2CTQA

Solution structure of j-domain from human dnaj subfamily c menber 12
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
112
structure length
112
Chain Sequence
GSSGSSGMDAILNYRSEDTEDYYTLLGCDELSSVEQILAEFKVRALECHPDKHPENPKAVETFQKLQKAKEILTNEESRARYDHWRRSQMSMPFQQWEALNDSVKTSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of J-domain from human DnaJ subfamily C menber 12
rcsb
source organism Homo sapiens
molecule tags Chaperone
molecule keywords DnaJ homolog subfamily C member 12
total genus 24
structure length 112
sequence length 112
ec nomenclature
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctqA01
2OCHA 2Y4TA 3APQA 3UO3A 2CTQA 3UO2A 2CTWA 2LGWA 2N05A 3UCSC 1HDJA 1GH6A 4J80A 3APOA 1WJZA 2GUZB 1BQ0A 2DN9A 2QWRB 1NZ6A 2Y4UA 4RWUA 2YUAA 4J7ZA 4IT5A 2CUGA 2QWOB 2LO1A 2L6LA 2EJ7A 2GUZA 2QSAA 2CTRA 2QWPB 1N4CA 2N04A 1BQZA 1IURA 2DMXA 1FPOA 2KQXA 2CTPA 1XBLA 2QWNB 2M6YA 2PF4E 3AG7A 1FAFA 2YS8A 3BVOA 2QWQB
chains in the Genus database with same CATH superfamily
5EBMC 3DC6A 1K33A 5AG2A 3UO2A 1GMGA 3JD2A 1GM7A 4BIOA 4LFCB 1VQ4V 4I4TA 5IY5B 2KG7B 1E79G 4O2BB 2YIBD 2JEUA 4DR1O 4JI2B 2YXYA 2YC0A 1AROP 1QCEA 2UU9O 3ABTA 3W7UA 5KHJA 1F4MA 1P7GA 4G28B 1G1XB 3ABLB 3MHSC 4QIWF 1EN5A 1GN2A 3WG7B 1NT2B 4J9ZB 4DUYB 1BHAA 3G80A 1PNKA 5BMVA 1BT8A 4E4EA 5JQGB 3DXRA 1JR9A 1BE3H 5L3DA 2E3CA 3SJAC 3OM3B 1H2MA 1L0NH 2BTOA 2GV9A 2WA4A 5K1XA 4TV8B 1B3QA 2E5LB 1JX9A 1WP8A 3R65A 4FLVA 2F1MA 2RCVA 1YCIA 3TETA 2IH3C 4E2LA 3N2GA 3EXAA 1QNMA 1XUQA 4P2ZA 4UVCA 1AI4A 3ZHRA 4MTFA 2V1DA 5BMVB 1SZTA 5JQGA 3ZMSA 3CC4V 3WB1A 2Q8VA 1LR1A 3OW2U 3WB0A 5IYCO 2XUMA 1EFRG 4ABMA 1BSMA 3BABA 1ZUQA 1P7BA 5GTIZ 1EM1A 3IFXA 3K9AA 4BIZA 4FIPC 2P6JA 3N2KB 3L72H 1M9NA 3LUTB 3T4DA 4B3MO 5LMUO 3G67A 4B3SO 1BHBA 2EIJB 5KAFZ 3ZHQA 4I55B 1S5LZ 2YI9A 4X65O 4JF3A 4HAMA 3W7XA 1KC8W 1RM1C 4NXMB 4HBNA 1Q82W 1K5SA 3DC5A 4JI2O 4JI8B 2B1IA 3CX5F 5H2FZ 1M5IA 1OCZC 1ZAUA 4JI0B 4F6RB 3JAWA 2GSMB 4L87A 4DO2A 1FJGO 2UXCB 3OFNG 3D3QA 1WAZA 3HKBA 4DYLA 4EKWA 1WJZA 2A9HA 2DYSB 3F5TA 3RT3C 4JV5O 5ITZA 4U3FH 1R6NA 2FKXA 3AG1B 5L3BA 2XAHA 2X6BA 4P30A 3ASNC 3K0DA 3I5DA 1AR4A 3RVZA 4CH6A 1MABG 1CP9A 1S0VA 2ZM6B 4D6TH 2YS8A 4K35A 1M1KW 3PN1A 3ZRWA 2UXBB 2ATKC 2DYSC 2DWDC 3E8BA 4UVBA 4O4LA 2ADPA 2EBOA 2NR5A 2IJHA 3OEEG 3CCMV 2OYQA 2Q67A 3AK2A 1WNSA 1Q3EA 4KFMA 5LMNB 5H9CA 4MVSA 1R3KC 3JATB 1KD1W 2HVJC 4CC5A 5KUMA 1IVSA 1UFIA 1CEZA 4OPHA 1JCHA 1QU7A 4PDMA 4MW3A 4DXWA 3ZRWB 3D36C 3SPGA 3FB8C 3AG3B 5H6RA 4O4LB 4DR5B 3K06A 4LWSB 1S72V 2UUBO 2YIDA 1NKDA 2EULA 2WLKA 4NTWA 2LFRA 4N21A 4NXMO 1SKVA 3I56V 2R70A 4NKGB 4AQYB 5BY1A 4DV0O 1JJ2U 2FTKA 2ZIMA 1OCRC 1QVGU 1K9MW 5GTHZ 5EIBD 2R9AA 2AHZA 5CA3A 3STZC 1AP6A 3ZHSA 3J81N 3AG2C 2UXCO 2M6YA 4X8AA 1N8RW 2M7WA 4DR6B 1K5QA 1HNXO 1R3IC 2WLMA 4FFBA 1YDXA 4NVPA 2OCCC 3TCUA 1W0KG 1AILA 3ZJZA 4Q20A 1QLEB 3N2GB 4PDRA 4PJ0Z 5IY5C 1SQXH 2X6AA 1WB8A 3D8CA 1FD9A 2EILC 3ETEA 2HHHO 1PNMA 1M4UA 1PL0A 3CRMA 3LDEA 1XL4A 3L70H 1NBMG 5KMGB 4UV8A 5KLVH 3E8FA 5B1BB 2E74B 3LNMB 2IBZH 4GX0A 4ZI7A 3SDLA 2QM4A 2V4DA 3SJBC 1N36O 3K79A 5EZYB 2AW9A 1P49A 1URFA 2CTQA 3ZX6A 3MD0A 4J80A 3K04A 2YUAA 2CK3G 5KHGA 1NVPD 2QKAA 4EEQA 3RVYA 2IJKA 4I0XA 1F7YA 4UB8Z 4UFZA 1ZLZA 3CSXA 1ROPA 2OCCB 2FL4A 1A32A 4I9WA 1OCCB 2JGDA 2IW5A 1Q90D 3JAWB 3K5MA 3LDDA 1HNWB 3G4SV 1Q5OA 2UXDO 5FNVA 3G71V 3FD9A 3HKBB 3QTCA 3CJHB 1TVKA 4CH5A 1KU9A 4J10A 3RGBA 4LR3A 5KA6A 5CBGA 1AI5A 1YF2A 1EZVH 3QVNA 1E1QG 3JSLA 4DV3O 4UCTA 1OCOB 2HP8A 4J9YB 5H5NA 4LFBO 4JI3B 3JD0A 1N34O 3KG2A 1KQSU 2JGDB 4IL6Z 4PA4A 4X88A 3UQ8A 4DV7B 3EHBB 5CA1A 1OZ0A 2Q68A 5LYJB 3T1YO 2P5OA 4XDKA 4IYHA 3P3NA 3CJHA 3OD4A 2IJJA 4DR7B 2F95B 1AJNA 1V9PA 2WAMA 3OMIB 4CS4A 4JZGA 1PNLA 2ZXWB 1HR0B 3ZMUA 4PDVA 1GRJA 4LF9O 3GWOA 5EBLC 2UXXA 3C3TA 4AILC 1VQKV 2B1GA 5IWAB 3VQYA 4JASA 5KHIA 3T1CA 4DR3O 3RYCA 3AG1C 1R73A 4B08A 2WLHA 3BVOA 2OIGA 2QWQB 2QKCA 3K03A 1WPXA 4ZHQB 1Y74A 2GTAA 5DM6V 3AG4B 3SPIA 4U3JA 3JD1A 