQE 2EM7A 2VE7C 2EN6A 3MHSC 3THOB 2RSIA 3EQ1A 1RC7A 1KYQA 1YYWA 3LMLA 2YTQA 2B7TA 4DV3E 5AASA 2JXPA 3MHHC 4DV6E 1UHZA 4R2AA 1UN6B 2EOFA 2EPPA 4LFAE 5LMNE 1N32E 4LFCE 2UUCE 3C4BA 3J7AG 2L3CA 1YZ9A 2LJUA 4R2EA 4F6NA 4HEIA 2EPNA 4P7DA 3EPLA 4RHBB 2HC5A 4ZYHA 5A6JA 3BIDA 3DJWA 2EORA 1BBOA 2NUEA 1RMDA 2EMCA 2ADRA 2EE8A 1IBKE 4DR1E 2KHXA 1DQ3A 3C6KA 2EMIA 2EM0A 4ZYGA 2KONA 2L92A 4O4KA 3VYXA 3F6GA 2A25A 4WSPA 4DUZE 5TSEA 1WRJA 1PKPA 4F9BB 5KL2A 2EMZA 4DR6E 2R1FA 5LL6R 2HJJA 2CSHA 4LF5E 2LUQA 1XMOE 2G7HA 2FGGA 4R2CA 2JOBA 2LRSA 1EH7A 2EOSA 2EMLA 1ZU1A 3IWDA 2V89A 2UXCE 4LTYA 3KZZA 4BHBA 1Z1BA 1X5WA 4R03A 2VQFE 4P78A 1YFHA 2LT7A 1PJQA 2E72A 3HTXA 2FTXB 3OTOE 2EOEA 2LCEA 1YSAC 2YTFA 3M99B 1IQOA 4JYAE 4K0KE 2EN3A 2K4VA 3JTZA 4B3TE 3ECRA 2L3JA 1WJPA 1J26A 2EPZA 4BHCA 3F6HA 4X62E 4MLVA
chains in the Genus database with same CATH topology
2HGHA 1A1FA 2EOZA 4R2SA 2CTDA 4FK5C 2EQ3A 2PRTA 2EMKA 2EOMA 2I13A 4WSGA 2EOOA 2EPAA 2EPUA 2EOQA 2EJ4A 2EM7A 1MEYC 2EMWA 1X3CA 2WBUA 2EN6A 2WBSA 3MHSC 4X9JA 2RSIA 4GZNC 2DMIA 2YTQA 1YUIA 1A1LA 3EPJA 1ZR9A 4IJDA 2MDGA 3MHHC 2ENCA 2EN2A 1A1HA 4R2AA 2YTOA 2YRMA 2ENHA 1UBDC 2BB8A 2YU8A 2YTGA 2EM5A 2GHFA 2GLIA 1UN6B 2DLQA 2EMYA 2EOFA 1KJKA 2EN8A 2EPPA 2LV2A 2EP3A 1LLMC 2EPXA 2VRDA 2EOJA 4R2DA 2EOIA 4F6MA 1YUJA 2YRKA 1A1GA 5KL5A 4IS1C 4F2JC 4R2EA 1X6FA 2ELZA 2WBTA 4F6NA 2EQ1A 2YTNA 3EPLA 1A1KA 4R2PA 2DRPA 2LVHA 2MKNA 5KL3A 5KL4A 1JK1A 2EORA 2EMHA 1F2IG 2EMAA 2ENAA 2LO3A 1BBOA 1RMDA 2EMCA 2ADRA 2EL6A 2WCC3 1TF6A 1ZAAC 2CT1A 2EE8A 2EM2A 1NCSA 2DLKA 2EOYA 1TF3A 1P47A 1A1IA 2EM9A 2EMIA 1G2FC 2EM0A 2YSPA 1JK2A 2YTPA 2EMBA 2YTDA 1TN9A 2A25A 2EMFA 2MKDA 1DGCA 2EOXA 2M9AA 5KL2A 2DGCA 3EPHA 2EMZA 2NABA 2R1FA 2EM8A 2EMXA 2RPCA 2ELYA 2CSHA 2D9HA 2EM6A 2EOHA 4R2CA 2EM3A 5KL6A 3EPKA 2EL4A 2EOSA 4R2RA 2EMGA 2EMLA 1ZU1A 2EL5A 1G2DC 1AAYA 2JP9A 2YTJA 1Z1BA 1X6HA 1X5WA 2YTIA 1BB8A 4M9VC 2YTEA 2EN1A 2EM4A 2LT7A 1B69A 2E72A 4R2QA 2JPAA 2J7JA 1X6EA 2EOEA 2LCEA 2YTFA 2YU5A 2EQ0A 2YSOA 3M99B 3VHTB 5KL7A 1YSAC 2EN3A 2EN7A 1A1JA 3UK3C 2EPCA 1WJPA 2EPRA 2EPZA 2YRHA 2EN4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HGH A;  1A1F A;  2EOZ A;  4R2S A;  2CTD A;  4FK5 C;  2EQ3 A;  2PRT A;  2EMK A;  2EOM A;  2I13 A;  4WSG A;  2EOO A;  2EPA A;  2EPU A;  