2CT1A

Solution structure of the zinc finger domain of transcriptional repressor ctcf protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
GSSGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcriptional repressor CTCF
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ct1A01
2EOFA 2RSIA 2ELZA 3VHTB 4R2SA 2JPAA 2I13A 2M9AA 2EOZA 1X6HA 1A1FA 1TF6A 1A1JA 4IJDA 2YTPA 1MEYC 2NABA 1G2DC 2J7JA 2EL6A 2LVHA 1TF3A 2CSHA 2EN7A 3EPKA 4F2JC 4F6MA 1A1KA 1G2FC 2EPRA 5KL2A 5KL4A 4R2CA 1A1LA 2R1FA 1LLMC 2HGHA 1BB8A 2EMGA 2YTGA 3EPHA 2EMFA 1WJPA 1A1IA 2EL5A 2EN8A 2DLKA 2YTQA 2EN1A 5KL6A 2EPPA 2EMWA 2DGCA 1BBOA 1YSAC 2YTOA 1Z1BA 2EOJA 2RPCA 2EPCA 2EM7A 2EN2A 1JK1A 2EMHA 1RMDA 2CTDA 1NCSA 2EN3A 2DMIA 2EMIA 2YTEA 4F6NA 2EOMA 2EM3A 5KL3A 2BB8A 1ZR9A 2D9HA 2EMCA 2YTNA 1KJKA 2EPZA 3MHSC 1JK2A 2YTJA 2EN6A 2EORA 2EPAA 2EOXA 2ADRA 2LO3A 4GZNC 2EOEA 3EPLA 4FK5C 1ZAAC 2EPXA 4R2RA 1YUJA 2EQ1A 2A25A 2ENCA 2VRDA 2EJ4A 4X9JA 2EPUA 3MHHC 2YRMA 1A1GA 2EOHA 2DRPA 2GLIA 2YSPA 3M99B 2YRHA 1F2IG 1A1HA 2EOIA 2JP9A 2EQ3A 1YUIA 2EP3A 4M9VC 2WBTA 2EM8A 1UBDC 2EM0A 2EOQA 2CT1A 2EMLA 2WBUA 2YSOA 2EMYA 2EOYA 2YTIA 4R2AA 2EE8A 2EMBA 2EL4A 1X3CA 2LT7A 1UN6B 1X6EA 1P47A 2EM5A 4WSGA 2EMZA 2YTFA 2EM6A 2GHFA 2MKNA 2EN4A 2ENHA 2EM2A 2WCC3 4R2DA 2DLQA 2WBSA 2EOSA 5KL5A 2YU5A 2EOOA 1ZU1A 2ENAA 1TN9A 4R2QA 4R2EA 2LV2A 2YRKA 3UK3C 1AAYA 2EMKA 1B69A 4R2PA 1DGCA 1X6FA 2EMXA 2LCEA 2MKDA 2EQ0A 1X5WA 5KL7A 2EM4A 3EPJA 2YU8A 4IS1C 2PRTA 2EMAA 2EM9A 2MDGA 2E72A 2YTDA 2ELYA
chains in the Genus database with same CATH superfamily
2RSIA 4WFTA 4O5GA 3VHTB 1IBLE 5LLQA 4B3RE 2YTPA 1DI2A 1G2DC 4JI4E 1T39A 4O4KA 2EWLA 3MSWA 2F8BA 1N36E 2EN7A 4WPYA 4JI1E 5KL2A 5KL4A 1BB8A 4JV5E 2R1FA 2MC5A 2EMGA 1PDAA 4ZYDA 2DLKA 2EPPA 2YWQA 2EMWA 4NZVA 1YSAC 2HHHE 4LF6E 2ODRC 2M4IA 2N8XA 1NCSA 2EZ6A 4LTYA 2EMIA 4BBYA 3C6KA 5AE3A 1WHNA 1EH7A 3HQ1A 2EM3A 2LUQA 2JVAA 2V8QB 1RC7A 2D9HA 3EQ1A 4WYQB 4YHHE 4DR1E 5IXMB 2EORA 4DUZE 4GZNC 4WXDA 1N32E 2LJUA 2EOEA 4JI6E 3ADJA 4DR2E 1XNQE 2L33A 1YUJA 5A2QC 2A25A 2VRDA 2B7TA 4DR7E 2MC6A 3TQMA 2GLIA 3J80C 2V88A 5AE1A 1GTKA 1IBKE 2EQ3A 4M0VA 3RMPA 1PKPA 2YT4A 2B7VA 4X62E 2IHR1 4J8ZA 2WBUA 2L2KB 4DV1E 1EH8A 2EPKX 4R2AA 1X48A 1X3CA 1UHZA 5LL6R 4GKKE 1X6EA 2VQFE 5FLXC 2B9DA 2EM2A 2DB2A 2DLQA 4X66E 2EOSA 2YU5A 1ZU1A 3ADGA 4K0KE 4R2QA 4KZSA 2YRKA 3L00A 4BMJA 4P78A 2E5LE 3H09A 2UXDE 3EPJA 2RS6A 4WSPA 2DSYA 4TUGA 2MDGA 2ELYA 3BGHA 4RHBB 4B3SE 1XNRE 4R03A 2M9AA 2EOZA 3ECRA 1WXRA 1TF6A 1NEIA 1A1JA 4IJDA 4X65E 4BCAA 4MLQA 3AV0A 3KZZA 2LVHA 3KWRA 5AE2A 2YTGA 2K7IA 4BS9A 5CFFE 5F3WA 3VYYA 1A1IA 2EL5A 4NXNE 2LJHA 3HXLA 3FIGA 1PJSA 1WHQA 4F9BB 2RPCA 4M2ZA 2EN2A 5A69A 2EMHA 4DKKA 3HTXA 4LFCE 2V89A 1GZ6A 1IQOA 1YYKA 4ZYGA 3OTOE 1N33E 4RH8A 2EPZA 1IMUA 1JK2A 3LLHA 4DV5E 2LO3A 2E1MA 2FTXB 4BHCA 4FK5C 4DV2E 1ZAAC 1BBGA 2UXBE 2BBGA 4LF7E 4X9JA 3MHHC 1A1GA 5IWAE 2YSPA 3C4BA 5A6AA 1F2IG 2EP3A 4M9VC 3AUZA 2EOQA 2EMLA 2L3CA 4MLVA 3IWCA 1FJGE 2LTRA 2YTIA 4X8WA 2EMBA 2EL4A 3KZYA 1X49A 2V83A 2LMZA 1XMOE 2GHFA 2NUEA 2WCC3 4R2DA 3THOB 2EPOA 1T4LB 2V85A 2ENAA 4P7DA 4R2EA 4LF5E 1PJQA 2LV2A 2VQEE 1AAYA 3JAMC 1SFEA 1DGCA 1I94E 5KL7A 2UXCE 2EM4A 4DR4E 2LE2A 2YU8A 2EMAA 5BR8E 2EM9A 2L2NA 5A6BA 3T1HE 2VF1A 4JI5E 2EOFA 2ELZA 4BHBA 4R2SA 2L8TA 1YFHA 2RQLA 5AC5A 4DR3E 3BF2A 2L3JA 4R8OA 1FKAE 4L8NA 1N34E 4DV6E 2N3GA 5AASA 3DF6A 3EPKA 4F6MA 1YYWA 2RS7A 2NA2A 5A6KA 4R2CA 1A1LA 1LLMC 4HTGA 1O0WA 3F6HA 4NHRA 5T6JA 2KHXA 5KL6A 5DNYA 4DUYE 1EKZA 2UUCE 2DGCA 4DV3E 1Z1BA 4DV0E 4DR5E 2UU9E 2EPCA 1DQ3A 2JYAA 1JK1A 4LFAE 2I9IA 2KONA 4LFBE 1STUA 1RMDA 2EN3A 1X47A 4OOGC 2EOMA 1QU6A 3ADIA 5KL3A 1ZR9A 2EMCA 3THNA 2YTNA 2DMYA 2K4VA 5A6BD 1EH6A 2EPNA 3J7AG 2EOXA 4LF4E 2LTSA 2EPLX 4R2RA 1J26A 2EQ1A 2ENCA 2EPUA 2FV4B 2YRMA 2DRPA 3M99B 1IQSA 2YRHA 1A1HA 2LBSB 2EOIA 1AH5A 2RTXA 4JI0E 4OX9E 2WBTA 2RSMA 5LMNE 1UBDC 1UILA 2EM0A 2YSOA 4L5NC 1ZBQA 5TSEA 2UUAE 4KWYA 4BC9A 2KOUA 1P47A 1HNXE 2L92A 2NUFA 2EMZA 2YTFA 