2CTFA

Solution structure of the 4th kh type i domain from human vigilin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
102
Chain Sequence
GSSGSSGEPEKLGQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVSVAQEQIEGMVKDLINRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the 4th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein
molecule keywords Vigilin
total genus 15
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctfA00
4IFDG 5K36G 2ANRA 5JEAG 2DGRA 1VIHA 5C0XG 1K1GA 1ZTGA 2ANNA 2CTLA 1J5KA 2FMRA 2JEAI 4JVYA 2JE6I 1X4MA 2NN6G 2JZXA 4WALA 3AEVB 1J4WA 2CTMA 1WE8A 2PY9A 2JA9A 3L7ZC 4AM3A 2MJHA 2HH2A 4BA1I 4LIJA 1EC6A 2P2RA 2JVZA 4WANA 4AIMA 2CTJA 2OPVA 2BL5A 2JEBI 2E3UA 1TUAA 1WVNA 2OPUA 2Z0SA 4BA2I 1DT4A 4QMFB 1ZZJA 4B8TA 4OO1G 1VIGA 2YQRA 3VKEA 2CTFA 4JVHA 1KHMA 4NBQA 3U1KA 2CPQA 2CTKA 2PQUA 2CTEA 1X4NA 2HH3A 2QNDA 1ZZKA 1ZZIA 3V69A 1DTJA 2AXYA 2BA0A
chains in the Genus database with same CATH superfamily
4JI2H 4DR4H 2Y3MA 5K36G 2ZM6H 3OETA 2ANRA 1AN7A 3J80W 4JI1H 3GR5A 2FMRA 4LF8H 3KDGA 3KDKA 4NZTM 2JZXA 1J4WA 3L7ZC 2MJHA 4DR1H 1WHRA 2UUCH 1EC6A 2P2RA 5IT9W 1HNXH 4K0KH 2E3UA 2Z0SA 4DR6H 4B8TA 4OO1G 2YQRA 3T1HH 2CTFA 4LF5H 4AQYH 2PQUA 1ZZIA 2G8YA 3V69A 1DTJA 2LF0A 2UU9H 2AXYA 2JE6I 4YHHH 4GKKH 2UUAH 2DGRA 1XRHA 4DV7H 1K1GA 4LF6H 4JVYA 4JYAH 1HNWH 4LFBH 1WE8A 2M8WA 2JA9A 4AM3A 4BA1I 4GKJH 5A2QW 4JI8H 4KHPH 5DT9A 2JVZA 1X0AA 4OCHA 1UG8A 1IBMH 2OPVA 3FAUA 4DR2H 1TUAA 1WVNA 4LF4H 3J81W 1HNZH 2VQEH 1ZZJA 2UUBH 5LMNH 3T1YH 1VIGA 5FLXW 1FKAH 1KHMA 2ZQEA 5IWAH 4JI3H 1WTJA 3U1KA 4PDBA 1XMOH 2PT7G 1I94H 4X64H 1X4NA 1ZZKA 2VKCA 4DUZH 1HR0H 3NCVA 4LF7H 4DV0H 4LFAH 4IFDG 4NXMH 2A1SA 3OTOH 1N33H 4X66H 2FFMA 2VQFH 1VIHA 4JI7H 5C0XG 5LL6b 3GKUA 2F4VH 2ANNA 2K1HA 1PQXA 1XMQH 2JEAI 1X4MA 2NN6G 5BR8H 4WALA 4B8CD 4EC5A 5LMUH 2E5LH 4B3SH 1V9NA 1F0XA 4DR3H 2HH2A 4FJSA 4JV5H 4WANA 4LF9H 2X06A 4AIMA 1SEIA 2UXDH 2JEBI 3EZJA 4DV1H 4JI5H 1NXUA 1IBKH 1N34H 3OSSD 1MSZA 1DT4A 4QMFB 2M6QA 3GABA 4JI4H 2FPHX 2O4CA 4JI6H 3I0PA 4FJUA 4JVHA 4NBQA 3RF2A 1V8CA 2CPQA 3SB1A 2CTKA 4YY3H 2CTEA 2HH3A 1ODHA 4E9JA 3JAMW 1VBIA 1X9ZA 2LTMA 4OX9H 4DV5H 2HHHH 5JEAG 4B3MH 4DR5H 2LRRA 4DUYH 1J5EH 1ZTGA 1S03G 2CWHA 2CTLA 1J5KA 4LFCH 1N32H 3AEVB 2CTMA 1S20A 1IBLH 1N36H 2PY9A 1XNRH 1XNQH 4JI0H 3QD7X 4B3RH 1Z2IA 4LIJA 2D9IA 4H8AA 4X62H 2CTJA 2BL5A 4X65H 4DV6H 2UXCH 3UOEA 4DV2H 4OD6A 2OPUA 4BA2I 4NXNH 1FJGH 2CPMA 2UXBH 3VKEA 4DR7H 2LTLA 4B3TH 4DV3H 1I6UA 2QNDA 2CWFA 4G08A 3J7AK 4NZRM 4DV4H 2BA0A