2EOQ A;  2EJ4 A;  2EM7 A;  1MEY C;  2EMW A;  1X3C A;  2WBU A;  2EN6 A;  2WBS A;  3MHS C;  4X9J A;  2RSI A;  4GZN C;  2DMI A;  2YTQ A;  1YUI A;  1A1L A;  3EPJ A;  1ZR9 A;  4IJD A;  2MDG A;  3MHH C;  2ENC A;  2EN2 A;  1A1H A;  4R2A A;  2YTO A;  2YRM A;  2ENH A;  1UBD C;  2BB8 A;  2YU8 A;  2YTG A;  2EM5 A;  2GHF A;  2GLI A;  1UN6 B;  2DLQ A;  2EMY A;  2EOF A;  1KJK A;  2EN8 A;  2EPP A;  2LV2 A;  2EP3 A;  1LLM C;  2EPX A;  2VRD A;  2EOJ A;  4R2D A;  2EOI A;  4F6M A;  1YUJ A;  2YRK A;  1A1G A;  5KL5 A;  4IS1 C;  4F2J C;  4R2E A;  1X6F A;  2ELZ A;  2WBT A;  4F6N A;  2EQ1 A;  2YTN A;  3EPL A;  1A1K A;  4R2P A;  2DRP A;  2LVH A;  2MKN A;  5KL3 A;  5KL4 A;  1JK1 A;  2EOR A;  2EMH A;  1F2I G;  2EMA A;  2ENA A;  2LO3 A;  1BBO A;  1RMD A;  2EMC A;  2ADR A;  2EL6 A;  2WCC 3;  1TF6 A;  1ZAA C;  2CT1 A;  2EE8 A;  2EM2 A;  1NCS A;  2DLK A;  2EOY A;  1TF3 A;  1P47 A;  1A1I A;  2EM9 A;  2EMI A;  1G2F C;  2EM0 A;  2YSP A;  1JK2 A;  2YTP A;  2EMB A;  2YTD A;  1TN9 A;  2A25 A;  2EMF A;  2MKD A;  1DGC A;  2EOX A;  2M9A A;  5KL2 A;  2DGC A;  3EPH A;  2EMZ A;  2NAB A;  2R1F A;  2EM8 A;  2EMX A;  2RPC A;  2ELY A;  2CSH A;  2D9H A;  2EM6 A;  2EOH A;  4R2C A;  2EM3 A;  5KL6 A;  3EPK A;  2EL4 A;  2EOS A;  4R2R A;  2EMG A;  2EML A;  1ZU1 A;  2EL5 A;  1G2D C;  1AAY A;  2JP9 A;  2YTJ A;  1Z1B A;  1X6H A;  1X5W A;  2YTI A;  1BB8 A;  4M9V C;  2YTE A;  2EN1 A;  2EM4 A;  2LT7 A;  1B69 A;  2E72 A;  4R2Q A;  2JPA A;  2J7J A;  1X6E A;  2EOE A;  2LCE A;  2YTF A;  2YU5 A;  2EQ0 A;  2YSO A;  3M99 B;  3VHT B;  5KL7 A;  1YSA C;  2EN3 A;  2EN7 A;  1A1J A;  3UK3 C;  2EPC A;  1WJP A;  2EPR A;  2EPZ A;  2YRH A;  2EN4 A; 
#chains in the Genus database with same CATH topology
 2R76 A;  2LJH A;  2L2M A;  2EOZ A;  2RQL A;  3L00 A;  2RS7 A;  4R2S A;  5BR8 E;  4WPY A;  4FK5 C;  2EQ3 A;  1RQ0 A;  4WSG A;  2BBG A;  4KZS A;  2EPU A;  4DMI A;  4TUI A;  2Q8U A;  1HNZ E;  1IBM E;  2EJ4 A;  4DV4 E;  2EMW A;  2WBS A;  4AQY E;  1BBG A;  2LE2 A;  4OOG C;  5A2Q C;  5AE2 A;  2RSM A;  1YUI A;  2NUF A;  4B3R E;  4N4R B;  5A6B D;  3JU0 A;  2MC5 A;  2ENC A;  4BC9 A;  1IMU A;  2NA2 A;  3RMP A;  1HNX E;  2DIX A;  1T4L B;  2FV4 B;  2GLI A;  1EH8 A;  2DLQ A;  4LF6 E;  1LLM C;  2EPX A;  2ZM6 E;  3C4T A;  3HPS A;  