2M1SA 2ENHA 4LF9E 2LRSA 2Q8UA 2HC5A 2F4VE 2M7QA 3VYXA 4ZYHA 5KL5A 5IV8B 3VK6A 2EOOA 4N4RB 3UK3C 1B69A 1YZ9A 4ZYEA 3ADLA 4R2PA 1X6FA 1J5EE 3IWDA 1XMQE 2L2MA 1X5WA 4JI8E 4NXME 3ZOQB 4HEIA 4O43A 1QNTA 4IS1C 2PRTA 4AQYE 2MDRA 3JTZA 2YTDA 2DIXA 3C4TA 3HPZA 2JPAA 2JOXA 4Q35B 2I13A 2GPIA 3QG5C 3BIDA 1X6HA 1A1FA 2EPMX 1T4OA 2JY9A 1HNZE 1MEYC 2NABA 2R76A 2J7JA 2EL6A 1L4SA 2G7HA 2HJJA 4F9CB 2V87A 2CSHA 1TF3A 4F2JC 1A1KA 1G2FC 2EPRA 4M30A 2HGHA 4F9AB 4F54A 3EPHA 2EMFA 1WJPA 4X64E 1YYOA 1IBME 2EN8A 2YTQA 3J81C 2EN1A 5A6JA 4DV4E 3K6QA 3LMLA 1BBOA 2YTOA 5AC4A 2YPNA 2EOJA 4B3TE 2EM7A 3HPSA 4TUIA 2H36X 2FGGA 2CTDA 4KHPE 2DMIA 4JI2E 3P1XA 4F6NA 2N3HA 2ZM6E 2BB8A 1SR9A 1T38A 1KJKA 3MHSC 2JXPA 4B3ME 2YTJA 2EN6A 2EPAA 1GQEA 2ADRA 3IWBA 3BBGA 3EPLA 4JI3E 4I8OA 5ADZA 2EPXA 3DJWA 2VE7C 3F6GA 4LU9A 1N3GA 2EJ4A 1WRJA 2ODRD 5LMUE 2EOHA 1HR0E 4JYAE 3J7Yp 2JP9A 1YUIA 4DMIA 2EM8A 1RQ0A 2CT1A 2LUPB 2EMYA 2EOYA 4WXCA 2EE8A 2B3TB 2JR1A 4DV7E 2L6MA 2LT7A 1UN6B 3T1YE 2EM5A 1MGTA 4WSGA 5IT9C 2EM6A 4BC7A 2JOBA 4LF8E 2MKNA 4Q28A 2EN4A 1PJTA 4GEQB 2NUGA 3C6MA 2CPNA 2WBSA 1TN9A 4DR6E 1ZBTA 2UUBE 3OMLA 4JI7E 4YY3E 1HNWE 2EMKA 2YZTA 2V86A 4WX9A 1KYQA 1T4NA 2EMXA 2LCEA 2JWOA 4O24A 2MKDA 2EQ0A 1YPNA 3JU0A 4GKJE 2E72A 2YTEA 2WZOA
chains in the Genus database with same CATH topology
2EOFA 2RSIA 2ELZA 3VHTB 4R2SA 2JPAA 2I13A 2M9AA 2EOZA 1X6HA 1A1FA 1TF6A 1A1JA 4IJDA 2YTPA 1MEYC 2NABA 1G2DC 2J7JA 2EL6A 2LVHA 1TF3A 2CSHA 2EN7A 3EPKA 4F2JC 4F6MA 1A1KA 1G2FC 2EPRA 5KL2A 5KL4A 4R2CA 1A1LA 2R1FA 1LLMC 2HGHA 1BB8A 2EMGA 2YTGA 3EPHA 2EMFA 1WJPA 1A1IA 2EL5A 2EN8A 2DLKA 2YTQA 2EN1A 5KL6A 2EPPA 2EMWA 2DGCA 1BBOA 1YSAC 2YTOA 1Z1BA 2EOJA 2RPCA 2EPCA 2EM7A 2EN2A 1JK1A 2EMHA 1RMDA 2CTDA 1NCSA 2EN3A 2DMIA 2EMIA 2YTEA 4F6NA 2EOMA 2EM3A 5KL3A 2BB8A 1ZR9A 2D9HA 2EMCA 2YTNA 1KJKA 2EPZA 3MHSC 1JK2A 2YTJA 2EN6A 2EORA 2EPAA 2EOXA 2ADRA 2LO3A 4GZNC 2EOEA 3EPLA 4FK5C 1ZAAC 2EPXA 4R2RA 1YUJA 2EQ1A 2A25A 2ENCA 2VRDA 2EJ4A 4X9JA 