2CTFA

Solution structure of the 4th kh type i domain from human vigilin
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
102
structure length
102
Chain Sequence
GSSGSSGEPEKLGQALTEVYAKANSFTVSSVAAPSWLHRFIIGKKGQNLAKITQQMPKVHIEFTEGEDKITLEGPTEDVSVAQEQIEGMVKDLINRSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vigilin
publication title Solution structure of the 4th KH type I domain from human Vigilin
rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 15
structure length 102
sequence length 102
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00013 KH_1 KH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.1370.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S8; Chain: A, domain 1 K Homology domain, type 1 2ctfA00
2CTMA 1ZZJA 2OPUA 2JEAI 1EC6A 2CTJA 2JE6I 4BA1I 2OPVA 2PY9A 3U1KA 3AEVB 4QMFB 2HH3A 2JEBI 5JEAG 1KHMA 2QNDA 2P2RA 2JA9A 2CTEA 3V69A 2ANNA 4JVHA 1VIHA 1ZZIA 2AXYA 1WVNA 2BA0A 4OO1G 5K36G 5C0XG 2JVZA 1X4MA 2JZXA 1J4WA 4WALA 4WANA 1WE8A 2HH2A 1TUAA 1DTJA 1VIGA 2E3UA 2PQUA 1DT4A 2BL5A 4IFDG 4AIMA 4BA2I 4JVYA 2DGRA 2CPQA 1K1GA 4NBQA 2Z0SA 3VKEA 4B8TA 2FMRA 2ANRA 1X4NA 2YQRA 4LIJA 2MJHA 4AM3A 1ZZKA 1J5KA 2NN6G 3L7ZC 2CTKA 1ZTGA 2CTFA 2CTLA
chains in the Genus database with same CATH superfamily
2PT7G 4DUYH 2JE6I 2M8WA 1WTJA 3I0PA 2HH3A 4LFCH 4B3SH 2VQEH 1V9NA 1NXUA 4DR5H 4DV4H 2D9IA 1I94H 4NXMH 1N34H 2X06A 2CWFA 4JI7H 2ANNA 3T1YH 1VIHA 3JAMW 1ODHA 2AXYA 1WVNA 1XMQH 4OO1G 5C0XG 2VKCA 1X4MA 4LF7H 1J4WA 1S03G 2LTMA 4LF9H 5A2QW 1IBMH 1N36H 2BL5A 4LF5H 1HNXH 1F0XA 1K1GA 4NBQA 1J5EH 1HNWH 4YY3H 3OTOH 2K1HA 2YQRA 2M6QA 4AM3A 2UXBH 1XRHA 1J5KA 1HR0H 3L7ZC 4JI2H 1WE8A 4X64H 2CTLA 1XNQH 2OPVA 3KDKA 3U1KA 2PY9A 4QMFB 4JI8H 4DUZH 3KDGA 3QD7X 4NXNH 4GKKH 2QNDA 2G8YA 1KHMA 2P2RA 1WHRA 4B3RH 3OSSD 3SB1A 2BA0A 2LRRA 4DR6H 3J81W 1XMOH 4DV2H 2LTLA 5IWAH 4DR7H 1DTJA 4DV0H 4OX9H 4LF4H 2VQFH 2UUBH 3VKEA 4DR3H 3GABA 2ANRA 1X4NA 4G08A 2NN6G 4YHHH 2JVZA 4GKJH 2ZM6H 2UXDH 4X65H 1EC6A 2CTJA 1PQXA 4FJSA 4H8AA 4BA1I 4B3TH 4JYAH 1MSZA 4DV3H 4NZTM 5JEAG 4AQYH 4DV6H 3J7AK 4JI6H 1N33H 1S20A 2HHHH 1VBIA 3V69A 4LF6H 5IT9W 1I6UA 2UXCH 2CWHA 1X0AA 4E9JA 3GKUA 5K36G 5FLXW 2JZXA 3J80W 3UOEA 4WALA 1IBKH 1HNZH 1TUAA 4IFDG 4BA2I 5BR8H 2Y3MA 4B3MH 2CPQA 4JI1H 2ZQEA 2LF0A 2Z0SA 2UU9H 4B8TA 5LMUH 2F4VH 4B8CD 2MJHA 4LIJA 4DV5H 3T1HH 4LF8H 1SEIA 5LMNH 2UUAH 2CTKA 4JVYA 2CTFA 4DR1H 4DR4H 