chains in the Genus database with same CATH topology
4IFDG 5K36G 2ANRA 5JEAG 2DGRA 1VIHA 5C0XG 1K1GA 1ZTGA 2ANNA 2CTLA 1J5KA 2FMRA 2JEAI 4JVYA 2JE6I 1X4MA 2NN6G 2JZXA 4WALA 3AEVB 1J4WA 2CTMA 1WE8A 2PY9A 2JA9A 3L7ZC 4AM3A 2MJHA 2HH2A 4BA1I 4LIJA 1EC6A 2P2RA 2JVZA 4WANA 4AIMA 2CTJA 2OPVA 2BL5A 2JEBI 2E3UA 1TUAA 1WVNA 2OPUA 2Z0SA 4BA2I 1DT4A 4QMFB 1ZZJA 4B8TA 4OO1G 1VIGA 2YQRA 3VKEA 2CTFA 4JVHA 1KHMA 4NBQA 3U1KA 2CPQA 2CTKA 2PQUA 2CTEA 1X4NA 2HH3A 2QNDA 1ZZKA 1ZZIA 3V69A 1DTJA 2AXYA 2BA0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IFD G;  5K36 G;  2ANR A;  5JEA G;  2DGR A;  1VIH A;  5C0X G;  1K1G A;  1ZTG A;  2ANN A;  2CTL A;  1J5K A;  2FMR A;  2JEA I;  4JVY A;  2JE6 I;  1X4M A;  2NN6 G;  2JZX A;  4WAL A;  3AEV B;  1J4W A;  2CTM A;  1WE8 A;  2PY9 A;  2JA9 A;  3L7Z C;  4AM3 A;  2MJH A;  2HH2 A;  4BA1 I;  4LIJ A;  1EC6 A;  2P2R A;  2JVZ A;  4WAN A;  4AIM A;  2CTJ A;  2OPV A;  2BL5 A;  2JEB I;  2E3U A;  1TUA A;  1WVN A;  2OPU A;  2Z0S A;  4BA2 I;  1DT4 A;  4QMF B;  1ZZJ A;  4B8T A;  4OO1 G;  1VIG A;  2YQR A;  3VKE A;  2CTF A;  4JVH A;  1KHM A;  4NBQ A;  3U1K A;  2CPQ A;  2CTK A;  2PQU A;  2CTE A;  1X4N A;  2HH3 A;  2QND A;  1ZZK A;  1ZZI A;  3V69 A;  1DTJ A;  2AXY A;  2BA0 A; 
#chains in the Genus database with same CATH topology
 4JI2 H;  4DR4 H;  2Y3M A;  5K36 G;  2ZM6 H;  3OET A;  2ANR A;  1AN7 A;  3J80 W;  4JI1 H;  3GR5 A;  2FMR A;  4LF8 H;  3KDG A;  3KDK A;  4NZT M;  2JZX A;  1J4W A;  3L7Z C;  2MJH A;  4DR1 H;  1WHR A;  2UUC H;  1EC6 A;  2P2R A;  5IT9 W;  1HNX H;  4K0K H;  2E3U A;  2Z0S A;  4DR6 H;  4B8T A;  4OO1 G;  2YQR A;  3T1H H;  2CTF A;  4LF5 H;  4AQY H;  2PQU A;  1ZZI A;  2G8Y A;  3V69 A;  1DTJ A;  2LF0 A;  2UU9 H;  2AXY A;  2JE6 I;  4YHH H;  4GKK H;  2UUA H;  2DGR A;  1XRH A;  4DV7 H;  1K1G A;  4LF6 H;  4JVY A;  4JYA H;  1HNW H;  4LFB H;  1WE8 A;  2M8W A;  2JA9 A;  4AM3 A;  4BA1 I;  4GKJ H;  5A2Q W;  4JI8 H;  4KHP H;  5DT9 A;  2JVZ A;  1X0A A;  4OCH A;  1UG8 A;  1IBM H;  2OPV A;  3FAU A;  4DR2 H;  1TUA A;  1WVN A;  4LF4 H;  3J81 W;  1HNZ H;  2VQE H;  1ZZJ A;  2UUB H;  5LMN H;  3T1Y H;  1VIG A;  5FLX W;  1FKA H;  1KHM A;  2ZQE A;  5IWA H;  4JI3 H;  1WTJ A;  3U1K A;  4PDB A;  1XMO H;  2PT7 G;  1I94 H;  4X64 H;  1X4N A;  1ZZK A;  2VKC A;  4DUZ H;  1HR0 H;  3NCV A;  4LF7 H;  4DV0 H;  4LFA H;  4IFD G;  4NXM H;  2A1S A;  3OTO H;  1N33 H;  4X66 H;  2FFM A;  2VQF H;  1VIH A;  4JI7 H;  5C0X G;  5LL6 b;  3GKU A;  2F4V H;  2ANN A;  2K1H A;  1PQX A;  1XMQ H;  2JEA I;  1X4M A;  2NN6 G;  5BR8 H;  4WAL A;  4B8C D;  4EC5 A;  5LMU H;  2E5L H;  4B3S H;  1V9N A;  1F0X A;  4DR3 H;  2HH2 A;  4FJS A;  4JV5 H;  4WAN A;  4LF9 H;  2X06 A;  4AIM A;  1SEI A;  2UXD H;  2JEB I;  3EZJ A;  4DV1 H;  4JI5 H;  1NXU A;  1IBK H;  1N34 H;  3OSS D;  1MSZ A;  1DT4 A;  4QMF B;  2M6Q A;  3GAB A;  4JI4 H;  2FPH X;  2O4C A;  4JI6 H;  3I0P A;  4FJU A;  4JVH A;  4NBQ A;  3RF2 A;  1V8C A;  2CPQ A;  3SB1 A;  2CTK A;  4YY3 H;  2CTE A;  2HH3 A;  1ODH A;  4E9J A;  3JAM W;  1VBI A;  1X9Z A;  2LTM A;  4OX9 H;  4DV5 H;  2HHH H;  5JEA G;  4B3M H;  4DR5 H;  2LRR A;  4DUY H;  1J5E H;  1ZTG A;  1S03 G;  2CWH A;  2CTL A;  1J5K A;  4LFC H;  1N32 H;  3AEV B;  2CTM A;  1S20 A;  1IBL H;  1N36 H;  2PY9 A;  1XNR H;  1XNQ H;  4JI0 H;  3QD7 X;  4B3R H;  1Z2I A;  4LIJ A;  2D9I A;  4H8A A;  4X62 H;  2CTJ A;  2BL5 A;  4X65 H;  4DV6 H;  2UXC H;  3UOE A;  4DV2 H;  4OD6 A;  2OPU A;  4BA2 I;  4NXN H;  1FJG H;  2CPM A;  2UXB H;  3VKE A;  4DR7 H;  2LTL A;  4B3T H;  4DV3 H;  1I6U A;  2QND A;  2CWF A;  4G08 A;  3J7A K;  4NZR M;  4DV4 H;  2BA0 A; 
#chains in the Genus database with same CATH homology
 4IFD G;  5K36 G;  2ANR A;  5JEA G;  2DGR A;  1VIH A;  5C0X G;  1K1G A;  1ZTG A;  2ANN A;  2CTL A;  1J5K A;  2FMR A;  2JEA I;  4JVY A;  2JE6 I;  1X4M A;  2NN6 G;  2JZX A;  4WAL A;  3AEV B;  1J4W A;  2CTM A;  1WE8 A;  2PY9 A;  2JA9 A;  3L7Z C;  4AM3 A;  2MJH A;  2HH2 A;  4BA1 I;  4LIJ A;  1EC6 A;  2P2R A;  2JVZ A;  4WAN A;  4AIM A;  2CTJ A;  2OPV A;  2BL5 A;  2JEB I;  2E3U A;  1TUA A;  1WVN A;  2OPU A;  2Z0S A;  4BA2 I;  1DT4 A;  4QMF B;  1ZZJ A;  4B8T A;  4OO1 G;  1VIG A;  2YQR A;  3VKE A;  2CTF A;  4JVH A;  1KHM A;  4NBQ A;  3U1K A;  2CPQ A;  2CTK A;  2PQU A;  2CTE A;  1X4N A;  2HH3 A;  2QND A;  1ZZK A;  1ZZI A;  3V69 A;  1DTJ A;  2AXY A;  2BA0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...