2CTWA

Solution structure of j-domain from mouse dnaj subfamily c menber 5
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
109
structure length
109
Chain Sequence
b'GSSGSSGRQRSLSTSGESLYHVLGLDKNATSDDIKKSYRKLALKYHPDKNPDNPEAADKFKEINNAHAILTDATKRNIYDKYGSLGLYVAEQFGEENVNTYFVSGPSSG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DnaJ homolog subfamily C member 5
publication title Solution structure of J-domain from mouse DnaJ subfamily C menber 5
rcsb
source organism Mus musculus
molecule tags Chaperone
total genus 21
structure length 109
sequence length 109
ec nomenclature
pdb deposition date 2005-05-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00226 DnaJ DnaJ domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.110 Mainly Alpha Orthogonal Bundle Helix Hairpins DnaJ domain 2ctwA00
1GH6A 2QWNB 2Y4TA 1WJZA 2LO1A 4J7ZA 1FPOA 1FAFA 2CTRA 2CUGA 3APOA 1NZ6A 3UO3A 2N04A 2YUAA 3APQA 2L6LA 2CTWA 2DN9A 2LGWA 2N05A 1XBLA 2CTQA 3AG7A 2OCHA 2CTPA 2QWOB 2Y4UA 2M6YA 2YS8A 2QSAA 1BQ0A 1N4CA 2KQXA 3UCSC 2QWRB 2EJ7A 4J80A 2GUZA 2QWQB 2DMXA 3BVOA 3UO2A 4IT5A 2PF4E 1HDJA 2GUZB 2QWPB 1IURA 1BQZA 4RWUA
chains in the Genus database with same CATH superfamily
3ASOB 1B3QA 3BFRA 3W7SA 3UT5B 1MG1A 5B1OA 1H8HG 2N04A 4MTFA 1E79G 2H94A 2PUSA 3E2EA 1KYOF 1SESA 4JTCB 4K3AA 5IJ0A 2Q73A 5E79Z 3M8AA 4GYCB 1WPXA 2DMXA 1A32A 5E1AC 2CK3G 3KZIZ 4U7NA 3T1HB 4PI2A 3ZRVA 2CAZC 1UPGA 1PL0A 1E1RG 4AILC 5IT9N 1IBMO 1HP8A 2ADQB 3APQA 3T1CA 2DYSB 4DV4O 3ZBHA 2ZR2A 2PYLA 2P22C 1TA8A 3BY6A 4XBFA 3SDLA 2IH1C 1FFTB 2VQFO 1FJGB 5K1PA 5JQGA 1PD3A 3JARA 1QVFU 4X65B 2ILMA 2Y48A 5BMVA 3K06A 2QM8A 4ZBMA 3WB1A 4MVMA 4IGGA 4I4TA 2MW2B 3W7UA 3O9OA 1WA8A 1L0NH 4X9QA 3ABUA 2IH3C 4UVCA 1WLEA 4X62B 4LR3A 2XAHA 3UCSC 1M9NA 2N74A 4J9YB 4JTAB 4ZI7B 4X1YB 2HG5C 1NT2B 1F7YA 1XHZA 1NVPB 2LFSA 4WFBV 3OT7A 5DECA 4DV2B 1WJZA 3I56V 4R8CA 1JQ0A 4X20B 4MTXA 2UU9B 3HKBA 2X7RB 1SQXH 2OCHA 1I08A 3MDSA 4DR1O 3CC4V 3ZMSA 4FLZA 4FFBA 1PP9H 1Q90D 5IYZB 3FAVA 3M99B 3K0DA 1CXZB 1SETA 3E8GA 2EIKC 2YUAA 1NU1H 2AHZA 4H0LB 2LJ2A 1AROP 4AI8A 4YHHO 2WA3A 3LDCA 4X89A 2YI8A 3L9DA 5HFLA 4JAUA 1AB3A 4YIOA 4JYAO 3CX5F 2Q7GA 2X0LA 4WFAV 2XAQA 3H1JH 4L8JA 4DV5O 1HNZB 4K8ZA 4LP8A 5IJ9B 2Y69C 4TV8A 3D8CA 4X1IB 3A8TA 1P7GA 4GUNA 3ZHUA 2PGGA 4H13B 4I50A 5B3SC 4FK5C 4UFZA 3R66A 1G6UA 3P30A 1Q81W 1KECA 2F43G 5AG2A 3RYIA 4YJ3B 4FLUA 2PZSA 2OYQA 4YJ2B 4N23A 1EN4A 2EIKB 3ZMUA 2Q68A 4TT3G 2XNDG 2Y4TA 5JWPA 4X64O 2KG7B 3DTUB 3J7AU 3KKYA 4W4KA 1K97A 4DR4B 4RUFA 1NBMG 4CH3A 2F1MA 4NYKA 3ABTA 2CH7B 3CCSV 2Q67A 3QG5A 4KHPB 2EIJC 2Y69B 3CE2A 1KP3A 1JPXA 2VS0A 1FD9A 1YDXA 3JASA 5B3SB 4NVPA 5A9GA 1VQNV 2CTQA 2CE4A 3JAKB 3JYCA 3FB6C 5JJEB 1SZTA 3CRRA 4X8AA 3BCCH 3DSQA 3F7VC 1QVGU 3WB0A 1YXBA 4DK1A 4L87A 4LF9O 2O57A 1XMOB 1PNKA 1N4CA 1Q6UA 5BZBA 2Q4PA 4LNUA 4DR7O 4JI0O 2EIJB 1N34O 4J7KA 5JH7B 2JJ1G 4OX9O 4O2AB 5KHIA 3E8BA 4TV9A 5IDJA 3ETGA 3JSNA 3W7TA 3C3SA 2Q6AA 2FMLA 3JSLA 3E22A 1IX9A 4B3SO 1U96A 4MVZA 1KC8W 5JVDA 3CXCU 4DR3O 4O4IA 5EBLC 3QNEA 2B5UA 5KX5B 3T2MA 3RN4A 1V54C 3J80N 1XNRO 1MSDA 5CB4B 1TGOA 2EINC 4GLXA 4XDJA 2Z0AA 4GCZA 4WFHA 1K9MW 4Z1VA 2Q5ZA 1FXKA 2UXNA 1FXHA 2DQ3A 4FM1A 2PF4E 2LP7A 5LHHA 4DR6B 4NXNB 4LWSB 2CGOA 1S5JA 4AQYO 3CCEV 1Y74B 3BPZA 4JGSA 4OGQB 3OR7C 4F6RB 2F23A 2BE3A 2YIBA 2M7WA 1XUQA 3FB8C 1NH2D 1Z2GA 4LF7O 4GX0A 3SYOA 2QJ1A 3C3TA 2YXLA 2ZE7A 2LW7A 2B1IA 4DV1O 3FD9A 3B2EE 2NR5A 4E2LA 2EINB 1GH6A 1JCHA 3ZHRA 3ZEDA 4MT8A 2GHYA 4K0KB 2M6YA 1CPYA 1W0KG 2ADPA 2XAJA 3OUSA 4RO2A 4ZI7A 2Z5UA 4B7EA 4IIJA 4MTOA 2QTOA 4MVQA 1ZTEA 4LF6O 4DW0A 4J41A 4DR2B 1QLEC 4FPPA 2OT5A 4DV5B 1MSWD 2AW9A 2UUBO 2IBZH 3PJSK 1WB8A 3PN1A 2RNBA 1N33O 4PA6A 1MMMA 1SA0B 4TQFA 4IL6Z 4JI5B 3CCLV 5IYZA 1AP5A 4BWAA 1RP3B 2Z3YA 1ZUQA 3QF7A 4X64B 3ABKC 4RWUA 2HLDG 1VQ6V 1AJQA 1JA8A 5LMNO 1SC5B 4CS3A 3CRCA 2ZXWC 1HNWB 1OCZC 4UCVA 1K4CC 1QLEB 3F7YC 1R3IC 1K73W 3OMAB 4UVAA 4DV7B 1X4TA 3ZMTA 4DV6O 4PA4A 2E74B 2JIZG 5IJ9A 1B6QA 