2CTXA

The refined crystal structure of alpha-cobratoxin from naja naja siamensis at 2.4-angstroms resolution
Total Genus 11
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
11
sequence length
71
structure length
71
Chain Sequence
IRCFITPDITSKDCPNGHVCYTKTWCDAFCSIRGKRVDLGCAATCPTVKTGVDIQCCSTDNCNPFPTRKRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-COBRATOXIN
publication title The refined crystal structure of alpha-cobratoxin from Naja naja siamensis at 2.4-A resolution.
pubmed rcsb
source organism Naja naja
molecule tags Neurotoxin
total genus 11
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 1991-09-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00087 Toxin_TOLIP Snake toxin and toxin-like protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.10.60.10 Mainly Beta Ribbon CD59 CD59 2ctxA00
3BT2U 1LXGA 4BIKB 2H62C 1KXIA 4EY8B 1KFHA 1QKDA 2H64C 2H7ZA 2K3GA 1HOYA 1PLOA 1ERGA 1CDSA 2BHIA 1RL5A 3EBXA 1QKEA 1G6MA 2MUOA 3FEVA 2BTXA 1KU6B 2MUPA 1I02A 1HAAA 1M9ZA 1BTEA 1ERAA 5IMTD 1IDIA 2HLQA 4AEAA 1YWHA 2HLRA 1B41B 2MJ4A 2N99A 1NXBA 2H8UA 2PJYC 1CVOA 4FAOE 2I9BE 3QB4B 1FRAA 2LA1A 2QJBC 2J8BA 1NEAA 1W6BA 2H64B 1LSIA 1IK8A 1LJZA 1CRFA 2QJAC 2NBTA 1DRSA 1UG4A 4UY2C 4HQPF 1KBSA 1LXHA 1BXPA 1HC9A 5IMYC 2GOOC 4QTIU 4BDTB 4P7UA 1NYSA 2CDXA 1CODA 2OFSA 3NEQA 2CCXA 1FSSB 3U74U 2UWRA 4XJJA 1KS6A 1COEA 1CCQA 2PJYB 3PLCA 2MFAA 1ABTA 2L03A 4IYEA 6EBXA 2X8BB 3KFDI 1FFJA 1MAHF 1H0JA 1FF4A 1IDGA 2CRSA 2MJYA 1ONJA 1JBDA 2QJ9C 2ABXA 4OM5A 1TXBA 3NH7A 1KBAA 1NORA 2H7ZB 4ZQYA 1CTXA 1QM7A 1XT3A 1CDTA 1CXNA 2FD6U 2GOOB 1CDQA 2VLWA 4RUDA 1V6PA 1JGKA 2JQPA 3U73U 2CTXA 2UX2A 1IKCA 1KBTA 2ERAA 1ZADA 1IDLA 3KFDE 1CDRA 4LFTA 1LX5B 1KL8A 1RGJA 3HH7A 1VB0A 3BT1U 2QC1A 2MJ0A 1NTNA 1IDHA 1CHVS 1F8UB 2JVEA 1FSCA 1KTZB 3NDSA 2H5FA 2LCRA 3ERAA 1NYUA 3VTSA 1HAJA 2CRTA 2MHYA 1ES7B 5DZ5A 1KC4A 1L4WA 1TXAA 4FAOC 1HC9B 1CXOA 1F94A 3LAQU 5DU1A 1TFSA 1JE9A 1FASA 1TGXA 1NTXA 5DO6A 4DO8A 2H62D 1S4YA 1IJCA 1CB9A 3EVSC 2L5SA 1REWC 1CREA 4OM4A 1IQ9A 1MR6A 5EBXA
