2CTZA

Crystal structure of o-acetyl homoserine sulfhydrylase from thermus thermophilus hb8
Total Genus 143
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
143
sequence length
421
structure length
421
Chain Sequence
MRFETLQLHAGYEPEPTTLSRQVPIYPTTSYVFKSPEHAANLFALKEFGNIYSRIMNPTVDVLEKRLAALEGGKAALATASGHAAQFLALTTLAQAGDNIVSTPNLYGGTFNQFKVTLKRLGIEVRFTSREERPEEFLALTDEKTRAWWVESIGNPALNIPDLEALAQAAREKGVALIVDNTFGMGGYLLRPLAWGAALVTHSLTKWVGGHGAVIAGAIVDGGNFPWEGGRYPLLTEPQPGYHGLRLTEAFGELAFIVKARVDGLRDQGQALGPFEAWVVLLGMETLSLRAERHVENTLHLAHWLLEQPQVAWVNYPGLPHHPHHDRAQKYFKGKPGAVLTFGLKGGYEAAKRFISRLKLISHLANVGDTRTLAIHPASTTHSQLSPEEQAQAGVSPEMVRLSVGLEHVEDLKAELKEALA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of o-acetyl homoserine sulfhydrylase from Thermus thermophilus HB8
rcsb
source organism Thermus thermophilus
molecule tags Transferase
molecule keywords O-acetyl-L-homoserine sulfhydrylase
total genus 143
structure length 421
sequence length 421
chains with identical sequence B
ec nomenclature ec 2.5.1.-:
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01053 Cys_Met_Meta_PP Cys/Met metabolism PLP-dependent enzyme
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.640.10 Alpha Beta 3-Layer(aba) Sandwich Aspartate Aminotransferase; domain 2 Type I PLP-dependent aspartate aminotransferase-like (Major domain) 2ctzA01
3.90.1150.10 Alpha Beta Alpha-Beta Complex Aspartate Aminotransferase, domain 1 Aspartate Aminotransferase, domain 1 2ctzA02
2DGKA 2O7CA 2W7LA 2W7MA 2Z1ZA 3VK2A 1TARA 1CZEA 1AKCA 1E5EA 3EI7A 4JEYA 2FM1A 3AEOA 1ASAA 3RQ1A 3GETA 3BCAA 5I92A 2VMSA 4MY5A 1IAXA 2VGSA 4OC9A 1MDZA 4GE7A 5E4ZA 3QM2A 3HBXA 2W8TA 3A9XA 5DJ1A 4MGRA 1D2FA 1ASFA 1GC4A 2FN6A 1O4SA 1LKCA 3RUYA 3MEBA 4LNLA 3FQ8A 2BWNA 3PDBA 1FG3A 1SFFA 3D6KA 2VIBA 3DR7A 1MDOA 4ZSWA 1AIBA 1N8PA 4WLHA 4MKJA 2BYJA 2V1PA 5J8QA 3OKSA 2QB3A 1ZC9A 2Z9XA 2QLRA 1ASEA 1CL2A 3DYDA 4B98A 4ZM4A 4TN4A 2GB3A 3AOVA 1C4KA 2VGVA 2ZYJA 