2CT1A

Solution structure of the zinc finger domain of transcriptional repressor ctcf protein
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
77
structure length
77
Chain Sequence
GSSGSSGRTHSGEKPYECYICHARFTQSGTMKMHILQKHTENVAKFHCPHCDTVIARKSDLGVHLRKQHSYSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution Structure of the zinc finger domain of Transcriptional repressor CTCF protein
rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords Transcriptional repressor CTCF
total genus 12
structure length 77
sequence length 77
ec nomenclature
pdb deposition date 2005-05-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00096 zf-C2H2 Zinc finger, C2H2 type
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.60 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Classic Zinc Finger 2ct1A01
2M9AA 2EMFA 2EMXA 2YTDA 5KL4A 2EPZA 1A1FA 3EPHA 2EN7A 2DLKA 2LO3A 2EM0A 5KL2A 2YRHA 2LT7A 1B69A 1MEYC 2EOEA 2CT1A 2MKNA 2EN4A 4R2RA 1AAYA 2EMLA 1X5WA 2EMIA 4R2PA 2EMZA 1X6HA 2WBUA 2ENAA 2J7JA 1G2DC 1YUIA 1NCSA 2EM3A 1TF3A 2GLIA 1X6FA 2YU8A 2YTQA 1F2IG 2EM5A 1JK1A 2EMYA 2R1FA 2PRTA 4M9VC 2EM2A 2EN1A 3EPLA 2E72A 2EJ4A 2EM6A 2YTGA 2EOQA 2EMHA 2DGCA 1P47A 1WJPA 2RSIA 2JP9A 2EMWA 2DRPA 2EORA 2EL6A 4R2AA 1UN6B 2EOJA 1A1IA 2ENHA 3MHHC 2EMCA 1JK2A 2YTEA 2YTOA 2I13A 2EOXA 4IS1C 1ZAAC 2WBTA 1KJKA 2EQ1A 2HGHA 2EE8A 2EOFA 1X3CA 2EL5A 2YSPA 2EQ0A 2D9HA 4R2DA 1LLMC 2ELYA 2LCEA 3M99B 3EPKA 2EPAA 3UK3C 2DMIA 2EMKA 4R2SA 2YSOA 4X9JA 2YTFA 2VRDA 4F2JC 1G2FC 1TN9A 2EOIA 2EPPA 2GHFA 2EP3A 2EOOA 2EQ3A 2EL4A 2CTDA 2EOSA 2EPXA 2CSHA 1ZU1A 2EOHA 2EM7A 1ZR9A 2YRMA 2BB8A 2EMBA 2EM4A 2YTIA 2EMGA 2EPUA 2EM8A 4R2QA 2ENCA 2YTPA 1BB8A 2YRKA 1UBDC 4F6NA 2EN2A 2EOZA 1Z1BA 2EN8A 2EOMA 1YUJA 1RMDA 4IJDA 4R2EA 2YTJA 2WCC3 4FK5C 4F6MA 2LVHA 1A1JA 1A1GA 2LV2A 2EMAA 3EPJA 1DGCA 2WBSA 5KL6A 2YU5A 1YSAC 4R2CA 1A1KA 5KL5A 2EN6A 2EPCA 2NABA 2RPCA 1X6EA 2EM9A 5KL7A 1BBOA 2EPRA 2EN3A 2MDGA 2A25A 3VHTB 4GZNC 1A1LA 5KL3A 2ELZA 4WSGA 1A1HA 2JPAA 3MHSC 1TF6A 2MKDA 2YTNA 2DLQA 2ADRA 2EOYA