2EOJ A;  2IHR 1;  4R2D A;  4F6M A;  1L4S A;  4LF8 E;  4F2J C;  2ELZ A;  4F9A B;  2EZ6 A;  2EPM X;  2EQ1 A;  2YTN A;  3P1X A;  2ODR C;  2LVH A;  3MSW A;  4KWY A;  5KL3 A;  2MKN A;  1SFE A;  4OX9 E;  4R8O A;  2EMH A;  1F2I G;  2EMA A;  4BC7 A;  4ZYE A;  1WHQ A;  2LUP B;  4DV7 E;  1HNW E;  2EM2 A;  4NHR A;  1XMQ E;  2JY9 A;  3KWR A;  4NXM E;  1DI2 A;  2UXD E;  2DLK A;  2JWO A;  1TF3 A;  2B3T B;  4JV5 E;  1A1I A;  5DNY A;  4JI4 E;  2EMB A;  2UXB E;  1TN9 A;  4BMJ A;  4DR3 E;  4JI2 E;  2MKD A;  4DUY E;  1DGC A;  2EOX A;  4J8Z A;  4TUG A;  2UUB E;  2F8B A;  2L2K B;  2YWQ A;  2NAB A;  2EM8 A;  2EMX A;  4JI1 E;  2ELY A;  2EM6 A;  2D9H A;  5F3W A;  2EOH A;  2EPK X;  5KL6 A;  2K7I A;  2EL4 A;  3AV0 A;  5IT9 C;  5LMU E;  4LFB E;  4B3M E;  1N34 E;  4JI6 E;  1YYK A;  2YTE A;  2EN1 A;  3IWB A;  1X6E A;  2EQ0 A;  2EN7 A;  2LMZ A;  3UK3 C;  2EPC A;  2E1M A;  4DR5 E;  1X48 A;  2I9I A;  2EWL A;  1T39 A;  1IBL E;  3ADI A;  2WZO A;  2L33 A;  1N3G A;  1GTK A;  2EOM A;  3C6M A;  2UUA E;  2EPA A;  3T1Y E;  4YHH E;  2UU9 E;  4LF7 E;  1MGT A;  1X47 A;  2MDR A;  1MEY C;  5IV8 B;  1X3C A;  2JR1 A;  2YPN A;  4F54 A;  4WYQ B;  4DR7 E;  2YT4 A;  2EPL X;  1A1L A;  3EPJ A;  3TQM A;  4IJD A;  2MDG A;  3QG5 C;  4HTG A;  3THN A;  5IWA E;  3K6Q A;  5A6B A;  1FKA E;  1A1H A;  1O0W A;  2YTO A;  2V8Q B;  2ENH A;  1UBD C;  1I94 E;  2B7V A;  1ZBQ A;  2BB8 A;  2YTG A;  5AC4 A;  5A6A A;  2EMY A;  1KJK A;  2EN8 A;  1YUJ A;  1T4N A;  2EOI A;  1A1G A;  5KL5 A;  4IS1 C;  3ADL A;  4GKJ E;  2DMY A;  2JYA A;  2WBT A;  1X49 A;  3KZY A;  3VK6 A;  4I8O A;  4JI8 E;  4R2P A;  2L2N A;  2YZT A;  4BS9 A;  1WXR A;  4B3S E;  1SR9 A;  2LO3 A;  3AUZ A;  1IQS A;  2V87 A;  4X65 E;  2CT1 A;  2E5L E;  5AE3 A;  1ZBT A;  1EKZ A;  2EOY A;  1P47 A;  2EM9 A;  3J7Y p;  1G2F C;  3BBG A;  4DR2 E;  1JK2 A;  2YTP A;  5ADZ A;  4X66 E;  4M0V A;  3ADG A;  1QNT A;  2N8X A;  3JAM C;  2H36 X;  4BBY A;  2RPC A;  2EM3 A;  2RTX A;  2V85 A;  3J81 C;  3EPK A;  4JI5 E;  4R2R A;  2EMG A;  4DKK A;  2EL5 A;  1G2D C;  5IXM B;  4JI3 E;  1PDA A;  1PJT A;  2M1S A;  4L5N C;  4DV0 E;  4F9C B;  4R2Q A;  3ADJ A;  4Q28 A;  2J7J A;  4YY3 E;  5KL7 A;  3VHT B;  2YSO A;  1GZ6 A;  3J80 C;  1A1J A;  4WX9 A;  2LTS A;  2EN4 A;  2HGH A;  2N3H A;  1PJS