4XBFA 4QGPA 3H1HH 1YEWA 3CC7V 2B9ZA 4FLXA 3CCRV 3AG2B 5EYPB 2EX3A 2F93B 3ZIAG 1BS3A 5JWPA 3H9VA 4GKKO 1I94O 2YEVB 2QTSA 1XL6A 2UUAB 1MZFA 3OAAG 4PHZA 2IH1C 4RQEA 1WA8B 1V55B 1U97A 1FXKB 1OHHG 1NH2B 1AB3A 4DV4B 1XQ8A 2N04A 2PI5A 2F43G 3AEIA 3QO7A 3JAMN 1VIBA 4LF8B 1SQPH 4UV9A 3ZN0A 4RQFA 4JAVA 5DECA 1NR7A 2QR4A 4X1KA 5B1NA 2ZNIA 3ZMTA 3ML0A 2K1EA 1DK1A 3VBBA 3CRRA 2ADQB 3K08A 4LNUB 3RWRD 1THZA 3CS5A 5KMGA 4J7KA 1EN6A 3W7TA 4DUZB 3O65A 2PTMA 3AG3C 4YY3O 2WA3A 2HLDG 4JZ2A 1M56C 4LF9B 4EFBA 5A9GA 1LNQA 5LGTA 1MNGA 3IJ4A 4KP4A 1H2KA 4OXSA 4TT3G 1WP7A 1HWYA 2AXTZ 1R6KA 4GT1A 5BR8O 5EK0A 4K3AA 2WWWA 1VQ8V 2QA4V 3JARA 2JRIA 4Z2WA 4OX9B 1M56B 3WG7C 1VQ5V 4MVOA 3HKCA 1MMMA 4J7ZA 1VQNV 3JCUZ 3FB7C 1IBLB 3F7YC 2XAGA 5DN6G 3LDCA 4H33A 1XREA 3WB2A 1X59A 1Y6XA 2A79B 1GO3F 3JD3A 4QJFB 2ZE5A 4JAUA 4LF5O 3CCUV 3ZHTA 2P4KA 3M99B 4UB6Z 2KG7A 4NXNB 1K34A 2JJ2G 1QR8A 4U7NA 4PV1B 4DK0A 4QE9A 1XDCA 1H2LA 1V55C 1AVMA 2RJZA 2P4VA 2ZE7A 3H1LH 3P30A 3D3IA 3TK1A 1N32O 2QM8A 1T5EA 3FFQA 4LF4O 5JJNB 3E35A 2KB1A 3OR7C 1HW7A 4QE7A 1PL4A 3LNNA 4FLWA 3J7AU 5LGUA 3ZN1A 5L3FA 1SQFA 4YHHO 1IBKO 1JFFA 4B3RO 4LH7A 1DF5A 3OE7G 3L73H 3K5OA 4DV2O 1S76D 1GM9A 1GK9A 4FVMA 1FFXA 4JI7B 1IX9A 1FS0G 1CXZB 2LFSA 2YIAA 1Y4MA 2BTQA 4X20A 3IC9A 3U11A 4UCOA 5LMNO 2QSAA 1SF9A 2IM9A 3E8HA 4C7UA 1K4CC 1DLBA 2KKWA 1N0NA 2E75B 3RYHB 1SA0A 2QGNA 4Z1VA 1XOUA 3OMAB 3APQA 4JI5O 2DWEC 1HDJA 1HNZO 3VQVA 4B3TB 2VQFO 1IBLO 1RSOB 3P32A 4JI1O 2CAZC 2JJ1G 4H0LB 5KHHA 1SQVH 2UUBB 3BCCH 1H2SB 2AGAA 5LHGA 3B4SA 5LXTB 4LF5B 2QE7G 4FZ1A 4TQFA 2D2CB 4LF7O 4WCEV 5JH7A 3VQWA 3SJCC 3H1JH 3CCEV 2WLIB 3FYIB 4PI2A 1DGSA 5L3CA 1E1RG 2PUSA 4X1KB 3A8TA 1RSOA 4K0KO 4DR6O 3E89A 1N33B 4O4IB 4GX5A 4JTDB 2JVDA 3CRQA 2ZE8A 5LXTA 3OUFA 5JVDB 2WSSG 3JD4A 3U10A 5JH7B 2WLJA 3CCLV 5IJ0B 4JYAO 5IYZB 2R9RB 4PDLA 1JOYA 2HG5C 2Q69A 2Q7GA 3CCVV 1Z5VA 4PA3A 4UCRA 1SETA 3ZHUA 4Q6GA 4J7JA 2NLJC 3UT5A 5LHHA 1YSCA 4NTXA 3U0ZA 2BOCC 2YI8A 1WLEA 2X7RB 2ZDIC 1WB7A 1YTFB 4TOIA 3UKMA 1RM1B 4KHPB 2VQFB 2ZDIA 3DXRB 4MVQA 2C2AA 2HFEC 1KECA 3A0RA 4TUYB 2XAJA 2ZR2A 3K9SA 4J41A 1XI1A 4PI0A 2XT9A 2X0LA 2LJ2A 5JCOC 2RDCA 2N74A 1NTZH 2KSDA 3JAKA 4JI8O 5F2VO 1FAFA 1OV9A 3UM7A 1ZSPA 5LA6B 1HNWO 3UO3A 1YJNV 3CCJV 4A5UB 3UCSC 4JI0O 2QM7A 1J95A 1VF5B 2QWRB 1NU1H 3SPJA 2V7QG 2EIMB 1HP8A 4K0KB 2LO1A 4X1YA 4OGQB 1PV0A 3ZHVA 4IIJA 2W0FC 4X62O 1PP9H 2JGUA 3M8AA 1ZL8A 3SJQC 2OTJV 2QWNB 4YIPA 1YITV 5IE9A 4TWKA 2CDYA 4L8JA 4FJCC 2DYRB 4LFBB 1GN6A 2OCHA 5LP6C 1VQLV 1SS3A 2H3OA 4IYIA 4O4JA 1N34B 3OTOB 3SYPA 3OUSA 1JFFB 3H01A 3R66A 2ZM6O 3B09A 4H37A 3N2KA 1FFTB 1VF6A 5B3SB 1XHZA 1H8EG 4GX2A 3CE2A 1V54C 1P4RA 2RQ6A 4JPRA 3T2MA 3ZRXA 2BTQB 4G27B 2ZD9A 3W7WA 3HKDB 4WFAV 3OT7A 2ZXWC 3T1HB 1LUVA 1ZL8B 1I5YA 4GX1A 4I5SA 5IDJA 3STLC 1AI7A 4Z1MG 4CS3A 4ZOLB 5IYBO 1Y76A 2PZSA 2JK5C 4MSWC 1OCZB 1VEWA 4KHPO 3HR0A 1OCRB 3K57A 2XASA 1CPYA 2GDSA 4P9OA 4DR5O 4RO2A 4DW1A 4XDLA 4LBEC 3CCSV 4RAIA 5B66Z 1VQ7V 2WLIA 5J2TA 2KQXA 1IZ3A 3JALB 2PYJA 5GONA 1Y76B 3IGAC 3ZRVA 1O9HA 1YTFD 1QQCA 5FLXN 1S77D 5LMUB 1VQ6V 3K3WA 1RP3B 5L3GA 1TVKB 1D5AA 1Q81W 3O9OA 1K92A 3AK3A 3ZMVA 3CEIA 1US6A 1TAEA 3CHXA 5IJ0A 1K8AW 4TV9B 1L8DA 1AR5A 4FLYA 3BHPA 3B40A 3B8MA 2ARHA 1OCOC 3RBZA 1JPXA 4IHJB 1H2NA 1JMKC 4KL1A 3ICXA 4DRXB 4PA6A 3T1HO 1XBLA 2H94A 1JQ0A 2YSUB 4R8CA 1H38A 1R1BA 3E83A 3CXCU 3WFVA 1SQQH 2ITCC 4DR2O 2WLNA 3LSSA 3RYCB 1F4NA 3BA8A 3BRCA 1R3JC 3FB6C 4UUJC 4ASUG 5BR8B 1ZWIC 5LP6A 4IHJA 2QDOA 2ZIOA 4OX9O 3ASNB 1V54B 2LW7A 4RUFA 1VP7A 3JAKB 4X64B 1BQ0A 3SPHA 1I7FA 5LHIA 1B06A 5LOVA 4DR4O 5EYPA 2YICA 2EJ7A 3ABMC 2ZINA 2AZ2A 3QNEA 1IXBA 3EFFK 1QHTA 3A2FA 2Q73A 1GN4A 3G6EV 1I5XA 4ZBMA 1U96A 3A0BZ 4B7KA 5B3SC 5LBQA 1FXKA 5EC1C 2A06H 2UXNA 3RYFB 4BIUA 3HPLC 1S3JA 3RYIB 5EC2C 2MW2B 4JI3O 4DV0B 4JI6O 5LGNA 4MVRA 4QNHB 1ENVA 2ZCEA 3FX7A 4LC1A 4N23A 5LOVB 1VQPV 5EZYA 4HNAA 4B7EA 1Q7YW 2PGGA 4HZ3A 4DV7O 4GLXA 1D5NA 1YJWV 3J80N 2BE3A 1KBHA 3X2QC 4LF4B 3ABKB 2HVKC 4I0XB 5KX5B 1XNRB 1XMQO 1MOFA 1XILA 1S5HC 1HR0O 3NXSA 1DTOA 2XHBA 5GW7A 1X4TA 4B3RB 4XDJA 2Q9LA 4MVMA 5EIBC 1YJ9V 3Q4HA 4JI7O 4G2KA 2LGWA 4PELA 2YXHA 3ABLC 1AR1B 1NVPB 3JSNA 3G6BA 1IBMO 2PYLA 3JCZA 2ITDC 4R7CA 4UCSA 1BMFG 3SR2C 3JARB 1FYJA 5BXZA 3K0GA 2ILMA 3HKCB 4X1IA 4H13B 4EB6B 1QVFU 4B3MB 1AP5A 5GONB 2DQ0A 2A0LA 4JI1B 2Q6AA 1NI8A 1S5JA 2HJFC 1IDSA 3W7SA 3ETQA 5B1OA 4LFAO 1BL8A 3CRCA 4JI4B 3CYOA 5CBFA 5TISZ 1K7DA 1H2GA 1R3LC 3QO8A 2RMKB 2YDEA 4TV8A 2JIZG 2EZPA 5KAIZ 3WU2Z 2EIJC 1NR1A 2P7TC 1QBZA 1JJOA 4AHCA 1PPJH 3CD6V 1TUBB 1FJGB 1KB9F 4R6ZA 4JI6B 4TSFG 2G38A 1Q8IA 3FAVA 3ZS8C 2WLLA 2QWPB 2CGOA 1N4CA 3TGUH 1GN3A 4H44B 1RPRA 4LP8A 5CMUA 2UXDB 4WFGA 4BWAA 1Y74B 4EFEA 4DR1B 3KKYA 5CA0B 4FMTA 2LGQA 1GM8A 5EBWC 3OTFA 2UU9B 4RWUA 4MVUA 1VARA 2HJDA 1YHQV 4DV3B 2D3OW 4FM0A 3KZIZ 3ZEDA 3FAVB 2WLLB 2R9IA 4J11A 2VWKA 1WA8A 4FFKA 3H1IH 5JCOA 2VWJA 1KP3A 1IBMB 1SQBH 4NTYA 2EINC 2DW4A 2VQEB 3RFRA 1W0JG 4I50A 3L74H 1L1FA 1F23A 3D36A 1P84F 3CPWU 3VOUA 3T4ZA 2EINB 4W4KA 3ZCCA 4DV5B 1Y67A 5KHKA 2P22C 5J2UB 4YJ2B 3B2EE 1I0HA 3H1KH 5KA5A 2PY5A 1R6TA 4LNUA 2P67A 2XTAA 1H8HG 1FXVA 3JYCA 4RUEA 4FM2A 4JI4O 5KUKA 5E1AC 2ZQMA 1UJWB 3LSUA 2MK3A 5CN0A 4LH6A 2CTPA 3RYIA 1KKDA 4JGSA 1MA1A 1VMGA 2W6JG 2PI4A 4WF9V 1L0LH 5DEDA 4DV1B 2BSKA 1ZX3A 2ODMA 1VQ9V 2FYUH 3SYOA 1NS1A 4QPJA 3CRAA 3QF7A 4I4TB 3E86A 3C90A 4GZRB 3AG4C 4O4IA 1KKCA 1J5EO 4GKJO 2XAQA 4UVAA 4OPAA 5JVDA 4AI8A 3I55V 1GH6A 4FLZA 1MZEA 1NH2D 1LUWA 4KXRA 4FLTA 2F66C 4YHHB 1IBKB 3E8GA 2P90A 1Q86W 2QWOB 4NYKA 2CTRA 1SZXA 2Q5ZA 4ZKIA 2IU0A 4CZZA 4JV5B 2XAFA 4LWSA 1YXBA 4JTCB 3UT5B 2JS3A 2VQEO 2Q7HA 2Y69B 3QO5A 1BCCH 4PD4F 2ETNA 1UPGA 1BZKA 1WPBA 2DJVA 4GCZA 5CB4A 4JI5B 1EN4A 3FYEB 4B3TO 3LSQA 1SC5B 3C3SA 2JDIG 2UXBO 3BPZA 1O9GA 4DV5O 5CBHA 1XNQB 4CBCA 5D5QA 4TUYA 2CTWA 2ZNJA 1TUEB 2DN9A 2A7WA 2R72A 3ZRSA 2LP7A 2XOKG 3FKSG 4I7ZB 4FLUA 4LF7B 5LA6A 5CB4B 3GVMA 1QR9A 4DV6B 2F4VO 1FFXB 3X2QB 4PA9A 4DV1O 2YXLA 3CXHF 2LW1A 3GWKC 4BAYA 3DGEA 4F4LA 2L35A 3K5LA 4IIJB 3S3XA 2OIEA 4LFCO 1OJHA 4AQYO 1GTOA 1SA0B 4WFFA 2DQ3A 4BR6A 1J5EB 4GKJB 1AJQA 2RN9A 2PF4E 4O4JB 1VF7A 3ZBHA 4F6RA 1MSWD 1FXKC 4JYAB 5FL7G 4DUYO 1VQOV 3VQXA 4DR7O 2ZR3A 1PD3A 1JA8A 2BCCH 1RPOA 2HKOA 3ABMB 5ITZB 5IYDO 3MAQA 3CC2V 3HKDA 1KUQA 1G4YB 1FXHA 1N32B 3ASOB 1W59A 1QLEC 1PM9A 2NN4A 2E5LO 4UXNA 4DR2B 3ABUA 2DYRC 3OGCC 4ZOLA 1NTKH 1TA8A 3IAYA 2CGNA 3BFRA 4FPPA 3B8NA 2AZ0A 4DV2B 2HHHB 4O4HA 2XNDG 4I9QA 2O57A 4MT8A 2JS5A 4X64O 2EILB 4K8ZA 4WBNA 2FB5A 4MS2A 3JATA 3APOA 3ZMZA 1G8MA 1EZJA 4R50A 4X66B 1N36B 3KCYA 1I94B 2Z3YA 4LF6O 1BQZA 2UUAO 4DV6O 1NTMH 5LYJA 3EVKA 4FK5C 4B3SB 4DV4O 4DK1A 3BEHA 4X62B 2Z0AA 3AK1A 2QJ1A 2VRZA 3SPCA 2CE4A 1XMOO 3THOA 3CP1A 4X65B 4LF8O 4DW0A 4WBNB 2CUGA 4FM1A 1IXMA 1EBOA 1QLNA 1TGOA 3OTOO 3E22A 2DOSA 5H6QA 4U7OA 4TV9A 3ABKC 2OT5A 1KYOF 4JYBA 1AJPA 2Y4TA 3CWBH 3GB7C 3RN4A 2NNUA 2GBOA 1XNRO 4FFBB 4YY3B 2DE0X 3SYCA 3MDSA 1PKXA 4PA7A 4ZHQA 1N33O 1DF4A 1XEQA 2BOBC 4WFEA 3CB2A 2IJIA 1Z2GA 4NB5A 4DR4B 5E79Z 3TJTA 4YJ3A 5B1BC 4TQDA 1KP2A 1YVWA 3T1YB 3ETGA 2GUZB 4JYYA 4X1YB 3K5NA 2AHYA 3M7MX 4IGGA 5LP6B 1RFYA 2IU3A 2ZE6A 2GHYA 2DMXA 3DSQA 4F6EA 3AG7A 1YZBA 1JVMA 5IWAO 1NQTA 4ZI7B 2YIBA 2EIMC 3NR7A 2EIKC 2P06A 3L75H 4X66O 1GAXA 1M57C 3A0HZ 2Y4UA 2OWOA 4IT5A 4YJ3B 4LFAB 1K3EA 4LF6B 3DTUB 3SGIA 4D7TA 3ASOC 1D2DA 2CH7B 1N0JA 1K97A 3SYQA 5IJ9B 3RYFA 1XMOB 4O2AA 5B5EZ 2ZKOA 3TXSA 3HB3B 3ETDA 1I08A 3IC7A 3SYAA 1Y66A 2L6LA 1MSDA 3HKEA 4JTAB 5FNVB 4HYOA 4GKKB 3L9DA 4WFHA 3S3WA 5C8YA 3B77A 2Z5UA 1FPOA 4MVZA 3RW0A 4GUNA 5B1AB 2JEXA 1SERA 2CH7A 1KMIZ 3PJSK 1HNXB 4O2BA 1M57B 3MHHC 5K1PA 5L3EA 5IJ9A 2Y48A 3OMNB 5J2TB 3JALA 1G6UA 2QEXV 5CA1B 3BA9A 2Y0PA 4BW9A 2QKSA 3E2EA 4O4HB 2A3QA 2E76B 3TXQA 4K8XA 5JJEB 4X89A 4DUZO 4D7SA 3CMAV 2HR3A 2WPDG 2X6CA 4KUMA 5LL6Y 4NR1A 3BAAA 3OR6C 3CCQV 1YI2V 1HNZB 2UUCB 4X1IB 4W4LA 4EB6A 4GYCB 4WFBV 4CH3A 1K4DC 1AI6A 1F51A 2H8PC 2HEPA 1Z5WA 2Y69C 1YIJV 4MW8A 4QPKA 4DRXA 