2CTWA

Solution structure of j-domain from mouse dnaj subfamily c menber 5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
GSSGSSGRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 5
publication title Solution structure of J-domain from mouse DnaJ subfamily C menber 5
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 21
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctwA00
2CTWA 2CUGA 1FPOA 2Y4UA 2GUZB 2YUAA 4IT5A 4J80A 1FAFA 4RWUA 3AG7A 1HDJA 3UO2A 2KQXA 2QSAA 3UCSC 1BQZA 1GH6A 2CTQA 2N05A 1BQ0A 2QWNB 2L6LA 2DN9A 2PF4E 2DMXA 2Y4TA 1N4CA 1WJZA 4J7ZA 2N04A 3APOA 1XBLA 2QWPB 2QWRB 1IURA 2GUZA 2LO1A 2M6YA 3BVOA 2CTPA 2EJ7A 3UO3A 1NZ6A 2CTRA 2OCHA 2YS8A 2LGWA 2QWOB 2QWQB 3APQA
chains in the Genus database with same CATH superfamily
4G2KA 5LGUA 3W7UA 5JQGB 3OTFA 4FFBA 2Y4UA 5ITZB 4PA3A 1PM9A 1URFA 3OT7A 1MZFA 4BWAA 4MVRA 4LFAB 1RM1B 5FPRA 1K9MW 4TT3G 4PI2A 3O65A 4NTYA 3R66A 1XMQO 4LR3A 2OYQA 1IBKO 3FB6C 1S5JA 2JS3A 3JARA 2A79B 4ZHQA 4EKWA 1LUVA 3K08A 1SQFA 4JPRA 4D7SA 2O57A 2X6BA 4WFGA 4K35A 3AG4B 2F43G 4JAAA 2UU9O 2P06A 3H9VA 3K9SA 4RQFA 1R3KC 2OTJV 2QE7G 4AQYO 3DGEA 5ITZA 3I5DA 3K5MA 2HR3A 1SESA 2PUSA 2CTPA 3K5LA 1VQ4V 3DTUB 1SQQH 1AJPA 3AG3C 5LYJA 2WLNA 4NTWA 1K7DA 5IYCO 1NI8A 5EBMC 2ZIOA 3RWRD 2GTSA 4J9YB 4TV9A 3ZHSA 4RQEA 3TETA 4B3TO 1RFYA 1OCRC 1NTKH 3M99B 5B3SB 4GKJO 2EIMC 1V55C 4NXNO 2ZNIA 4B7EA 3VQVA 3CCEV 1B06A 1RPRA 1E1QG 5EK0A 1Q86W 1JJ2U 2BOCC 1R3JC 1X59A 2XAHA 1LUWA 4YIPA 3DSQA 4DV2O 4IIJA 3RYCB 4WFHA 4PA7A 2UXBO 2UU9B 1PPJH 3GWOA 1Y76B 1IBLB 2LGQA 1OCCC 1JVMA 3OM3B 3E8GA 5JH7B 4TOIA 3CD6V 4QJFB 3BFRA 1CP9A 4HBNA 1Q6HA 1Y74A 3TXSA 1OHHG 4UXNA 3JASB 1M4UA 3E22A 5J2TA 1IBMB 4FLYA 1JOYA 1CPYA 1N8RW 4E2LA 1Q5OA 3E83A 3ZHQA 2HKOA 3FB8C 1TAEA 2PF4E 4QIWF 4I7ZB 4DV2B 2LW1A 4PI0A 1VP7A 3W7TA 1IDSA 1P84F 2UXBB 1I08A 2Q4PA 4X65B 3JD2A 2QWQB 4BIOA 1H8HG 3CCMV 4O2AA 4X62O 1YSCA 3JASA 3SPHA 5J2UB 4CC6A 1NR7A 2ETNA 2DW4A 2XASA 3AEIA 4MW3A 4LF8B 4EB6B 4KP4A 3ABTA 5CMUA 5IT9N 1XNRB 3L70H 1GRJA 5BMVB 1K3EA 4RWUA 3AG2B 4OX9O 3JD4A 2VWJA 2PGGA 4LF6B 5GTIZ 2QTSA 1NU1H 1P7BA 1L1FA 5LL6Y 3ABMB 1SERA 3UO3A 2A0LA 3SJBC 1S5HC 3CYOA 4GLXA 2YXYA 1QLNA 1V54B 2BE3A 4EB6A 5LHGA 2F4VO 4JZ2A 1AI5A 4DUYB 4FLTA 4FK5C 4UFZA 3HKCA 3PN1A 1J5EO 1NBMG 4MVSA 4F6RA 1QR8A 5LHHA 2ZNJA 3B2EE 4ZI7A 4F6EA 1R6KA 2RCVA 4DYLA 3H1JH 2QM7A 1NTZH 3SGIA 4GKKO 1KBHA 1AR4A 4JTDB 1SQPH 5IDJA 2CAZC 1MZEA 3U11A 1B04A 1V9PA 3CJHA 3OUFA 1UPGA 4JI0O 1I5YA 1BGYH 1WAZA 1PNKA 1IURA 3CCQV 4DV4O 1KQSU 2WLMA 4I55B 1M5IA 5LP6B 5IYDO 3EFFK 2HVJC 2WLLB 1AJQA 4OPAA 5HFLA 1XL4A 1HR0B 1WPBA 4MVMA 2VRZA 1E79G 4KL1A 4B08A 3JSNA 2F4VB 1SZTA 1YTFD 2OT5A 3QG5A 4TQDA 5LOVA 2WA3A 1XUQA 4LBEC 3DC5A 3K04A 1Q3EA 5JCOC 2CE4A 2NLJC 1J5EB 3RVZA 4LF5O 1NH2D 5KHGA 4B3MO 2N74A 3J80N 2LFRA 4LF9O 2Q69A 1SF9A 1M90W 2AXTZ 2BTOA 3KG2A 5L3DA 4CS2A 4ZKIA 2NNUA 4X20A 2WLLA 3QTCA 4U3JB 2EIKC 2UUAB 1R1BA 4FLXA 3ZMTA 4JI0B 4P30A 4ZIBA 3JD0A 1S76D 2WA4A 5GONB 1VQPV 2R72A 3T4ZA 4U7OA 2FKXA 4DK1A 1Y6XA 1HNWO 3CE2A 1QNMA 1HDJA 2D3OW 3GWKC 1Q6UA 4J11A 1QVGU 1BT8A 3IC9A 4O4JA 4JI1B 2PYLA 5CB4B 4MS2A 1O9HA 4O4IB 3RGBA 1CEZA 3JALA 2FMLA 1OCOC 1YXBA 4LH6A 4KFMA 4LNUB 4IT5A 1Y4MA 1FFTB 4UB8Z 1AROP 4B3MB 1GMGA 4PJ0Z 3B8MA 1NS1A 2N05A 2PI5A 4RO2A 3JAWA 3CEIA 1EFRG 4HAMA 3CMAV 3SR2C 2QWPB 4CS4A 4JYCA 4O4HB 5KHHA 3WU2Z 2UXDB 4B7KA 2B1GA 1MSWD 2IJKA 2ZKOA 4FMTA 1YHQV 4O4LA 1BHBA 1VQLV 3ZRWA 2QSAA 2W0XA 4ABMA 1Q82W 1G4YB 3K59A 1WLEA 1XL6A 2UUCB 3L72H 1VQ5V 5IYZA 3MHSC 3SJQC 2ODMA 1AILA 3HPLC 5BR8O 3T2MA 5TISZ 5H2FZ 1AI7A 1KECA 2WLIB 3A0RA 1WA8B 3RW0A 5BXZA 2VWKA 4DR4B 2FB5A 5EC1C 2Q5ZA 1GKFA 4PA9A 3K79A 3ZIAG 2M6YA 4DR7O 2IJIA 4I9WA 5KMGA 1ROPA 2CTRA 5FPOA 3APQA 4MVOA 2XAGA 2ILMA 2EBOA 3RYFA 5B3SC 4FPPA 1HWYA 4K0KO 3M8AA 1XHXA 2LQTA 4DR5O 4E4EA 4R50A 1FFXB 4X1YA 1KKDA 1M57B 2YI9A 2WLIA 2QWRB 2P22C 1VQNV 4DV3O 2F95B 2MW2B 4TUYA 2QWOB 2Z0AA 3ASOB 