chains in the Genus database with same CATH superfamily
2M9AA 3JAMC 2EMFA 3EPHA 2H36X 2EPKX 2LTSA 2DLKA 1PJSA 4LFCE 1B69A 2EOEA 2V89A 2CT1A 4LF6E 2EN4A 2L2KB 1X5WA 1T38A 1J5EE 2JY9A 2J7JA 4N4RB 2VQEE 1EH8A 3RMPA 1WHQA 1F2IG 2EM5A 1IQSA 1JK1A 4F9AB 1L4SA 2EM2A 2EN1A 3EPLA 2YTGA 3HXLA 3AUZA 5IT9C 2DRPA 2EORA 2UU9E 4BHCA 2ENHA 3HTXA 2L8TA 2VQFE 1UILA 1FJGE 4IS1C 2JWOA 2UXCE 1PKPA 2EQ1A 2L33A 2HC5A 3ADJA 1N3GA 2YSPA 4LTYA 2EQ0A 3LLHA 5AASA 4R2DA 5LMUE 5T6JA 2LTRA 2EMKA 2RTXA 2YSOA 3THOB 2VRDA 2EPPA 2V87A 2ZM6E 1ZU1A 2EOHA 1YPNA 5DNYA 4DR2E 2LUQA 2EMGA 4X8WA 1SFEA 3DJWA 1GZ6A 2V88A 3AV0A 1YYWA 1UBDC 4YY3E 1QU6A 3KZYA 5LMNE 2EN8A 1IBME 2EOMA 2YPNA 4FK5C 5CFFE 3VYYA 1A1JA 1A1GA 4B3SE 4L5NC 1DGCA 4OX9E 2M7QA 4DR7E 4DR1E 4B3TE 2L3JA 1N32E 1X6EA 2EM9A 4DV0E 2EPRA 2JXPA 1PJTA 2A25A 3VHTB 3J80C 2UXBE 3C4BA 5KL3A 4L8NA 4WSGA 4Q35B 3ADIA 4JV5E 2B7TA 1TF6A 2RS7A 2MKDA 2RSMA 4JI5E 2YTDA 2EPZA 3HPSA 4LF9E 2EZ6A 2EM0A 4JI4E 1YYKA 2N3HA 5IWAE 4R2RA 2EMIA 2IHR1 2MDRA 3BGHA 2EM3A 1TF3A 2YT4A 1X6FA 3F6HA 2YTQA 3J7Yp 5FLXC 1GTKA 4TUIA 2EM6A 4RHBB 3IWDA 2K7IA 2MC6A 2HJJA 2DGCA 3KZZA 1X49A 2RSIA 4JI8E 4BBYA 2UUBE 4DV4E 1X48A 2N8XA 3QG5C 2EOJA 1N34E 4GKKE 1WXRA 1A1IA 3C4TA 4O24A 4WPYA 2LBSB 1QNTA 4JI6E 2YTOA 3VYXA 2WBTA 1XMQE 2JR1A 1HR0E 4DR4E 1X3CA 2EL5A 1STUA 1NEIA 2D9HA 2B9DA 2LCEA 4YHHE 2DMIA 1DI2A 4X9JA 2JOBA 4WSPA 1G2FC 2VE7C 1TN9A 2EOIA 2L2MA 3LMLA 2EQ3A 3BBGA 1ZR9A 1HNWE 1YFHA 2EM4A 2EMBA 1N36E 1EH6A 4DUYE 4O43A 2EM8A 1O0WA 2ENCA 2YTPA 2LMZA 2YRKA 2NA2A 2EOZA 4P78A 1Z1BA 2KONA 4K0KE 4HTGA 3C6KA 4R8OA 4RH8A 4R2EA 2V86A 4DKKA 2WCC3 2B7VA 2LV2A 2B3TB 3P1XA 5A6KA 1XNQE 2V8QB 4M30A 2FGGA 4HEIA 3MSWA 2MC5A 2EPCA 2NABA 3VK6A 5IV8B 2RPCA 1HNZE 4BMJA 2EN3A 1ZBQA 2MDGA 2LUPB 3BIDA 1EKZA 4WXDA 4GZNC 2DSYA 1A1LA 2WZOA 2ELZA 1A1HA 2Q8UA 4NXME 2JPAA 2BBGA 1I94E 2YTNA 4O4KA 5ADZA 5KL4A 1A1FA 2VF1A 2UUAE 2EN7A 2LO3A 1IBKE 2FV4B 5KL2A 2YRHA 2LT7A 2JVAA 2L6MA 1MEYC 1IBLE 4BC9A 2RS6A 3DF6A 2WBUA 4DR3E 2NUEA 4M0VA 2YZTA 1G2DC 4Q28A 1YUIA 