2LQTA 4LCUC 3L71H 1ORQC 4U3JB 1VQMV 5IT9N 4MTGA 3K58A 2GTSA 3E22B 1B6QA 2VS0A 1TUBA 1SQGA 1Q43A 2F23A 2ZT9B 2YEVA 4UCUA 2Q4PA 2RNBA 4J42A 4I55A 5J9PC 4X20B 3BY6A 4NXNO 3CMEV 2OTLV 1VF6C 5CA0A 1XMQB 4YIOA 3OEHG 4MTOA 2W0XA 3RYHA 2K9PA 2Y0IA 4CH4A 2Q0OC 4X9QA 1FKAO 5BZBA 1NZ6A 2EZOA 1Q6HA 1GKFA 3P3PA 4UCVA 5B1AC 4MTXA 4YXWG 3F7VC 2GUZA 2Q0AA 1SESA 5FPRA 1Q6UA 3JASA 1B04A 1BGYH 4ICGA 1XHXA 3N27A 1WN7A 1ZTEA 4I50B 2B5UA 3OGIB 1SRYA 1COWG 4JYCA 1NJIW 3KCXA 2UUCO 2QTOA 5FPOA 4HNAB 1XNQO 1M93A 4DR3B 4BW5A 4P9PA 5J2UA 4YJ2A 3K59A 3FB5C 3JASB 5A2QN 2FMLA 4ZIBA 5HFLA 2EJRA 4FZ0A 2N05A 5KX5A 2W6IG 3QG5A 1W2BU 2EIKB 5HFMA 4O2AB 1M90W 1OCCC 4CS2A 1K73W 5D5PA 3F5WC 1IURA 1MG1A 2F4VB 3Q4HB 3HKEB 5JJJB 4JAAA 1Q6IA 5IYZA 2Q7EA 5C93A 5C8YB 2BSKB 4CC6A
chains in the Genus database with same CATH topology
2OCHA 2Y4TA 3APQA 3UO3A 2CTQA 3UO2A 2CTWA 2LGWA 2N05A 3UCSC 1HDJA 1GH6A 4J80A 3APOA 1WJZA 2GUZB 1BQ0A 2DN9A 2QWRB 1NZ6A 2Y4UA 4RWUA 2YUAA 4J7ZA 4IT5A 2CUGA 2QWOB 2LO1A 2L6LA 2EJ7A 2GUZA 2QSAA 2CTRA 2QWPB 1N4CA 2N04A 1BQZA 1IURA 2DMXA 1FPOA 2KQXA 2CTPA 1XBLA 2QWNB 2M6YA 2PF4E 3AG7A 1FAFA 2YS8A 3BVOA 2QWQB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2OCH A;  2Y4T A;  3APQ A;  3UO3 A;  2CTQ A;  3UO2 A;  2CTW A;  2LGW A;  2N05 A;  3UCS C;  1HDJ A;  1GH6 A;  4J80 A;  3APO A;  1WJZ A;  2GUZ B;  1BQ0 A;  2DN9 A;  2QWR B;  1NZ6 A;  2Y4U A;  4RWU A;  2YUA A;  4J7Z A;  4IT5 A;  2CUG A;  2QWO B;  2LO1 A;  2L6L A;  2EJ7 A;  2GUZ A;  2QSA A;  2CTR A;  2QWP B;  1N4C A;  2N04 A;  1BQZ A;  1IUR A;  2DMX A;  1FPO A;  2KQX A;  2CTP A;  1XBL A;  2QWN B;  2M6Y A;  2PF4 E;  3AG7 A;  1FAF A;  2YS8 A;  3BVO A;  2QWQ B; 
#chains in the Genus database with same CATH topology
 5EBM C;  3DC6 A;  1K33 A;  5AG2 A;  3UO2 A;  1GMG A;  3JD2 A;  1GM7 A;  4BIO A;  4LFC B;  1VQ4 V;  4I4T A;  5IY5 B;  2KG7 B;  1E79 G;  4O2B B;  2YIB D;  2JEU A;  4DR1 O;  4JI2 B;  2YXY A;  2YC0 A;  1ARO P;  1QCE A;  2UU9 O;  3ABT A;  3W7U A;  5KHJ A;  1F4M A;  1P7G A;  4G28 B;  1G1X B;  3ABL B;  3MHS C;  4QIW F;  1EN5 A;  1GN2 A;  3WG7 B;  1NT2 B;  4J9Z B;  4DUY B;  1BHA A;  3G80 A;  1PNK A;  5BMV A;  1BT8 A;  4E4E A;  5JQG B;  3DXR A;  1JR9 A;  1BE3 H;  5L3D A;  2E3C A;  3SJA C;  3OM3 B;  1H2M A;  1L0N H;  2BTO A;  2GV9 A;  2WA4 A;  5K1X A;  4TV8 B;  1B3Q A;  2E5L B;  1JX9 A;  1WP8 A;  3R65 A;  4FLV A;  2F1M A;  2RCV A;  1YCI A;  3TET A;  2IH3 C;  4E2L A;  3N2G A;  3EXA A;  1QNM A;  1XUQ A;  4P2Z A;  4UVC A;  1AI4 A;  3ZHR A;  4MTF A;  2V1D A;  5BMV B;  1SZT A;  5JQG A;  3ZMS A;  3CC4 V;  3WB1 A;  2Q8V A;  1LR1 A;  3OW2 U;  3WB0 A;  5IYC O;  2XUM A;  1EFR G;  4ABM A;  1BSM A;  3BAB A;  1ZUQ A;  1P7B A;  5GTI Z;  1EM1 A;  3IFX A;  3K9A A;  4BIZ A;  4FIP C;  2P6J A;  3N2K B;  3L72 H;  1M9N A;  3LUT B;  3T4D A;  4B3M O;  5LMU O;  3G67 A;  4B3S O;  1BHB A;  2EIJ B;  5KAF Z;  3ZHQ A;  4I55 B;  1S5L Z;  2YI9 A;  4X65 O;  4JF3 A;  4HAM A;  3W7X A;  1KC8 W;  1RM1 C;  4NXM B;  4HBN A;  1Q82 W;  1K5S A;  3DC5 A;  4JI2 O;  4JI8 B;  2B1I A;  3CX5 F;  5H2F Z;  1M5I A;  1OCZ C;  1ZAU A;  4JI0 B;  4F6R B;  3JAW A;  2GSM B;  4L87 A;  4DO2 A;  1FJG O;  2UXC B;  3OFN G;  3D3Q A;  1WAZ A;  3HKB A;  4DYL A;  4EKW A;  1WJZ A;  2A9H A;  2DYS B;  3F5T A;  3RT3 C;  4JV5 O;  5ITZ A;  4U3F H;  1R6N A;  2FKX A;  3AG1 B;  5L3B A;  2XAH A;  2X6B A;  4P30 A;  3ASN C;  3K0D A;  3I5D A;  1AR4 A;  3RVZ A;  4CH6 A;  1MAB G;  1CP9 A;  1S0V A;  2ZM6 B;  4D6T H;  2YS8 A;  4K35 A;  1M1K W;  3PN1 A;  3ZRW A;  2UXB B;  2ATK C;  2DYS C;  2DWD C;  3E8B A;  4UVB A;  4O4L A;  2ADP A;  2EBO A;  2NR5 A;  2IJH A;  3OEE G;  3CCM V;  2OYQ A;  2Q67 A;  3AK2 A;  1WNS A;  1Q3E A;  4KFM A;  5LMN B;  5H9C A;  4MVS A;  1R3K C;  3JAT B;  1KD1 W;  2HVJ C;  4CC5 A;  5KUM A;  1IVS A;  1UFI A;  1CEZ A;  4OPH A;  1JCH A;  1QU7 A;  4PDM A;  4MW3 A;  4DXW A;  3ZRW B;  3D36 C;  3SPG A;  3FB8 C;  3AG3 B;  5H6R