1XILA 2P7TC 2NN4A 1W0JG 2QDOA 5JJNB 4DV0O 1RPOA 5BR8B 2EIJC 2KSDA 5LA6B 3OEEG 3T1HO 1N4CA 3OAAG 3ABUA 3KCYA 3P32A 5IY5C 1FXKB 1VQMV 1Z5VA 4LF4O 1JA8A 3P30A 2JIZG 1FD9A 4DR7B 2AW9A 1QR9A 2YXLA 3MHHC 3SPCA 1SA0B 1LR1A 5CBFA 3HB3B 1XNQO 2X0LA 2V1DA 2QJ1A 2HEPA 1N34B 4NKGB 4DR1O 4DR5B 2OTLV 2GUZA 1B3QA 2P6JA 1PD3A 1TUBB 5H5NA 4IHJA 1ZL8A 2LP7A 3U0ZA 2HHHB 4UVBA 4DV3B 4GX0A 4PDVA 2Q7EA 3CCLV 1M93A 3CRQA 3K0DA 4H44B 5L3FA 2UXCO 1Q81W 4Z1VA 2B9ZA 1AI6A 2DYSC 1Q43A 4DV1B 4NR1A 1J95A 4DV0B 1VF7A 3JATB 2QGNA 5C8YA 4JV5B 4UVAA 4MT8A 3D3IA 3LSUA 4UCVA 4JTCB 3HKBB 1GN2A 5B1NA 2RDCA 3ZJZA 3G71V 1WN7A 1MABG 3ZRXA 2F66C 1H2GA 1KB9F 3L73H 4JI3B 2ZE7A 3C3SA 1ZX3A 1XNQB 2YIDA 3SYQA 1Q90D 4JI2B 5E1AC 4DR1B 2L35A 4Q6GA 3M7MX 2IH3C 3MAQA 1YDXA 4GUNA 1AR1B 2UXCB 4O2BA 4PDLA 5EBLC 3KZIZ 3ZHRA 4JYAO 1V54C 2JEXA 5J9PC 2JVDA 2WPDG 2XUMA 3ML0A 2WLKA 4BIUA 3FAVB 4ZOLB 5IJ9A 3AK2A 2Y69B 1FS0G 4J9ZB 3TCUA 5GTHZ 1NTMH 3OR6C 3LUTB 4L87A 5JQGA 1IBLO 1K4DC 5DM6V 3CCJV 3CCUV 1X4TA 2Q7HA 2YC0A 4FZ0A 3TXQA 4GX1A 2Z5UA 1XMOB 3ZBHA 1O9GA 2Y0IA 1W0KG 4CH3A 3T1CA 2YDEA 2JGDB 3ZEDA 2R9RB 1IBMO 2Q73A 1XOUA 4QPJA 5LP6C 5LGNA 2C2AA 3CB2A 1XREA 2LGWA 3KCXA 4YY3B 4JYAB 2YXHA 3FX7A 4H33A 4D7TA 1K92A 2DWEC 4I50B 1PNMA 3GB7C 3ETDA 3VOUA 3ZMVA 3X2QB 2CGNA 2HLDG 2PYJA 5JJJB 1YTFB 4OXSA 4X65O 5L3CA 3BCCH 1M56C 4HNAB 4FIPC 5KHJA 1BCCH 2Q8VA 4J7ZA 3TK1A 2ZDIC 3AG1B 3LDDA 3NR7A 1GM8A 2LFSA 1VARA 4X1KB 4DR3B 2YUAA 1NH2B 2EINB 2XAFA 1P4RA 1SKVA 4WFAV 4LF8O 2IU3A 2MK3A 3F5WC 1BS3A 1XNRO 1NZ6A 3RYCA 2E5LB 1ZUQA 3OGIB 1OV9A 1Z5WA 4X64B 1F4NA 4FJCC 4J41A 3PJSK 1K4CC 2H3OA 1H2MA 3UQ8A 4LF6O 1XEQA 1Y76A 4GZRB 4KXRA 1D2DA 3L75H 5L3GA 5B1BB 2N04A 4X8AA 4A5UB 3H1IH 5JH7A 1VF6A 3JCZA 3ZCCA 1SQGA 2BSKB 4LWSB 1IXMA 4QE7A 4JF3A 4DUYO 1Q6IA 4JGSA 3UKMA 2DYRB 1M9NA 4I0XB 4MSWC 2ZM6B 1JMKC 1A32A 2YIBA 1JCHA 3OFNG 3K5NA 4K8ZA 4H0LB 1VQ8V 2JGUA 3CCVV 5EBWC 2JJ1G 2EJRA 1R3IC 4H37A 4JYYA 1YI2V 2IM9A 1HNZB 5CA0B 4TSFG 3C90A 1GAXA 5FNVB 3ABKC 1QLEC 2Y4TA 1PL0A 4DR6B 2LW7A 2JDIG 4YJ3B 2FL4A 1P49A 3RYHB 3OEHG 1SETA 4NXMO 5J2UA 3CC7V 3JD1A 1HR0O 2VQEB 2V4DA 3ZHUA 2W6JG 4FM2A 2QR4A 1MG1A 3BA8A 1TVKB 1ZWIC 5B1OA 1EBOA 1N0NA 3BEHA 2FYUH 3BHPA 5BMVA 2YIAA 1TUEB 3FYIB 2ZINA 3T1YB 2XAJA 2ZXWB 1M57C 2XT9A 3H1LH 2QM4A 5KX5B 2QWNB 2UUAO 1JFFB 1L0NH 5KA6A 1I94O 5KLVH 3Q4HB 3ASOC 1COWG 1IX9A 1BHAA 4DRXB 5JVDB 5L3BA 3CC4V 4DV6O 4XDLA 4PA6A 1PKXA 1ZSPA 4NXMB 2HVKC 3HR0A 5IWAB 3JSLA 4J80A 4WBNB 3JAKB 3G67A 4UV9A 1S3JA 5DECA 3ABLB 4KUMA 4JI1O 5F2VO 1OCRB 2EIMB 1V55B 3ZMZA 3F7YC 1FXKC 4CZZA 1BMFG 5CN0A 1WPXA 2ZE5A 4R7CA 2OCHA 3CHXA 2ZIMA 3CRMA 2IH1C 4R8CA 1Y67A 4L8JA 1FJGB 4DRXA 3SJAC 3FYEB 3RYIB 4I55A 2CH7B 3CC2V 3ETGA 3IGAC 5LP6A 3G80A 2V7QG 1YJ9V 3G4SV 2UXDO 3BY6A 5B1AC 3BVOA 1IZ3A 1GN4A 5H6QA 1I94B 2KG7B 3ASNB 1FYJA 2P5OA 1OCCB 4DO2A 4LFCO 3F7VC 4DV6B 1YITV 3L74H 2UUCO 3QO8A 4GCZA 1OCZB 4P2ZA 4TWKA 2XTAA 2ZDIA 2AZ0A 1N36B 3IJ4A 4UCOA 4DW0A 3LNNA 2YIBD 1W59A 2VQFO 3QVNA 3VQXA 4U3JA 2RNBA 1DTOA 3A0HZ 3B40A 4DR4O 1KD1W 4QPKA 2B5UA 3I56V 1TGOA 4IYHA 4XDJA 4LC1A 5GONA 1N33B 3RBZA 4DR2B 3TGUH 3OMNB 2LJ2A 1F51A 1FXVA 4FLWA 5CB4A 1RM1C 2E75B 2H94A 4O4IA 1GK9A 4LFCB 5LXTB 2G38A 3VQWA 4XBFA 4LNUA 2ZCEA 3HKDB 4YJ2B 4JI8B 4WFBV 3C3TA 4PHZA 3HKEB 3AG4C 2VQFB 4O4HA 3E89A 4FFKA 3MDSA 3EVKA 2IJHA 4N21A 1SZXA 1BQ0A 2DN9A 2H8PC 4UVCA 3CCSV 3K06A 5EIBC 1ENVA 4BW9A 4TV8B 5IJ0B 4UCUA 5GW7A 4DXWA 5LXTA 3ZRVA 2JRIA 3B09A 1W2BU 1FPOA 1BZKA 4QE9A 1EZVH 1ORQC 1VQKV 1YVWA 3UM7A 1K33A 2IBZH 1N34O 4LCUC 4J42A 2PTMA 5KHKA 3CPWU 1CXZB 3W7SA 2ZR3A 3JD3A 2OIEA 2HHHO 1TA8A 2Q0OC 2X6AA 4BW5A 2EZPA 1WA8A 2QKSA 2YS8A 2ITCC 3D36C 1WP7A 2GSMB 1HNXB 1BSMA 2OWOA 4DV1O 3FD9A 3UO2A 1IXBA 1WNSA 2VS0A 4AHCA 2ATKC 1YZBA 3ZN0A 4JV5O 5B66Z 5EYPB 3AG1C 2XAQA 3DXRB 1DGSA 4DUZO 5DN6G 1I5XA 1FFXA 3JAMN 1NR1A 1WP8A 1PV0A 1VF6C 1WB7A 3QO7A 3CRRA 2GHYA 1YF2A 4Q20A 1NVPD 4JI3O 5EZYB 2ZT9B 3EXAA 3N27A 1KUQA 