4WFTA 2GLIA 2NUGA 1T4NA 2EPOA 2R1FA 2PRTA 3FIGA 2E72A 2EJ4A 4DV6E 2E5LE 4LF5E 2EMHA 2N3GA 1P47A 1WJPA 5A2QC 2JP9A 4NHRA 4R2AA 1UHZA 1UN6B 2F4VE 1N33E 1HNXE 2YTEA 2EOXA 4BC7A 3IWCA 3F6GA 1T4LB 2HGHA 4LFAE 2EE8A 2EOFA 1LLMC 3C6MA 5LL6R 1IQOA 4B3RE 2EL4A 2CTDA 2EOSA 5AC4A 4I8OA 2EM7A 5AC5A 2YRMA 4JI0E 2BB8A 2YTIA 1EH7A 5BR8E 2CPNA 1YYOA 2EPUA 2DIXA 2KOUA 4O5GA 1IMUA 5IXMB 4R2QA 5AE1A 2EPLX 4MLQA 5F3WA 4JI2E 4KHPE 1BB8A 2G7HA 2ODRD 3KWRA 1XMOE 4LF4E 2EPMX 4R03A 4IJDA 4J8ZA 2YTJA 3H09A 3ZOQB 4GKJE 2LVHA 5A6BA 2V85A 2EMAA 4LF7E 3TQMA 1GQEA 2WBSA 2E1MA 4DV3E 4F9BB 5KL6A 2YU5A 2EN6A 4NZVA 5TSEA 4AQYE 4ZYEA 2EWLA 4ZYHA 3ADLA 2K4VA 1KYQA 1DQ3A 1BBOA 1SR9A 1ZBTA 4BS9A 4KWYA 1WHNA 2LRSA 4DR5E 4F54A 5A6BD 3MHSC 5AE3A 4NXNE 4GEQB 2EMXA 2KHXA 2R76A 4OOGC 2GPIA 3EQ1A 2YWQA 4LU9A 2MKNA 3ECRA 1AAYA 2EMLA 4R2PA 2EMZA 1X6HA 3IWBA 2ENAA 3T1HE 2ODRC 1NCSA 1WRJA 2YU8A 4WYQB 4BHBA 3OMLA 2EMYA 2LJUA 1AH5A 5A6JA 4M9VC 1PJQA 2EOQA 1XNRE 5A69A 3HPZA 4MLVA 4WXCA 4LFBE 4DR6E 2EMWA 1X47A 1RC7A 2L3CA 2EL6A 4LF8E 4JYAE 2LJHA 3J81C 3OTOE 1J26A 4KZSA 2I9IA 4TUGA 3MHHC 2EMCA 5LLQA 1JK2A 2JOXA 4DUZE 2DMYA 2I13A 4B3ME 4DV2E 1PDAA 1ZAAC 3J7AG 1KJKA 2L92A 2ELYA 3M99B 3EPKA 2EPAA 3UK3C 3JU0A 4R2SA 4F2JC 2FTXB 2YTFA 4DV5E 4P7DA 4JI1E 2V83A 2GHFA 2EP3A 3L00A 2EOOA 3K6QA 2EPXA 2CSHA 4F9CB 3T1YE 2DB2A 2L2NA 2EPNA 4F6NA 2EN2A 1MGTA 4BCAA 1RQ0A 4ZYDA 5A6AA 1YZ9A 3JTZA 2JYAA 2UXDE 1YUJA 1RMDA 4WX9A 4DV1E 3THNA 1FKAE 4F6MA 2NUFA 3ADGA 3EPJA 5AE2A 4X64E 3HQ1A 4ZYGA 1YSAC 4R2CA 1A1KA 4M2ZA 2RQLA 5KL5A 2M4IA 1T39A 5KL7A 2LE2A 4X62E 1T4OA 2UUCE 4X65E 2M1SA 1BBGA 4DMIA 4JI7E 4DV7E 2F8BA 2HHHE 3BF2A 4JI3E 4X66E 2DLQA 2ADRA 2EOYA
chains in the Genus database with same CATH topology
2M9AA 2EMFA 2EMXA 2YTDA 5KL4A 2EPZA 1A1FA 3EPHA 2EN7A 2DLKA 2LO3A 2EM0A 5KL2A 2YRHA 2LT7A 1B69A 1MEYC 2EOEA 2CT1A 2MKNA 2EN4A 4R2RA 1AAYA 2EMLA 1X5WA 2EMIA 4R2PA 2EMZA 1X6HA 2WBUA 2ENAA 2J7JA 1G2DC 1YUIA 1NCSA 2EM3A 1TF3A 2GLIA 1X6FA 2YU8A 2YTQA 1F2IG 2EM5A 1JK1A 2EMYA 2R1FA 2PRTA 4M9VC 2EM2A 2EN1A 