A;  4O4L B;  4DR5 B;  3K06 A;  4LWS B;  1S72 V;  2UUB O;  2YID A;  1NKD A;  2EUL A;  2WLK A;  4NTW A;  2LFR A;  4N21 A;  4NXM O;  1SKV A;  3I56 V;  2R70 A;  4NKG B;  4AQY B;  5BY1 A;  4DV0 O;  1JJ2 U;  2FTK A;  2ZIM A;  1OCR C;  1QVG U;  1K9M W;  5GTH Z;  5EIB D;  2R9A A;  2AHZ A;  5CA3 A;  3STZ C;  1AP6 A;  3ZHS A;  3J81 N;  3AG2 C;  2UXC O;  2M6Y A;  4X8A A;  1N8R W;  2M7W A;  4DR6 B;  1K5Q A;  1HNX O;  1R3I C;  2WLM A;  4FFB A;  1YDX A;  4NVP A;  2OCC C;  3TCU A;  1W0K G;  1AIL A;  3ZJZ A;  4Q20 A;  1QLE B;  3N2G B;  4PDR A;  4PJ0 Z;  5IY5 C;  1SQX H;  2X6A A;  1WB8 A;  3D8C A;  1FD9 A;  2EIL C;  3ETE A;  2HHH O;  1PNM A;  1M4U A;  1PL0 A;  3CRM A;  3LDE A;  1XL4 A;  3L70 H;  1NBM G;  5KMG B;  4UV8 A;  5KLV H;  3E8F A;  5B1B B;  2E74 B;  3LNM B;  2IBZ H;  4GX0 A;  4ZI7 A;  3SDL A;  2QM4 A;  2V4D A;  3SJB C;  1N36 O;  3K79 A;  5EZY B;  2AW9 A;  1P49 A;  1URF A;  2CTQ A;  3ZX6 A;  3MD0 A;  4J80 A;  3K04 A;  2YUA A;  2CK3 G;  5KHG A;  1NVP D;  2QKA A;  4EEQ A;  3RVY A;  2IJK A;  4I0X A;  1F7Y A;  4UB8 Z;  4UFZ A;  1ZLZ A;  3CSX A;  1ROP A;  2OCC B;  2FL4 A;  1A32 A;  4I9W A;  1OCC B;  2JGD A;  2IW5 A;  1Q90 D;  3JAW B;  3K5M A;  3LDD A;  1HNW B;  3G4S V;  1Q5O A;  2UXD O;  5FNV A;  3G71 V;  3FD9 A;  3HKB B;  3QTC A;  3CJH B;  1TVK A;  4CH5 A;  1KU9 A;  4J10 A;  3RGB A;  4LR3 A;  5KA6 A;  5CBG A;  1AI5 A;  1YF2 A;  1EZV H;  3QVN A;  1E1Q G;  3JSL A;  4DV3 O;  4UCT A;  1OCO B;  2HP8 A;  4J9Y B;  5H5N A;  4LFB O;  4JI3 B;  3JD0 A;  1N34 O;  3KG2 A;  1KQS U;  2JGD B;  4IL6 Z;  4PA4 A;  4X88 A;  3UQ8 A;  4DV7 B;  3EHB B;  5CA1 A;  1OZ0 A;  2Q68 A;  5LYJ B;  3T1Y O;  2P5O A;  4XDK A;  4IYH A;  3P3N A;  3CJH A;  3OD4 A;  2IJJ A;  4DR7 B;  2F95 B;  1AJN A;  1V9P A;  2WAM A;  3OMI B;  4CS4 A;  4JZG A;  1PNL A;  2ZXW B;  1HR0 B;  3ZMU A;  4PDV A;  1GRJ A;  4LF9 O;  3GWO A;  5EBL C;  2UXX A;  3C3T A;  4AIL C;  1VQK V;  2B1G A;  5IWA B;  3VQY A;  4JAS A;  5KHI A;  3T1C A;  4DR3 O;  3RYC A;  3AG1 C;  1R73 A;  4B08 A;  2WLH A;  3BVO A;  2OIG A;  2QWQ B;  2QKC A;  3K03 A;  1WPX A;  4ZHQ B;  1Y74 A;  2GTA A;  5DM6 V;  3AG4 B;  3SPI A;  4U3J A;  3JD1 A;  4XBF A;  4QGP A;  3H1H H;  1YEW A;  3CC7 V;  2B9Z A;  4FLX A;  3CCR V;  3AG2 B;  5EYP B;  2EX3 A;  2F93 B;  3ZIA G;  1BS3 A;  5JWP A;  3H9V A;  4GKK O;  1I94 O;  2YEV B;  2QTS A;  1XL6 A;  2UUA B;  1MZF A;  3OAA G;  4PHZ A;  2IH1 C;  4RQE A;  1WA8 B;  1V55 B;  1U97 A;  1FXK B;  1OHH G;  1NH2 B;  1AB3 A;  4DV4 B;  1XQ8 A;  2N04 A;  2PI5 A;  2F43 G;  3AEI A;  3QO7 A;  3JAM N;  1VIB A;  4LF8 B;  1SQP H;  4UV9 A;  3ZN0 A;  4RQF A;  4JAV A;  5DEC A;  1NR7 A;  2QR4 A;  4X1K A;  5B1N A;  2ZNI A;  3ZMT A;  3ML0 A;  2K1E A;  1DK1 A;  3VBB A;  3CRR A;  2ADQ B;  3K08 A;  4LNU B;  3RWR D;  1THZ A;  3CS5 A;  5KMG A;  4J7K A;  1EN6 A;  3W7T A;  4DUZ B;  3O65 A;  2PTM A;  3AG3 C;  4YY3 O;  2WA3 A;  2HLD G;  4JZ2 A;  1M56 C;  4LF9 B;  4EFB A;  5A9G A;  1LNQ A;  5LGT A;  1MNG A;  3IJ4 A;  4KP4 A;  1H2K A;  4OXS A;  4TT3 G;  1WP7 A;  1HWY A;  2AXT Z;  1R6K A;  4GT1 A;  5BR8 O;  5EK0 A;  4K3A A;  2WWW A;  1VQ8 V;  2QA4 V;  3JAR A;  2JRI A;  4Z2W A;  4OX9 B;  1M56 B;  3WG7 C;  1VQ5 V;  4MVO A;  3HKC A;  1MMM A;  4J7Z A;  1VQN V;  3JCU Z;  3FB7 C;  1IBL B;  3F7Y C;  2XAG A;  5DN6 G;  3LDC A;  4H33 A;  1XRE A;  3WB2 A;  1X59 A;  1Y6X A;  2A79 B;  1GO3 F;  3JD3 A;  4QJF B;  2ZE5 A;  4JAU A;  4LF5 O;  3CCU V;  3ZHT A;  2P4K A;  3M99 B;  4UB6 Z;  2KG7 A;  4NXN B;  1K34 A;  2JJ2 G;  1QR8 A;  4U7N A;  4PV1 B;  4DK0 A;  4QE9 A;  1XDC A;  1H2L A;  1V55 C;  1AVM A;  2RJZ A;  2P4V A;  2ZE7 A;  3H1L H;  3P30 A;  3D3I A;  3TK1 A;  1N32 O;  2QM8 A;  1T5E A;  3FFQ A;  4LF4 O;  5JJN B;  3E35 A;  2KB1 A;  3OR7 C;  1HW7 A;  4QE7 A;  1PL4 A;  3LNN A;  4FLW A;  3J7A U;  5LGU A;  3ZN1 A;  5L3F A;  1SQF A;  4YHH O;  1IBK O;  1JFF A;  4B3R O;  4LH7 A;  1DF5 A;  3OE7 G;  3L73 H;  3K5O A;  4DV2 O;  