2B1IA 3E8FA 3FFQA 1VQ9V 4JI2O 1RSOB 3L71H 5LGTA 3UT5B 5H6RA 5LA6A 2DQ3A 2OCCB 1K5QA 2EILB 4HZ3A 2UXNA 1JJOA 5K1PA 4IYIA 5KA5A 4UUJC 1FXKA 1JPXA 5HFMA 3IC7A 1ZLZA 1K34A 4OGQB 3FKSG 1SA0A 1UFIA 3E8BA 4QNHB 2EIKB 2HFEC 5JWPA 3KKYA 4FZ1A 2Q67A 1GM7A 3RT3C 3I55V 1DF4A 4DUZB 4JAUA 5A2QN 1TUBA 2JEUA 1EN5A 3H1KH 2AGAA 2BCCH 4FFBB 3K9AA 2CK3G 2GTAA 1H2SB 4GX2A 1NJIW 5IE9A 1B6QA 4YHHB 1KMIZ 3BRCA 5LMNO 1XMOO 3K57A 3ZHTA 3FB5C 1SQBH 4OPHA 5C93A 4KHPO 3AG2C 1PP9H 3OW2U 3WB1A 4B3SB 3ZN1A 1OCOB 3JATA 3OD4A 4J7KA 1F23A 1DF5A 3JARB 2W6IG 2EX3A 1MOFA 2GBOA 3B8NA 3ABMC 1EZJA 1GN6A 1H8EG 1H38A 2Q0AA 3HKBA 2F93B 1MNGA 2HG5C 3JYCA 3CRAA 4YY3O 3WFVA 2Q9LA 4JI4B 1Q8IA 3N2KB 2K1EA 1FAFA 1U97A 1AVMA 4NYKA 4WFEA 1FXHA 2JS5A 2M7WA 5LYJB 4LF7B 4JYBA 3K3WA 1NT2B 1ZTEA 3CXCU 4TV9B 1MSDA 3P3PA 2WSSG 2PI4A 2QM8A 4DR3O 2ADPA 2ZXWC 5LBQA 1XHZA 4B3RO 3STZC 1F4MA 5LMNB 1IVSA 4Z1MG 4KHPB 2X6CA 2KB1A 1BQZA 5E79Z 4JI5O 2L6LA 1AP6A 2JK5C 3N2KA 3W7XA 3JCUZ 2E5LO 5H9CA 3FAVA 4ZOLA 4IIJB 4X64O 1PL4A 2UUBB 5FLXN 3TJTA 3BA9A 1SC5B 3G6EV 4RUEA 1E1RG 1KP2A 1RP3B 3ABLC 3W7WA 4F4LA 5IYBO 2ITDC 5KUMA 4CBCA 1BE3H 1EN4A 4FLZA 5K1XA 3J81N 2Z3YA 3SPJA 1XMQB 1IBKB 2R9IA 3WB0A 2QKAA 2WLJA 3OMIB 2JGDA 3S3XA 1Y74B 2Q7GA 1GTOA 5LHIA 3RVYA 1G1XB 4B3RB 4PDMA 3E22B 2ZQMA 2P4VA 4DW1A 2CGOA 5J2TB 2ZM6O 3UCSC 4PELA 4X88A 4CC5A 4J10A 2EIJB 3D36A 4P9PA 3U10A 4JI5B 3ASNC 4AQYB 3CWBH 4I50A 5IY5B 2PY5A 1ZAUA 1YIJV 2ZE8A 1HNZO 2WAMA 3K5OA 2FTKA 4QGPA 3WG7B 4HNAA 1OCZC 2DJVA 4J7JA 4H13B 4DR6O 1KC8W 3THOA 1S5LZ 2CTQA 4LP8A 1AI4A 4UB6Z 4O2AB 3SPIA 4B3TB 3O9OA 4GKJB 4X1KA 3A2FA 4NXNB 3ZS8C 4C7UA 3P3NA 2DE0X 2VQEO 1M1KW 1R6TA 1AR5A 3BAAA 3LSQA 5EC2C 4JTAB 4GYCB 4EEQA 4GX5A 3RN4A 1GH6A 2DYSB 4FVMA 1S72V 4MVQA 1SRYA 1G6UA 2E76B 3WB2A 1VMGA 4U7NA 3OE7G 3T1YO 2D2CB 3SJCC 2Y0PA 4ICGA 1K97A 4G28B 2PZSA 3IFXA 1WB8A 2BSKA 1JQ0A 3S3WA 4LWSA 5FL7G 2RN9A 1AJNA 3MD0A 1YJWV 5IWAO 3E2EA 3BABA 1EM1A 3ETEA 3HKCB 4I0XA 3OMAB 3ZX6A 4F6RB 2DWDC 4YIOA 1N32O 2EULA 3NXSA 3ZMUA 3SYPA 4ZI7B 1NQTA 3QF7A 2EZOA 2DQ0A 1QHTA 1P7GA 2IU0A 5CA0A 4GT1A 5FNVA 4JI7O 3CJHB 1UJWB 5BY1A 1FJGO 1YEWA 2NR5A 1KU9A 4YJ3A 3RYHA 4X62B 5KUKA 4MTOA 1KYOF 1I0HA 4BAYA 2BOBC 3B4SA 5EIBD 2BTQB 1TVKA 4UCSA 4FLVA 4UCTA 3VBBA 2IW5A 3AK3A 5CBHA 2YSUB 4TQFA 5LOVB 3AG3B 4FM0A 4ASUG 1SS3A 5KAIZ 2RMKB 4CH6A 2QTOA 2ZE6A 4OX9B 2DMXA 1N36O 2HJFC 1N32B 1H2NA 1GN3A 3OUSA 1LNQA 2IJJA 2KKWA 5KX5A 4X20B 1JFFA 1K5SA 1L0LH 1YJNV 2BTQA 3E86A 3Q4HA 5LMUO 4JI7B 5JVDA 3K58A 1N33O 3B77A 1L8DA 1NVPB 4DR2O 2ZD9A 3CS5A 4I4TB 4PDRA 2E3CA 1KP3A 2LO1A 2UXXA 4WBNA 3QO5A 1US6A 2OCCC 3CCRV 3JAKA 4U3FH 2EILC 3E8HA 3OGCC 1M56B 1QQCA 3SDLA 3IAYA 2K9PA 5A9GA 5JJEB 4O4JB 4LFBO 3CP1A 1G8MA 3JALB 3CSXA 3T4DA 4GKKB 2QKCA 3K03A 4UV8A 2AHYA 2RJZA 1N0JA 4K8XA 4JI8O 4R6ZA 4IL6Z 3RYIA 1DLBA 4DV4B 3GVMA 2CH7A 3JAWB 2ARHA 4I4TA 2HJDA 5KHIA 3ETQA 4JASA 1XDCA 2A9HA 2Q68A 2E74B 3AG7A 4MTXA 3FB7C 3VQYA 5CBGA 4D6TH 1JR9A 5L3EA 4W4KA 2KG7A 2HP8A 5LMUB 2ZR2A 2RQ6A 3APOA 1PNLA 4O4LB 3ZMSA 3CXHF 3ZRWB 3BPZA 1D5NA 1QU7A 2P4KA 4NB5A 4AI8A 4LF5B 1OJHA 3N2GB 3H1HH 4LF9B 5IYZB 3E35A 2R70A 4WFFA 4LFBB 1F7YA 3L9DA 4UCRA 1XBLA 3AK1A 2R9AA 1GM9A 5KAFZ 3LDEA 1HNXO 4X66O 2GDSA 4YXWG 5CA1B 1SQVH 1H2LA 1XQ8A 3SPGA 3J7AU 3OR7C 4WF9V 3QNEA 4X1IB 1HP8A 2Y69C 2Y48A 1BL8A 4DV5O 3OTOO 2JJ2G 1Z2GA 3H01A 5KMGB 1MA1A 2A3QA 4CH5A 1HNWB 1VQ6V 1HW7A 1R73A 3ABKB 4G27B 2P90A 1QLEB 2Q6AA 3RYFB 2A06H 3N2GA 5B5EZ 3D3QA 4XDKA 2EJ7A 5DEDA 1K73W 4CH4A 2XNDG 4X1YB 4Z2WA 1DK1A 2WLHA 1QBZA 3EHBB 4PA4A 2AZ2A 1R6NA 1QVFU 1FKAO 3HKDA 1YCIA 5CA1A 4YJ2A 4TUYB 1VIBA 3HKEA 4X1IA 4WCEV 2YI8A 3A8TA 2DOSA 1VF5B 1T5EA 1S0VA 1D5AA 4JZGA 4X66B 4RUFA 4JI6O 3CX5F 4I5SA 5IJ0A 4TV8A 3X2QC 4MVZA 5D5QA 4DV5B 3OTOB 4PD4F 1AB3A 4X89A 5BZBA 2X7RB 4CS3A 4X9QA 1KKCA 4AILC 2CTWA 5D5PA 2EINC 1I7FA 2GUZB 1QCEA 2P67A 4IHJB 1NKDA 1ZL8B 1VQ7V 3DC6A 2ADQB 4DV7O 1JX9A 4YHHO 4MTFA 2WWWA 2GV9A 3ICXA 4FLUA 