A;  2L8T A;  3HXL A;  2CTD A;  2KOU A;  4DR4 E;  2EMK A;  4LU9 A;  3DF6 A;  2I13 A;  2EOO A;  4KHP E;  4O5G A;  3VYY A;  4DV2 E;  3BF2 A;  1AH5 A;  1EH6 A;  2WBU A;  1YYO A;  4X9J A;  2RS6 A;  5FLX C;  4GZN C;  2DMI A;  4M2Z A;  5T6J A;  2M4I A;  1ZR9 A;  4BCA A;  5A69 A;  2JVA A;  2EN2 A;  2V83 A;  3H09 A;  2YRM A;  1FJG E;  2M7Q A;  4RH8 A;  2YU8 A;  4WXC A;  1YPN A;  2EM5 A;  2EPO A;  2GHF A;  2V86 A;  2LTR A;  2LV2 A;  2EP3 A;  3HPZ A;  2VRD A;  1HR0 E;  2YRK A;  2DSY A;  1X6F A;  3IWC A;  1STU A;  1A1K A;  2DRP A;  5KL4 A;  1JK1 A;  4ZYD A;  4JI7 E;  1WHN A;  3BGH A;  2ENA A;  2VQE E;  1T38 A;  5AE1 A;  3ZOQ B;  2EL6 A;  2JOX A;  5CFF E;  2WCC 3;  1TF6 A;  1ZAA C;  2HHH E;  1J5E E;  1XNR E;  1NCS A;  4WXD A;  3T1H E;  1QU6 A;  2L6M A;  4M30 A;  2DB2 A;  2YSP A;  2NUG A;  2YTD A;  2N3G A;  2LBS B;  2EMF A;  3FIG A;  4DV1 E;  1T4O A;  2GPI A;  2M9A A;  2DGC A;  3EPH A;  5A6K A;  4JI0 E;  4O24 A;  1AAY A;  1GQE A;  2CPN A;  2JP9 A;  2MC6 A;  2V88 A;  2YTJ A;  4LF9 E;  1X6H A;  1BB8 A;  2YTI A;  4GEQ B;  5LLQ A;  3HQ1 A;  4O43 A;  4M9V C;  4X64 E;  2VF1 A;  2EM4 A;  1B69 A;  3OML A;  1N36 E;  2JPA A;  2YU5 A;  3LLH A;  4NZV A;  4X8W A;  4LF4 E;  2EPR A;  4L8N A;  5AC5 A;  2ODR D;  2YRH A;  2B9D A;  4WFT A;  1A1F A;  1N33 E;  4GKK E;  4Q35 B;  2PRT A;  1UIL A;  4NXN E;  2F4V E;  1NEI A;  4MLQ A;  2EOQ A;  4DV5 E;  1XNQ E;  2EM7 A;  2VE7 C;  2EN6 A;  3MHS C;  3THO B;  2RSI A;  3EQ1 A;  1RC7 A;  1KYQ A;  1YYW A;  3LML A;  2YTQ A;  2B7T A;  4DV3 E;  5AAS A;  2JXP A;  3MHH C;  4DV6 E;  1UHZ A;  4R2A A;  1UN6 B;  2EOF A;  2EPP A;  4LFA E;  5LMN E;  1N32 E;  4LFC E;  2UUC E;  3C4B A;  3J7A G;  2L3C A;  1YZ9 A;  2LJU A;  4R2E A;  4F6N A;  4HEI A;  2EPN A;  4P7D A;  3EPL A;  4RHB B;  2HC5 A;  4ZYH A;  5A6J A;  3BID A;  3DJW A;  2EOR A;  1BBO A;  2NUE A;  1RMD A;  2EMC A;  2ADR A;  2EE8 A;  1IBK E;  4DR1 E;  2KHX A;  1DQ3 A;  3C6K A;  2EMI A;  2EM0 A;  4ZYG A;  2KON A;  2L92 A;  4O4K A;  3VYX A;  3F6G A;  2A25 A;  4WSP A;  4DUZ E;  5TSE A;  1WRJ A;  1PKP A;  4F9B B;  5KL2 A;  2EMZ A;  4DR6 E;  2R1F A;  5LL6 R;  2HJJ A;  2CSH A;  4LF5 E;  2LUQ A;  1XMO E;  2G7H A;  2FGG A;  4R2C A;  2JOB A;  2LRS A;  1EH7 A;  2EOS A;  2EML A;  1ZU1 A;  3IWD A;  2V89 