4UHOA 4E3RA 3DODA 1B9HA 4N0WA 1IX7A 1M6SA 4UQVA 1I43A 4KAMA 4B9BA 4E1OA 4OBUA 3WZFA 1WKHA 4BMKA 1OHVA 2VMOA 1GEXA 2VGTA 4A6UA 4XEWA 4OTLA 4R5ZA 1J32A 4EB5A 2HUUA 2YKVA 4BA4A 2CY8A 2AEUA 4RKDA 2BIEA 4AO4A 3LY1A 3EZ1A 4Q76A 3JWAA 4ZAHA 3PJ0A 1N31A 3RI6A 1ASMA 1D7RA 1TATA 2YKXA 3BCBA 3TFTA 4ZDOA 2ZY5A 4IX8A 3EUCA 2AY9A 3JU7A 2FNUA 2ORDA 4U1TA 3BWNA 2E7JA 2ZJGA 2EO5A 4TV7A 2FYFA 1V2DA 2D5YA 1ZOBA 3ASAA 1RVUA 4F5IA 3FTBA 1ZODA 1TASA 2BKWA 3K7YA 3HQTA 3QHXA 1OXPA 2GQNA 4RITA 4F5HA 1XEYA 1C9CA 1W7LA 1TOKA 3P6KA 4Q6RA 5FT6A 3FFRA 3PD6B 4ITXA 5EIGA 2Z20A 2EZ1A 1CL1A 3NRAA 4IYOA 1YNUA 1Y4IA 2VMVA 4W91A 1ELQA 5G2QA 1ELUA 1ASGA 1LK9A 3BS8A 2QA3A 2AEVA 3L8AA 4W1XA 1GEWA 2D7YA 2CFBA 2JG2A 3NX3A 4J8LA 1MGVA 1PG8A 2GMUA 3EIBA 3WX9A 3BWOA 1V72A 1B4XA 3AEPA 2D7ZA 2D63A 1DKAA 3FDBA 2W7HA 3KGWA 4UHNA 4JEVA 4IXSA 4WB0A 2AY4A 4L0OA 1AAMA 2ZSLA 4LC3A 4P7YA 1P3WA 3ISLA 4JF0A 1ASNA 2DR1A 3NU7A 1UU0A 1VP4A 3F9TA 4WLJA 3NTJA 1YJSA 4XAUA 1WYTB 3MAUA 1AY8A 3WGCA 5HXXA 1AY4A 1IX8A 3GZDC 1OHWA 2ZUKA 5EUDA 1AMAA 1OXOA 3ZRPA 3EI6A 2Z9UA 3CQ5A 3F6TA 2PB2A 1WYUA 1X28A 2YKYA 3L44A 5EUNA 4ATQA 3IHJA 4AZKA 2X8UA 3E2YA 1ARSA 4JEWA 1DGEA 1G7XA 2CB1A 3LV2A 3MAFB 1SZKA 2ZP7A 2BYLA 2BI3A 3AEMC 3GBXA 3HDOA 4WB0B 4HVKA 1EG5A 2BHXA 5DB5A 3PDBB 1IBJA 1W3UA 2VGUA 4CBRA 1C7OA 2CANA 4ATPA 2WK7A 2W7JA 3UWCA 3MADA 5F9SA 1SPAA 3FCRA 1ASDA 3LWSA 1AHGA 1UKJA 2HUFA 1MAPA 3TCMA 2VMNA 4BA5A 1ARGA 3QI6A 3ACZA 4F5FA 2DOUA 2VMPA 3P1TA 1IJIA 1SVVA 3R4TA 1QGNA 4CVQA 1TPLA 1AJSA 3DRDA 3PAAA 5HDMA 3EI5A 2YCNA 2DGMA 3FFHA 4IW7A 5JAYA 1M0NA 1YIZA 2AY2A 3DC1A 3VK4A 2OGAA 2W7IA 1LC7A 4M2MA 2XH1A 4R5FA 4IY7A 3VAXA 4ZDLA 1G7WA 4JEZA 1PMMA 1FC4A 4WP0A 1LW4A 1PMOA 4DQ6A 2FNIA 1OATA 2DKJA 3DZZA 3B1EA 5EUEA 2CH1A 3UAKA 1V2EA 4DBCA 2C0RA 2BI1A 4R2NA 3DXWA 3CBFA 3WLXA 2CJGA 4A0GA 1XI9A 1D7VA 2OGEA 4H51A 1BJOA 4WXBA 3JWBA 2CJDA 1MDXA 3RBFA 1X2AA 2WK9A 3HMUA 3HLMA 1BJOB 2W8WA 4ZDPA 4ADCA 3F0HA 4A0RA 4LNJA 1JS6A 1EJIA 3E2ZA 2OKKA 3TATA 2C7TA 3E2ZB 