2CTFA

Solution structure of the 4th kh type i domain from human vigilin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
102
Chain Sequence
b'GSSGSSGEPEKLGQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVSVAQEQIEGMVKDLINRSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 4th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 15
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctfA00
1VIHA 2PY9A 3U1KA 1EC6A 1WVNA 4JVHA 2JZXA 2QNDA 2CTEA 2BL5A 4WANA 2JEBI 4LIJA 1ZTGA 4BA2I 1VIGA 2E3UA 3AEVB 4AM3A 4JVYA 2JE6I 2FMRA 2BA0A 2CTFA 1WE8A 4NBQA 2MJHA 4OO1G 1X4NA 1TUAA 4AIMA 4B8TA 1J5KA 2PQUA 2P2RA 1J4WA 1ZZIA 3VKEA 2CPQA 1DTJA 2NN6G 2JA9A 2OPUA 2DGRA 5K36G 4WALA 4QMFB 2ANRA 2OPVA 5C0XG 2ANNA 1X4MA 2HH2A 2HH3A 2Z0SA 5JEAG 4IFDG 1ZZKA 2JVZA 2YQRA 2JEAI 1DT4A 3L7ZC 1KHMA 2CTJA 3V69A 1ZZJA 2CTLA 1K1GA 4BA1I 2AXYA 2CTKA 2CTMA
chains in the Genus database with same CATH superfamily
4JI6H 4DV6H 4JI2H 1EC6A 1WVNA 4OCHA 2VQEH 4JVHA 2O4CA 4X66H 4AQYH 2G8YA 1XMOH 5BR8H 2CWFA 2E3UA 4JVYA 3J7AK 3GKUA 4X64H 2FMRA 4DV7H 2MJHA 1IBKH 2Y3MA 3OTOH 4B8TA 3J81W 1J4WA 4PDBA 4DV2H 3VKEA 4LF9H 1S20A 5A2QW 1IBLH 2FPHX 1X4MA 2HH2A 4B3MH 3JAMW 5JEAG 1VBIA 1ZZKA 2FFMA 2JVZA 4KHPH 4DR3H 2UUAH 4LF7H 4E9JA 1N36H 4LFCH 3GR5A 1ZZJA 2CTLA 2E5LH 4JI0H 2AXYA 1ODHA 4NXNH 1VIHA 1HR0H 3U1KA 2QNDA 4NZRM 1XMQH 1MSZA 1UG8A 2BL5A 2CTEA 2JEBI 4JI3H 2HHHH 4JYAH 4G08A 4DV5H 4DR7H 4BA2I 5IWAH 1N32H 3AEVB 1I6UA 2VKCA 4FJUA 4NBQA 1WE8A 4X65H 4DR4H 4AIMA 2PQUA 1J5KA 1WHRA 1HNZH 5LL6b 4B3TH 3GABA 1PQXA 3T1HH 4JV5H 5K36G 1FJGH 4GKKH 3T1YH 4EC5A 2OPVA 5C0XG 4JI8H 2K1HA 4IFDG 3OSSD 4DV4H 4LFBH 1F0XA 3L7ZC 3UOEA 4B3SH 4LFAH 2UU9H 1N33H 1V9NA 3J80W 2ANRA 4DV3H 4NXMH 2JZXA 2PT7G 4B8CD 5IT9W 1IBMH 2M6QA 1S03G 4DR6H 4WANA 4X62H 4DV0H 2LRRA 2ZM6H 1VIGA 4LF8H 2F4VH 3QD7X 1XRHA 2BA0A 2CTFA 1FKAH 4OO1G 1WTJA 1X4NA 2ZQEA 1X9ZA 1I94H 2LTLA 3RF2A 1N34H 4OD6A 4B3RH 2LTMA 5DT9A 1HNXH 2CPQA 1DTJA 2OPUA 2JA9A 2UUBH 2UUCH 4WALA 5LMUH 4JI4H 4OX9H 1XNQH 4YHHH 2UXDH 2Z0SA 4K0KH 2UXBH 1HNWH 2CPMA 2YQRA 1KHMA 1DT4A 4DUYH 2CWHA 3OETA 3KDKA 4BA1I 3I0PA 2HH3A 2PY9A 2UXCH 5LMNH 3SB1A 2X06A 1XNRH 4YY3H 1Z2IA 1SEIA 4LIJA 1ZTGA 4JI1H 4AM3A 4LF6H 3KDGA 2JE6I 4FJSA 1TUAA 1AN7A 4LF5H 2P2RA 4DUZH 4DV1H 2M8WA 4DR1H 5FLXW 2LF0A 1ZZIA 1NXUA 2NN6G 3FAUA 1V8CA 2DGRA 3EZJA 4LF4H 4QMFB 2ANNA 1X0AA 4JI7H 4GKJH 2VQFH 2D9IA 2JEAI 3NCVA 2A1SA 2CTJA 1J5EH 4H8AA 3V69A 4DR2H 4DR5H 4NZTM 1K1GA 4JI5H 2CTKA 2CTMA