2EPUA 3MHHC 2YRMA 1A1GA 2EOHA 2DRPA 2GLIA 2YSPA 3M99B 2YRHA 1F2IG 1A1HA 2EOIA 2JP9A 2EQ3A 1YUIA 2EP3A 4M9VC 2WBTA 2EM8A 1UBDC 2EM0A 2EOQA 2CT1A 2EMLA 2WBUA 2YSOA 2EMYA 2EOYA 2YTIA 4R2AA 2EE8A 2EMBA 2EL4A 1X3CA 2LT7A 1UN6B 1X6EA 1P47A 2EM5A 4WSGA 2EMZA 2YTFA 2EM6A 2GHFA 2MKNA 2EN4A 2ENHA 2EM2A 2WCC3 4R2DA 2DLQA 2WBSA 2EOSA 5KL5A 2YU5A 2EOOA 1ZU1A 2ENAA 1TN9A 4R2QA 4R2EA 2LV2A 2YRKA 3UK3C 1AAYA 2EMKA 1B69A 4R2PA 1DGCA 1X6FA 2EMXA 2LCEA 2MKDA 2EQ0A 1X5WA 5KL7A 2EM4A 3EPJA 2YU8A 4IS1C 2PRTA 2EMAA 2EM9A 2MDGA 2E72A 2YTDA 2ELYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EOF A;  2RSI A;  2ELZ A;  3VHT B;  4R2S A;  2JPA A;  2I13 A;  2M9A A;  2EOZ A;  1X6H A;  1A1F A;  1TF6 A;  1A1J A;  4IJD A;  2YTP A;  1MEY C;  2NAB A;  1G2D C;  2J7J A;  2EL6 A;  2LVH A;  1TF3 A;  2CSH A;  2EN7 A;  3EPK A;  4F2J C;  4F6M A;  1A1K A;  1G2F C;  2EPR A;  5KL2 A;  5KL4 A;  4R2C A;  1A1L A;  2R1F A;  1LLM C;  2HGH A;  1BB8 A;  2EMG A;  2YTG A;  3EPH A;  2EMF A;  1WJP A;  1A1I A;  2EL5 A;  2EN8 A;  2DLK A;  2YTQ A;  2EN1 A;  5KL6 A;  2EPP A;  2EMW A;  2DGC A;  1BBO A;  1YSA C;  2YTO A;  1Z1B A;  2EOJ A;  2RPC A;  2EPC A;  2EM7 A;  2EN2 A;  1JK1 A;  2EMH A;  1RMD A;  2CTD A;  1NCS A;  2EN3 A;  2DMI A;  2EMI A;  2YTE A;  4F6N A;  2EOM A;  2EM3 A;  5KL3 A;  2BB8 A;  1ZR9 A;  2D9H A;  2EMC A;  2YTN A;  1KJK A;  2EPZ A;  3MHS C;  1JK2 A;  2YTJ A;  2EN6 A;  2EOR A;  2EPA A;  2EOX A;  2ADR A;  2LO3 A;  4GZN C;  2EOE A;  3EPL A;  4FK5 C;  1ZAA C;  2EPX A;  4R2R A;  1YUJ A;  2EQ1 A;  2A25 A;  2ENC A;  2VRD A;  2EJ4 A;  4X9J A;  2EPU A;  3MHH C;  2YRM A;  1A1G A;  2EOH A;  2DRP A;  2GLI A;  2YSP A;  3M99 B;  2YRH A;  1F2I G;  1A1H A;  2EOI A;  2JP9 A;  2EQ3 A;  1YUI A;  2EP3 A;  4M9V C;  2WBT A;  2EM8 A;  1UBD C;  2EM0 A;  2EOQ A;  2CT1 A;  2EML A;  2WBU A;  2YSO A;  2EMY A;  2EOY A;  2YTI A;  4R2A A;  2EE8 A;  2EMB A;  2EL4 A;  1X3C A;  2LT7 A;  1UN6 B;  1X6E A;  1P47 A;  2EM5 A;  