chains in the Genus database with same CATH superfamily
3BT2U 1LXGA 4BIKB 2H62C 1KXIA 4EY8B 1KFHA 1QKDA 2H64C 2H7ZA 2K3GA 1HOYA 1PLOA 1ERGA 1CDSA 2BHIA 1RL5A 3EBXA 1QKEA 1G6MA 2MUOA 3FEVA 2BTXA 1KU6B 2MUPA 4KSNA 1HAAA 1I02A 1M9ZA 1BTEA 1ERAA 5IMTD 1IDIA 2HLQA 4AEAA 1YWHA 2HLRA 1B41B 2MJ4A 2N99A 1NXBA 2H8UA 2PJYC 1CVOA 4FAOE 2I9BE 3QB4B 1FRAA 2LA1A 2QJBC 2J8BA 1NEAA 1W6BA 2H64B 1LSIA 1IK8A 1LJZA 1CRFA 2QJAC 2NBTA 1DRSA 1UG4A 4UY2C 4HQPF 1KBSA 1LXHA 1BXPA 1HC9A 5IMYC 2GOOC 4QTIU 4BDTB 4P7UA 1NYSA 2CDXA 1CODA 2OFSA 3NEQA 2CCXA 1FSSB 3U74U 2UWRA 4XJJA 1KS6A 1COEA 1CCQA 2PJYB 3PLCA 2MFAA 1ABTA 2L03A 4IYEA 6EBXA 2X8BB 3KFDI 1FFJA 1MAHF 1H0JA 1FF4A 1IDGA 2CRSA 2MJYA 1ONJA 1JBDA 2QJ9C 2ABXA 4OM5A 1TXBA 3NH7A 1KBAA 1NORA 2H7ZB 4ZQYA 1CTXA 1QM7A 1XT3A 1CDTA 1CXNA 2FD6U 2GOOB 1CDQA 2VLWA 4RUDA 1V6PA 1JGKA 2JQPA 3U73U 2CTXA 2UX2A 1IKCA 1KBTA 2ERAA 1ZADA 1IDLA 3KFDE 1CDRA 4LFTA 1LX5B 1KL8A 1RGJA 3HH7A 1VB0A 3BT1U 2QC1A 2MJ0A 1NTNA 1IDHA 1CHVS 1F8UB 2JVEA 1FSCA 1KTZB 3NDSA 2H5FA 2LCRA 3ERAA 1NYUA 3VTSA 1HAJA 2CRTA 2MHYA 1ES7B 5DZ5A 1KC4A 1L4WA 1TXAA 4FAOC 1HC9B 1CXOA 1F94A 3LAQU 5DU1A 1TFSA 1JE9A 1FASA 1TGXA 1NTXA 5DO6A 4DO8A 2H62D 1S4YA 1IJCA 1CB9A 3EVSC 2L5SA 1REWC 1CREA 4OM4A 1IQ9A 1MR6A 5EBXA
chains in the Genus database with same CATH topology
3BT2U 1LXGA 4BIKB 2H62C 1KXIA 4EY8B 1KFHA 1QKDA 2H64C 2H7ZA 2K3GA 1HOYA 1PLOA 1ERGA 1CDSA 2BHIA 1RL5A 3EBXA 1QKEA 1G6MA 2MUOA 3FEVA 2BTXA 1KU6B 2MUPA 4KSNA 1HAAA 1I02A 1M9ZA 1BTEA 1ERAA 5IMTD 1IDIA 2HLQA 4AEAA 1YWHA 2HLRA 1B41B 2MJ4A 2N99A 1NXBA 2H8UA 2PJYC 1CVOA 4FAOE 2I9BE 3QB4B 1FRAA 2LA1A 2QJBC 2J8BA 1NEAA 1W6BA 2H64B 1LSIA 1IK8A 1LJZA 1CRFA 2QJAC 2NBTA 1DRSA 1UG4A 4UY2C 4HQPF 1KBSA 1LXHA 1BXPA 1HC9A 5IMYC 2GOOC 4QTIU 4BDTB 4P7UA 1NYSA 2CDXA 1CODA 2OFSA 3NEQA 2CCXA 1FSSB 3U74U 2UWRA 4XJJA 1KS6A 1COEA 1CCQA 2PJYB 3PLCA 2MFAA 1ABTA 2L03A 4IYEA 6EBXA 2X8BB 3KFDI 1FFJA 1MAHF 1H0JA 1FF4A 1IDGA 2CRSA 2MJYA 1ONJA 1JBDA 2QJ9C 2ABXA 4OM5A 1TXBA 3NH7A 1KBAA 1NORA 