3EPLA 2E72A 2EJ4A 2EM6A 2YTGA 2EOQA 2EMHA 2DGCA 1P47A 1WJPA 2RSIA 2JP9A 2EMWA 2DRPA 2EORA 2EL6A 4R2AA 1UN6B 2EOJA 1A1IA 2ENHA 3MHHC 2EMCA 1JK2A 2YTEA 2YTOA 2I13A 2EOXA 4IS1C 1ZAAC 2WBTA 1KJKA 2EQ1A 2HGHA 2EE8A 2EOFA 1X3CA 2EL5A 2YSPA 2EQ0A 2D9HA 4R2DA 1LLMC 2ELYA 2LCEA 3M99B 3EPKA 2EPAA 3UK3C 2DMIA 2EMKA 4R2SA 2YSOA 4X9JA 2YTFA 2VRDA 4F2JC 1G2FC 1TN9A 2EOIA 2EPPA 2GHFA 2EP3A 2EOOA 2EQ3A 2EL4A 2CTDA 2EOSA 2EPXA 2CSHA 1ZU1A 2EOHA 2EM7A 1ZR9A 2YRMA 2BB8A 2EMBA 2EM4A 2YTIA 2EMGA 2EPUA 2EM8A 4R2QA 2ENCA 2YTPA 1BB8A 2YRKA 1UBDC 4F6NA 2EN2A 2EOZA 1Z1BA 2EN8A 2EOMA 1YUJA 1RMDA 4IJDA 4R2EA 2YTJA 2WCC3 4FK5C 4F6MA 2LVHA 1A1JA 1A1GA 2LV2A 2EMAA 3EPJA 1DGCA 2WBSA 5KL6A 2YU5A 1YSAC 4R2CA 1A1KA 5KL5A 2EN6A 2EPCA 2NABA 2RPCA 1X6EA 2EM9A 5KL7A 1BBOA 2EPRA 2EN3A 2MDGA 2A25A 3VHTB 4GZNC 1A1LA 5KL3A 2ELZA 4WSGA 1A1HA 2JPAA 3MHSC 1TF6A 2MKDA 2YTNA 2DLQA 2ADRA 2EOYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M9A A;  2EMF A;  2EMX A;  2YTD A;  5KL4 A;  2EPZ A;  1A1F A;  3EPH A;  2EN7 A;  2DLK A;  2LO3 A;  2EM0 A;  5KL2 A;  2YRH A;  2LT7 A;  1B69 A;  1MEY C;  2EOE A;  2CT1 A;  2MKN A;  2EN4 A;  4R2R A;  1AAY A;  2EML A;  1X5W A;  2EMI A;  4R2P A;  2EMZ A;  1X6H A;  2WBU A;  2ENA A;  2J7J A;  1G2D C;  1YUI A;  1NCS A;  2EM3 A;  1TF3 A;  2GLI A;  1X6F A;  2YU8 A;  2YTQ A;  1F2I G;  2EM5 A;  1JK1 A;  2EMY A;  2R1F A;  2PRT A;  4M9V C;  2EM2 A;  2EN1 A;  3EPL A;  2E72 A;  2EJ4 A;  2EM6 A;  2YTG A;  2EOQ A;  2EMH A;  2DGC A;  1P47 A;  1WJP A;  2RSI A;  2JP9 A;  2EMW A;  2DRP A;  2EOR A;  2EL6 A;  4R2A A;  1UN6 B;  2EOJ A;  1A1I A;  2ENH A;  3MHH C;  2EMC A;  1JK2 A;  2YTE A;  2YTO A;  2I13 A;  2EOX A;  4IS1 C;  1ZAA C;  2WBT A;  1KJK A;  2EQ1 A;  2HGH A;  2EE8 A;  2EOF A;  1X3C A;  2EL5 A;  2YSP A;  2EQ0 A;  2D9H A;  4R2D A;  1LLM C;  2ELY A;  2LCE A;  3M99 B;  3EPK A;  2EPA A;  3UK3 C;  2DMI A;  2EMK A;  4R2S A;  2YSO A;  4X9J A;  2YTF A;  2VRD A;  4F2J C;  1G2F C;  1TN9 A;  2EOI A;  2EPP A;  2GHF A;  2EP3 A;  2EOO A;  2EQ3 A;  2EL4 A;  