3R65A 3D8CA 3LSSA 4B3SO 4NTXA 3WG7C 2XOKG 3CMEV 3CRCA 5EYPA 3STLC 3DXRA 5C8YB 2KQXA 4JI6B 4PV1B 1VQOV 5B1BC 4K0KB 3ZHVA 4ZBMA 4MTGA 4W4LA 3SYAA 4HYOA 3LDCA 2YEVB 4JI4O 5B1AB 1OZ0A 5EZYA 3K0GA 3SYOA 1R3LC 5CA3A 2CUGA 2YICA 4LFAO 4LF7O 1RSOA 2DYRC 2A7WA 1MMMA 3RFRA 3UT5A 4DK0A 4JAVA 5JCOA 2QA4V 1THZA 2XHBA 4RAIA 4IGGA 1S77D 2QEXV 1WJZA 1K8AW 3A0BZ 4LH7A 4MW8A 5AG2A 3T1HB 4EFEA 4BR6A 2F1MA 4DV7B 4O2BB 3F5TA 3SYCA 2CDYA 3G6BA 4LF4B 1H2KA 2OIGA 4NVPA 2YEVA 4P9OA 3LNMB 1AP5A 1Y66A 4MVUA 1SQXH 4N23A 1GO3F 1U96A 1EN6A 4ZHQB 4BIZA 2F23A 4I9QA 3ZRSA 4K3AA 4EFBA 2UUBO 1XI1A 5IJ9B 1VEWA 2W0FC 1Q7YW 2AHZA 4FM1A
chains in the Genus database with same CATH topology
2CTWA 2CUGA 1FPOA 2Y4UA 2GUZB 2YUAA 4IT5A 4J80A 1FAFA 4RWUA 3AG7A 1HDJA 3UO2A 2KQXA 2QSAA 3UCSC 1BQZA 1GH6A 2CTQA 2N05A 1BQ0A 2QWNB 2L6LA 2DN9A 2PF4E 2DMXA 2Y4TA 1N4CA 1WJZA 4J7ZA 2N04A 3APOA 1XBLA 2QWPB 2QWRB 1IURA 2GUZA 2LO1A 2M6YA 3BVOA 2CTPA 2EJ7A 3UO3A 1NZ6A 2CTRA 2OCHA 2YS8A 2LGWA 2QWOB 2QWQB 3APQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CTW A;  2CUG A;  1FPO A;  2Y4U A;  2GUZ B;  2YUA A;  4IT5 A;  4J80 A;  1FAF A;  4RWU A;  3AG7 A;  1HDJ A;  3UO2 A;  2KQX A;  2QSA A;  3UCS C;  1BQZ A;  1GH6 A;  2CTQ A;  2N05 A;  1BQ0 A;  2QWN B;  2L6L A;  2DN9 A;  2PF4 E;  2DMX A;  2Y4T A;  1N4C A;  1WJZ A;  4J7Z A;  2N04 A;  3APO A;  1XBL A;  2QWP B;  2QWR B;  1IUR A;  2GUZ A;  2LO1 A;  2M6Y A;  3BVO A;  2CTP A;  2EJ7 A;  3UO3 A;  1NZ6 A;  2CTR A;  2OCH A;  2YS8 A;  2LGW A;  2QWO B;  2QWQ B;  3APQ A; 
#chains in the Genus database with same CATH topology
 4G2K A;  5LGU A;  3W7U A;  5JQG B;  3OTF A;  4FFB A;  2Y4U A;  5ITZ B;  4PA3 A;  1PM9 A;  1URF A;  3OT7 A;  1MZF A;  4BWA A;  4MVR A;  4LFA B;  1RM1 B;  5FPR A;  1K9M W;  4TT3 G;  4PI2 A;  3O65 A;  4NTY A;  3R66 A;  1XMQ O;  4LR3 A;  2OYQ A;  1IBK O;  3FB6 C;  1S5J A;  2JS3 A;  3JAR A;  2A79 B;  4ZHQ A;  4EKW A;  1LUV A;  3K08 A;  1SQF A;  4JPR A;  4D7S A;  2O57 A;  2X6B A;  4WFG A;  4K35 A;  3AG4 B;  2F43 G;  4JAA A;  2UU9 O;  2P06 A;  3H9V A;  3K9S A;  4RQF A;  1R3K C;  2OTJ V;  2QE7 G;  4AQY O;  3DGE A;  5ITZ A;  3I5D A;  3K5M A;  2HR3 A;  1SES A;  2PUS A;  2CTP A;  3K5L A;  1VQ4 V;  3DTU B;  1SQQ H;  1AJP A;  3AG3 C;  5LYJ A;  2WLN A;  4NTW A;  1K7D A;  5IYC O;  1NI8 A;  5EBM C;  2ZIO A;  3RWR D;  2GTS A;  4J9Y B;  4TV9 A;  3ZHS A;  4RQE A;  3TET A;  4B3T O;  1RFY A;  1OCR C;  1NTK H;  3M99 B;  5B3S B;  4GKJ O;  2EIM C;  1V55 C;  4NXN O;  2ZNI A;  4B7E A;  3VQV A;  3CCE V;  1B06 A;  1RPR A;  1E1Q G;  5EK0 A;  1Q86 W;  1JJ2 U;  2BOC C;  1R3J C;  1X59 A;  2XAH A;  1LUW A;  4YIP A;  3DSQ A;  4DV2 O;  4IIJ A;  3RYC B;  4WFH A;  4PA7 A;  2UXB O;  2UU9 B;  1PPJ H;  3GWO A;  1Y76 B;  1IBL B;  2LGQ A;  1OCC C;  1JVM A;  3OM3 B;  3E8G A;  5JH7 B;  4TOI A;  3CD6 V;  4QJF B;  3BFR A;  1CP9 A;  4HBN A;  1Q6H A;  1Y74 A;  3TXS A;  1OHH G;  4UXN A;  3JAS B;  1M4U A;  3E22 A;  5J2T A;  1IBM B;  4FLY A;  1JOY A;  1CPY A;  1N8R W;  4E2L A;  1Q5O A;  3E83 A;  3ZHQ A;  2HKO A;  3FB8 C;  1TAE A;  2PF4 E;  4QIW F;  4I7Z B;  4DV2 B;  2LW1 A;  4PI0 A;  1VP7 A;  3W7T A;  1IDS A;  1P84 F;  2UXB B;  1I08 A;  2Q4P A;  4X65 B;  3JD2 A;  2QWQ B;  4BIO A;  1H8H G;  3CCM V;  4O2A A;  4X62 O;  1YSC A;  3JAS A;  3SPH A;  5J2U B;  4CC6 A;  1NR7 A;  2ETN A;  2DW4 A;  2XAS A;  3AEI A;  4MW3 A;  4LF8 B;  4EB6 B;  4KP4 A;  3ABT A;  5CMU A;  5IT9 N;  1XNR B;  3L70 H;  1GRJ A;  5BMV B;  1K3E A;  4RWU A;  3AG2 B;  4OX9 O;  3JD4 A;  2VWJ A;  2PGG A;  4LF6 B;  5GTI Z;  2QTS A;  1NU1 H;  1P7B A;  1L1F A;  5LL6 Y;  3ABM B;  1SER A;  3UO3 A;  2A0L A;  3SJB C;  1S5H C;  3CYO A;  4GLX A;  2YXY A;  1QLN A;  1V54 B;  2BE3 A;  4EB6 A;  5LHG A;  2F4V O;  4JZ2 A;  1AI5 A;  4DUY B;  4FLT A;  4FK5 C;  4UFZ A;  3HKC A;  3PN1 A;  1J5E O;  1NBM G;  4MVS A;  4F6R A;  1QR8 A;  5LHH A;  2ZNJ A;  3B2E E;  4ZI7 A;  4F6E