2H7ZB 4ZQYA 1CTXA 1QM7A 1XT3A 1CDTA 1CXNA 2FD6U 2GOOB 1CDQA 2VLWA 4RUDA 1V6PA 1JGKA 2JQPA 3U73U 2CTXA 2UX2A 1IKCA 1KBTA 2ERAA 1ZADA 1IDLA 3KFDE 1CDRA 4LFTA 1LX5B 1KL8A 1RGJA 3HH7A 1VB0A 3BT1U 2QC1A 2MJ0A 1NTNA 1IDHA 1CHVS 1F8UB 2JVEA 1FSCA 1KTZB 3NDSA 2H5FA 2LCRA 3ERAA 1NYUA 3VTSA 1HAJA 2CRTA 2MHYA 1ES7B 5DZ5A 1KC4A 1L4WA 1TXAA 4FAOC 1HC9B 1CXOA 1F94A 3LAQU 5DU1A 1TFSA 1JE9A 1FASA 1TGXA 1NTXA 5DO6A 4DO8A 2H62D 1S4YA 1IJCA 1CB9A 3EVSC 2L5SA 1REWC 1CREA 4OM4A 1IQ9A 1MR6A 5EBXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BT2 U;  1LXG A;  4BIK B;  2H62 C;  1KXI A;  4EY8 B;  1KFH A;  1QKD A;  2H64 C;  2H7Z A;  2K3G A;  1HOY A;  1PLO A;  1ERG A;  1CDS A;  2BHI A;  1RL5 A;  3EBX A;  1QKE A;  1G6M A;  2MUO A;  3FEV A;  2BTX A;  1KU6 B;  2MUP A;  1I02 A;  1HAA A;  1M9Z A;  1BTE A;  1ERA A;  5IMT D;  1IDI A;  2HLQ A;  4AEA A;  1YWH A;  2HLR A;  1B41 B;  2MJ4 A;  2N99 A;  1NXB A;  2H8U A;  2PJY C;  1CVO A;  4FAO E;  2I9B E;  3QB4 B;  1FRA A;  2LA1 A;  2QJB C;  2J8B A;  1NEA A;  1W6B A;  2H64 B;  1LSI A;  1IK8 A;  1LJZ A;  1CRF A;  2QJA C;  2NBT A;  1DRS A;  1UG4 A;  4UY2 C;  4HQP F;  1KBS A;  1LXH A;  1BXP A;  1HC9 A;  5IMY C;  2GOO C;  4QTI U;  4BDT B;  4P7U A;  1NYS A;  2CDX A;  1COD A;  2OFS A;  3NEQ A;  2CCX A;  1FSS B;  3U74 U;  2UWR A;  4XJJ A;  1KS6 A;  1COE A;  1CCQ A;  2PJY B;  3PLC A;  2MFA A;  1ABT A;  2L03 A;  4IYE A;  6EBX A;  2X8B B;  3KFD I;  1FFJ A;  1MAH F;  1H0J A;  1FF4 A;  1IDG A;  2CRS A;  2MJY A;  1ONJ A;  1JBD A;  2QJ9 C;  2ABX A;  4OM5 A;  1TXB A;  3NH7 A;  1KBA A;  1NOR A;  2H7Z B;  4ZQY A;  1CTX A;  1QM7 A;  1XT3 A;  1CDT A;  1CXN A;  2FD6 U;  2GOO B;  1CDQ A;  2VLW A;  4RUD A;  1V6P A;  1JGK A;  2JQP A;  3U73 U;  2CTX A;  2UX2 A;  1IKC A;  1KBT A;  2ERA A;  1ZAD A;  1IDL A;  3KFD E;  1CDR A;  4LFT A;  1LX5 B;  1KL8 A;  1RGJ A;  3HH7 A;  1VB0 A;  3BT1 U;  2QC1 A;  2MJ0 A;  1NTN A;  1IDH A;  1CHV S;  1F8U B;  2JVE A;  1FSC A;  1KTZ B;  3NDS A;  2H5F A;  2LCR A;  3ERA A;  1NYU A;  3VTS A;  1HAJ A;  2CRT A;  2MHY A;  1ES7 B;  5DZ5 A;  1KC4 A;  1L4W A;  1TXA A;  4FAO C;  1HC9 B;  1CXO A;  1F94 A;  3LAQ U;  5DU1 A;  1TFS A;  1JE9 A;  1FAS A;  1TGX A;  1NTX A;  5DO6 A;  4DO8 A;  2H62 D;  1S4Y A;  1IJC A;  1CB9 A;  3EVS C;  2L5S A;  1REW C;  1CRE A;  4OM4 A;  1IQ9 A;  1MR6 A;  5EBX A; 