4KUMA 1IBLB 2DWEC 4I0XB 5EYPB 1THZA 3G6EV 3OMIB 3U10A 3IFXA 2GDSA 5EZYB 1ROPA 5CBHA 3ETEA 4YJ2A 3UO2A 2ZE5A 3JATB 2XHBA 3JD1A 3ZN0A 3RYCA 1R3LC 1OCZB 2ZINA 4PDVA 2A79B 1MABG 4JI0B 4UVBA 3CMAV 1B04A 3ML0A 1GM9A 3K9AA 4BR6A 3CJHB 5LBQA 3BHPA 4PA9A 4FJCC 5C8YB 1XMQO 4B3SB 5KUMA 2N05A 2ZE8A 4CBCA 5FPRA 4PI0A 1M1KW 4TUYB 5C93A 1PV0A 3NXSA 5TISZ 3GWKC 4G28B 3U11A 1WAZA 1HDJA 4XDLA 4X66B 1O9HA 3UKMA 4R6ZA 4R50A 1Q86W 3L73H 1FPOA 2NLJC 4F6EA 4PDMA 1I94O 2E5LB 3CWBH 5GTIZ 2B1GA 3MAQA 5GTHZ 2ITCC 1NKDA 2IW5A 4YY3B 4ZKIA 5JCOC 1JFFB 2EJ7A 5JH7A 2CGNA 4LFBO 4UCSA 5K1XA 3E35A 1BS3A 1N0JA 2IM9A 2V7QG 3AK3A 1IVSA 5J2TA 5IE9A 2IU0A 5BY1A 3FYIB 2OCCC 3ZHQA 1H2LA 5JJNB 3K57A 4J11A 2QGNA 1O9GA 3DC5A 1HNXB 1Y67A 2OTJV 3RW0A 4CC5A 4U3JB 2Q7EA 4TQDA 2W6IG 2XAGA 1F4MA 1N32B 2WAMA 4NXMB 5CB4A 2A3QA 3JAWB 2UUCB 3G71V 4WBNB 1IBKO 4NB5A 1ZSPA 1NVPD 5KLVH 4UCOA 4MTGA 2CTWA 5FNVB 4R7CA 3ZJZA 3SPHA 5CBFA 1PL4A 5EIBC 1FFXB 4JI1O 4GKJB 3T1YO 4P2ZA 1K33A 1VF6C 3CC2V 4HBNA 3CXHF 2ZQMA 5LGNA 4LWSA 4CS2A 2OCCB 1H8EG 1US6A 1PKXA 4J7ZA 2EX3A 2UXDB 2HKOA 1S3JA 3X2QB 2EZOA 4Z1MG 2GSMB 4E4EA 4JAVA 1M57C 5J2UB 4FZ0A 5LMUO 4A5UB 4Q20A 3GWOA 1K92A 1H2GA 1M90W 3FKSG 4DUYO 1S0VA 5KMGB 5LA6B 1YVWA 3F5WC 3D36C 4LF4O 2UXCB 1CP9A 2JJ2G 5KHHA 2QM4A 2V4DA 3B77A 4B3MO 2QEXV 3VQVA 1AR4A 2EIMC 1QR8A 3P3NA 5DEDA 2X6BA 1ENVA 4C7UA 2F4VB 1QLNA 2WLLB 3AG1C 1GN4A 1KU9A 4JYBA 1Q43A 1Y6XA 2E3CA 4QPJA 4RUEA 1DK1A 1R6TA 3G4SV 1NTMH 1XNQO 1KKDA 2D3OW 2QWOB 2R9AA 4UXNA 4CS4A 3H1HH 3OEEG 4EB6B 1DLBA 2Q9LA 1HR0O 3E86A 3N2KB 3VQYA 5L3CA 1R73A 3L75H 3K9SA 2HJFC 5KHJA 3WU2Z 2EIMB 4CH5A 3CSXA 2FL4A 5LXTB 4QPKA 4JAAA 3HB3B 1TUBA 3AG1B 1TUEB 4HNAB 3IAYA 3CS5A 4TSFG 4IHJA 4DW1A 2W6JG 1OCOC 5EC2C 3E83A 2VRZA 2XT9A 4MVOA 3H1LH 2PY5A 2P67A 4FVMA 1R1BA 4MSWC 1OHHG 3OR6C 4J7JA 4TOIA 3CC7V 5LYJB 4CH4A 1R3KC 3JATA 1V9PA 1LNQA 5BR8B 2JS3A 2QE7G 2A06H 2QWPB 3BEHA 5A2QN 1VQOV 1KBHA 1M56B 3B4SA 3CRAA 3OUFA 1IXMA 2BCCH 3J81N 2L35A 4O4HB 1SQVH 3JALB 1S5LZ 2JGDB 3I5DA 3L74H 1OCOB 1ZWIC 5LP6C 1WN7A 5CA0A 2UUAO 1X59A 3A2FA 3CJHA 3K03A 3MHHC 4LBEC 4I7ZB 4ZOLA 3LNNA 5H6RA 3DC6A 3U0ZA 3HKCB 3Q4HB 3JD0A 1VMGA 4JI2B 4FM2A 2HR3A 2KKWA 4HYOA 5L3FA 3KG2A 1GN3A 1HWYA 4O4JB 4O4LB 2YS8A 2XASA 3DGEA 4B3RO 3HKDB 5GONB 3IC9A 1EN5A 1YCIA 3E89A 1N36B 1ZL8B 4JI3B 1MNGA 1AI5A 2GTAA 2YEVB 4JI4B 4LFAO 1RSOA 4EFEA 5LP6B 3N2GA 5KA6A 5IYCO 2ATKC 3CRMA 1B06A 3HKEA 3T4DA 1XBLA 2Y0IA 2E75B 1JFFA 1AJPA 2IJIA 1FXVA 4CZZA 5GW7A 3CRQA 1AI4A 1WB7A 5L3BA 5IWAO 3C90A 3OTOO 1K7DA 1KD1W 2HFEC 1RFYA 3CCUV 5B1AC 3R65A 3CCMV 2ZM6O 1KB9F 3K59A 3EHBB 5LMUB 4FIPC 4X88A 3H01A 3CCRV 4MS2A 3WG7C 4U3JA 5BXZA 1AI6A 3N27A 4UV8A 1GM7A 3JAWA 1JR9A 4BAYA 2RDCA 1JOYA 1IBMB 4I55A 1OZ0A 5JCOA 3VBBA 5FNVA 2P4VA 3RFRA 4DV4B 1NZ6A 4P9PA 2QDOA 4J42A 5LGTA 3F5TA 4NTXA 2VQFB 3QTCA 3WFVA 2IU3A 2WLKA 2P4KA 4UCUA 5CA1A 2RQ6A 2DJVA 5B1AB 3STZC 1SQGA 2AZ2A 3UT5A 2HHHO 2G38A 4IYIA 1Q3EA 2Q69A 2R9RB 5ITZB 1WP8A 4Q6GA 3WG7B 3FB5C 2OTLV 2YI9A 1MZFA 2LW1A 1VF5B 1K5SA 3ZHVA 4J80A 3AG4C 1VARA 4GX5A 2YDEA 4TWKA 4LF8O 3IJ4A 1HW7A 2BSKB 5F2VO 1XHXA 3APOA 4MVRA 1F4NA 4PDRA 2JRIA 1AP6A 4DR1B 2R70A 4LFCO 1QQCA 1D2DA 2ZKOA 1S77D 2EBOA 4PJ0Z 4JI8O 4IT5A 1V54B 3L71H 1H2NA 2R9IA 2PI5A 1QU7A 1COWG 1W2BU 1XL4A 2ZIMA 2QWNB 1FS0G 3A0RA 2JDIG 2OIEA 1EBOA 2BTQB 4EB6A 4LF5O 2RJZA 4YHHB 3AG4B 4X1YA 4JYAB 1KP2A 5FL7G 3SYAA 4DUZO 5LXTA 4X20A 3ZCCA 1NTZH 2F95B 1SF9A 1SZXA 4GX1A 2A7WA 1PPJH 4BW5A 1YSCA 3SJAC 3JAMN 2P6JA 4HZ3A 1UJWB 4JI7O 1GAXA 4DV0O 2QKCA 2LO1A 4KP4A 1G8MA 4DR5O 1JX9A 3W7XA 2LGQA 4B08A 4PELA 5LYJA 5LOVB 3SPJA 2P90A 4B3RB 4ASUG 1AI7A 2P7TC 4CC6A 1MA1A 1H38A 1GMGA 1J5EO 4JASA 5EBWC 3RBZA 4U7OA 4O2BB 3T1HO 3TXQA 4O4HA 4EKWA 3K5LA 3CEIA 4K8XA 3JALA 1YJ9V 3LSQA 1AILA 4X1IA 2QTSA 3GVMA 5CBGA 3L70H 3TETA 2DN9A 2P06A 3HKBB 2K9PA 1KMIZ 1WNSA 4ZHQB 5IWAB 4YJ3A 2ETNA 4GX2A 3ZRWB 5J9PC 3ABKB 4WF9V 3Q4HA 4QGPA 4D6TH 4FFBB 1FJGO 2ZM6B 1DGSA 1NR7A 2KG7A 3M7MX 2ZXWB 4JYYA 4LF9B 2WLIB 1AR5A 