A;  2UXC E;  4LTY A;  3KZZ A;  4BHB A;  1Z1B A;  1X5W A;  4R03 A;  2VQF E;  4P78 A;  1YFH A;  2LT7 A;  1PJQ A;  2E72 A;  3HTX A;  2FTX B;  3OTO E;  2EOE A;  2LCE A;  1YSA C;  2YTF A;  3M99 B;  1IQO A;  4JYA E;  4K0K E;  2EN3 A;  2K4V A;  3JTZ A;  4B3T E;  3ECR A;  2L3J A;  1WJP A;  1J26 A;  2EPZ A;  4BHC A;  3F6H A;  4X62 E;  4MLV A; 
#chains in the Genus database with same CATH homology
 2HGH A;  1A1F A;  2EOZ A;  4R2S A;  2CTD A;  4FK5 C;  2EQ3 A;  2PRT A;  2EMK A;  2EOM A;  2I13 A;  4WSG A;  2EOO A;  2EPA A;  2EPU A;  2EOQ A;  2EJ4 A;  2EM7 A;  1MEY C;  2EMW A;  1X3C A;  2WBU A;  2EN6 A;  2WBS A;  3MHS C;  4X9J A;  2RSI A;  4GZN C;  2DMI A;  2YTQ A;  1YUI A;  1A1L A;  3EPJ A;  1ZR9 A;  4IJD A;  2MDG A;  3MHH C;  2ENC A;  2EN2 A;  1A1H A;  4R2A A;  2YTO A;  2YRM A;  2ENH A;  1UBD C;  2BB8 A;  2YU8 A;  2YTG A;  2EM5 A;  2GHF A;  2GLI A;  1UN6 B;  2DLQ A;  2EMY A;  2EOF A;  1KJK A;  2EN8 A;  2EPP A;  2LV2 A;  2EP3 A;  1LLM C;  2EPX A;  2VRD A;  2EOJ A;  4R2D A;  2EOI A;  4F6M A;  1YUJ A;  2YRK A;  1A1G A;  5KL5 A;  4IS1 C;  4F2J C;  4R2E A;  1X6F A;  2ELZ A;  2WBT A;  4F6N A;  2EQ1 A;  2YTN A;  3EPL A;  1A1K A;  4R2P A;  2DRP A;  2LVH A;  2MKN A;  5KL3 A;  5KL4 A;  1JK1 A;  2EOR A;  2EMH A;  1F2I G;  2EMA A;  2ENA A;  2LO3 A;  1BBO A;  1RMD A;  2EMC A;  2ADR A;  2EL6 A;  2WCC 3;  1TF6 A;  1ZAA C;  2CT1 A;  2EE8 A;  2EM2 A;  1NCS A;  2DLK A;  2EOY A;  1TF3 A;  1P47 A;  1A1I A;  2EM9 A;  2EMI A;  1G2F C;  2EM0 A;  2YSP A;  1JK2 A;  2YTP A;  2EMB A;  2YTD A;  1TN9 A;  2A25 A;  2EMF A;  2MKD A;  1DGC A;  2EOX A;  2M9A A;  5KL2 A;  2DGC A;  3EPH A;  2EMZ A;  2NAB A;  2R1F A;  2EM8 A;  2EMX A;  2RPC A;  2ELY A;  2CSH A;  2D9H A;  2EM6 A;  2EOH A;  4R2C A;  2EM3 A;  5KL6 A;  3EPK A;  2EL4 A;  2EOS A;  4R2R A;  2EMG A;  2EML A;  1ZU1 A;  2EL5 A;  1G2D C;  1AAY A;  2JP9 A;  2YTJ A;  1Z1B A;  1X6H A;  1X5W A;  2YTI A;  1BB8 A;  4M9V C;  2YTE A;  2EN1 A;  2EM4 A;  2LT7 A;  1B69 A;  2E72 A;  4R2Q A;  2JPA A;  2J7J A;  1X6E A;  2EOE A;  2LCE A;  2YTF A;  2YU5 A;  2EQ0 A;  2YSO A;  3M99 B;  3VHT B;  5KL7 A;  1YSA C;  2EN3 A;  2EN7 A;  1A1J A;  3UK3 C;  2EPC A;  1WJP A;  2EPR A;  2EPZ A;  2YRH A;  2EN4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...