2CTD A;  2EOS A;  2EPX A;  2CSH A;  1ZU1 A;  2EOH A;  2EM7 A;  1ZR9 A;  2YRM A;  2BB8 A;  2EMB A;  2EM4 A;  2YTI A;  2EMG A;  2EPU A;  2EM8 A;  4R2Q A;  2ENC A;  2YTP A;  1BB8 A;  2YRK A;  1UBD C;  4F6N A;  2EN2 A;  2EOZ A;  1Z1B A;  2EN8 A;  2EOM A;  1YUJ A;  1RMD A;  4IJD A;  4R2E A;  2YTJ A;  2WCC 3;  4FK5 C;  4F6M A;  2LVH A;  1A1J A;  1A1G A;  2LV2 A;  2EMA A;  3EPJ A;  1DGC A;  2WBS A;  5KL6 A;  2YU5 A;  1YSA C;  4R2C A;  1A1K A;  5KL5 A;  2EN6 A;  2EPC A;  2NAB A;  2RPC A;  1X6E A;  2EM9 A;  5KL7 A;  1BBO A;  2EPR A;  2EN3 A;  2MDG A;  2A25 A;  3VHT B;  4GZN C;  1A1L A;  5KL3 A;  2ELZ A;  4WSG A;  1A1H A;  2JPA A;  3MHS C;  1TF6 A;  2MKD A;  2YTN A;  2DLQ A;  2ADR A;  2EOY A; 
#chains in the Genus database with same CATH topology
 2M9A A;  3JAM C;  2EMF A;  3EPH A;  2H36 X;  2EPK X;  2LTS A;  2DLK A;  1PJS A;  4LFC E;  1B69 A;  2EOE A;  2V89 A;  2CT1 A;  4LF6 E;  2EN4 A;  2L2K B;  1X5W A;  1T38 A;  1J5E E;  2JY9 A;  2J7J A;  4N4R B;  2VQE E;  1EH8 A;  3RMP A;  1WHQ A;  1F2I G;  2EM5 A;  1IQS A;  1JK1 A;  4F9A B;  1L4S A;  2EM2 A;  2EN1 A;  3EPL A;  2YTG A;  3HXL A;  3AUZ A;  5IT9 C;  2DRP A;  2EOR A;  2UU9 E;  4BHC A;  2ENH A;  3HTX A;  2L8T A;  2VQF E;  1UIL A;  1FJG E;  4IS1 C;  2JWO A;  2UXC E;  1PKP A;  2EQ1 A;  2L33 A;  2HC5 A;  3ADJ A;  1N3G A;  2YSP A;  4LTY A;  2EQ0 A;  3LLH A;  5AAS A;  4R2D A;  5LMU E;  5T6J A;  2LTR A;  2EMK A;  2RTX A;  2YSO A;  3THO B;  2VRD A;  2EPP A;  2V87 A;  2ZM6 E;  1ZU1 A;  2EOH A;  1YPN A;  5DNY A;  4DR2 E;  2LUQ A;  2EMG A;  4X8W A;  1SFE A;  3DJW A;  1GZ6 A;  2V88 A;  3AV0 A;  1YYW A;  1UBD C;  4YY3 E;  1QU6 A;  3KZY A;  5LMN E;  2EN8 A;  1IBM E;  2EOM A;  2YPN A;  4FK5 C;  5CFF E;  3VYY A;  1A1J A;  1A1G A;  4B3S E;  4L5N C;  1DGC A;  4OX9 E;  2M7Q A;  4DR7 E;  4DR1 E;  4B3T E;  2L3J A;  1N32 E;  1X6E A;  2EM9 A;  4DV0 E;  2EPR A;  2JXP A;  1PJT A;  2A25 A;  3VHT B;  3J80 C;  2UXB E;  3C4B A;  5KL3 A;  4L8N A;  4WSG A;  4Q35 B;  3ADI A;  4JV5 E;  2B7T A;  1TF6 A;  2RS7 A;  