2CTMA 5LL6b 1ZZJA 2OPUA 2JEAI 5DT9A 4OD6A 1IBLH 2A1SA 3AEVB 4PDBA 2JEBI 4JI0H 4X66H 1X9ZA 1N32H 2JA9A 2CTEA 4K0KH 4JI4H 4FJUA 4KHPH 4JVHA 1FJGH 3EZJA 3NCVA 1V8CA 4DV1H 1AN7A 2E5LH 3RF2A 3FAUA 4WANA 2HH2A 1Z2IA 4EC5A 1XNRH 1VIGA 2E3UA 2FFMA 1DT4A 4DV7H 2PQUA 4JI5H 4AIMA 2O4CA 2DGRA 4DR2H 4LFAH 3GR5A 2UUCH 2CPMA 4NZRM 4OCHA 2FMRA 1FKAH 4JV5H 2FPHX 4LFBH 1UG8A 1ZZKA 4X62H 1ZTGA 1ZZIA 3OETA 4JI3H
chains in the Genus database with same CATH topology
2CTMA 1ZZJA 2OPUA 2JEAI 1EC6A 2CTJA 2JE6I 4BA1I 2OPVA 2PY9A 3U1KA 3AEVB 4QMFB 2HH3A 2JEBI 5JEAG 1KHMA 2QNDA 2P2RA 2JA9A 2CTEA 3V69A 2ANNA 4JVHA 1VIHA 1ZZIA 2AXYA 1WVNA 2BA0A 4OO1G 5K36G 5C0XG 2JVZA 1X4MA 2JZXA 1J4WA 4WALA 4WANA 1WE8A 2HH2A 1TUAA 1DTJA 1VIGA 2E3UA 2PQUA 1DT4A 2BL5A 4IFDG 4AIMA 4BA2I 4JVYA 2DGRA 2CPQA 1K1GA 4NBQA 2Z0SA 3VKEA 4B8TA 2FMRA 2ANRA 1X4NA 2YQRA 4LIJA 2MJHA 4AM3A 1ZZKA 1J5KA 2NN6G 3L7ZC 2CTKA 1ZTGA 2CTFA 2CTLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTM A;  1ZZJ A;  2OPU A;  2JEA I;  1EC6 A;  2CTJ A;  2JE6 I;  4BA1 I;  2OPV A;  2PY9 A;  3U1K A;  3AEV B;  4QMF B;  2HH3 A;  2JEB I;  5JEA G;  1KHM A;  2QND A;  2P2R A;  2JA9 A;  2CTE A;  3V69 A;  2ANN A;  4JVH A;  1VIH A;  1ZZI A;  2AXY A;  1WVN A;  2BA0 A;  4OO1 G;  5K36 G;  5C0X G;  2JVZ A;  1X4M A;  2JZX A;  1J4W A;  4WAL A;  4WAN A;  1WE8 A;  2HH2 A;  1TUA A;  1DTJ A;  1VIG A;  2E3U A;  2PQU A;  1DT4 A;  2BL5 A;  4IFD G;  4AIM A;  4BA2 I;  4JVY A;  2DGR A;  2CPQ A;  1K1G A;  4NBQ A;  2Z0S A;  3VKE A;  4B8T A;  2FMR A;  2ANR A;  1X4N A;  2YQR A;  4LIJ A;  2MJH A;  4AM3 A;  1ZZK A;  1J5K A;  2NN6 G;  3L7Z C;  2CTK A;  1ZTG A;  2CTF A;  2CTL A; 
#chains in the Genus database with same CATH topology
 2PT7 G;  4DUY H;  2JE6 I;  2M8W A;  1WTJ A;  3I0P A;  2HH3 A;  4LFC H;  4B3S H;  2VQE H;  1V9N A;  1NXU A;  4DR5 H;  4DV4 H;  2D9I A;  1I94 H;  4NXM H;  1N34 H;  2X06 A;  2CWF A;  4JI7 H;  2ANN A;  3T1Y H;  1VIH A;  3JAM W;  1ODH A;  2AXY A;  1WVN A;  1XMQ H;  4OO1 G;  5C0X G;  2VKC A;  1X4M A;  4LF7 H;  1J4W A;  1S03 G;  2LTM A;  4LF9 H;  5A2Q W;  1IBM H;  1N36 H;  2BL5 A;  4LF5 H;  1HNX H;  1F0X A;  1K1G A;  4NBQ A;  1J5E H;  1HNW H;  4YY3 H;  3OTO H;  2K1H A;  2YQR A;  2M6Q A;  4AM3 A;  2UXB H;  1XRH A;  1J5K A;  1HR0 H;  3L7Z C;  4JI2 H;  1WE8 A;  4X64 H;  2CTL A;  1XNQ H;  2OPV A;  3KDK A;  3U1K A;  2PY9 A;  4QMF B;  4JI8 H;  4DUZ H;  3KDG