4WSG A;  2EMZ A;  2YTF A;  2EM6 A;  2GHF A;  2MKN A;  2EN4 A;  2ENH A;  2EM2 A;  2WCC 3;  4R2D A;  2DLQ A;  2WBS A;  2EOS A;  5KL5 A;  2YU5 A;  2EOO A;  1ZU1 A;  2ENA A;  1TN9 A;  4R2Q A;  4R2E A;  2LV2 A;  2YRK A;  3UK3 C;  1AAY A;  2EMK A;  1B69 A;  4R2P A;  1DGC A;  1X6F A;  2EMX A;  2LCE A;  2MKD A;  2EQ0 A;  1X5W A;  5KL7 A;  2EM4 A;  3EPJ A;  2YU8 A;  4IS1 C;  2PRT A;  2EMA A;  2EM9 A;  2MDG A;  2E72 A;  2YTD A;  2ELY A; 
#chains in the Genus database with same CATH topology
 2RSI A;  4WFT A;  4O5G A;  3VHT B;  1IBL E;  5LLQ A;  4B3R E;  2YTP A;  1DI2 A;  1G2D C;  4JI4 E;  1T39 A;  4O4K A;  2EWL A;  3MSW A;  2F8B A;  1N36 E;  2EN7 A;  4WPY A;  4JI1 E;  5KL2 A;  5KL4 A;  1BB8 A;  4JV5 E;  2R1F A;  2MC5 A;  2EMG A;  1PDA A;  4ZYD A;  2DLK A;  2EPP A;  2YWQ A;  2EMW A;  4NZV A;  1YSA C;  2HHH E;  4LF6 E;  2ODR C;  2M4I A;  2N8X A;  1NCS A;  2EZ6 A;  4LTY A;  2EMI A;  4BBY A;  3C6K A;  5AE3 A;  1WHN A;  1EH7 A;  3HQ1 A;  2EM3 A;  2LUQ A;  2JVA A;  2V8Q B;  1RC7 A;  2D9H A;  3EQ1 A;  4WYQ B;  4YHH E;  4DR1 E;  5IXM B;  2EOR A;  4DUZ E;  4GZN C;  4WXD A;  1N32 E;  2LJU A;  2EOE A;  4JI6 E;  3ADJ A;  4DR2 E;  1XNQ E;  2L33 A;  1YUJ A;  5A2Q C;  2A25 A;  2VRD A;  2B7T A;  4DR7 E;  2MC6 A;  3TQM A;  2GLI A;  3J80 C;  2V88 A;  5AE1 A;  1GTK A;  1IBK E;  2EQ3 A;  4M0V A;  3RMP A;  1PKP A;  2YT4 A;  2B7V A;  4X62 E;  2IHR 1;  4J8Z A;  2WBU A;  2L2K B;  4DV1 E;  1EH8 A;  2EPK X;  4R2A A;  1X48 A;  1X3C A;  1UHZ A;  5LL6 R;  4GKK E;  1X6E A;  2VQF E;  5FLX C;  2B9D A;  2EM2 A;  2DB2 A;  2DLQ A;  4X66 E;  2EOS A;  2YU5 A;  1ZU1 A;  3ADG A;  4K0K E;  4R2Q A;  4KZS A;  2YRK A;  3L00 A;  4BMJ A;  4P78 A;  2E5L E;  3H09 A;  2UXD E;  3EPJ A;  2RS6 A;  4WSP A;  2DSY A;  4TUG A;  2MDG A;  2ELY A;  3BGH A;  4RHB B;  4B3S E;  1XNR E;  4R03 A;  2M9A A;  2EOZ A;  3ECR A;  1WXR A;  1TF6 A;  1NEI A;  1A1J A;  4IJD A;  4X65 E;  4BCA A;  4MLQ A;  3AV0 A;  3KZZ A;  2LVH A;  3KWR