1S76 D;  1GM9 A;  1GK9 A;  4FVM A;  1FFX A;  4JI7 B;  1IX9 A;  1FS0 G;  1CXZ B;  2LFS A;  2YIA A;  1Y4M A;  2BTQ A;  4X20 A;  3IC9 A;  3U11 A;  4UCO A;  5LMN O;  2QSA A;  1SF9 A;  2IM9 A;  3E8H A;  4C7U A;  1K4C C;  1DLB A;  2KKW A;  1N0N A;  2E75 B;  3RYH B;  1SA0 A;  2QGN A;  4Z1V A;  1XOU A;  3OMA B;  3APQ A;  4JI5 O;  2DWE C;  1HDJ A;  1HNZ O;  3VQV A;  4B3T B;  2VQF O;  1IBL O;  1RSO B;  3P32 A;  4JI1 O;  2CAZ C;  2JJ1 G;  4H0L B;  5KHH A;  1SQV H;  2UUB B;  3BCC H;  1H2S B;  2AGA A;  5LHG A;  3B4S A;  5LXT B;  4LF5 B;  2QE7 G;  4FZ1 A;  4TQF A;  2D2C B;  4LF7 O;  4WCE V;  5JH7 A;  3VQW A;  3SJC C;  3H1J H;  3CCE V;  2WLI B;  3FYI B;  4PI2 A;  1DGS A;  5L3C A;  1E1R G;  2PUS A;  4X1K B;  3A8T A;  1RSO A;  4K0K O;  4DR6 O;  3E89 A;  1N33 B;  4O4I B;  4GX5 A;  4JTD B;  2JVD A;  3CRQ A;  2ZE8 A;  5LXT A;  3OUF A;  5JVD B;  2WSS G;  3JD4 A;  3U10 A;  5JH7 B;  2WLJ A;  3CCL V;  5IJ0 B;  4JYA O;  5IYZ B;  2R9R B;  4PDL A;  1JOY A;  2HG5 C;  2Q69 A;  2Q7G A;  3CCV V;  1Z5V A;  4PA3 A;  4UCR A;  1SET A;  3ZHU A;  4Q6G A;  4J7J A;  2NLJ C;  3UT5 A;  5LHH A;  1YSC A;  4NTX A;  3U0Z A;  2BOC C;  2YI8 A;  1WLE A;  2X7R B;  2ZDI C;  1WB7 A;  1YTF B;  4TOI A;  3UKM A;  1RM1 B;  4KHP B;  2VQF B;  2ZDI A;  3DXR B;  4MVQ A;  2C2A A;  2HFE C;  1KEC A;  3A0R A;  4TUY B;  2XAJ A;  2ZR2 A;  3K9S A;  4J41 A;  1XI1 A;  4PI0 A;  2XT9 A;  2X0L A;  2LJ2 A;  5JCO C;  2RDC A;  2N74 A;  1NTZ H;  2KSD A;  3JAK A;  4JI8 O;  5F2V O;  1FAF A;  1OV9 A;  3UM7 A;  1ZSP A;  5LA6 B;  1HNW O;  3UO3 A;  1YJN V;  3CCJ V;  4A5U B;  3UCS C;  4JI0 O;  2QM7 A;  1J95 A;  1VF5 B;  2QWR B;  1NU1 H;  3SPJ A;  2V7Q G;  2EIM B;  1HP8 A;  4K0K B;  2LO1 A;  4X1Y A;  4OGQ B;  1PV0 A;  3ZHV A;  4IIJ A;  2W0F C;  4X62 O;  1PP9 H;  2JGU A;  3M8A A;  1ZL8 A;  3SJQ C;  2OTJ V;  2QWN B;  4YIP A;  1YIT V;  5IE9 A;  4TWK A;  2CDY A;  4L8J A;  4FJC C;  2DYR B;  4LFB B;  1GN6 A;  2OCH A;  5LP6 C;  1VQL V;  1SS3 A;  2H3O A;  4IYI A;  4O4J A;  1N34 B;  3OTO B;  3SYP A;  3OUS A;  1JFF B;  3H01 A;  3R66 A;  2ZM6 O;  3B09 A;  4H37 A;  3N2K A;  1FFT B;  1VF6 A;  5B3S B;  1XHZ A;  1H8E G;  4GX2 A;  3CE2 A;  1V54 C;  1P4R A;  2RQ6 A;  4JPR A;  3T2M A;  3ZRX A;  2BTQ B;  4G27 B;  2ZD9 A;  3W7W A;  3HKD B;  4WFA V;  3OT7 A;  2ZXW C;  3T1H B;  1LUV A;  1ZL8 B;  1I5Y A;  4GX1 A;  4I5S A;  5IDJ A;  3STL C;  1AI7 A;  4Z1M G;  4CS3 A;  4ZOL B;  5IYB O;  1Y76 A;  2PZS A;  2JK5 C;  4MSW C;  1OCZ B;  1VEW A;  4KHP O;  3HR0 A;  1OCR B;  3K57 A;  2XAS A;  1CPY A;  2GDS A;  4P9O A;  4DR5 O;  4RO2 A;  4DW1 A;  4XDL A;  4LBE C;  3CCS V;  4RAI A;  5B66 Z;  1VQ7 V;  2WLI A;  5J2T A;  2KQX A;  1IZ3 A;  3JAL B;  2PYJ A;  5GON A;  1Y76 B;  3IGA C;  3ZRV A;  1O9H A;  1YTF D;  1QQC A;  5FLX N;  1S77 D;  5LMU B;  1VQ6 V;  3K3W A;  1RP3 B;  5L3G A;  1TVK B;  1D5A A;  1Q81 W;  3O9O A;  1K92 A;  3AK3 A;  3ZMV A;  3CEI A;  1US6 A;  1TAE A;  3CHX A;  5IJ0 A;  1K8A W;  4TV9 B;  1L8D A;  1AR5 A;  4FLY A;  3BHP A;  3B40 A;  3B8M A;  2ARH A;  1OCO C;  3RBZ A;  1JPX A;  4IHJ B;  1H2N A;  1JMK C;  4KL1 A;  3ICX A;  4DRX B;  4PA6 A;  3T1H O;  1XBL A;  2H94 A;  1JQ0 A;  2YSU B;  4R8C A;  1H38 A;  1R1B A;  3E83 A;  3CXC U;  3WFV A;  1SQQ H;  2ITC C;  4DR2 O;  2WLN A;  3LSS A;  3RYC B;  1F4N A;  3BA8 A;  3BRC A;  1R3J C;  3FB6 C;  4UUJ C;  4ASU G;  5BR8 B;  1ZWI C;  5LP6 A;  4IHJ A;  2QDO A;  2ZIO A;  4OX9 O;  3ASN B;  1V54 B;  2LW7 A;  4RUF A;  1VP7 A;  3JAK B;  4X64 B;  1BQ0 A;  3SPH A;  1I7F A;  5LHI A;  1B06 A;  5LOV A;  4DR4 O;  5EYP A;  2YIC A;  2EJ7 A;  3ABM C;  2ZIN A;  2AZ2 A;  3QNE A;  1IXB A;  3EFF K;  1QHT A;  3A2F A;  2Q73 A;  1GN4 A;  3G6E V;  1I5X A;  4ZBM A;  1U96 A;  3A0B Z;  4B7K A;  5B3S C;  5LBQ A;  1FXK A;  5EC1 C;  2A06 H;  2UXN A;  3RYF B;  4BIU A;  3HPL C;  1S3J A;  3RYI B;  5EC2 C;  2MW2 B;  4JI3 O;  4DV0 B;  4JI6 O;  5LGN A;  4MVR A;  4QNH B;  1ENV A;  2ZCE A;  