chains in the Genus database with same CATH topology
1VIHA 2PY9A 3U1KA 1EC6A 1WVNA 4JVHA 2JZXA 2QNDA 2CTEA 2BL5A 4WANA 2JEBI 4LIJA 1ZTGA 4BA2I 1VIGA 2E3UA 3AEVB 4AM3A 4JVYA 2JE6I 2FMRA 2BA0A 2CTFA 1WE8A 4NBQA 2MJHA 4OO1G 1X4NA 1TUAA 4AIMA 4B8TA 1J5KA 2PQUA 2P2RA 1J4WA 1ZZIA 3VKEA 2CPQA 1DTJA 2NN6G 2JA9A 2OPUA 2DGRA 5K36G 4WALA 4QMFB 2ANRA 2OPVA 5C0XG 2ANNA 1X4MA 2HH2A 2HH3A 2Z0SA 5JEAG 4IFDG 1ZZKA 2JVZA 2YQRA 2JEAI 1DT4A 3L7ZC 1KHMA 2CTJA 3V69A 1ZZJA 2CTLA 1K1GA 4BA1I 2AXYA 2CTKA 2CTMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1VIH A;  2PY9 A;  3U1K A;  1EC6 A;  1WVN A;  4JVH A;  2JZX A;  2QND A;  2CTE A;  2BL5 A;  4WAN A;  2JEB I;  4LIJ A;  1ZTG A;  4BA2 I;  1VIG A;  2E3U A;  3AEV B;  4AM3 A;  4JVY A;  2JE6 I;  2FMR A;  2BA0 A;  2CTF A;  1WE8 A;  4NBQ A;  2MJH A;  4OO1 G;  1X4N A;  1TUA A;  4AIM A;  4B8T A;  1J5K A;  2PQU A;  2P2R A;  1J4W A;  1ZZI A;  3VKE A;  2CPQ A;  1DTJ A;  2NN6 G;  2JA9 A;  2OPU A;  2DGR A;  5K36 G;  4WAL A;  4QMF B;  2ANR A;  2OPV A;  5C0X G;  2ANN A;  1X4M A;  2HH2 A;  2HH3 A;  2Z0S A;  5JEA G;  4IFD G;  1ZZK A;  2JVZ A;  2YQR A;  2JEA I;  1DT4 A;  3L7Z C;  1KHM A;  2CTJ A;  3V69 A;  1ZZJ A;  2CTL A;  1K1G A;  4BA1 I;  2AXY A;  2CTK A;  2CTM A; 
#chains in the Genus database with same CATH topology
 4JI6 H;  4DV6 H;  4JI2 H;  1EC6 A;  1WVN A;  4OCH A;  2VQE H;  4JVH A;  2O4C A;  4X66 H;  4AQY H;  2G8Y A;  1XMO H;  5BR8 H;  2CWF A;  2E3U A;  4JVY A;  3J7A K;  3GKU A;  4X64 H;  2FMR A;  4DV7 H;  2MJH A;  1IBK H;  2Y3M A;  3OTO H;  4B8T A;  3J81 W;  1J4W A;  4PDB A;  4DV2 H;  3VKE A;  4LF9 H;  1S20 A;  5A2Q W;  1IBL H;  2FPH X;  1X4M A;  2HH2 A;  4B3M H;  3JAM W;  5JEA G;  1VBI A;  1ZZK A;  2FFM A;  2JVZ A;  4KHP H;  4DR3 H;  2UUA H;  4LF7 H;  4E9J A;  1N36 H;  4LFC H;  3GR5 A;  1ZZJ A;  2CTL A;  2E5L H;  4JI0 H;  2AXY A;  1ODH A;  4NXN H;  1VIH A;  1HR0 H;  3U1K A;  2QND A;  4NZR M;  1XMQ H;  1MSZ A;  1UG8 A;  2BL5 A;  2CTE A;  2JEB I;  4JI3 H;  2HHH H;  4JYA H;  4G08 A;  4DV5 H;  4DR7 H;  4BA2 I;  5IWA H;  1N32 H;  3AEV B;  1I6U A;  2VKC A;  4FJU A;  