2MKD A;  2RSM A;  4JI5 E;  2YTD A;  2EPZ A;  3HPS A;  4LF9 E;  2EZ6 A;  2EM0 A;  4JI4 E;  1YYK A;  2N3H A;  5IWA E;  4R2R A;  2EMI A;  2IHR 1;  2MDR A;  3BGH A;  2EM3 A;  1TF3 A;  2YT4 A;  1X6F A;  3F6H A;  2YTQ A;  3J7Y p;  5FLX C;  1GTK A;  4TUI A;  2EM6 A;  4RHB B;  3IWD A;  2K7I A;  2MC6 A;  2HJJ A;  2DGC A;  3KZZ A;  1X49 A;  2RSI A;  4JI8 E;  4BBY A;  2UUB E;  4DV4 E;  1X48 A;  2N8X A;  3QG5 C;  2EOJ A;  1N34 E;  4GKK E;  1WXR A;  1A1I A;  3C4T A;  4O24 A;  4WPY A;  2LBS B;  1QNT A;  4JI6 E;  2YTO A;  3VYX A;  2WBT A;  1XMQ E;  2JR1 A;  1HR0 E;  4DR4 E;  1X3C A;  2EL5 A;  1STU A;  1NEI A;  2D9H A;  2B9D A;  2LCE A;  4YHH E;  2DMI A;  1DI2 A;  4X9J A;  2JOB A;  4WSP A;  1G2F C;  2VE7 C;  1TN9 A;  2EOI A;  2L2M A;  3LML A;  2EQ3 A;  3BBG A;  1ZR9 A;  1HNW E;  1YFH A;  2EM4 A;  2EMB A;  1N36 E;  1EH6 A;  4DUY E;  4O43 A;  2EM8 A;  1O0W A;  2ENC A;  2YTP A;  2LMZ A;  2YRK A;  2NA2 A;  2EOZ A;  4P78 A;  1Z1B A;  2KON A;  4K0K E;  4HTG A;  3C6K A;  4R8O A;  4RH8 A;  4R2E A;  2V86 A;  4DKK A;  2WCC 3;  2B7V A;  2LV2 A;  2B3T B;  3P1X A;  5A6K A;  1XNQ E;  2V8Q B;  4M30 A;  2FGG A;  4HEI A;  3MSW A;  2MC5 A;  2EPC A;  2NAB A;  3VK6 A;  5IV8 B;  2RPC A;  1HNZ E;  4BMJ A;  2EN3 A;  1ZBQ A;  2MDG A;  2LUP B;  3BID A;  1EKZ A;  4WXD A;  4GZN C;  2DSY A;  1A1L A;  2WZO A;  2ELZ A;  1A1H A;  2Q8U A;  4NXM E;  2JPA A;  2BBG A;  1I94 E;  2YTN A;  4O4K A;  5ADZ A;  5KL4 A;  1A1F A;  2VF1 A;  2UUA E;  2EN7 A;  2LO3 A;  1IBK E;  2FV4 B;  5KL2 A;  2YRH A;  2LT7 A;  2JVA A;  2L6M A;  1MEY C;  1IBL E;  4BC9 A;  2RS6 A;  3DF6 A;  2WBU A;  4DR3 E;  2NUE A;  4M0V A;  2YZT A;  1G2D C;  4Q28 A;  1YUI A;  4WFT A;  2GLI A;  2NUG A;  1T4N A;  2EPO A;  2R1F A;  2PRT A;  3FIG A;  2E72 A;  2EJ4 A;  4DV6 E;  2E5L E;  4LF5 E;  2EMH A;  2N3G A;  1P47 A;  1WJP A;  5A2Q C;  2JP9 A;  4NHR A;  4R2A A;  1UHZ A;  1UN6 B;  2F4V E;  1N33 E;  1HNX E;  2YTE A;  2EOX A;  4BC7 A;  3IWC A;  3F6G A;  1T4L B;  2HGH A;  4LFA E;  2EE8 A;  2EOF A;  1LLM C;  3C6M A;  