3FX7 A;  4LC1 A;  4N23 A;  5LOV B;  1VQP V;  5EZY A;  4HNA A;  4B7E A;  1Q7Y W;  2PGG A;  4HZ3 A;  4DV7 O;  4GLX A;  1D5N A;  1YJW V;  3J80 N;  2BE3 A;  1KBH A;  3X2Q C;  4LF4 B;  3ABK B;  2HVK C;  4I0X B;  5KX5 B;  1XNR B;  1XMQ O;  1MOF A;  1XIL A;  1S5H C;  1HR0 O;  3NXS A;  1DTO A;  2XHB A;  5GW7 A;  1X4T A;  4B3R B;  4XDJ A;  2Q9L A;  4MVM A;  5EIB C;  1YJ9 V;  3Q4H A;  4JI7 O;  4G2K A;  2LGW A;  4PEL A;  2YXH A;  3ABL C;  1AR1 B;  1NVP B;  3JSN A;  3G6B A;  1IBM O;  2PYL A;  3JCZ A;  2ITD C;  4R7C A;  4UCS A;  1BMF G;  3SR2 C;  3JAR B;  1FYJ A;  5BXZ A;  3K0G A;  2ILM A;  3HKC B;  4X1I A;  4H13 B;  4EB6 B;  1QVF U;  4B3M B;  1AP5 A;  5GON B;  2DQ0 A;  2A0L A;  4JI1 B;  2Q6A A;  1NI8 A;  1S5J A;  2HJF C;  1IDS A;  3W7S A;  3ETQ A;  5B1O A;  4LFA O;  1BL8 A;  3CRC A;  4JI4 B;  3CYO A;  5CBF A;  5TIS Z;  1K7D A;  1H2G A;  1R3L C;  3QO8 A;  2RMK B;  2YDE A;  4TV8 A;  2JIZ G;  2EZP A;  5KAI Z;  3WU2 Z;  2EIJ C;  1NR1 A;  2P7T C;  1QBZ A;  1JJO A;  4AHC A;  1PPJ H;  3CD6 V;  1TUB B;  1FJG B;  1KB9 F;  4R6Z A;  4JI6 B;  4TSF G;  2G38 A;  1Q8I A;  3FAV A;  3ZS8 C;  2WLL A;  2QWP B;  2CGO A;  1N4C A;  3TGU H;  1GN3 A;  4H44 B;  1RPR A;  4LP8 A;  5CMU A;  2UXD B;  4WFG A;  4BWA A;  1Y74 B;  4EFE A;  4DR1 B;  3KKY A;  5CA0 B;  4FMT A;  2LGQ A;  1GM8 A;  5EBW C;  3OTF A;  2UU9 B;  4RWU A;  4MVU A;  1VAR A;  2HJD A;  1YHQ V;  4DV3 B;  2D3O W;  4FM0 A;  3KZI Z;  3ZED A;  3FAV B;  2WLL B;  2R9I A;  4J11 A;  2VWK A;  1WA8 A;  4FFK A;  3H1I H;  5JCO A;  2VWJ A;  1KP3 A;  1IBM B;  1SQB H;  4NTY A;  2EIN C;  2DW4 A;  2VQE B;  3RFR A;  1W0J G;  4I50 A;  3L74 H;  1L1F A;  1F23 A;  3D36 A;  1P84 F;  3CPW U;  3VOU A;  3T4Z A;  2EIN B;  4W4K A;  3ZCC A;  4DV5 B;  1Y67 A;  5KHK A;  2P22 C;  5J2U B;  4YJ2 B;  3B2E E;  1I0H A;  3H1K H;  5KA5 A;  2PY5 A;  1R6T A;  4LNU A;  2P67 A;  2XTA A;  1H8H G;  1FXV A;  3JYC A;  4RUE A;  4FM2 A;  4JI4 O;  5KUK A;  5E1A C;  2ZQM A;  1UJW B;  3LSU A;  2MK3 A;  5CN0 A;  4LH6 A;  2CTP A;  3RYI A;  1KKD A;  4JGS A;  1MA1 A;  1VMG A;  2W6J G;  2PI4 A;  4WF9 V;  1L0L H;  5DED A;  4DV1 B;  2BSK A;  1ZX3 A;  2ODM A;  1VQ9 V;  2FYU H;  3SYO A;  1NS1 A;  4QPJ A;  3CRA A;  3QF7 A;  4I4T B;  3E86 A;  3C90 A;  4GZR B;  3AG4 C;  4O4I A;  1KKC A;  1J5E O;  4GKJ O;  2XAQ A;  4UVA A;  4OPA A;  5JVD A;  4AI8 A;  3I55 V;  1GH6 A;  4FLZ A;  1MZE A;  1NH2 D;  1LUW A;  4KXR A;  4FLT A;  2F66 C;  4YHH B;  1IBK B;  3E8G A;  2P90 A;  1Q86 W;  2QWO B;  4NYK A;  2CTR A;  1SZX A;  2Q5Z A;  4ZKI A;  2IU0 A;  4CZZ A;  4JV5 B;  2XAF A;  4LWS A;  1YXB A;  4JTC B;  3UT5 B;  2JS3 A;  2VQE O;  2Q7H A;  2Y69 B;  3QO5 A;  1BCC H;  4PD4 F;  2ETN A;  1UPG A;  1BZK A;  1WPB A;  2DJV A;  4GCZ A;  5CB4 A;  4JI5 B;  1EN4 A;  3FYE B;  4B3T O;  3LSQ A;  1SC5 B;  3C3S A;  2JDI G;  2UXB O;  3BPZ A;  1O9G A;  4DV5 O;  5CBH A;  1XNQ B;  4CBC A;  5D5Q A;  4TUY A;  2CTW A;  2ZNJ A;  1TUE B;  2DN9 A;  2A7W A;  2R72 A;  3ZRS A;  2LP7 A;  2XOK G;  3FKS G;  4I7Z B;  4FLU A;  4LF7 B;  5LA6 A;  5CB4 B;  3GVM A;  1QR9 A;  4DV6 B;  2F4V O;  1FFX B;  3X2Q B;  4PA9 A;  4DV1 O;  2YXL A;  3CXH F;  2LW1 A;  3GWK C;  4BAY A;  3DGE A;  4F4L A;  2L35 A;  3K5L A;  4IIJ B;  3S3X A;  2OIE A;  4LFC O;  1OJH A;  4AQY O;  1GTO A;  1SA0 B;  4WFF A;  2DQ3 A;  4BR6 A;  1J5E B;  4GKJ B;  1AJQ A;  2RN9 A;  2PF4 E;  4O4J B;  1VF7 A;  3ZBH A;  4F6R A;  1MSW D;  1FXK C;  4JYA B;  5FL7 G;  4DUY O;  1VQO V;  3VQX A;  4DR7 O;  2ZR3 A;  1PD3 A;  1JA8 A;  2BCC H;  1RPO A;  2HKO A;  3ABM B;  5ITZ B;  5IYD O;  3MAQ A;  3CC2 V;  3HKD A;  1KUQ A;  1G4Y B;  1FXH A;  1N32 B;  3ASO B;  1W59 A;  1QLE C;  1PM9 A;  2NN4 A;  2E5L O;  4UXN A;  4DR2 B;  3ABU A;  2DYR C;  3OGC C;  4ZOL A;  1NTK H;  1TA8 A;  3IAY A;  2CGN A;  3BFR A;  4FPP A;  3B8N A;  2AZ0 A;  4DV2 B;  2HHH B;  4O4H A;  2XND G;  4I9Q A;  2O57 A;  4MT8 A;  2JS5 A;  4X64 O;  2EIL B;  4K8Z A;  4WBN A;  2FB5 