4Z2WA 4GZRB 4QNHB 2CH7A 2DWDC 1XDCA 4DR7B 2ZCEA 4X62O 3ZHTA 2QWRB 1N34B 1ZL8A 4N21A 3ZHSA 3K5NA 4OX9B 1NTKH 3HPLC 3CHXA 2YEVA 5IYBO 1Z5WA 1YHQV 2F93B 4I9QA 4DV2O 3KCYA 1YITV 1GKFA 4GKKO 2UU9O 1VIBA 3JAKA 1DTOA 1W0JG 4NTWA 1K3EA 4K35A 2LFRA 4I50B 4DR3B 3OM3B 2ZNIA 2DOSA 2UXBO 3AG3C 3IC7A 4W4LA 3EVKA 1YJNV 5FLXN 3RYIB 1MOFA 1XNRB 4UV9A 3EFFK 3ETQA 1D5AA 1VP7A 3K5OA 1YI2V 3K0GA 3ABLC 2H8PC 4EFBA 1ZX3A 1DF5A 5EIBD 2D2CB 1BMFG 2AHYA 4O2AA 1VF7A 1H2SB 4AQYB 3ZMVA 2K1EA 1XQ8A 4OPAA 4LCUC 2A0LA 3SR2C 2JVDA 4AHCA 1EM1A 2QA4V 2ODMA 1AJNA 3AK1A 5EK0A 4LF7B 3BA9A 3H1IH 1HNZO 3JASB 1VQ9V 2BTOA 3AG3B 3QO8A 4FLTA 4DV1B 1URFA 1QR9A 3LSUA 1BT8A 5KX5A 1P49A 4B3TO 1F51A 1FYJA 3OE7G 3ABLB 1DF4A 4MW3A 5CA3A 1BHBA 4LF5B 2ZDIC 1N0NA 2WWWA 5DM6V 4DR4O 4D7SA 1BQ0A 2WSSG 4LF6B 4JV5O 1CEZA 1FXKC 2EILC 2UUBB 1Y74A 4UB6Z 4KHPO 1NJIW 2Q7HA 1YJWV 4F6RA 1FAFA 1N33B 1EN6A 2XUMA 1G1XB 5KHKA 5JJJB 3B40A 2VQEO 4I9WA 1XL6A 4YIPA 3LDDA 2FYUH 2WLNA 5IY5C 3UM7A 3ZRSA 1NR1A 4PA3A 2IJKA 1Q82W 1Q5OA 4ICGA 1Q7YW 5LMNB 1GM8A 4DR5B 3I55V 1VQ5V 1L1FA 1JVMA 2BTQA 5LHGA 2YC0A 3BAAA 5L3GA 2AZ0A 1VQKV 4JZ2A 3VQXA 4IYHA 3JD3A 3E8FA 5H6QA 3SYPA 1XMOO 1U97A 2ZNJA 1NQTA 1J5EB 2P5OA 3ZRXA 1FXKB 2EILB 3DXRB 1GN2A 2EZPA 4PDLA 4DV6B 4MVSA 2H3OA 2OWOA 3JD4A 1Y4MA 3SJBC 2VWJA 1OV9A 1M57B 1SA0A 5LL6Y 3O65A 1N8RW 3B8MA 3MD0A 5IY5B 4UCRA 3ZIAG 3L72H 2YXHA 2QR4A 2QKAA 1SQBH 3ZN1A 4LH7A 5L3EA 2YICA 3TXSA 1FKAO 3K04A 1LUVA 4JTDB 1KUQA 1SRYA 5EBMC 2W0XA 5D5QA 1BSMA 2XAFA 5LOVA 4DRXB 1D5NA 1NS1A 2DE0X 1ZLZA 3LUTB 3W7WA 1VQ8V 3K79A 4OPHA 4DV3O 2Q0AA 4LC1A 1M93A 2FB5A 4IIJB 4O2BA 3CCJV 4DR6O 4I0XA 5EYPA 3TCUA 1YTFB 2MK3A 1XMQB 4GKKB 4NXNO 3SJCC 3RYHB 2WPDG 1BGYH 5EZYA 4QE9A 1VQPV 4ZHQA 3NR7A 2UXBB 3ZRWA 4HAMA 5B1NA 1GRJA 5HFMA 4X1KB 2PTMA 3CP1A 4DYLA 1LR1A 4PV1B 5KUKA 2WLIA 3D3IA 1I94B 3THOA 3RYFB 4BIOA 3G67A 5KAFZ 1Y66A 2PYJA 1XREA 5LGUA 4RAIA 4K0KO 4LFBB 2KSDA 3CD6V 2A9HA 4H33A 1G4YB 4NKGB 1V55C 5C8YA 4DR2O 1QCEA 4RQEA 4YXWG 5H5NA 3FYEB 3VOUA 1M4UA 3CB2A 4TUYA 3P32A 4JI5O 4B3TB 4JI6O 3FFQA 5B66Z 1M5IA 3G6BA 1TVKB 2GUZB 1IBKB 3BRCA 3LDEA 3RYCB 1K4DC 3AEIA 3OW2U 2XTAA 1RPOA 3H9VA 3ZMZA 5B5EZ 1HNWO 4JI1B 1Y76B 3ETDA 3B8NA 2ZT9B 3T1YB 4PHZA 3OD4A 1L8DA 3SPGA 3SGIA 4JV5B 4BIZA 2QM7A 1V55B 1J95A 1PNLA 4FLXA 2RN9A 1L0LH 1I5YA 4DV7O 2UXXA 2F66C 5KA5A 3QVNA 2VQEB 1SERA 4KFMA 1IBLO 3AG7A 4B7KA 2WLMA 3A0HZ 4DUYB 2IJJA 3CCVV 4QE7A 3WB2A 4LF4B 3CMEV 4WBNA 3BA8A 4B3MB 2CUGA 1OCRC 1MZEA 3SJQC 2YIDA 3LSSA 1FFXA 3TGUH 1JJ2U 2HP8A 2ZD9A 2DQ0A 4FMTA 4NTYA 1XILA 2VWKA 4D7TA 1VQ7V 5KAIZ 4ABMA 3OEHG 1XNQB 3GB7C 5J2TB 3RWRD 2R72A 1GTOA 2B9ZA 2BOCC 5J2UA 1EFRG 3OTFA 1AR1B 3OGCC 2FTKA 2NN4A 2GTSA 3QO5A 1HR0B 4FLWA 5KMGA 4FM0A 3OGIB 5LA6A 2ZDIA 1EZJA 1F23A 1OCRB 1JMKC 4X66O 4JZGA 5H2FZ 1XOUA 2DYRC 4PD4F 2PI4A 1QHTA 2HVKC 1VF6A 2IJHA 2E5LO 4DV3B 1K8AW 3DXRA 2WLLA 5FPOA 1H2KA 3OFNG 3TK1A 4YY3O 3BABA 4FZ1A 3K5MA 4I5SA 1I5XA 3IGAC 4MVUA 1Q8IA 3KCXA 4NR1A 5KHGA 4BW9A 3JCUZ 3T4ZA 1R6NA 3FX7A 1SKVA 3ABMC 2LQTA 4P30A 2E76B 3EXAA 2YIAA 2KB1A 1Q6HA 3D36A 2KQXA 2AGAA 2JK5C 2WA4A 3RVZA 1JJOA 3N2KA 1BL8A 3SYQA 1VQLV 1HNXO 3AK2A 4PA7A 4J9ZB 2BOBC 5IJ0B 2GBOA 2RCVA 2DYRB 1IURA 1N32O 1BCCH 1UFIA 4DRXA 4NXMO 2RMKB 1YF2A 2UUCO 3ASNC 2Y0PA 2ARHA 3TJTA 2L6LA 4HNAA 1W59A 3P3PA 3QO7A 1NI8A 4KL1A 2UUAB 3RT3C 1RPRA 2DW4A 2JGUA 5CMUA 4GKJO 4J10A 3ABMB 1BQZA 2Q0OC 4WFGA 3RYHA 1P7BA 5JQGB 1S5HC 3JARB 3JCZA 3B09A 5BMVB 1Z5VA 1I7FA 3RGBA 2UXDO 3OMNB 4I4TB 1WA8B 4OXSA 4JI6B 3LNMB 1ORQC 5LHIA 1BHAA 1WP7A 4X1KA 4ZIBA 1H2MA 1SQQH 1OJHA 5H9CA 2NNUA 3G80A 1OCCC 3ASNB 3RYFA 1IZ3A 2V1DA 4UCTA 1TAEA 4F4LA 4LFAB 2QKSA 2UXCO 2JGDA 2ZR3A 1WPBA 1K5QA 1AVMA 1PNMA 1TUBB 4RQFA 1IXBA 4H37A 1I0HA 5IYDO 1XEQA 1YEWA 4IHJB 2QWQB 2F4VO 1KQSU 3HKCA 3OTOB 2C2AA 2YSUB 2X6AA 2WLJA 1NH2B 3FAVB 4X65O 4O4JA 4O4LA 4DO2A 3E8HA 4G2KA 4WCEV 1IDSA 4KXRA 2YXYA 3HKDA 5GONA 5B1BC 2GV9A 4QIWF 1TVKA 2GUZA 3SPIA 1OCCB 1SQFA 4H44B 1GN6A 1YZBA 1BZKA 4P9OA 3OAAG 1LUWA 