A;  1R6K A;  2RCV A;  4DYL A;  3H1J H;  2QM7 A;  1NTZ H;  3SGI A;  4GKK O;  1KBH A;  1AR4 A;  4JTD B;  1SQP H;  5IDJ A;  2CAZ C;  1MZE A;  3U11 A;  1B04 A;  1V9P A;  3CJH A;  3OUF A;  1UPG A;  4JI0 O;  1I5Y A;  1BGY H;  1WAZ A;  1PNK A;  1IUR A;  3CCQ V;  4DV4 O;  1KQS U;  2WLM A;  4I55 B;  1M5I A;  5LP6 B;  5IYD O;  3EFF K;  2HVJ C;  2WLL B;  1AJQ A;  4OPA A;  5HFL A;  1XL4 A;  1HR0 B;  1WPB A;  4MVM A;  2VRZ A;  1E79 G;  4KL1 A;  4B08 A;  3JSN A;  2F4V B;  1SZT A;  1YTF D;  2OT5 A;  3QG5 A;  4TQD A;  5LOV A;  2WA3 A;  1XUQ A;  4LBE C;  3DC5 A;  3K04 A;  1Q3E A;  5JCO C;  2CE4 A;  2NLJ C;  1J5E B;  3RVZ A;  4LF5 O;  1NH2 D;  5KHG A;  4B3M O;  2N74 A;  3J80 N;  2LFR A;  4LF9 O;  2Q69 A;  1SF9 A;  1M90 W;  2AXT Z;  2BTO A;  3KG2 A;  5L3D A;  4CS2 A;  4ZKI A;  2NNU A;  4X20 A;  2WLL A;  3QTC A;  4U3J B;  2EIK C;  2UUA B;  1R1B A;  4FLX A;  3ZMT A;  4JI0 B;  4P30 A;  4ZIB A;  3JD0 A;  1S76 D;  2WA4 A;  5GON B;  1VQP V;  2R72 A;  3T4Z A;  4U7O A;  2FKX A;  4DK1 A;  1Y6X A;  1HNW O;  3CE2 A;  1QNM A;  1HDJ A;  2D3O W;  3GWK C;  1Q6U A;  4J11 A;  1QVG U;  1BT8 A;  3IC9 A;  4O4J A;  4JI1 B;  2PYL A;  5CB4 B;  4MS2 A;  1O9H A;  4O4I B;  3RGB A;  1CEZ A;  3JAL A;  2FML A;  1OCO C;  1YXB A;  4LH6 A;  4KFM A;  4LNU B;  4IT5 A;  1Y4M A;  1FFT B;  4UB8 Z;  1ARO P;  4B3M B;  1GMG A;  4PJ0 Z;  3B8M A;  1NS1 A;  2N05 A;  2PI5 A;  4RO2 A;  3JAW A;  3CEI A;  1EFR G;  4HAM A;  3CMA V;  3SR2 C;  2QWP B;  4CS4 A;  4JYC A;  4O4H B;  5KHH A;  3WU2 Z;  2UXD B;  4B7K A;  2B1G A;  1MSW D;  2IJK A;  2ZKO A;  4FMT A;  1YHQ V;  4O4L A;  1BHB A;  1VQL V;  3ZRW A;  2QSA A;  2W0X A;  4ABM A;  1Q82 W;  1G4Y B;  3K59 A;  1WLE A;  1XL6 A;  2UUC B;  3L72 H;  1VQ5 V;  5IYZ A;  3MHS C;  3SJQ C;  2ODM A;  1AIL A;  3HPL C;  5BR8 O;  3T2M A;  5TIS Z;  5H2F Z;  1AI7 A;  1KEC A;  2WLI B;  3A0R A;  1WA8 B;  3RW0 A;  5BXZ A;  2VWK A;  4DR4 B;  2FB5 A;  5EC1 C;  2Q5Z A;  1GKF A;  4PA9 A;  3K79 A;  3ZIA G;  2M6Y A;  4DR7 O;  2IJI A;  4I9W A;  5KMG A;  1ROP A;  2CTR A;  5FPO A;  3APQ A;  4MVO A;  2XAG A;  2ILM A;  2EBO A;  3RYF A;  5B3S C;  4FPP A;  1HWY A;  4K0K O;  3M8A A;  1XHX A;  2LQT A;  4DR5 O;  4E4E A;  4R50 A;  1FFX B;  4X1Y A;  1KKD A;  1M57 B;  2YI9 A;  2WLI A;  2QWR B;  2P22 C;  1VQN V;  4DV3 O;  2F95 B;  2MW2 B;  4TUY A;  2QWO B;  2Z0A A;  3ASO B;  1XIL A;  2P7T C;  2NN4 A;  1W0J G;  2QDO A;  5JJN B;  4DV0 O;  1RPO A;  5BR8 B;  2EIJ C;  2KSD A;  5LA6 B;  3OEE G;  3T1H O;  1N4C A;  3OAA G;  3ABU A;  3KCY A;  3P32 A;  5IY5 C;  1FXK B;  1VQM V;  1Z5V A;  4LF4 O;  1JA8 A;  3P30 A;  2JIZ G;  1FD9 A;  4DR7 B;  2AW9 A;  1QR9 A;  2YXL A;  3MHH C;  3SPC A;  1SA0 B;  1LR1 A;  5CBF A;  3HB3 B;  1XNQ O;  2X0L A;  2V1D A;  2QJ1 A;  2HEP A;  1N34 B;  4NKG B;  4DR1 O;  4DR5 B;  2OTL V;  2GUZ A;  1B3Q A;  2P6J A;  1PD3 A;  1TUB B;  5H5N A;  4IHJ A;  1ZL8 A;  2LP7 A;  3U0Z A;  2HHH B;  4UVB A;  4DV3 B;  4GX0 A;  4PDV A;  2Q7E A;  3CCL V;  1M93 A;  3CRQ A;  3K0D A;  4H44 B;  5L3F A;  2UXC O;  1Q81 W;  4Z1V A;  2B9Z A;  1AI6 A;  2DYS C;  1Q43 A;  4DV1 B;  4NR1 A;  1J95 A;  4DV0 B;  1VF7 A;  3JAT B;  2QGN A;  5C8Y A;  4JV5 B;  4UVA A;  4MT8 A;  3D3I A;  3LSU A;  4UCV A;  4JTC B;  3HKB B;  1GN2 A;  5B1N A;  2RDC A;  3ZJZ A;  3G71 V;  1WN7 A;  1MAB G;  3ZRX A;  2F66 C;  1H2G A;  1KB9 F;  3L73 H;  4JI3 B;  2ZE7 A;  3C3S A;  1ZX3 A;  1XNQ B;  2YID A;  3SYQ A;  1Q90 D;  4JI2 B;  5E1A C;  4DR1 B;  2L35 A;  4Q6G A;  3M7M X;  2IH3 C;  3MAQ A;  1YDX A;  4GUN A;  1AR1 B;  2UXC B;  4O2B A;  4PDL A;  5EBL C;  3KZI Z;  3ZHR A;  4JYA O;  1V54 C;  2JEX A;  5J9P C;  2JVD A;  2WPD G;  2XUM A;  3ML0 A;  2WLK A;  4BIU A;  3FAV B;  4ZOL B;  5IJ9 A;  3AK2 A;  2Y69 B;  1FS0 G;  4J9Z B;  3TCU A;  5GTH Z;  1NTM H;  3OR6 C;  3LUT B;  4L87 A;  5JQG A;  1IBL O;  1K4D C;  5DM6 V;  3CCJ V;  3CCU V;  1X4T A;  2Q7H A;  2YC0 A;  4FZ0 A;  3TXQ A;  4GX1 A;  2Z5U A;  1XMO B;  3ZBH A;  1O9G A;  2Y0I A;  1W0K G;  4CH3 A;  3T1C A;  2YDE A;  2JGD B;  3ZED A;  2R9R B;  1IBM O;  2Q73 A;  1XOU A;  4QPJ A;  5LP6 C;  5LGN A;  2C2A A;  3CB2 A;  1XRE A;  2LGW A;  3KCX A;  4YY3 B;  4JYA B;  2YXH A;  3FX7 A;  4H33 A;  4D7T A;  1K92 A;  2DWE C;  4I50 B;  1PNM A;  3GB7 C;  3ETD A;  3VOU A;  3ZMV A;  3X2Q B;  2CGN A;  2HLD G;  2PYJ A;  5JJJ B;  1YTF B;  4OXS A;  4X65 O;  5L3C A;  3BCC H;  1M56 C;  4HNA B;  4FIP C;  5KHJ A;  1BCC H;  2Q8V A;  4J7Z A;  3TK1 A;  2ZDI C;  3AG1 B;  3LDD A;  3NR7 A;  1GM8 A;  2LFS A;  1VAR A;  4X1K B;  4DR3 B;  2YUA A;  1NH2 B;  2EIN B;  2XAF A;  1P4R A;  1SKV A;  4WFA V;  4LF8 O;  2IU3 A;  2MK3 A;  3F5W C;  1BS3 A;  1XNR O;  1NZ6 A;  3RYC A;  2E5L B;  1ZUQ A;  3OGI B;  1OV9 A;  1Z5W A;  4X64 B;  1F4N A;  4FJC C;  4J41 A;  3PJS K;  1K4C C;  2H3O A;  1H2M A;  3UQ8 A;  4LF6 O;  1XEQ A;  1Y76 A;  4GZR B;  4KXR A;  1D2D A;  3L75 H;  5L3G A;  5B1B B;  2N04 A;  4X8A A;  4A5U B;  3H1I H;  5JH7 A;  1VF6 A;  3JCZ A;  3ZCC A;  1SQG A;  2BSK B;  4LWS B;  1IXM A;  4QE7 A;  4JF3 A;  4DUY O;  1Q6I A;  4JGS A;  3UKM A;  2DYR B;  1M9N A;  4I0X B;  4MSW C;  2ZM6 B;  1JMK C;  1A32 A;  2YIB A;  1JCH A;  3OFN G;  3K5N A;  4K8Z A;  4H0L B;  1VQ8 V;  2JGU A;  3CCV V;  5EBW C;  2JJ1 G;  2EJR A;  1R3I C;  4H37 A;  4JYY A;  1YI2 V;  2IM9 A;  1HNZ B;  5CA0 B;  4TSF G;  3C90 A;  1GAX A;  5FNV B;  3ABK C;  1QLE C;  2Y4T A;  1PL0 A;  4DR6 B;  2LW7 A;  2JDI G;  4YJ3 B;  2FL4 A;  1P49 A;  3RYH B;  3OEH G;  1SET A;  4NXM O;  5J2U A;  3CC7 V;  3JD1 A;  1HR0 O;  2VQE B;  2V4D A;  3ZHU A;  2W6J G;  4FM2 A;  2QR4 A;  1MG1 A;  3BA8 A;  1TVK B;  1ZWI C;  5B1O A;  1EBO A;  1N0N A;  3BEH A;  2FYU H;  3BHP A;  5BMV A;  2YIA A;  1TUE B;  3FYI B;  2ZIN A;  3T1Y B;  2XAJ A;  2ZXW B;  1M57 C;  2XT9 A;  3H1L H;  2QM4 A;  5KX5 B;  2QWN B;  2UUA O;  1JFF B;  1L0N H;  5KA6 A;  1I94 O;  5KLV H;  3Q4H B;  3ASO C;  1COW G;  1IX9 A;  1BHA A;  4DRX B;  5JVD B;  5L3B A;  3CC4 V;  4DV6 O;  4XDL A;  4PA6 A;  1PKX A;  1ZSP A;  4NXM B;  2HVK C;  3HR0 A;  5IWA B;  3JSL A;  4J80 A;  4WBN B;  3JAK B;  3G67 A;  4UV9 A;  1S3J A;  5DEC A;  3ABL B;  4KUM A;  4JI1 O;  5F2V O;  1OCR B;  2EIM B;  1V55 B;  3ZMZ A;  3F7Y C;  1FXK C;  4CZZ A;  1BMF G;  5CN0 A;  1WPX A;  2ZE5 A;  4R7C A;  2OCH A;  3CHX A;  2ZIM A;  3CRM A;  2IH1 C;  4R8C A;  1Y67 A;  4L8J A;  1FJG B;  4DRX A;  3SJA C;  3FYE B;  3RYI B;  4I55 A;  2CH7 B;  3CC2 V;  3ETG A;  3IGA C;  5LP6 A;  3G80 A;  2V7Q G;  1YJ9 V;  3G4S V;  2UXD O;  3BY6 A;  5B1A C;  3BVO A;  1IZ3 A;  1GN4 A;  5H6Q A;  1I94 B;  2KG7 B;  3ASN B;  1FYJ A;  2P5O A;  1OCC B;  4DO2 A;  4LFC O;  3F7V C;  4DV6 B;  1YIT V;  3L74 H;  2UUC O;  3QO8 A;  4GCZ A;  1OCZ B;  4P2Z A;  4TWK A;  2XTA A;  2ZDI A;  2AZ0 A;  1N36 B;  3IJ4 A;  4UCO A;  4DW0 A;  3LNN A;  2YIB D;  1W59 A;  2VQF O;  3QVN A;  3VQX A;  4U3J A;  2RNB A;  1DTO A;  3A0H Z;  3B40 A;  4DR4 O;  1KD1 W;  4QPK A;  2B5U A;  3I56 V;  1TGO A;  4IYH A;  4XDJ A;  4LC1 A;  5GON A;  1N33 B;  3RBZ A;  4DR2 B;  3TGU H;  3OMN B;  2LJ2 A;  1F51 A;  1FXV A;  4FLW A;  5CB4 A;  1RM1 C;  2E75 B;  2H94 A;  4O4I A;  1GK9 A;  4LFC B;  5LXT B;  2G38 A;  3VQW A;  4XBF A;  4LNU A;  2ZCE A;  3HKD B;  4YJ2 B;  4JI8 B;  4WFB V;  3C3T A;  4PHZ A;  3HKE B;  3AG4 C;  2VQF B;  4O4H A;  3E89 A;  4FFK A;  3MDS A;  3EVK A;  2IJH A;  4N21 A;  1SZX A;  1BQ0 A;  2DN9 A;  2H8P C;  4UVC A;  3CCS V;  3K06 A;  5EIB C;  1ENV A;  4BW9 A;  4TV8 B;  5IJ0 B;  4UCU A;  5GW7 A;  4DXW A;  5LXT A;  3ZRV A;  2JRI A;  3B09 A;  1W2B U;  1FPO A;  1BZK A;  4QE9 A;  1EZV H;  1ORQ C;  1VQK V;  1YVW A;  3UM7 A;  1K33 A;  2IBZ H;  1N34 O;  4LCU C;  4J42 A;  2PTM A;  5KHK A;  3CPW U;  1CXZ B;  3W7S A;  2ZR3 A;  3JD3 A;  2OIE A;  2HHH O;  1TA8 A;  2Q0O C;  2X6A A;  4BW5 A;  2EZP A;  1WA8 A;  2QKS A;  2YS8 A;  2ITC C;  3D36 C;  1WP7 