A;  5AE2 A;  2YTG A;  2K7I A;  4BS9 A;  5CFF E;  5F3W A;  3VYY A;  1A1I A;  2EL5 A;  4NXN E;  2LJH A;  3HXL A;  3FIG A;  1PJS A;  1WHQ A;  4F9B B;  2RPC A;  4M2Z A;  2EN2 A;  5A69 A;  2EMH A;  4DKK A;  3HTX A;  4LFC E;  2V89 A;  1GZ6 A;  1IQO A;  1YYK A;  4ZYG A;  3OTO E;  1N33 E;  4RH8 A;  2EPZ A;  1IMU A;  1JK2 A;  3LLH A;  4DV5 E;  2LO3 A;  2E1M A;  2FTX B;  4BHC A;  4FK5 C;  4DV2 E;  1ZAA C;  1BBG A;  2UXB E;  2BBG A;  4LF7 E;  4X9J A;  3MHH C;  1A1G A;  5IWA E;  2YSP A;  3C4B A;  5A6A A;  1F2I G;  2EP3 A;  4M9V C;  3AUZ A;  2EOQ A;  2EML A;  2L3C A;  4MLV A;  3IWC A;  1FJG E;  2LTR A;  2YTI A;  4X8W A;  2EMB A;  2EL4 A;  3KZY A;  1X49 A;  2V83 A;  2LMZ A;  1XMO E;  2GHF A;  2NUE A;  2WCC 3;  4R2D A;  3THO B;  2EPO A;  1T4L B;  2V85 A;  2ENA A;  4P7D A;  4R2E A;  4LF5 E;  1PJQ A;  2LV2 A;  2VQE E;  1AAY A;  3JAM C;  1SFE A;  1DGC A;  1I94 E;  5KL7 A;  2UXC E;  2EM4 A;  4DR4 E;  2LE2 A;  2YU8 A;  2EMA A;  5BR8 E;  2EM9 A;  2L2N A;  5A6B A;  3T1H E;  2VF1 A;  4JI5 E;  2EOF A;  2ELZ A;  4BHB A;  4R2S A;  2L8T A;  1YFH A;  2RQL A;  5AC5 A;  4DR3 E;  3BF2 A;  2L3J A;  4R8O A;  1FKA E;  4L8N A;  1N34 E;  4DV6 E;  2N3G A;  5AAS A;  3DF6 A;  3EPK A;  4F6M A;  1YYW A;  2RS7 A;  2NA2 A;  5A6K A;  4R2C A;  1A1L A;  1LLM C;  4HTG A;  1O0W A;  3F6H A;  4NHR A;  5T6J A;  2KHX A;  5KL6 A;  5DNY A;  4DUY E;  1EKZ A;  2UUC E;  2DGC A;  4DV3 E;  1Z1B A;  4DV0 E;  4DR5 E;  2UU9 E;  2EPC A;  1DQ3 A;  2JYA A;  1JK1 A;  4LFA E;  2I9I A;  2KON A;  4LFB E;  1STU A;  1RMD A;  2EN3 A;  1X47 A;  4OOG C;  2EOM A;  1QU6 A;  3ADI A;  5KL3 A;  1ZR9 A;  2EMC A;  3THN A;  2YTN A;  2DMY A;  2K4V A;  5A6B D;  1EH6 A;  2EPN A;  3J7A G;  2EOX A;  4LF4 E;  2LTS A;  2EPL X;  4R2R A;  1J26 A;  2EQ1 A;  2ENC A;  2EPU A;  2FV4 B;  2YRM A;  2DRP A;  3M99 B;  1IQS A;  2YRH A;  1A1H A;  2LBS B;  2EOI A;  1AH5 A;  2RTX A;  4JI0 E;  4OX9 E;  2WBT A;  2RSM A;  5LMN E;  1UBD C;  1UIL A;  2EM0 A;  2YSO