#chains in the Genus database with same CATH topology
 3BT2 U;  1LXG A;  4BIK B;  2H62 C;  1KXI A;  4EY8 B;  1KFH A;  1QKD A;  2H64 C;  2H7Z A;  2K3G A;  1HOY A;  1PLO A;  1ERG A;  1CDS A;  2BHI A;  1RL5 A;  3EBX A;  1QKE A;  1G6M A;  2MUO A;  3FEV A;  2BTX A;  1KU6 B;  2MUP A;  4KSN A;  1HAA A;  1I02 A;  1M9Z A;  1BTE A;  1ERA A;  5IMT D;  1IDI A;  2HLQ A;  4AEA A;  1YWH A;  2HLR A;  1B41 B;  2MJ4 A;  2N99 A;  1NXB A;  2H8U A;  2PJY C;  1CVO A;  4FAO E;  2I9B E;  3QB4 B;  1FRA A;  2LA1 A;  2QJB C;  2J8B A;  1NEA A;  1W6B A;  2H64 B;  1LSI A;  1IK8 A;  1LJZ A;  1CRF A;  2QJA C;  2NBT A;  1DRS A;  1UG4 A;  4UY2 C;  4HQP F;  1KBS A;  1LXH A;  1BXP A;  1HC9 A;  5IMY C;  2GOO C;  4QTI U;  4BDT B;  4P7U A;  1NYS A;  2CDX A;  1COD A;  2OFS A;  3NEQ A;  2CCX A;  1FSS B;  3U74 U;  2UWR A;  4XJJ A;  1KS6 A;  1COE A;  1CCQ A;  2PJY B;  3PLC A;  2MFA A;  1ABT A;  2L03 A;  4IYE A;  6EBX A;  2X8B B;  3KFD I;  1FFJ A;  1MAH F;  1H0J A;  1FF4 A;  1IDG A;  2CRS A;  2MJY A;  1ONJ A;  1JBD A;  2QJ9 C;  2ABX A;  4OM5 A;  1TXB A;  3NH7 A;  1KBA A;  1NOR A;  2H7Z B;  4ZQY A;  1CTX A;  1QM7 A;  1XT3 A;  1CDT A;  1CXN A;  2FD6 U;  2GOO B;  1CDQ A;  2VLW A;  4RUD A;  1V6P A;  1JGK A;  2JQP A;  3U73 U;  2CTX A;  2UX2 A;  1IKC A;  1KBT A;  2ERA A;  1ZAD A;  1IDL A;  3KFD E;  1CDR A;  4LFT A;  1LX5 B;  1KL8 A;  1RGJ A;  3HH7 A;  1VB0 A;  3BT1 U;  2QC1 A;  2MJ0 A;  1NTN A;  1IDH A;  1CHV S;  1F8U B;  2JVE A;  1FSC A;  1KTZ B;  3NDS A;  2H5F A;  2LCR A;  3ERA A;  1NYU A;  3VTS A;  1HAJ A;  2CRT A;  2MHY A;  1ES7 B;  5DZ5 A;  1KC4 A;  1L4W A;  1TXA A;  4FAO C;  1HC9 B;  1CXO A;  1F94 A;  3LAQ U;  5DU1 A;  1TFS A;  1JE9 A;  1FAS A;  1TGX A;  1NTX A;  5DO6 A;  4DO8 A;  2H62 D;  1S4Y A;  1IJC A;  1CB9 A;  3EVS C;  2L5S A;  1REW C;  1CRE A;  4OM4 A;  1IQ9 A;  1MR6 A;  5EBX A; 