A;  2GSM B;  1HNX B;  1BSM A;  2OWO A;  4DV1 O;  3FD9 A;  3UO2 A;  1IXB A;  1WNS A;  2VS0 A;  4AHC A;  2ATK C;  1YZB A;  3ZN0 A;  4JV5 O;  5B66 Z;  5EYP B;  3AG1 C;  2XAQ A;  3DXR B;  1DGS A;  4DUZ O;  5DN6 G;  1I5X A;  1FFX A;  3JAM N;  1NR1 A;  1WP8 A;  1PV0 A;  1VF6 C;  1WB7 A;  3QO7 A;  3CRR A;  2GHY A;  1YF2 A;  4Q20 A;  1NVP D;  4JI3 O;  5EZY B;  2ZT9 B;  3EXA A;  3N27 A;  1KUQ A;  2B1I A;  3E8F A;  3FFQ A;  1VQ9 V;  4JI2 O;  1RSO B;  3L71 H;  5LGT A;  3UT5 B;  5H6R A;  5LA6 A;  2DQ3 A;  2OCC B;  1K5Q A;  2EIL B;  4HZ3 A;  2UXN A;  1JJO A;  5K1P A;  4IYI A;  5KA5 A;  4UUJ C;  1FXK A;  1JPX A;  5HFM A;  3IC7 A;  1ZLZ A;  1K34 A;  4OGQ B;  3FKS G;  1SA0 A;  1UFI A;  3E8B A;  4QNH B;  2EIK B;  2HFE C;  5JWP A;  3KKY A;  4FZ1 A;  2Q67 A;  1GM7 A;  3RT3 C;  3I55 V;  1DF4 A;  4DUZ B;  4JAU A;  5A2Q N;  1TUB A;  2JEU A;  1EN5 A;  3H1K H;  2AGA A;  2BCC H;  4FFB B;  3K9A A;  2CK3 G;  2GTA A;  1H2S B;  4GX2 A;  1NJI W;  5IE9 A;  1B6Q A;  4YHH B;  1KMI Z;  3BRC A;  5LMN O;  1XMO O;  3K57 A;  3ZHT A;  3FB5 C;  1SQB H;  4OPH A;  5C93 A;  4KHP O;  3AG2 C;  1PP9 H;  3OW2 U;  3WB1 A;  4B3S B;  3ZN1 A;  1OCO B;  3JAT A;  3OD4 A;  4J7K A;  1F23 A;  1DF5 A;  3JAR B;  2W6I G;  2EX3 A;  1MOF A;  2GBO A;  3B8N A;  3ABM C;  1EZJ A;  1GN6 A;  1H8E G;  1H38 A;  2Q0A A;  3HKB A;  2F93 B;  1MNG A;  2HG5 C;  3JYC A;  3CRA A;  4YY3 O;  3WFV A;  2Q9L A;  4JI4 B;  1Q8I A;  3N2K B;  2K1E A;  1FAF A;  1U97 A;  1AVM A;  4NYK A;  4WFE A;  1FXH A;  2JS5 A;  2M7W A;  5LYJ B;  4LF7 B;  4JYB A;  3K3W A;  1NT2 B;  1ZTE A;  3CXC U;  4TV9 B;  1MSD A;  3P3P A;  2WSS G;  2PI4 A;  2QM8 A;  4DR3 O;  2ADP A;  2ZXW C;  5LBQ A;  1XHZ A;  4B3R O;  3STZ C;  1F4M A;  5LMN B;  1IVS A;  4Z1M G;  4KHP B;  2X6C A;  2KB1 A;  1BQZ A;  5E79 Z;  4JI5 O;  2L6L A;  1AP6 A;  2JK5 C;  3N2K A;  3W7X A;  3JCU Z;  2E5L O;  5H9C A;  3FAV A;  4ZOL A;  4IIJ B;  4X64 O;  1PL4 A;  2UUB B;  5FLX N;  3TJT A;  3BA9 A;  1SC5 B;  3G6E V;  4RUE A;  1E1R G;  1KP2 A;  1RP3 B;  3ABL C;  3W7W A;  4F4L A;  5IYB O;  2ITD C;  5KUM A;  4CBC A;  1BE3 H;  1EN4 A;  4FLZ A;  5K1X A;  3J81 N;  2Z3Y A;  3SPJ A;  1XMQ B;  1IBK B;  2R9I A;  3WB0 A;  2QKA A;  2WLJ A;  3OMI B;  2JGD A;  3S3X A;  1Y74 B;  2Q7G A;  1GTO A;  5LHI A;  3RVY A;  1G1X B;  4B3R B;  4PDM A;  3E22 B;  2ZQM A;  2P4V A;  4DW1 A;  2CGO A;  5J2T B;  2ZM6 O;  3UCS C;  4PEL A;  4X88 A;  4CC5 A;  4J10 A;  2EIJ B;  3D36 A;  4P9P A;  3U10 A;  4JI5 B;  3ASN C;  4AQY B;  3CWB H;  4I50 A;  5IY5 B;  2PY5 A;  1ZAU A;  1YIJ V;  2ZE8 A;  1HNZ O;  2WAM A;  3K5O A;  2FTK A;  4QGP A;  3WG7 B;  4HNA A;  1OCZ C;  2DJV A;  4J7J A;  4H13 B;  4DR6 O;  1KC8 W;  3THO A;  1S5L Z;  2CTQ A;  4LP8 A;  1AI4 A;  4UB6 Z;  4O2A B;  3SPI A;  4B3T B;  3O9O A;  4GKJ B;  4X1K A;  3A2F A;  4NXN B;  3ZS8 C;  4C7U A;  3P3N A;  2DE0 X;  2VQE O;  1M1K W;  1R6T A;  1AR5 A;  3BAA A;  3LSQ A;  5EC2 C;  4JTA B;  4GYC B;  4EEQ A;  4GX5 A;  3RN4 A;  1GH6 A;  2DYS B;  4FVM A;  1S72 V;  4MVQ A;  1SRY A;  1G6U A;  2E76 B;  3WB2 A;  1VMG A;  4U7N A;  3OE7 G;  3T1Y O;  2D2C B;  3SJC C;  2Y0P A;  4ICG A;  1K97 A;  4G28 B;  2PZS A;  3IFX A;  1WB8 A;  2BSK A;  1JQ0 A;  3S3W A;  4LWS A;  5FL7 G;  2RN9 A;  1AJN A;  3MD0 A;  1YJW V;  5IWA O;  3E2E A;  3BAB A;  1EM1 A;  3ETE A;  3HKC B;  4I0X A;  3OMA B;  3ZX6 A;  4F6R B;  2DWD C;  4YIO A;  1N32 O;  2EUL A;  3NXS A;  3ZMU A;  3SYP A;  4ZI7 B;  1NQT A;  3QF7 A;  2EZO A;  2DQ0 A;  1QHT A;  1P7G A;  2IU0 A;  5CA0 A;  4GT1 A;  5FNV A;  4JI7 O;  3CJH B;  1UJW B;  5BY1 A;  1FJG O;  1YEW A;  2NR5 A;  1KU9 A;  4YJ3 A;  3RYH A;  4X62 B;  5KUK A;  4MTO A;  1KYO F;  1I0H A;  4BAY A;  2BOB C;  3B4S A;  5EIB D;  2BTQ B;  1TVK A;  4UCS A;  4FLV A;  4UCT A;  3VBB A;  2IW5 A;  3AK3 A;  5CBH A;  2YSU B;  4TQF A;  5LOV B;  3AG3 B;  4FM0 A;  4ASU G;  1SS3 A;  5KAI Z;  2RMK B;  4CH6 A;  2QTO A;  2ZE6 