A;  4L5N C;  1ZBQ A;  5TSE A;  2UUA E;  4KWY A;  4BC9 A;  2KOU A;  1P47 A;  1HNX E;  2L92 A;  2NUF A;  2EMZ A;  2YTF A;  2M1S A;  2ENH A;  4LF9 E;  2LRS A;  2Q8U A;  2HC5 A;  2F4V E;  2M7Q A;  3VYX A;  4ZYH A;  5KL5 A;  5IV8 B;  3VK6 A;  2EOO A;  4N4R B;  3UK3 C;  1B69 A;  1YZ9 A;  4ZYE A;  3ADL A;  4R2P A;  1X6F A;  1J5E E;  3IWD A;  1XMQ E;  2L2M A;  1X5W A;  4JI8 E;  4NXM E;  3ZOQ B;  4HEI A;  4O43 A;  1QNT A;  4IS1 C;  2PRT A;  4AQY E;  2MDR A;  3JTZ A;  2YTD A;  2DIX A;  3C4T A;  3HPZ A;  2JPA A;  2JOX A;  4Q35 B;  2I13 A;  2GPI A;  3QG5 C;  3BID A;  1X6H A;  1A1F A;  2EPM X;  1T4O A;  2JY9 A;  1HNZ E;  1MEY C;  2NAB A;  2R76 A;  2J7J A;  2EL6 A;  1L4S A;  2G7H A;  2HJJ A;  4F9C B;  2V87 A;  2CSH A;  1TF3 A;  4F2J C;  1A1K A;  1G2F C;  2EPR A;  4M30 A;  2HGH A;  4F9A B;  4F54 A;  3EPH A;  2EMF A;  1WJP A;  4X64 E;  1YYO A;  1IBM E;  2EN8 A;  2YTQ A;  3J81 C;  2EN1 A;  5A6J A;  4DV4 E;  3K6Q A;  3LML A;  1BBO A;  2YTO A;  5AC4 A;  2YPN A;  2EOJ A;  4B3T E;  2EM7 A;  3HPS A;  4TUI A;  2H36 X;  2FGG A;  2CTD A;  4KHP E;  2DMI A;  4JI2 E;  3P1X A;  4F6N A;  2N3H A;  2ZM6 E;  2BB8 A;  1SR9 A;  1T38 A;  1KJK A;  3MHS C;  2JXP A;  4B3M E;  2YTJ A;  2EN6 A;  2EPA A;  1GQE A;  2ADR A;  3IWB A;  3BBG A;  3EPL A;  4JI3 E;  4I8O A;  5ADZ A;  2EPX A;  3DJW A;  2VE7 C;  3F6G A;  4LU9 A;  1N3G A;  2EJ4 A;  1WRJ A;  2ODR D;  5LMU E;  2EOH A;  1HR0 E;  4JYA E;  3J7Y p;  2JP9 A;  1YUI A;  4DMI A;  2EM8 A;  1RQ0 A;  2CT1 A;  2LUP B;  2EMY A;  2EOY A;  4WXC A;  2EE8 A;  2B3T B;  2JR1 A;  4DV7 E;  2L6M A;  2LT7 A;  1UN6 B;  3T1Y E;  2EM5 A;  1MGT A;  4WSG A;  5IT9 C;  2EM6 A;  4BC7 A;  2JOB A;  4LF8 E;  2MKN A;  4Q28 A;  2EN4 A;  1PJT A;  4GEQ B;  2NUG A;  3C6M A;  2CPN A;  2WBS A;  1TN9 A;  4DR6 E;  1ZBT A;  2UUB E;  3OML A;  4JI7 E;  4YY3 E;  1HNW E;  2EMK A;  2YZT A;  2V86 A;  4WX9 A;  1KYQ A;  1T4N A;  2EMX A;  2LCE A;  2JWO A;  4O24 A;  2MKD A;  2EQ0 A;  1YPN A;  3JU0 A;  4GKJ E;  2E72 A;  2YTE A;  2WZO A; 