3AG2C 5D5PA 1ZAUA 2JS5A 4EEQA 5LP6A 1R3JC 2CTRA 1RM1C 1EZVH 1Y76A 2HEPA 2CDYA 4UB8Z 2Y4UA 4TV8B 1YIJV 3VQWA 3HR0A 5CA0B 2HJDA 2HHHB 3BVOA 4G27B 1KKCA 4FLYA 3D3QA 2HVJC 4U3FH 1VQMV 4ZOLB 2EJRA 3K58A 4QJFB 2WLHA 4GT1A 5CN0A 2ZIOA 5B1BB 3CPWU 1SS3A 2CTPA 5DN6G 2EULA 4FFKA 1QNMA 4XDKA 3SYCA 4MW8A 3H1KH 3K08A 4JPRA 4LH6A 1VQ4V 3AG2B 4JYCA 1S76D 4LF8B 5BR8O 1T5EA 4JF3A 1RM1B 2X6CA 1K34A 3UQ8A 2ZE6A 4LFCB 1RSOB 3N2GB 1SQPH 3HKEB 3JD2A 2AXTZ 5EC1C 4JI8B 3FB7C 1R6KA 2XOKG 2YIBD 1QBZA 3S3XA 5ITZA 3STLC 2JEXA 4JI2O 1M56C 1P4RA 3ASOC 1S72V 4UUJC 2FKXA 3ICXA 3X2QC 2QSAA 1VEWA 4DXWA 1PM9A 5L3DA 3A0BZ 1P84F 2ITDC 3K3WA 1E1QG 4LNUB 3ZX6A 2BSKA 4DUZB 1Q6IA 4DK0A 3ZS8C 1GO3F 1N36O 1BE3H 1XI1A 4JI3O 4I55B 3SPCA 3UO3A 4TV9B 3CCQV 3CYOA 4CH6A 2LGWA 4JI4O 2JEUA 1YTFD 3RVYA 4BIUA 4WFFA 2W0FC 2DYSC 3E22B 4FLVA 2OIGA 4JI7B 2Q8VA 3MHSC 4WFEA 3S3WA 4DV0B 5JVDB 5CA1B 1GK9A 4O4IB
chains in the Genus database with same CATH topology
1GH6A 2QWNB 2Y4TA 1WJZA 2LO1A 4J7ZA 1FPOA 1FAFA 2CTRA 2CUGA 3APOA 1NZ6A 3UO3A 2N04A 2YUAA 3APQA 2L6LA 2CTWA 2DN9A 2LGWA 2N05A 1XBLA 2CTQA 3AG7A 2OCHA 2CTPA 2QWOB 2Y4UA 2M6YA 2YS8A 2QSAA 1BQ0A 1N4CA 2KQXA 3UCSC 2QWRB 2EJ7A 4J80A 2GUZA 2QWQB 2DMXA 3BVOA 3UO2A 4IT5A 2PF4E 1HDJA 2GUZB 2QWPB 1IURA 1BQZA 4RWUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GH6 A;  2QWN B;  2Y4T A;  1WJZ A;  2LO1 A;  4J7Z A;  1FPO A;  1FAF A;  2CTR A;  2CUG A;  3APO A;  1NZ6 A;  3UO3 A;  2N04 A;  2YUA A;  3APQ A;  2L6L A;  2CTW A;  2DN9 A;  2LGW A;  2N05 A;  1XBL A;  2CTQ A;  3AG7 A;  2OCH A;  2CTP A;  2QWO B;  2Y4U A;  2M6Y A;  2YS8 A;  2QSA A;  1BQ0 A;  1N4C A;  2KQX A;  3UCS C;  2QWR B;  2EJ7 A;  4J80 A;  2GUZ A;  2QWQ B;  2DMX A;  3BVO A;  3UO2 A;  4IT5 A;  2PF4 E;  1HDJ A;  2GUZ B;  2QWP B;  1IUR A;  1BQZ A;  4RWU A; 
#chains in the Genus database with same CATH topology
 3ASO B;  1B3Q A;  3BFR A;  3W7S A;  3UT5 B;  1MG1 A;  5B1O A;  1H8H G;  2N04 A;  4MTF A;  1E79 G;  2H94 A;  2PUS A;  3E2E A;  1KYO F;  1SES A;  4JTC B;  4K3A A;  5IJ0 A;  2Q73 A;  5E79 Z;  3M8A A;  4GYC B;  1WPX A;  2DMX A;  1A32 A;  5E1A C;  2CK3 G;  3KZI Z;  4U7N A;  3T1H B;  4PI2 A;  3ZRV A;  2CAZ C;  1UPG A;  1PL0 A;  1E1R G;  4AIL C;  5IT9 N;  1IBM O;  1HP8 A;  2ADQ B;  3APQ A;  3T1C A;  2DYS B;  4DV4 O;  3ZBH A;  2ZR2 A;  2PYL A;  2P22 C;  1TA8 A;  3BY6 A;  4XBF A;  3SDL A;  2IH1 C;  1FFT B;  2VQF O;  1FJG B;  5K1P A;  5JQG A;  1PD3 A;  3JAR A;  1QVF U;  4X65 B;  2ILM A;  2Y48 A;  5BMV A;  3K06 A;  2QM8 A;  4ZBM A;  3WB1 A;  4MVM A;  4IGG A;  4I4T A;  2MW2 B;  3W7U A;  3O9O A;  1WA8 A;  1L0N H;  4X9Q A;  3ABU A;  2IH3 C;  4UVC A;  1WLE A;  4X62 B;  4LR3 A;  2XAH A;  3UCS C;  1M9N A;  2N74 A;  4J9Y B;  4JTA B;  4ZI7 B;  4X1Y B;  2HG5 C;  1NT2 B;  1F7Y A;  1XHZ A;  1NVP B;  2LFS A;  4WFB V;  3OT7 A;  5DEC A;  4DV2 B;  1WJZ A;  3I56 V;  4R8C A;  1JQ0 A;  4X20 B;  4MTX A;  2UU9 B;  3HKB A;  2X7R B;  1SQX H;  2OCH A;  1I08 A;  3MDS A;  4DR1 O;  3CC4 V;  3ZMS A;  4FLZ A;  4FFB A;  1PP9 H;  1Q90 D;  5IYZ B;  3FAV A;  3M99 B;  3K0D A;  1CXZ B;  1SET A;  3E8G A;  2EIK C;  2YUA A;  1NU1 H;  2AHZ A;  4H0L B;  2LJ2 A;  1ARO P;  4AI8 A;  4YHH O;  2WA3 A;  3LDC A;  4X89 A;  2YI8 A;  3L9D A;  5HFL A;  4JAU A;  1AB3 A;  4YIO A;  4JYA O;  3CX5 F;  2Q7G A;  2X0L A;  4WFA V;  2XAQ A;  3H1J H;  4L8J A;  4DV5 O;  1HNZ B;  4K8Z A;  4LP8 A;  5IJ9 B;  2Y69 C;  4TV8 A;  3D8C A;  4X1I B;  3A8T A;  1P7G A;  4GUN A;  3ZHU A;  2PGG A;  4H13 B;  4I50 A;  5B3S C;  4FK5 C;  4UFZ A;  3R66 A;  1G6U A;  3P30 A;  1Q81 W;  1KEC A;  2F43 G;  5AG2 A;  3RYI A;  4YJ3 B;  4FLU A;  2PZS A;  2OYQ A;  4YJ2 B;  4N23 A;  1EN4 A;  2EIK B;  3ZMU A;  2Q68 A;  4TT3 G;  2XND G;  2Y4T A;  5JWP A;  4X64 O;  2KG7 B;  3DTU B;  3J7A U;  3KKY A;  4W4K A;  1K97 A;  4DR4 B;  4RUF A;  1NBM G;  4CH3 A;  2F1M A;  4NYK A;  3ABT A;  2CH7 B;  3CCS V;  2Q67 A;  3QG5 A;  4KHP B;  2EIJ C;  2Y69 B;  3CE2 A;  1KP3 A;  1JPX