A;  4OX9 B;  2DMX A;  1N36 O;  2HJF C;  1N32 B;  1H2N A;  1GN3 A;  3OUS A;  1LNQ A;  2IJJ A;  2KKW A;  5KX5 A;  4X20 B;  1JFF A;  1K5S A;  1L0L H;  1YJN V;  2BTQ A;  3E86 A;  3Q4H A;  5LMU O;  4JI7 B;  5JVD A;  3K58 A;  1N33 O;  3B77 A;  1L8D A;  1NVP B;  4DR2 O;  2ZD9 A;  3CS5 A;  4I4T B;  4PDR A;  2E3C A;  1KP3 A;  2LO1 A;  2UXX A;  4WBN A;  3QO5 A;  1US6 A;  2OCC C;  3CCR V;  3JAK A;  4U3F H;  2EIL C;  3E8H A;  3OGC C;  1M56 B;  1QQC A;  3SDL A;  3IAY A;  2K9P A;  5A9G A;  5JJE B;  4O4J B;  4LFB O;  3CP1 A;  1G8M A;  3JAL B;  3CSX A;  3T4D A;  4GKK B;  2QKC A;  3K03 A;  4UV8 A;  2AHY A;  2RJZ A;  1N0J A;  4K8X A;  4JI8 O;  4R6Z A;  4IL6 Z;  3RYI A;  1DLB A;  4DV4 B;  3GVM A;  2CH7 A;  3JAW B;  2ARH A;  4I4T A;  2HJD A;  5KHI A;  3ETQ A;  4JAS A;  1XDC A;  2A9H A;  2Q68 A;  2E74 B;  3AG7 A;  4MTX A;  3FB7 C;  3VQY A;  5CBG A;  4D6T H;  1JR9 A;  5L3E A;  4W4K A;  2KG7 A;  2HP8 A;  5LMU B;  2ZR2 A;  2RQ6 A;  3APO A;  1PNL A;  4O4L B;  3ZMS A;  3CXH F;  3ZRW B;  3BPZ A;  1D5N A;  1QU7 A;  2P4K A;  4NB5 A;  4AI8 A;  4LF5 B;  1OJH A;  3N2G B;  3H1H H;  4LF9 B;  5IYZ B;  3E35 A;  2R70 A;  4WFF A;  4LFB B;  1F7Y A;  3L9D A;  4UCR A;  1XBL A;  3AK1 A;  2R9A A;  1GM9 A;  5KAF Z;  3LDE A;  1HNX O;  4X66 O;  2GDS A;  4YXW G;  5CA1 B;  1SQV H;  1H2L A;  1XQ8 A;  3SPG A;  3J7A U;  3OR7 C;  4WF9 V;  3QNE A;  4X1I B;  1HP8 A;  2Y69 C;  2Y48 A;  1BL8 A;  4DV5 O;  3OTO O;  2JJ2 G;  1Z2G A;  3H01 A;  5KMG B;  1MA1 A;  2A3Q A;  4CH5 A;  1HNW B;  1VQ6 V;  1HW7 A;  1R73 A;  3ABK B;  4G27 B;  2P90 A;  1QLE B;  2Q6A A;  3RYF B;  2A06 H;  3N2G A;  5B5E Z;  3D3Q A;  4XDK A;  2EJ7 A;  5DED A;  1K73 W;  4CH4 A;  2XND G;  4X1Y B;  4Z2W A;  1DK1 A;  2WLH A;  1QBZ A;  3EHB B;  4PA4 A;  2AZ2 A;  1R6N A;  1QVF U;  1FKA O;  3HKD A;  1YCI A;  5CA1 A;  4YJ2 A;  4TUY B;  1VIB A;  3HKE A;  4X1I A;  4WCE V;  2YI8 A;  3A8T A;  2DOS A;  1VF5 B;  1T5E A;  1S0V A;  1D5A A;  4JZG A;  4X66 B;  4RUF A;  4JI6 O;  3CX5 F;  4I5S A;  5IJ0 A;  4TV8 A;  3X2Q C;  4MVZ A;  5D5Q A;  4DV5 B;  3OTO B;  4PD4 F;  1AB3 A;  4X89 A;  5BZB A;  2X7R B;  4CS3 A;  4X9Q A;  1KKC A;  4AIL C;  2CTW A;  5D5P A;  2EIN C;  1I7F A;  2GUZ B;  1QCE A;  2P67 A;  4IHJ B;  1NKD A;  1ZL8 B;  1VQ7 V;  3DC6 A;  2ADQ B;  4DV7 O;  1JX9 A;  4YHH O;  4MTF A;  2WWW A;  2GV9 A;  3ICX A;  4FLU A;  3R65 A;  3D8C A;  3LSS A;  4B3S O;  4NTX A;  3WG7 C;  2XOK G;  3CME V;  3CRC A;  5EYP A;  3STL C;  3DXR A;  5C8Y B;  2KQX A;  4JI6 B;  4PV1 B;  1VQO V;  5B1B C;  4K0K B;  3ZHV A;  4ZBM A;  4MTG A;  4W4L A;  3SYA A;  4HYO A;  3LDC A;  2YEV B;  4JI4 O;  5B1A B;  1OZ0 A;  5EZY A;  3K0G A;  3SYO A;  1R3L C;  5CA3 A;  2CUG A;  2YIC A;  4LFA O;  4LF7 O;  1RSO A;  2DYR C;  2A7W A;  1MMM A;  3RFR A;  3UT5 A;  4DK0 A;  4JAV A;  5JCO A;  2QA4 V;  1THZ A;  2XHB A;  4RAI A;  4IGG A;  1S77 D;  2QEX V;  1WJZ A;  1K8A W;  3A0B Z;  4LH7 A;  4MW8 A;  5AG2 A;  3T1H B;  4EFE A;  4BR6 A;  2F1M A;  4DV7 B;  4O2B B;  3F5T A;  3SYC A;  2CDY A;  3G6B A;  4LF4 B;  1H2K A;  2OIG A;  4NVP A;  2YEV A;  4P9O A;  3LNM B;  1AP5 A;  1Y66 A;  4MVU A;  1SQX H;  4N23 A;  1GO3 F;  1U96 A;  1EN6 A;  4ZHQ B;  4BIZ A;  2F23 A;  4I9Q A;  3ZRS A;  4K3A A;  4EFB A;  2UUB O;  1XI1 A;  5IJ9 B;  1VEW A;  2W0F C;  1Q7Y W;  2AHZ A;  4FM1 A; 
#chains in the Genus database with same CATH homology
 2CTW A;  2CUG A;  1FPO A;  2Y4U A;  2GUZ B;  2YUA A;  4IT5 A;  4J80 A;  1FAF A;  4RWU A;  3AG7 A;  1HDJ A;  3UO2 A;  2KQX A;  2QSA A;  3UCS C;  1BQZ A;  1GH6 A;  2CTQ A;  2N05 A;  1BQ0 A;  2QWN B;  2L6L A;  2DN9 A;  2PF4 E;  2DMX A;  2Y4T A;  1N4C A;  1WJZ A;  4J7Z A;  2N04 A;  3APO A;  1XBL A;  2QWP B;  2QWR B;  1IUR A;  2GUZ A;  2LO1 A;  2M6Y A;  3BVO A;  2CTP A;  2EJ7 A;  3UO3 A;  1NZ6 A;  2CTR A;  2OCH A;  2YS8 A;  2LGW A;  2QWO B;  2QWQ B;  3APQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...