5LL6 R;  1IQO A;  4B3R E;  2EL4 A;  2CTD A;  2EOS A;  5AC4 A;  4I8O A;  2EM7 A;  5AC5 A;  2YRM A;  4JI0 E;  2BB8 A;  2YTI A;  1EH7 A;  5BR8 E;  2CPN A;  1YYO A;  2EPU A;  2DIX A;  2KOU A;  4O5G A;  1IMU A;  5IXM B;  4R2Q A;  5AE1 A;  2EPL X;  4MLQ A;  5F3W A;  4JI2 E;  4KHP E;  1BB8 A;  2G7H A;  2ODR D;  3KWR A;  1XMO E;  4LF4 E;  2EPM X;  4R03 A;  4IJD A;  4J8Z A;  2YTJ A;  3H09 A;  3ZOQ B;  4GKJ E;  2LVH A;  5A6B A;  2V85 A;  2EMA A;  4LF7 E;  3TQM A;  1GQE A;  2WBS A;  2E1M A;  4DV3 E;  4F9B B;  5KL6 A;  2YU5 A;  2EN6 A;  4NZV A;  5TSE A;  4AQY E;  4ZYE A;  2EWL A;  4ZYH A;  3ADL A;  2K4V A;  1KYQ A;  1DQ3 A;  1BBO A;  1SR9 A;  1ZBT A;  4BS9 A;  4KWY A;  1WHN A;  2LRS A;  4DR5 E;  4F54 A;  5A6B D;  3MHS C;  5AE3 A;  4NXN E;  4GEQ B;  2EMX A;  2KHX A;  2R76 A;  4OOG C;  2GPI A;  3EQ1 A;  2YWQ A;  4LU9 A;  2MKN A;  3ECR A;  1AAY A;  2EML A;  4R2P A;  2EMZ A;  1X6H A;  3IWB A;  2ENA A;  3T1H E;  2ODR C;  1NCS A;  1WRJ A;  2YU8 A;  4WYQ B;  4BHB A;  3OML A;  2EMY A;  2LJU A;  1AH5 A;  5A6J A;  4M9V C;  1PJQ A;  2EOQ A;  1XNR E;  5A69 A;  3HPZ A;  4MLV A;  4WXC A;  4LFB E;  4DR6 E;  2EMW A;  1X47 A;  1RC7 A;  2L3C A;  2EL6 A;  4LF8 E;  4JYA E;  2LJH A;  3J81 C;  3OTO E;  1J26 A;  4KZS A;  2I9I A;  4TUG A;  3MHH C;  2EMC A;  5LLQ A;  1JK2 A;  2JOX A;  4DUZ E;  2DMY A;  2I13 A;  4B3M E;  4DV2 E;  1PDA A;  1ZAA C;  3J7A G;  1KJK A;  2L92 A;  2ELY A;  3M99 B;  3EPK A;  2EPA A;  3UK3 C;  3JU0 A;  4R2S A;  4F2J C;  2FTX B;  2YTF A;  4DV5 E;  4P7D A;  4JI1 E;  2V83 A;  2GHF A;  2EP3 A;  3L00 A;  2EOO A;  3K6Q A;  2EPX A;  2CSH A;  4F9C B;  3T1Y E;  2DB2 A;  2L2N A;  2EPN A;  4F6N A;  2EN2 A;  1MGT A;  4BCA A;  1RQ0 A;  4ZYD A;  5A6A A;  1YZ9 A;  3JTZ A;  2JYA A;  2UXD E;  1YUJ A;  1RMD A;  4WX9 A;  4DV1 E;  3THN A;  1FKA E;  4F6M A;  2NUF A;  3ADG A;  3EPJ A;  5AE2 A;  4X64 E;  3HQ1 A;  4ZYG A;  1YSA C;  4R2C A;  1A1K A;  4M2Z A;  2RQL A;  5KL5 A;  2M4I A;  1T39 A;  5KL7 A;  2LE2 A;  4X62 E;  1T4O A;  2UUC E;  4X65 E;  2M1S A;  1BBG A;  4DMI A;  4JI7 E;  4DV7 E;  2F8B A;  2HHH E;  3BF2 A;  4JI3 E;  4X66 E;  2DLQ A;  2ADR A;  2EOY A; 