A;  2VS0 A;  1FD9 A;  1YDX A;  3JAS A;  5B3S B;  4NVP A;  5A9G A;  1VQN V;  2CTQ A;  2CE4 A;  3JAK B;  3JYC A;  3FB6 C;  5JJE B;  1SZT A;  3CRR A;  4X8A A;  3BCC H;  3DSQ A;  3F7V C;  1QVG U;  3WB0 A;  1YXB A;  4DK1 A;  4L87 A;  4LF9 O;  2O57 A;  1XMO B;  1PNK A;  1N4C A;  1Q6U A;  5BZB A;  2Q4P A;  4LNU A;  4DR7 O;  4JI0 O;  2EIJ B;  1N34 O;  4J7K A;  5JH7 B;  2JJ1 G;  4OX9 O;  4O2A B;  5KHI A;  3E8B A;  4TV9 A;  5IDJ A;  3ETG A;  3JSN A;  3W7T A;  3C3S A;  2Q6A A;  2FML A;  3JSL A;  3E22 A;  1IX9 A;  4B3S O;  1U96 A;  4MVZ A;  1KC8 W;  5JVD A;  3CXC U;  4DR3 O;  4O4I A;  5EBL C;  3QNE A;  2B5U A;  5KX5 B;  3T2M A;  3RN4 A;  1V54 C;  3J80 N;  1XNR O;  1MSD A;  5CB4 B;  1TGO A;  2EIN C;  4GLX A;  4XDJ A;  2Z0A A;  4GCZ A;  4WFH A;  1K9M W;  4Z1V A;  2Q5Z A;  1FXK A;  2UXN A;  1FXH A;  2DQ3 A;  4FM1 A;  2PF4 E;  2LP7 A;  5LHH A;  4DR6 B;  4NXN B;  4LWS B;  2CGO A;  1S5J A;  4AQY O;  3CCE V;  1Y74 B;  3BPZ A;  4JGS A;  4OGQ B;  3OR7 C;  4F6R B;  2F23 A;  2BE3 A;  2YIB A;  2M7W A;  1XUQ A;  3FB8 C;  1NH2 D;  1Z2G A;  4LF7 O;  4GX0 A;  3SYO A;  2QJ1 A;  3C3T A;  2YXL A;  2ZE7 A;  2LW7 A;  2B1I A;  4DV1 O;  3FD9 A;  3B2E E;  2NR5 A;  4E2L A;  2EIN B;  1GH6 A;  1JCH A;  3ZHR A;  3ZED A;  4MT8 A;  2GHY A;  4K0K B;  2M6Y A;  1CPY A;  1W0K G;  2ADP A;  2XAJ A;  3OUS A;  4RO2 A;  4ZI7 A;  2Z5U A;  4B7E A;  4IIJ A;  4MTO A;  2QTO A;  4MVQ A;  1ZTE A;  4LF6 O;  4DW0 A;  4J41 A;  4DR2 B;  1QLE C;  4FPP A;  2OT5 A;  4DV5 B;  1MSW D;  2AW9 A;  2UUB O;  2IBZ H;  3PJS K;  1WB8 A;  3PN1 A;  2RNB A;  1N33 O;  4PA6 A;  1MMM A;  1SA0 B;  4TQF A;  4IL6 Z;  4JI5 B;  3CCL V;  5IYZ A;  1AP5 A;  4BWA A;  1RP3 B;  2Z3Y A;  1ZUQ A;  3QF7 A;  4X64 B;  3ABK C;  4RWU A;  2HLD G;  1VQ6 V;  1AJQ A;  1JA8 A;  5LMN O;  1SC5 B;  4CS3 A;  3CRC A;  2ZXW C;  1HNW B;  1OCZ C;  4UCV A;  1K4C C;  1QLE B;  3F7Y C;  1R3I C;  1K73 W;  3OMA B;  4UVA A;  4DV7 B;  1X4T A;  3ZMT A;  4DV6 O;  4PA4 A;  2E74 B;  2JIZ G;  5IJ9 A;  1B6Q A;  4KUM A;  1IBL B;  2DWE C;  4I0X B;  5EYP B;  1THZ A;  3G6E V;  3OMI B;  3U10 A;  3IFX A;  2GDS A;  5EZY B;  1ROP A;  5CBH A;  3ETE A;  4YJ2 A;  3UO2 A;  2ZE5 A;  3JAT B;  2XHB A;  3JD1 A;  3ZN0 A;  3RYC A;  1R3L C;  1OCZ B;  2ZIN A;  4PDV A;  2A79 B;  1MAB G;  4JI0 B;  4UVB A;  3CMA V;  1B04 A;  3ML0 A;  1GM9 A;  3K9A A;  4BR6 A;  3CJH B;  5LBQ A;  3BHP A;  4PA9 A;  4FJC C;  5C8Y B;  1XMQ O;  4B3S B;  5KUM A;  2N05 A;  2ZE8 A;  4CBC A;  5FPR A;  4PI0 A;  1M1K W;  4TUY B;  5C93 A;  1PV0 A;  3NXS A;  5TIS Z;  3GWK C;  4G28 B;  3U11 A;  1WAZ A;  1HDJ A;  4XDL A;  4X66 B;  1O9H A;  3UKM A;  4R6Z A;  4R50 A;  1Q86 W;  3L73 H;  1FPO A;  2NLJ C;  4F6E A;  4PDM A;  1I94 O;  2E5L B;  3CWB H;  5GTI Z;  2B1G A;  3MAQ A;  5GTH Z;  2ITC C;  1NKD A;  2IW5 A;  4YY3 B;  4ZKI A;  5JCO C;  1JFF B;  2EJ7 A;  5JH7 A;  2CGN A;  4LFB O;  4UCS A;  5K1X A;  3E35 A;  1BS3 A;  1N0J A;  2IM9 A;  2V7Q G;  3AK3 A;  1IVS A;  5J2T A;  5IE9 A;  2IU0 A;  5BY1 A;  3FYI B;  2OCC C;  3ZHQ A;  1H2L A;  5JJN B;  3K57 A;  4J11 A;  2QGN A;  1O9G A;  3DC5 A;  1HNX B;  1Y67 A;  2OTJ V;  3RW0 A;  4CC5 A;  4U3J B;  2Q7E A;  4TQD A;  2W6I G;  2XAG A;  1F4M A;  1N32 B;  2WAM A;  4NXM B;  5CB4 A;  2A3Q A;  3JAW B;  2UUC B;  3G71 V;  4WBN B;  1IBK O;  4NB5 A;  1ZSP A;  1NVP D;  5KLV H;  4UCO A;  4MTG A;  2CTW A;  5FNV B;  4R7C A;  3ZJZ A;  3SPH A;  5CBF A;  1PL4 A;  5EIB C;  1FFX B;  4JI1 O;  4GKJ B;  3T1Y O;  4P2Z A;  1K33 A;  1VF6 C;  3CC2 V;  4HBN A;  3CXH F;  2ZQM A;  5LGN A;  4LWS A;  4CS2 A;  2OCC B;  1H8E G;  1US6 A;  1PKX A;  4J7Z A;  2EX3 A;  2UXD B;  2HKO A;  1S3J A;  3X2Q B;  2EZO A;  4Z1M G;  2GSM B;  4E4E A;  4JAV A;  1M57 C;  5J2U B;  4FZ0 A;  5LMU O;  4A5U B;  4Q20 A;  3GWO A;  1K92 A;  1H2G A;  1M90 W;  3FKS G;  4DUY O;  1S0V A;  5KMG B;  5LA6 B;  1YVW A;  3F5W C;  3D36 C;  4LF4 O;  2UXC B;  1CP9 A;  2JJ2 G;  5KHH A;  2QM4 A;  2V4D A;  3B77 A;  4B3M O;  2QEX