4WXFA 1X29A 1WSTA 2PO3A 4JEXA 4MQPA 5E3KA 1VEFA 3ZZKA 3NDNA 4ADBA 3NU8A 4W8IA 4CXRA 1ARIA 2Z9VA 1GC2A 3PDXA 5BJ4A 4XJOA 4GRXA 3A9ZA 5EIGB 4MKKA 1C7NA 1LC8A 1AHEA 2HORA 4AH3A 1WYVA 3EI9A 4K2BA 2E7IA 3AENA 1ECXA 1UU2A 3TQXA 3AEJA 3BB8A 2Q7WA 4GE4A 1AIAA 2YKUA 4Y0DA 3W1IA 2BIAA 3FQ7A 5LH9A 1LS3A 1QISA 2BIGA 3QN6A 8AATA 1O69A 1GC0A 2QMAA 2AY7A 5BJ3A 2QBTA 2X3LA 4PVFA 4WBTA 4Q75A 3G0TA 1ARHA 2YRRA 3GZCA 4GDYA 2W8JA 2HP1A 3MC6A 3CAIA 3I5TA 1YIYA 4BQ0A 1YJYA 2CH2A 3UE8A 2W7KA 2AATA 5DX5A 3WCOA 4ZSYA 2AY6A 3ZRQA 2OQXA 3FVXA 1WYTA 3NUIA 2JJEA 4R8DA 1AKAA 3G8MA 2BWPA 4PIWA 1YAAA 4M2KA 2D64A 2ZY4A 3FKDA 1KKJA 2TPLA 4EFFA 1J04A 5M4DA 3NNKA 2G6WA 4F5GA 2JJFA 2C44A 4KXKA 2VMWA 3MKJA 1AJSB 2DKBA 2E7UA 3GR9A 4WXGA 4WYAA 2VMUA 5TF5A 1ASCA 4MQQA 3FD0A 1W23A 3MAFA 1N2TA 3FDDA 1BJ4A 3PIUA 4W1WA 2AY5A 1D7UA 1M0PA 4Y0HA 2YCPA 2GMSA 3LG0A 3RCHA 1QJ3A 3NYSA 5M46A 4UOYA 2D66A 3AELA 1QJ5A 3VOMA 3EZSA 2RFVA 4OBVA 3AATA 2AY8A 4F5KA 3FVUA 3QGUA 1M4NA 1UU1A 2VIAA 5G4JA 4EU1A 2DGLA 4WYCA 4XJMA 2YRIA 3HVYA 3WGBA 1JF9A 4ISYA 2W7DA 7AATA 1E5FA 4E3QA 1M32A 4EB7A 1AKBA 3N75A 2EGYA 1SZUA 1QIRA 1B9IA 2R0TA 3H7FA 3JTXA 3G7QA 4AZJA 4WYFA 3B1DA 3PPLA 1BJWA 1D7SA 1G4VA 3GJUA 1BKGA 1I48A 2W8VA 3PA9A 1H0CA 1TOGA 1VJOA 3BWNC 1ARTA 2D65A 2OATA 4O6ZA 3ECDA 2CJHA 3FRKA 4XJLA 1JS3A 3OP7A 4K2MA 2X5FA 4A6TA 1DJUA 2W7FA 1I41A 1CQ7A 4RIZA 4W1VA 1Z7DA 3II0A 3R9AA 1GDEA 4XJPA 3ELEA 4AO9A 3NYUA 3M5UA 1MLYA 2VMRA 3K40A 2BWOA 2HP2A 1BW0A 4OT8A 3T32A 9AATA 1G4XA 4A0FA 4P3MA 2ZY2A 2EH6A 4WD2A 1KKPA 5D95A 4A6RA 3DXVA 4WYEA 3CQ4A 2V0YA 4JF1A 4RLGA 1IAYA 2R5CB 1AMSA 2VYCA 4OYTA 4UHMA 5C6UA 1SZSA 2R5CA 3K28A 3WCNA 1QZ9A 3BC8A 4IXOA 2C81A 3B1CA 4A0HA 1X0MA 4KYOA 4OMAA 1W7NA 2YOBA 1O62A 4LW2A 4ZWMA 3WKSA 1AAWA 1IX6A 1DJ9A 2Z61A 4PFFA 3E77A 4ZM3A 5M4BA 3EI8A 4LNMA 1MLZA 1DJEA 3WY7A 4LW4A 2W8UA 3AOWA 1EQBA 2BI9A 2AY3A 2Z67A 2JISA 2Z9WA 1C7GA 5AX8A 1S06A 3N5MA 4M2JA 4MSOA 1IVRA 1MAQA 2VI9A 2HOXA 1AJRA 1AHYA 1ASBA 4Q31A 4WYDA 2HOYA 3ATHA 