4NBQ A;  1WE8 A;  4X65 H;  4DR4 H;  4AIM A;  2PQU A;  1J5K A;  1WHR A;  1HNZ H;  5LL6 b;  4B3T H;  3GAB A;  1PQX A;  3T1H H;  4JV5 H;  5K36 G;  1FJG H;  4GKK H;  3T1Y H;  4EC5 A;  2OPV A;  5C0X G;  4JI8 H;  2K1H A;  4IFD G;  3OSS D;  4DV4 H;  4LFB H;  1F0X A;  3L7Z C;  3UOE A;  4B3S H;  4LFA H;  2UU9 H;  1N33 H;  1V9N A;  3J80 W;  2ANR A;  4DV3 H;  4NXM H;  2JZX A;  2PT7 G;  4B8C D;  5IT9 W;  1IBM H;  2M6Q A;  1S03 G;  4DR6 H;  4WAN A;  4X62 H;  4DV0 H;  2LRR A;  2ZM6 H;  1VIG A;  4LF8 H;  2F4V H;  3QD7 X;  1XRH A;  2BA0 A;  2CTF A;  1FKA H;  4OO1 G;  1WTJ A;  1X4N A;  2ZQE A;  1X9Z A;  1I94 H;  2LTL A;  3RF2 A;  1N34 H;  4OD6 A;  4B3R H;  2LTM A;  5DT9 A;  1HNX H;  2CPQ A;  1DTJ A;  2OPU A;  2JA9 A;  2UUB H;  2UUC H;  4WAL A;  5LMU H;  4JI4 H;  4OX9 H;  1XNQ H;  4YHH H;  2UXD H;  2Z0S A;  4K0K H;  2UXB H;  1HNW H;  2CPM A;  2YQR A;  1KHM A;  1DT4 A;  4DUY H;  2CWH A;  3OET A;  3KDK A;  4BA1 I;  3I0P A;  2HH3 A;  2PY9 A;  2UXC H;  5LMN H;  3SB1 A;  2X06 A;  1XNR H;  4YY3 H;  1Z2I A;  1SEI A;  4LIJ A;  1ZTG A;  4JI1 H;  4AM3 A;  4LF6 H;  3KDG A;  2JE6 I;  4FJS A;  1TUA A;  1AN7 A;  4LF5 H;  2P2R A;  4DUZ H;  4DV1 H;  2M8W A;  4DR1 H;  5FLX W;  2LF0 A;  1ZZI A;  1NXU A;  2NN6 G;  3FAU A;  1V8C A;  2DGR A;  3EZJ A;  4LF4 H;  4QMF B;  2ANN A;  1X0A A;  4JI7 H;  4GKJ H;  2VQF H;  2D9I A;  2JEA I;  3NCV A;  2A1S A;  2CTJ A;  1J5E H;  4H8A A;  3V69 A;  4DR2 H;  4DR5 H;  4NZT M;  1K1G A;  4JI5 H;  2CTK A;  2CTM A; 
#chains in the Genus database with same CATH homology
 1VIH A;  2PY9 A;  3U1K A;  1EC6 A;  1WVN A;  4JVH A;  2JZX A;  2QND A;  2CTE A;  2BL5 A;  4WAN A;  2JEB I;  4LIJ A;  1ZTG A;  4BA2 I;  1VIG A;  2E3U A;  3AEV B;  4AM3 A;  4JVY A;  2JE6 I;  2FMR A;  2BA0 A;  2CTF A;  1WE8 A;  4NBQ A;  2MJH A;  4OO1 G;  1X4N A;  1TUA A;  4AIM A;  4B8T A;  1J5K A;  2PQU A;  2P2R A;  1J4W A;  1ZZI A;  3VKE A;  2CPQ A;  1DTJ A;  2NN6 G;  2JA9 A;  2OPU A;  2DGR A;  5K36 G;  4WAL A;  4QMF B;  2ANR A;  2OPV A;  5C0X G;  2ANN A;  1X4M A;  2HH2 A;  2HH3 A;  2Z0S A;  5JEA G;  4IFD G;  1ZZK A;  2JVZ A;  2YQR A;  2JEA I;  1DT4 A;  3L7Z C;  1KHM A;  2CTJ A;  3V69 A;  1ZZJ A;  2CTL A;  1K1G A;  4BA1 I;  2AXY A;  2CTK A;  2CTM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...