V;  3VQV A;  1AR4 A;  2EIM C;  1QR8 A;  3P3N A;  5DED A;  2X6B A;  1ENV A;  4C7U A;  2F4V B;  1QLN A;  2WLL B;  3AG1 C;  1GN4 A;  1KU9 A;  4JYB A;  1Q43 A;  1Y6X A;  2E3C A;  4QPJ A;  4RUE A;  1DK1 A;  1R6T A;  3G4S V;  1NTM H;  1XNQ O;  1KKD A;  2D3O W;  2QWO B;  2R9A A;  4UXN A;  4CS4 A;  3H1H H;  3OEE G;  4EB6 B;  1DLB A;  2Q9L A;  1HR0 O;  3E86 A;  3N2K B;  3VQY A;  5L3C A;  1R73 A;  3L75 H;  3K9S A;  2HJF C;  5KHJ A;  3WU2 Z;  2EIM B;  4CH5 A;  3CSX A;  2FL4 A;  5LXT B;  4QPK A;  4JAA A;  3HB3 B;  1TUB A;  3AG1 B;  1TUE B;  4HNA B;  3IAY A;  3CS5 A;  4TSF G;  4IHJ A;  4DW1 A;  2W6J G;  1OCO C;  5EC2 C;  3E83 A;  2VRZ A;  2XT9 A;  4MVO A;  3H1L H;  2PY5 A;  2P67 A;  4FVM A;  1R1B A;  4MSW C;  1OHH G;  3OR6 C;  4J7J A;  4TOI A;  3CC7 V;  5LYJ B;  4CH4 A;  1R3K C;  3JAT A;  1V9P A;  1LNQ A;  5BR8 B;  2JS3 A;  2QE7 G;  2A06 H;  2QWP B;  3BEH A;  5A2Q N;  1VQO V;  1KBH A;  1M56 B;  3B4S A;  3CRA A;  3OUF A;  1IXM A;  2BCC H;  3J81 N;  2L35 A;  4O4H B;  1SQV H;  3JAL B;  1S5L Z;  2JGD B;  3I5D A;  3L74 H;  1OCO B;  1ZWI C;  5LP6 C;  1WN7 A;  5CA0 A;  2UUA O;  1X59 A;  3A2F A;  3CJH A;  3K03 A;  3MHH C;  4LBE C;  4I7Z B;  4ZOL A;  3LNN A;  5H6R A;  3DC6 A;  3U0Z A;  3HKC B;  3Q4H B;  3JD0 A;  1VMG A;  4JI2 B;  4FM2 A;  2HR3 A;  2KKW A;  4HYO A;  5L3F A;  3KG2 A;  1GN3 A;  1HWY A;  4O4J B;  4O4L B;  2YS8 A;  2XAS A;  3DGE A;  4B3R O;  3HKD B;  5GON B;  3IC9 A;  1EN5 A;  1YCI A;  3E89 A;  1N36 B;  1ZL8 B;  4JI3 B;  1MNG A;  1AI5 A;  2GTA A;  2YEV B;  4JI4 B;  4LFA O;  1RSO A;  4EFE A;  5LP6 B;  3N2G A;  5KA6 A;  5IYC O;  2ATK C;  3CRM A;  1B06 A;  3HKE A;  3T4D A;  1XBL A;  2Y0I A;  2E75 B;  1JFF A;  1AJP A;  2IJI A;  1FXV A;  4CZZ A;  5GW7 A;  3CRQ A;  1AI4 A;  1WB7 A;  5L3B A;  5IWA O;  3C90 A;  3OTO O;  1K7D A;  1KD1 W;  2HFE C;  1RFY A;  3CCU V;  5B1A C;  3R65 A;  3CCM V;  2ZM6 O;  1KB9 F;  3K59 A;  3EHB B;  5LMU B;  4FIP C;  4X88 A;  3H01 A;  3CCR V;  4MS2 A;  3WG7 C;  4U3J A;  5BXZ A;  1AI6 A;  3N27 A;  4UV8 A;  1GM7 A;  3JAW A;  1JR9 A;  4BAY A;  2RDC A;  1JOY A;  1IBM B;  4I55 A;  1OZ0 A;  5JCO A;  3VBB A;  5FNV A;  2P4V A;  3RFR A;  4DV4 B;  1NZ6 A;  4P9P A;  2QDO A;  4J42 A;  5LGT A;  3F5T A;  4NTX A;  2VQF B;  3QTC A;  3WFV A;  2IU3 A;  2WLK A;  2P4K A;  4UCU A;  5CA1 A;  2RQ6 A;  2DJV A;  5B1A B;  3STZ C;  1SQG A;  2AZ2 A;  3UT5 A;  2HHH O;  2G38 A;  4IYI A;  1Q3E A;  2Q69 A;  2R9R B;  5ITZ B;  1WP8 A;  4Q6G A;  3WG7 B;  3FB5 C;  2OTL V;  2YI9 A;  1MZF A;  2LW1 A;  1VF5 B;  1K5S A;  3ZHV A;  4J80 A;  3AG4 C;  1VAR A;  4GX5 A;  2YDE A;  4TWK A;  4LF8 O;  3IJ4 A;  1HW7 A;  2BSK B;  5F2V O;  1XHX A;  3APO A;  4MVR A;  1F4N A;  4PDR A;  2JRI A;  1AP6 A;  4DR1 B;  2R70 A;  4LFC O;  1QQC A;  1D2D A;  2ZKO A;  1S77 D;  2EBO A;  4PJ0 Z;  4JI8 O;  4IT5 A;  1V54 B;  3L71 H;  1H2N A;  2R9I A;  2PI5 A;  1QU7 A;  1COW G;  1W2B U;  1XL4 A;  2ZIM A;  2QWN B;  1FS0 G;  3A0R A;  2JDI G;  2OIE A;  1EBO A;  2BTQ B;  4EB6 A;  4LF5 O;  2RJZ A;  4YHH B;  3AG4 B;  4X1Y A;  4JYA B;  1KP2 A;  5FL7 G;  3SYA A;  4DUZ O;  5LXT A;  4X20 A;  3ZCC A;  1NTZ H;  2F95 B;  1SF9 A;  1SZX A;  4GX1 A;  2A7W A;  1PPJ H;  4BW5 A;  1YSC A;  3SJA C;  3JAM N;  2P6J A;  4HZ3 A;  1UJW B;  4JI7 O;  1GAX A;  4DV0 O;  2QKC A;  2LO1 A;  4KP4 A;  1G8M A;  4DR5 O;  1JX9 A;  3W7X A;  2LGQ A;  4B08 A;  4PEL A;  5LYJ A;  5LOV B;  3SPJ A;  2P90 A;  4B3R B;  4ASU G;  1AI7 A;  2P7T C;  4CC6 A;  1MA1 A;  1H38 A;  1GMG A;  1J5E O;  4JAS A;  5EBW C;  3RBZ A;  4U7O A;  4O2B B;  3T1H O;  3TXQ A;  4O4H A;  4EKW A;  3K5L A;  3CEI A;  4K8X A;  3JAL A;  1YJ9 V;  3LSQ A;  1AIL A;  4X1I A;  2QTS A;  3GVM A;  5CBG A;  3L70 H;  3TET A;  2DN9 A;  2P06 A;  3HKB B;  2K9P A;  1KMI Z;  1WNS A;  4ZHQ B;  5IWA B;  4YJ3 A;  2ETN A;  4GX2 A;  3ZRW B;  5J9P C;  3ABK B;  4WF9 V;  3Q4H A;  4QGP A;  4D6T H;  4FFB B;  1FJG O;  2ZM6 B;  1DGS A;  1NR7 A;  2KG7 A;  3M7M X;  2ZXW B;  