#chains in the Genus database with same CATH homology
 2EOF A;  2RSI A;  2ELZ A;  3VHT B;  4R2S A;  2JPA A;  2I13 A;  2M9A A;  2EOZ A;  1X6H A;  1A1F A;  1TF6 A;  1A1J A;  4IJD A;  2YTP A;  1MEY C;  2NAB A;  1G2D C;  2J7J A;  2EL6 A;  2LVH A;  1TF3 A;  2CSH A;  2EN7 A;  3EPK A;  4F2J C;  4F6M A;  1A1K A;  1G2F C;  2EPR A;  5KL2 A;  5KL4 A;  4R2C A;  1A1L A;  2R1F A;  1LLM C;  2HGH A;  1BB8 A;  2EMG A;  2YTG A;  3EPH A;  2EMF A;  1WJP A;  1A1I A;  2EL5 A;  2EN8 A;  2DLK A;  2YTQ A;  2EN1 A;  5KL6 A;  2EPP A;  2EMW A;  2DGC A;  1BBO A;  1YSA C;  2YTO A;  1Z1B A;  2EOJ A;  2RPC A;  2EPC A;  2EM7 A;  2EN2 A;  1JK1 A;  2EMH A;  1RMD A;  2CTD A;  1NCS A;  2EN3 A;  2DMI A;  2EMI A;  2YTE A;  4F6N A;  2EOM A;  2EM3 A;  5KL3 A;  2BB8 A;  1ZR9 A;  2D9H A;  2EMC A;  2YTN A;  1KJK A;  2EPZ A;  3MHS C;  1JK2 A;  2YTJ A;  2EN6 A;  2EOR A;  2EPA A;  2EOX A;  2ADR A;  2LO3 A;  4GZN C;  2EOE A;  3EPL A;  4FK5 C;  1ZAA C;  2EPX A;  4R2R A;  1YUJ A;  2EQ1 A;  2A25 A;  2ENC A;  2VRD A;  2EJ4 A;  4X9J A;  2EPU A;  3MHH C;  2YRM A;  1A1G A;  2EOH A;  2DRP A;  2GLI A;  2YSP A;  3M99 B;  2YRH A;  1F2I G;  1A1H A;  2EOI A;  2JP9 A;  2EQ3 A;  1YUI A;  2EP3 A;  4M9V C;  2WBT A;  2EM8 A;  1UBD C;  2EM0 A;  2EOQ A;  2CT1 A;  2EML A;  2WBU A;  2YSO A;  2EMY A;  2EOY A;  2YTI A;  4R2A A;  2EE8 A;  2EMB A;  2EL4 A;  1X3C A;  2LT7 A;  1UN6 B;  1X6E A;  1P47 A;  2EM5 A;  4WSG A;  2EMZ A;  2YTF A;  2EM6 A;  2GHF A;  2MKN A;  2EN4 A;  2ENH A;  2EM2 A;  2WCC 3;  4R2D A;  2DLQ A;  2WBS A;  2EOS A;  5KL5 A;  2YU5 A;  2EOO A;  1ZU1 A;  2ENA A;  1TN9 A;  4R2Q A;  4R2E A;  2LV2 A;  2YRK A;  3UK3 C;  1AAY A;  2EMK A;  1B69 A;  4R2P A;  1DGC A;  1X6F A;  2EMX A;  2LCE A;  2MKD A;  2EQ0 A;  1X5W A;  5KL7 A;  2EM4 A;  3EPJ A;  2YU8 A;  4IS1 C;  2PRT A;  2EMA A;  2EM9 A;  2MDG A;  2E72 A;  2YTD A;  2ELY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...