1TOIA 3I16A 2VGWA 4F5JA 2EPJA 1AHXA 4W5KA 2X5DA 2HZPA 3N0LA 1AMRA 1AY5A 3DU4A 3ELPA 4NOGA 4XQ2A 3FZ7A 1O61A 1W7MA 1I29A 2W7EA 4Y0IA 5F8VA 5M49A 3VK3A 1B8GA 1B5OA 3AEMA 4JE5D 4IXZA 1WKGA 1YJZA 1DFOA 3BV0A 2HUIA 2BI5A 3JW9A 3KE3A 3NYTA 5FT4A 1M0OA 3NUBA 2YCTA 4FL0A 1CQ6A 4J5UA 2CINA 4CBSA 2D61A 5LHAA 1YOOA 4ITGA 3W1HA 1RV3A 3RCHB 2BI2A 4FFCA 3E9KA 3PGYA 3MC6C 2PB0A 3CQ6A 4A72A 1AHFA 1CS1A 4A00A 1S0AA 3DR4A 2VLFA 3GWPA 4GSAA 3W1JA 1H1CA 3BCXA 2O0RA 1OHYA 2OKJA 1BS0A 4RJ0A 3LVJA 4K2IA 5EAVA 4ZASA 5K8BA 2R5EA 2XBNA 1CJ0A 1FG7A 2CTZA 1RV4A 1ASLA 3AV7A 1GCKA 1TOJA 1S09A 1LW5A 2Z1YA 5G09A 3RBLA 2WK8A 1JG8A 1BT4A 4PFNA 4RKCA 2FQ6A 5EQCA 4ZLVA 1PFFA 1TOEA 3A8UX 3HL2A 2VMQA 2WKAA 1BJNA 5G0AA 4CXQA 1DTYA 1DGDA 1SF2A 1GD9A 2EZ2A 4RAEA 4QGRA 4BHDA 5HHYA 2GSAA 2JJGA 2ZSMA 3H14A 3FZ6A 2VMTA 2HOZA 3ZRRA 4U2HA 4JE5A 3VP6A 4F5MA 1B5PA 1LC5A 1Z3ZA 2E54A 3FVSA 4F5LA 1QITA 3USFA 1WYVB 2VI8A 2QB2A 3AENB 3E2FA 1U08A 1M0QA 4HF8A 4TMRA 4ADEA 2O1BA 3BN1A 4E77A 3Q8NA 4RJYA 3MBBA 3B8XA 2JJHA 2ZY3A 2CSTA 1KMJA 4EMYA 3AEJC 1RVYA 3E6GA 2VMZA 1KL2A 2W7GA 3GSBA 5E5IA 1C0NA 3ASBA 2F8JA 3WKRA 1AICA 2ZC0A 1BQAA 1V2FA 5G4IA 3A9YA 5EFSA 1S07A 2VMXA 3FQAA 5DJ9A 2VMYA 4ZWVA 3LVLB 4IYOB 3GZDA 3COGA 1AMQA 1T3IA 4OCAA 5EAAA 4GEBA 1M7YA 1S08A 2VGZA 3KKIA 1KMKA 1CQ8A 3QPGA 1BQDA 4WYGA 3A2BA 4RM1A 3FZ8A 4ADDA 1GEYA 1KL1A 1WYUB 1GBNA 3B46A 4AOAA 2JGTA 3QBOA 2NMPA 3FSLA 4DGTA 3ZZJA 3I4JA 3LVMA 3HT4A 5FT5A 4XK1A 4N0BA 2VLHA 3KGXA 4F4EA 3PD6A 3IF2A 3LVKA 4GE9A 5D5SA 2R2NA 5G2PA 1ORDA 4MQRA 4I8AA 1GC3A 3EIAA 5FT8A 3TFUA 1AX4A 5IWQA 3JZLA 2AY1A 1CZCA 1IUGA 2YHKA
chains in the Genus database with same CATH superfamily
2DGKA 2O7CA 2W7LA 2W7MA 2Z1ZA 3VK2A 1TARA 1CZEA 1AKCA 1E5EA 3EI7A 4JEYA 2FM1A 3AEOA 1ASAA 3RQ1A 3GETA 3BCAA 5I92A 2VMSA 4MY5A 1IAXA 2VGSA 4OC9A 1MDZA 4GE7A 5E4ZA 3QM2A 3HBXA 2W8TA 3A9XA 5DJ1A 4MGRA 1D2FA 1ASFA 1GC4A 2FN6A 1O4SA 1LKCA 3RUYA 3MEBA 4LNLA 3FQ8A 2BWNA 3PDBA 1FG3A 1SFFA 3D6KA 2VIBA 3DR7A 1MDOA 4ZSWA 