4JYY A;  4LF9 B;  2WLI B;  1AR5 A;  4Z2W A;  4GZR B;  4QNH B;  2CH7 A;  2DWD C;  1XDC A;  4DR7 B;  2ZCE A;  4X62 O;  3ZHT A;  2QWR B;  1N34 B;  1ZL8 A;  4N21 A;  3ZHS A;  3K5N A;  4OX9 B;  1NTK H;  3HPL C;  3CHX A;  2YEV A;  5IYB O;  1Z5W A;  1YHQ V;  2F93 B;  4I9Q A;  4DV2 O;  3KCY A;  1YIT V;  1GKF A;  4GKK O;  2UU9 O;  1VIB A;  3JAK A;  1DTO A;  1W0J G;  4NTW A;  1K3E A;  4K35 A;  2LFR A;  4I50 B;  4DR3 B;  3OM3 B;  2ZNI A;  2DOS A;  2UXB O;  3AG3 C;  3IC7 A;  4W4L A;  3EVK A;  1YJN V;  5FLX N;  3RYI B;  1MOF A;  1XNR B;  4UV9 A;  3EFF K;  3ETQ A;  1D5A A;  1VP7 A;  3K5O A;  1YI2 V;  3K0G A;  3ABL C;  2H8P C;  4EFB A;  1ZX3 A;  1DF5 A;  5EIB D;  2D2C B;  1BMF G;  2AHY A;  4O2A A;  1VF7 A;  1H2S B;  4AQY B;  3ZMV A;  2K1E A;  1XQ8 A;  4OPA A;  4LCU C;  2A0L A;  3SR2 C;  2JVD A;  4AHC A;  1EM1 A;  2QA4 V;  2ODM A;  1AJN A;  3AK1 A;  5EK0 A;  4LF7 B;  3BA9 A;  3H1I H;  1HNZ O;  3JAS B;  1VQ9 V;  2BTO A;  3AG3 B;  3QO8 A;  4FLT A;  4DV1 B;  1URF A;  1QR9 A;  3LSU A;  1BT8 A;  5KX5 A;  1P49 A;  4B3T O;  1F51 A;  1FYJ A;  3OE7 G;  3ABL B;  1DF4 A;  4MW3 A;  5CA3 A;  1BHB A;  4LF5 B;  2ZDI C;  1N0N A;  2WWW A;  5DM6 V;  4DR4 O;  4D7S A;  1BQ0 A;  2WSS G;  4LF6 B;  4JV5 O;  1CEZ A;  1FXK C;  2EIL C;  2UUB B;  1Y74 A;  4UB6 Z;  4KHP O;  1NJI W;  2Q7H A;  1YJW V;  4F6R A;  1FAF A;  1N33 B;  1EN6 A;  2XUM A;  1G1X B;  5KHK A;  5JJJ B;  3B40 A;  2VQE O;  4I9W A;  1XL6 A;  4YIP A;  3LDD A;  2FYU H;  2WLN A;  5IY5 C;  3UM7 A;  3ZRS A;  1NR1 A;  4PA3 A;  2IJK A;  1Q82 W;  1Q5O A;  4ICG A;  1Q7Y W;  5LMN B;  1GM8 A;  4DR5 B;  3I55 V;  1VQ5 V;  1L1F A;  1JVM A;  2BTQ A;  5LHG A;  2YC0 A;  3BAA A;  5L3G A;  2AZ0 A;  1VQK V;  4JZ2 A;  3VQX A;  4IYH A;  3JD3 A;  3E8F A;  5H6Q A;  3SYP A;  1XMO O;  1U97 A;  2ZNJ A;  1NQT A;  1J5E B;  2P5O A;  3ZRX A;  1FXK B;  2EIL B;  3DXR B;  1GN2 A;  2EZP A;  4PDL A;  4DV6 B;  4MVS A;  2H3O A;  2OWO A;  3JD4 A;  1Y4M A;  3SJB C;  2VWJ A;  1OV9 A;  1M57 B;  1SA0 A;  5LL6 Y;  3O65 A;  1N8R W;  3B8M A;  3MD0 A;  5IY5 B;  4UCR A;  3ZIA G;  3L72 H;  2YXH A;  2QR4 A;  2QKA A;  1SQB H;  3ZN1 A;  4LH7 A;  5L3E A;  2YIC A;  3TXS A;  1FKA O;  3K04 A;  1LUV A;  4JTD B;  1KUQ A;  1SRY A;  5EBM C;  2W0X A;  5D5Q A;  1BSM A;  2XAF A;  5LOV A;  4DRX B;  1D5N A;  1NS1 A;  2DE0 X;  1ZLZ A;  3LUT B;  3W7W A;  1VQ8 V;  3K79 A;  4OPH A;  4DV3 O;  2Q0A A;  4LC1 A;  1M93 A;  2FB5 A;  4IIJ B;  4O2B A;  3CCJ V;  4DR6 O;  4I0X A;  5EYP A;  3TCU A;  1YTF B;  2MK3 A;  1XMQ B;  4GKK B;  4NXN O;  3SJC C;  3RYH B;  2WPD G;  1BGY H;  5EZY A;  4QE9 A;  1VQP V;  4ZHQ A;  3NR7 A;  2UXB B;  3ZRW A;  4HAM A;  5B1N A;  1GRJ A;  5HFM A;  4X1K B;  2PTM A;  3CP1 A;  4DYL A;  1LR1 A;  4PV1 B;  5KUK A;  2WLI A;  3D3I A;  1I94 B;  3THO A;  3RYF B;  4BIO A;  3G67 A;  5KAF Z;  1Y66 A;  2PYJ A;  1XRE A;  5LGU A;  4RAI A;  4K0K O;  4LFB B;  2KSD A;  3CD6 V;  2A9H A;  4H33 A;  1G4Y B;  4NKG B;  1V55 C;  5C8Y A;  4DR2 O;  1QCE A;  4RQE A;  4YXW G;  5H5N A;  3FYE B;  3VOU A;  1M4U A;  3CB2 A;  4TUY A;  3P32 A;  4JI5 O;  4B3T B;  4JI6 O;  3FFQ A;  5B66 Z;  1M5I A;  3G6B A;  1TVK B;  2GUZ B;  1IBK B;  3BRC A;  3LDE A;  3RYC B;  1K4D C;  3AEI A;  3OW2 U;  2XTA A;  1RPO A;  3H9V A;  3ZMZ A;  5B5E Z;  1HNW O;  4JI1 B;  1Y76 B;  3ETD A;  3B8N A;  2ZT9 B;  3T1Y B;  4PHZ A;  3OD4 A;  1L8D A;  3SPG A;  3SGI A;  4JV5 B;  4BIZ A;  2QM7 A;  1V55 B;  1J95 A;  1PNL A;  4FLX A;  2RN9 A;  1L0L H;  1I5Y A;  4DV7 O;  2UXX A;  2F66 C;  5KA5 A;  3QVN A;  2VQE B;  1SER A;  4KFM A;  1IBL O;  3AG7 A;  4B7K A;  2WLM A;  3A0H Z;  4DUY B;  2IJJ A;  3CCV V;  4QE7 A;  3WB2 A;  4LF4 B;  3CME V;  4WBN A;  3BA8 A;  4B3M B;  2CUG A;  1OCR C;  1MZE A;  3SJQ C;  2YID A;  3LSS A;  1FFX A;  3TGU H;  1JJ2 U;  2HP8 A;  2ZD9 A;  2DQ0 A;  4FMT A;  4NTY A;  1XIL A;  2VWK A;  4D7T A;  1VQ7 V;  5KAI Z;  4ABM A;  3OEH G;  1XNQ B;  3GB7 C;  5J2T B;  3RWR D;  2R72 A;  1GTO A;  2B9Z A;  