A;  4MS2 A;  3JAT A;  3APO A;  3ZMZ A;  1G8M A;  1EZJ A;  4R50 A;  4X66 B;  1N36 B;  3KCY A;  1I94 B;  2Z3Y A;  4LF6 O;  1BQZ A;  2UUA O;  4DV6 O;  1NTM H;  5LYJ A;  3EVK A;  4FK5 C;  4B3S B;  4DV4 O;  4DK1 A;  3BEH A;  4X62 B;  2Z0A A;  3AK1 A;  2QJ1 A;  2VRZ A;  3SPC A;  2CE4 A;  1XMO O;  3THO A;  3CP1 A;  4X65 B;  4LF8 O;  4DW0 A;  4WBN B;  2CUG A;  4FM1 A;  1IXM A;  1EBO A;  1QLN A;  1TGO A;  3OTO O;  3E22 A;  2DOS A;  5H6Q A;  4U7O A;  4TV9 A;  3ABK C;  2OT5 A;  1KYO F;  4JYB A;  1AJP A;  2Y4T A;  3CWB H;  3GB7 C;  3RN4 A;  2NNU A;  2GBO A;  1XNR O;  4FFB B;  4YY3 B;  2DE0 X;  3SYC A;  3MDS A;  1PKX A;  4PA7 A;  4ZHQ A;  1N33 O;  1DF4 A;  1XEQ A;  2BOB C;  4WFE A;  3CB2 A;  2IJI A;  1Z2G A;  4NB5 A;  4DR4 B;  5E79 Z;  3TJT A;  4YJ3 A;  5B1B C;  4TQD A;  1KP2 A;  1YVW A;  3T1Y B;  3ETG A;  2GUZ B;  4JYY A;  4X1Y B;  3K5N A;  2AHY A;  3M7M X;  4IGG A;  5LP6 B;  1RFY A;  2IU3 A;  2ZE6 A;  2GHY A;  2DMX A;  3DSQ A;  4F6E A;  3AG7 A;  1YZB A;  1JVM A;  5IWA O;  1NQT A;  4ZI7 B;  2YIB A;  2EIM C;  3NR7 A;  2EIK C;  2P06 A;  3L75 H;  4X66 O;  1GAX A;  1M57 C;  3A0H Z;  2Y4U A;  2OWO A;  4IT5 A;  4YJ3 B;  4LFA B;  1K3E A;  4LF6 B;  3DTU B;  3SGI A;  4D7T A;  3ASO C;  1D2D A;  2CH7 B;  1N0J A;  1K97 A;  3SYQ A;  5IJ9 B;  3RYF A;  1XMO B;  4O2A A;  5B5E Z;  2ZKO A;  3TXS A;  3HB3 B;  3ETD A;  1I08 A;  3IC7 A;  3SYA A;  1Y66 A;  2L6L A;  1MSD A;  3HKE A;  4JTA B;  5FNV B;  4HYO A;  4GKK B;  3L9D A;  4WFH A;  3S3W A;  5C8Y A;  3B77 A;  2Z5U A;  1FPO A;  4MVZ A;  3RW0 A;  4GUN A;  5B1A B;  2JEX A;  1SER A;  2CH7 A;  1KMI Z;  3PJS K;  1HNX B;  4O2B A;  1M57 B;  3MHH C;  5K1P A;  5L3E A;  5IJ9 A;  2Y48 A;  3OMN B;  5J2T B;  3JAL A;  1G6U A;  2QEX V;  5CA1 B;  3BA9 A;  2Y0P A;  4BW9 A;  2QKS A;  3E2E A;  4O4H B;  2A3Q A;  2E76 B;  3TXQ A;  4K8X A;  5JJE B;  4X89 A;  4DUZ O;  4D7S A;  3CMA V;  2HR3 A;  2WPD G;  2X6C A;  4KUM A;  5LL6 Y;  4NR1 A;  3BAA A;  3OR6 C;  3CCQ V;  1YI2 V;  1HNZ B;  2UUC B;  4X1I B;  4W4L A;  4EB6 A;  4GYC B;  4WFB V;  4CH3 A;  1K4D C;  1AI6 A;  1F51 A;  2H8P C;  2HEP A;  1Z5W A;  2Y69 C;  1YIJ V;  4MW8 A;  4QPK A;  4DRX A;  2LQT A;  4LCU C;  3L71 H;  1ORQ C;  4U3J B;  1VQM V;  5IT9 N;  4MTG A;  3K58 A;  2GTS A;  3E22 B;  1B6Q A;  2VS0 A;  1TUB A;  1SQG A;  1Q43 A;  2F23 A;  2ZT9 B;  2YEV A;  4UCU A;  2Q4P A;  2RNB A;  4J42 A;  4I55 A;  5J9P C;  4X20 B;  3BY6 A;  4NXN O;  3CME V;  2OTL V;  1VF6 C;  5CA0 A;  1XMQ B;  4YIO A;  3OEH G;  4MTO A;  2W0X A;  3RYH A;  2K9P A;  2Y0I A;  4CH4 A;  2Q0O C;  4X9Q A;  1FKA O;  5BZB A;  1NZ6 A;  2EZO A;  1Q6H A;  1GKF A;  3P3P A;  4UCV A;  5B1A C;  4MTX A;  4YXW G;  3F7V C;  2GUZ A;  2Q0A A;  1SES A;  5FPR A;  1Q6U A;  3JAS A;  1B04 A;  1BGY H;  4ICG A;  1XHX A;  3N27 A;  1WN7 A;  1ZTE A;  4I50 B;  2B5U A;  3OGI B;  1SRY A;  1COW G;  4JYC A;  1NJI W;  3KCX A;  2UUC O;  2QTO A;  5FPO A;  4HNA B;  1XNQ O;  1M93 A;  4DR3 B;  4BW5 A;  4P9P A;  5J2U A;  4YJ2 A;  3K59 A;  3FB5 C;  3JAS B;  5A2Q N;  2FML A;  4ZIB A;  5HFL A;  2EJR A;  4FZ0 A;  2N05 A;  5KX5 A;  2W6I G;  3QG5 A;  1W2B U;  2EIK B;  5HFM A;  4O2A B;  1M90 W;  1OCC C;  4CS2 A;  1K73 W;  5D5P A;  3F5W C;  1IUR A;  1MG1 A;  2F4V B;  3Q4H B;  3HKE B;  5JJJ B;  4JAA A;  1Q6I A;  5IYZ A;  2Q7E A;  5C93 A;  5C8Y B;  2BSK B;  4CC6 A; 
#chains in the Genus database with same CATH homology
 2OCH A;  2Y4T A;  3APQ A;  3UO3 A;  2CTQ A;  3UO2 A;  2CTW A;  2LGW A;  2N05 A;  3UCS C;  1HDJ A;  1GH6 A;  4J80 A;  3APO A;  1WJZ A;  2GUZ B;  1BQ0 A;  2DN9 A;  2QWR B;  1NZ6 A;  2Y4U A;  4RWU A;  2YUA A;  4J7Z A;  4IT5 A;  2CUG A;  2QWO B;  2LO1 A;  2L6L A;  2EJ7 A;  2GUZ A;  2QSA A;  2CTR A;  2QWP B;  1N4C A;  2N04 A;  1BQZ A;  1IUR A;  2DMX A;  1FPO A;  2KQX A;  2CTP A;  1XBL A;  2QWN B;  2M6Y A;  2PF4 E;  3AG7 A;  1FAF A;  2YS8 A;  3BVO A;  2QWQ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...