#chains in the Genus database with same CATH homology
 2M9A A;  2EMF A;  2EMX A;  2YTD A;  5KL4 A;  2EPZ A;  1A1F A;  3EPH A;  2EN7 A;  2DLK A;  2LO3 A;  2EM0 A;  5KL2 A;  2YRH A;  2LT7 A;  1B69 A;  1MEY C;  2EOE A;  2CT1 A;  2MKN A;  2EN4 A;  4R2R A;  1AAY A;  2EML A;  1X5W A;  2EMI A;  4R2P A;  2EMZ A;  1X6H A;  2WBU A;  2ENA A;  2J7J A;  1G2D C;  1YUI A;  1NCS A;  2EM3 A;  1TF3 A;  2GLI A;  1X6F A;  2YU8 A;  2YTQ A;  1F2I G;  2EM5 A;  1JK1 A;  2EMY A;  2R1F A;  2PRT A;  4M9V C;  2EM2 A;  2EN1 A;  3EPL A;  2E72 A;  2EJ4 A;  2EM6 A;  2YTG A;  2EOQ A;  2EMH A;  2DGC A;  1P47 A;  1WJP A;  2RSI A;  2JP9 A;  2EMW A;  2DRP A;  2EOR A;  2EL6 A;  4R2A A;  1UN6 B;  2EOJ A;  1A1I A;  2ENH A;  3MHH C;  2EMC A;  1JK2 A;  2YTE A;  2YTO A;  2I13 A;  2EOX A;  4IS1 C;  1ZAA C;  2WBT A;  1KJK A;  2EQ1 A;  2HGH A;  2EE8 A;  2EOF A;  1X3C A;  2EL5 A;  2YSP A;  2EQ0 A;  2D9H A;  4R2D A;  1LLM C;  2ELY A;  2LCE A;  3M99 B;  3EPK A;  2EPA A;  3UK3 C;  2DMI A;  2EMK A;  4R2S A;  2YSO A;  4X9J A;  2YTF A;  2VRD A;  4F2J C;  1G2F C;  1TN9 A;  2EOI A;  2EPP A;  2GHF A;  2EP3 A;  2EOO A;  2EQ3 A;  2EL4 A;  2CTD A;  2EOS A;  2EPX A;  2CSH A;  1ZU1 A;  2EOH A;  2EM7 A;  1ZR9 A;  2YRM A;  2BB8 A;  2EMB A;  2EM4 A;  2YTI A;  2EMG A;  2EPU A;  2EM8 A;  4R2Q A;  2ENC A;  2YTP A;  1BB8 A;  2YRK A;  1UBD C;  4F6N A;  2EN2 A;  2EOZ A;  1Z1B A;  2EN8 A;  2EOM A;  1YUJ A;  1RMD A;  4IJD A;  4R2E A;  2YTJ A;  2WCC 3;  4FK5 C;  4F6M A;  2LVH A;  1A1J A;  1A1G A;  2LV2 A;  2EMA A;  3EPJ A;  1DGC A;  2WBS A;  5KL6 A;  2YU5 A;  1YSA C;  4R2C A;  1A1K A;  5KL5 A;  2EN6 A;  2EPC A;  2NAB A;  2RPC A;  1X6E A;  2EM9 A;  5KL7 A;  1BBO A;  2EPR A;  2EN3 A;  2MDG A;  2A25 A;  3VHT B;  4GZN C;  1A1L A;  5KL3 A;  2ELZ A;  4WSG A;  1A1H A;  2JPA A;  3MHS C;  1TF6 A;  2MKD A;  2YTN A;  2DLQ A;  2ADR A;  2EOY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...