2BOC C;  5J2U A;  1EFR G;  3OTF A;  1AR1 B;  3OGC C;  2FTK A;  2NN4 A;  2GTS A;  3QO5 A;  1HR0 B;  4FLW A;  5KMG A;  4FM0 A;  3OGI B;  5LA6 A;  2ZDI A;  1EZJ A;  1F23 A;  1OCR B;  1JMK C;  4X66 O;  4JZG A;  5H2F Z;  1XOU A;  2DYR C;  4PD4 F;  2PI4 A;  1QHT A;  2HVK C;  1VF6 A;  2IJH A;  2E5L O;  4DV3 B;  1K8A W;  3DXR A;  2WLL A;  5FPO A;  1H2K A;  3OFN G;  3TK1 A;  4YY3 O;  3BAB A;  4FZ1 A;  3K5M A;  4I5S A;  1I5X A;  3IGA C;  4MVU A;  1Q8I A;  3KCX A;  4NR1 A;  5KHG A;  4BW9 A;  3JCU Z;  3T4Z A;  1R6N A;  3FX7 A;  1SKV A;  3ABM C;  2LQT A;  4P30 A;  2E76 B;  3EXA A;  2YIA A;  2KB1 A;  1Q6H A;  3D36 A;  2KQX A;  2AGA A;  2JK5 C;  2WA4 A;  3RVZ A;  1JJO A;  3N2K A;  1BL8 A;  3SYQ A;  1VQL V;  1HNX O;  3AK2 A;  4PA7 A;  4J9Z B;  2BOB C;  5IJ0 B;  2GBO A;  2RCV A;  2DYR B;  1IUR A;  1N32 O;  1BCC H;  1UFI A;  4DRX A;  4NXM O;  2RMK B;  1YF2 A;  2UUC O;  3ASN C;  2Y0P A;  2ARH A;  3TJT A;  2L6L A;  4HNA A;  1W59 A;  3P3P A;  3QO7 A;  1NI8 A;  4KL1 A;  2UUA B;  3RT3 C;  1RPR A;  2DW4 A;  2JGU A;  5CMU A;  4GKJ O;  4J10 A;  3ABM B;  1BQZ A;  2Q0O C;  4WFG A;  3RYH A;  1P7B A;  5JQG B;  1S5H C;  3JAR B;  3JCZ A;  3B09 A;  5BMV B;  1Z5V A;  1I7F A;  3RGB A;  2UXD O;  3OMN B;  4I4T B;  1WA8 B;  4OXS A;  4JI6 B;  3LNM B;  1ORQ C;  5LHI A;  1BHA A;  1WP7 A;  4X1K A;  4ZIB A;  1H2M A;  1SQQ H;  1OJH A;  5H9C A;  2NNU A;  3G80 A;  1OCC C;  3ASN B;  3RYF A;  1IZ3 A;  2V1D A;  4UCT A;  1TAE A;  4F4L A;  4LFA B;  2QKS A;  2UXC O;  2JGD A;  2ZR3 A;  1WPB A;  1K5Q A;  1AVM A;  1PNM A;  1TUB B;  4RQF A;  1IXB A;  4H37 A;  1I0H A;  5IYD O;  1XEQ A;  1YEW A;  4IHJ B;  2QWQ B;  2F4V O;  1KQS U;  3HKC A;  3OTO B;  2C2A A;  2YSU B;  2X6A A;  2WLJ A;  1NH2 B;  3FAV B;  4X65 O;  4O4J A;  4O4L A;  4DO2 A;  3E8H A;  4G2K A;  4WCE V;  1IDS A;  4KXR A;  2YXY A;  3HKD A;  5GON A;  5B1B C;  2GV9 A;  4QIW F;  1TVK A;  2GUZ A;  3SPI A;  1OCC B;  1SQF A;  4H44 B;  1GN6 A;  1YZB A;  1BZK A;  4P9O A;  3OAA G;  1LUW A;  3AG2 C;  5D5P A;  1ZAU A;  2JS5 A;  4EEQ A;  5LP6 A;  1R3J C;  2CTR A;  1RM1 C;  1EZV H;  1Y76 A;  2HEP A;  2CDY A;  4UB8 Z;  2Y4U A;  4TV8 B;  1YIJ V;  3VQW A;  3HR0 A;  5CA0 B;  2HJD A;  2HHH B;  3BVO A;  4G27 B;  1KKC A;  4FLY A;  3D3Q A;  2HVJ C;  4U3F H;  1VQM V;  4ZOL B;  2EJR A;  3K58 A;  4QJF B;  2WLH A;  4GT1 A;  5CN0 A;  2ZIO A;  5B1B B;  3CPW U;  1SS3 A;  2CTP A;  5DN6 G;  2EUL A;  4FFK A;  1QNM A;  4XDK A;  3SYC A;  4MW8 A;  3H1K H;  3K08 A;  4JPR A;  4LH6 A;  1VQ4 V;  3AG2 B;  4JYC A;  1S76 D;  4LF8 B;  5BR8 O;  1T5E A;  4JF3 A;  1RM1 B;  2X6C A;  1K34 A;  3UQ8 A;  2ZE6 A;  4LFC B;  1RSO B;  3N2G B;  1SQP H;  3HKE B;  3JD2 A;  2AXT Z;  5EC1 C;  4JI8 B;  3FB7 C;  1R6K A;  2XOK G;  2YIB D;  1QBZ A;  3S3X A;  5ITZ A;  3STL C;  2JEX A;  4JI2 O;  1M56 C;  1P4R A;  3ASO C;  1S72 V;  4UUJ C;  2FKX A;  3ICX A;  3X2Q C;  2QSA A;  1VEW A;  4DXW A;  1PM9 A;  5L3D A;  3A0B Z;  1P84 F;  2ITD C;  3K3W A;  1E1Q G;  4LNU B;  3ZX6 A;  2BSK A;  4DUZ B;  1Q6I A;  4DK0 A;  3ZS8 C;  1GO3 F;  1N36 O;  1BE3 H;  1XI1 A;  4JI3 O;  4I55 B;  3SPC A;  3UO3 A;  4TV9 B;  3CCQ V;  3CYO A;  4CH6 A;  2LGW A;  4JI4 O;  2JEU A;  1YTF D;  3RVY A;  4BIU A;  4WFF A;  2W0F C;  2DYS C;  3E22 B;  4FLV A;  2OIG A;  4JI7 B;  2Q8V A;  3MHS C;  4WFE A;  3S3W A;  4DV0 B;  5JVD B;  5CA1 B;  1GK9 A;  4O4I B; 
#chains in the Genus database with same CATH homology
 1GH6 A;  2QWN B;  2Y4T A;  1WJZ A;  2LO1 A;  4J7Z A;  1FPO A;  1FAF A;  2CTR A;  2CUG A;  3APO A;  1NZ6 A;  3UO3 A;  2N04 A;  2YUA A;  3APQ A;  2L6L A;  2CTW A;  2DN9 A;  2LGW A;  2N05 A;  1XBL A;  2CTQ A;  3AG7 A;  2OCH A;  2CTP A;  2QWO B;  2Y4U A;  2M6Y A;  2YS8 A;  2QSA A;  1BQ0 A;  1N4C A;  2KQX A;  3UCS C;  2QWR B;  2EJ7 A;  4J80 A;  2GUZ A;  2QWQ B;  2DMX A;  3BVO A;  3UO2 A;  4IT5 A;  2PF4 E;  1HDJ A;  2GUZ B;  2QWP B;  1IUR A;  1BQZ A;  4RWU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...