A;  3QD7 X;  4NXN H;  4GKK H;  2QND A;  2G8Y A;  1KHM A;  2P2R A;  1WHR A;  4B3R H;  3OSS D;  3SB1 A;  2BA0 A;  2LRR A;  4DR6 H;  3J81 W;  1XMO H;  4DV2 H;  2LTL A;  5IWA H;  4DR7 H;  1DTJ A;  4DV0 H;  4OX9 H;  4LF4 H;  2VQF H;  2UUB H;  3VKE A;  4DR3 H;  3GAB A;  2ANR A;  1X4N A;  4G08 A;  2NN6 G;  4YHH H;  2JVZ A;  4GKJ H;  2ZM6 H;  2UXD H;  4X65 H;  1EC6 A;  2CTJ A;  1PQX A;  4FJS A;  4H8A A;  4BA1 I;  4B3T H;  4JYA H;  1MSZ A;  4DV3 H;  4NZT M;  5JEA G;  4AQY H;  4DV6 H;  3J7A K;  4JI6 H;  1N33 H;  1S20 A;  2HHH H;  1VBI A;  3V69 A;  4LF6 H;  5IT9 W;  1I6U A;  2UXC H;  2CWH A;  1X0A A;  4E9J A;  3GKU A;  5K36 G;  5FLX W;  2JZX A;  3J80 W;  3UOE A;  4WAL A;  1IBK H;  1HNZ H;  1TUA A;  4IFD G;  4BA2 I;  5BR8 H;  2Y3M A;  4B3M H;  2CPQ A;  4JI1 H;  2ZQE A;  2LF0 A;  2Z0S A;  2UU9 H;  4B8T A;  5LMU H;  2F4V H;  4B8C D;  2MJH A;  4LIJ A;  4DV5 H;  3T1H H;  4LF8 H;  1SEI A;  5LMN H;  2UUA H;  2CTK A;  4JVY A;  2CTF A;  4DR1 H;  4DR4 H;  2CTM A;  5LL6 b;  1ZZJ A;  2OPU A;  2JEA I;  5DT9 A;  4OD6 A;  1IBL H;  2A1S A;  3AEV B;  4PDB A;  2JEB I;  4JI0 H;  4X66 H;  1X9Z A;  1N32 H;  2JA9 A;  2CTE A;  4K0K H;  4JI4 H;  4FJU A;  4KHP H;  4JVH A;  1FJG H;  3EZJ A;  3NCV A;  1V8C A;  4DV1 H;  1AN7 A;  2E5L H;  3RF2 A;  3FAU A;  4WAN A;  2HH2 A;  1Z2I A;  4EC5 A;  1XNR H;  1VIG A;  2E3U A;  2FFM A;  1DT4 A;  4DV7 H;  2PQU A;  4JI5 H;  4AIM A;  2O4C A;  2DGR A;  4DR2 H;  4LFA H;  3GR5 A;  2UUC H;  2CPM A;  4NZR M;  4OCH A;  2FMR A;  1FKA H;  4JV5 H;  2FPH X;  4LFB H;  1UG8 A;  1ZZK A;  4X62 H;  1ZTG A;  1ZZI A;  3OET A;  4JI3 H; 
#chains in the Genus database with same CATH homology
 2CTM A;  1ZZJ A;  2OPU A;  2JEA I;  1EC6 A;  2CTJ A;  2JE6 I;  4BA1 I;  2OPV A;  2PY9 A;  3U1K A;  3AEV B;  4QMF B;  2HH3 A;  2JEB I;  5JEA G;  1KHM A;  2QND A;  2P2R A;  2JA9 A;  2CTE A;  3V69 A;  2ANN A;  4JVH A;  1VIH A;  1ZZI A;  2AXY A;  1WVN A;  2BA0 A;  4OO1 G;  5K36 G;  5C0X G;  2JVZ A;  1X4M A;  2JZX A;  1J4W A;  4WAL A;  4WAN A;  1WE8 A;  2HH2 A;  1TUA A;  1DTJ A;  1VIG A;  2E3U A;  2PQU A;  1DT4 A;  2BL5 A;  4IFD G;  4AIM A;  4BA2 I;  4JVY A;  2DGR A;  2CPQ A;  1K1G A;  4NBQ A;  2Z0S A;  3VKE A;  4B8T A;  2FMR A;  2ANR A;  1X4N A;  2YQR A;  4LIJ A;  2MJH A;  4AM3 A;  1ZZK A;  1J5K A;  2NN6 G;  3L7Z C;  2CTK A;  1ZTG A;  2CTF A;  2CTL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...