#chains in the Genus database with same CATH homology
 3BT2 U;  1LXG A;  4BIK B;  2H62 C;  1KXI A;  4EY8 B;  1KFH A;  1QKD A;  2H64 C;  2H7Z A;  2K3G A;  1HOY A;  1PLO A;  1ERG A;  1CDS A;  2BHI A;  1RL5 A;  3EBX A;  1QKE A;  1G6M A;  2MUO A;  3FEV A;  2BTX A;  1KU6 B;  2MUP A;  4KSN A;  1HAA A;  1I02 A;  1M9Z A;  1BTE A;  1ERA A;  5IMT D;  1IDI A;  2HLQ A;  4AEA A;  1YWH A;  2HLR A;  1B41 B;  2MJ4 A;  2N99 A;  1NXB A;  2H8U A;  2PJY C;  1CVO A;  4FAO E;  2I9B E;  3QB4 B;  1FRA A;  2LA1 A;  2QJB C;  2J8B A;  1NEA A;  1W6B A;  2H64 B;  1LSI A;  1IK8 A;  1LJZ A;  1CRF A;  2QJA C;  2NBT A;  1DRS A;  1UG4 A;  4UY2 C;  4HQP F;  1KBS A;  1LXH A;  1BXP A;  1HC9 A;  5IMY C;  2GOO C;  4QTI U;  4BDT B;  4P7U A;  1NYS A;  2CDX A;  1COD A;  2OFS A;  3NEQ A;  2CCX A;  1FSS B;  3U74 U;  2UWR A;  4XJJ A;  1KS6 A;  1COE A;  1CCQ A;  2PJY B;  3PLC A;  2MFA A;  1ABT A;  2L03 A;  4IYE A;  6EBX A;  2X8B B;  3KFD I;  1FFJ A;  1MAH F;  1H0J A;  1FF4 A;  1IDG A;  2CRS A;  2MJY A;  1ONJ A;  1JBD A;  2QJ9 C;  2ABX A;  4OM5 A;  1TXB A;  3NH7 A;  1KBA A;  1NOR A;  2H7Z B;  4ZQY A;  1CTX A;  1QM7 A;  1XT3 A;  1CDT A;  1CXN A;  2FD6 U;  2GOO B;  1CDQ A;  2VLW A;  4RUD A;  1V6P A;  1JGK A;  2JQP A;  3U73 U;  2CTX A;  2UX2 A;  1IKC A;  1KBT A;  2ERA A;  1ZAD A;  1IDL A;  3KFD E;  1CDR A;  4LFT A;  1LX5 B;  1KL8 A;  1RGJ A;  3HH7 A;  1VB0 A;  3BT1 U;  2QC1 A;  2MJ0 A;  1NTN A;  1IDH A;  1CHV S;  1F8U B;  2JVE A;  1FSC A;  1KTZ B;  3NDS A;  2H5F A;  2LCR A;  3ERA A;  1NYU A;  3VTS A;  1HAJ A;  2CRT A;  2MHY A;  1ES7 B;  5DZ5 A;  1KC4 A;  1L4W A;  1TXA A;  4FAO C;  1HC9 B;  1CXO A;  1F94 A;  3LAQ U;  5DU1 A;  1TFS A;  1JE9 A;  1FAS A;  1TGX A;  1NTX A;  5DO6 A;  4DO8 A;  2H62 D;  1S4Y A;  1IJC A;  1CB9 A;  3EVS C;  2L5S A;  1REW C;  1CRE A;  4OM4 A;  1IQ9 A;  1MR6 A;  5EBX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...