The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
23
|
sequence length |
107
|
structure length |
107
|
Chain Sequence |
APKAPADGLKMEATKQPVVFNHSTHKSVKCGDCHHPVNGKEDYRKCGTAGCHDSMDKKDKSAKGYYHVMHDKNTKFKSCVGCHVEVAGADAAKKKDLTGCKKSKCHE
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
| molecule tags |
Electron transport
|
| molecule keywords |
CYTOCHROME C3
|
| publication title |
Refinement of the Three-Dimensional Structures of Cytochromes C3 from Desulfovibrio Vulgaris Hildenborough at 1.67 Angstrom Resolution and from Desulfovibrio Desulfuricans Atcc 27774 at 1.6 Angstrom Resolution
pubmed rcsb |
| total genus |
23
|
| structure length |
107
|
| sequence length |
107
|
| chains with identical sequence |
B
|
| ec nomenclature | |
| pdb deposition date | 1997-06-18 |
Image from the rcsb pdb (www.rcsb.org)
cath code
| Class | Architecture | Topology | Homology | Domain |
|---|---|---|---|---|---|
| Alpha Beta | Alpha-Beta Complex | Cytochrome C3 | Cytochrome C3 |
#chains in the Genus database with same CATH superfamily 1I77 A; 1RWJ A; 3H4N A; 2KSU A; 4HDL A; 1GYO A; 2LZZ A; 1W7O A; 1OFY A; 1LM2 A; 1NEW A; 1L3O A; 4HAJ A; 1OFW A; 2KMY A; 4HBF A; 1IT1 A; 3OV0 A; 1GWS A; 1F22 A; 2YXC A; 1Z1N X; 2E84 A; 3CAR A; 3OUQ A; 1J0O A; 1GMB A; 2CTH A; 2CY3 A; 4HC3 A; 1WAD A; 2N91 A; 3CYR A; 3SEL X; 2CVC A; 2A3P A; 1UP9 A; 3CAO A; 2BQ4 A; 3SJ1 X; 1KWJ A; 1AQE A; 3BXU A; 2EWI A; 3H34 A; 1HH5 A; 1H29 A; 3H33 A; 2FFN A; 1DUW A; 2EWU A; 2EWK A; 1UPD A; 3SJ4 X; 2Z47 A; 2LDO A; 4HB6 A; 3SJ0 X; 1A2I A; 2YYX A; 1OS6 A; 1CZJ A; 1EHJ A; 2CDV A; 19HC A; 1GM4 A; 1MDV A; 1WR5 A; 4HB8 A; 1QN1 A; 3OUE A; 2MZ9 A; 2BPN A; 2CYM A; 1QN0 A; 2YYW A; 2A3M A; 1J0P A; #chains in the Genus database with same CATH topology 1I77 A; 1RWJ A; 3H4N A; 2KSU A; 4HDL A; 1GYO A; 2LZZ A; 1W7O A; 1OFY A; 1LM2 A; 1NEW A; 1L3O A; 4HAJ A; 1OFW A; 2KMY A; 4HBF A; 1IT1 A; 3OV0 A; 1GWS A; 1F22 A; 2YXC A; 1Z1N X; 2E84 A; 3CAR A; 3OUQ A; 1J0O A; 1GMB A; 2CTH A; 2CY3 A; 4HC3 A; 1WAD A; 2N91 A; 3CYR A; 3SEL X; 2CVC A; 2A3P A; 1UP9 A; 3CAO A; 2BQ4 A; 3SJ1 X; 1KWJ A; 1AQE A; 3BXU A; 2EWI A; 3H34 A; 1HH5 A; 1H29 A; 3H33 A; 2FFN A; 1DUW A; 2EWU A; 2EWK A; 1UPD A; 3SJ4 X; 2Z47 A; 2LDO A; 4HB6 A; 3SJ0 X; 1A2I A; 2YYX A; 1OS6 A; 1CZJ A; 1EHJ A; 2CDV A; 19HC A; 1GM4 A; 1MDV A; 1WR5 A; 4HB8 A; 1QN1 A; 3OUE A; 2MZ9 A; 2BPN A; 2CYM A; 1QN0 A; 2YYW A; 2A3M A; 1J0P A; #chains in the Genus database with same CATH homology 1I77 A; 1RWJ A; 3H4N A; 2KSU A; 4HDL A; 1GYO A; 2LZZ A; 1W7O A; 1OFY A; 1LM2 A; 1NEW A; 1L3O A; 4HAJ A; 1OFW A; 2KMY A; 4HBF A; 1IT1 A; 3OV0 A; 1GWS A; 1F22 A; 2YXC A; 1Z1N X; 2E84 A; 3CAR A; 3OUQ A; 1J0O A; 1GMB A; 2CTH A; 2CY3 A; 4HC3 A; 1WAD A; 2N91 A; 3CYR A; 3SEL X; 2CVC A; 2A3P A; 1UP9 A; 3CAO A; 2BQ4 A; 3SJ1 X; 1KWJ A; 1AQE A; 3BXU A; 2EWI A; 3H34 A; 1HH5 A; 1H29 A; 3H33 A; 2FFN A; 1DUW A; 2EWU A; 2EWK A; 1UPD A; 3SJ4 X; 2Z47 A; 2LDO A; 4HB6 A; 3SJ0 X; 1A2I A; 2YYX A; 1OS6 A; 1CZJ A; 1EHJ A; 2CDV A; 19HC A; 1GM4 A; 1MDV A; 1WR5 A; 4HB8 A; 1QN1 A; 3OUE A; 2MZ9 A; 2BPN A; 2CYM A; 1QN0 A; 2YYW A; 2A3M A; 1J0P A;
#similar chains in the Genus database (?% sequence similarity) ...loading similar chains, please wait... #similar chains, but unknotted ...loading similar chains, please wait... #similar chains in the pdb database (?% sequence similarity) ...loading similar chains, please wait...