1AIBA 1N8PA 4WLHA 4MKJA 2BYJA 2V1PA 5J8QA 3OKSA 2QB3A 1ZC9A 2Z9XA 2QLRA 1ASEA 1CL2A 3DYDA 4B98A 4ZM4A 4TN4A 2GB3A 3AOVA 1C4KA 2VGVA 2ZYJA 4UHOA 4E3RA 3DODA 1B9HA 4N0WA 1IX7A 1M6SA 4UQVA 1I43A 4KAMA 4B9BA 4E1OA 4OBUA 3WZFA 1WKHA 4BMKA 1OHVA 2VMOA 1GEXA 2VGTA 4A6UA 2WB6A 4XEWA 4OTLA 4R5ZA 1J32A 4EB5A 2HUUA 2YKVA 4BA4A 2CY8A 2AEUA 4RKDA 2BIEA 4AO4A 3LY1A 3EZ1A 4Q76A 3JWAA 4ZAHA 3PJ0A 1N31A 3RI6A 1ASMA 1D7RA 1TATA 2YKXA 3BCBA 3TFTA 4ZDOA 2ZY5A 4IX8A 3EUCA 2AY9A 3JU7A 2FNUA 2ORDA 4U1TA 3BWNA 2E7JA 2ZJGA 2EO5A 4TV7A 2FYFA 1V2DA 2D5YA 1ZOBA 3ASAA 1RVUA 4F5IA 3FTBA 1ZODA 1TASA 2BKWA 3K7YA 3HQTA 3QHXA 1OXPA 2GQNA 4RITA 4F5HA 1XEYA 1C9CA 1W7LA 1TOKA 3P6KA 4Q6RA 5FT6A 3FFRA 3PD6B 4ITXA 5EIGA 2Z20A 2A1VA 4K05A 2EZ1A 1CL1A 3NRAA 4IYOA 1YNUA 1Y4IA 2VMVA 4W91A 1ELQA 3N4RA 5G2QA 1ELUA 1ASGA 1LK9A 3BS8A 2QA3A 2AEVA 2QSRA 3L8AA 4W1XA 1GEWA 2D7YA 2CFBA 2JG2A 3NX3A 4J8LA 1MGVA 1PG8A 2GMUA 3EIBA 3WX9A 3BWOA 1V72A 1B4XA 3AEPA 2D7ZA 2D63A 1DKAA 3FDBA 2W7HA 3KGWA 4UHNA 4JEVA 4IXSA 4WB0A 2AY4A 4L0OA 1AAMA 2ZSLA 4LC3A 4P7YA 1P3WA 3ISLA 4JF0A 1ASNA 2DR1A 3NU7A 1UU0A 1VP4A 3F9TA 4WLJA 3NTJA 1YJSA 4XAUA 1WYTB 3MAUA 1AY8A 3WGCA 5HXXA 1AY4A 1IX8A 3GZDC 2EYQA 1OHWA 2ZUKA 5EUDA 1AMAA 1OXOA 3ZRPA 3EI6A 2Z9UA 3CQ5A 3F6TA 2PB2A 1WYUA 1X28A 2YKYA 3L44A 5EUNA 4ATQA 3IHJA 4AZKA 2X8UA 3E2YA 1ARSA 4JEWA 1DGEA 1G7XA 2CB1A 3LV2A 3MAFB 1SZKA 2ZP7A 2BYLA 2BI3A 3AEMC 3GBXA 3HDOA 4WB0B 4HVKA 1EG5A 2BHXA 5DB5A 3PDBB 1IBJA 1W3UA 2VGUA 4CBRA 1C7OA 2CANA 4ATPA 2WK7A 2W7JA 3UWCA 3MADA 5F9SA 1SPAA 3FCRA 1ASDA 3LWSA 1AHGA 1UKJA 2HUFA 1MAPA 3TCMA 2VMNA 4BA5A 1ARGA 3QI6A 3ACZA 4F5FA 2DOUA 2VMPA 3P1TA 1IJIA 1SVVA 3R4TA 1QGNA 4CVQA 1TPLA 1AJSA 3DRDA 3PAAA 5HDMA 3EI5A 2YCNA 2DGMA 3FFHA 4IW7A 5JAYA 1M0NA 1YIZA 2AY2A 3DC1A 3VK4A 2OGAA 2W7IA 1LC7A 4M2MA 2XH1A 4R5FA 4IY7A 3VAXA 4ZDLA 1G7WA 4JEZA 1PMMA 1FC4A 4WP0A 3N7NA 1LW4A 1PMOA 4DQ6A 2FNIA 1OATA 2DKJA 3DZZA 3B1EA 5EUEA 2CH1A 3UAKA 1V2EA 4DBCA 2C0RA 2BI1A 4R2NA 3DXWA 3CBFA 3WLXA 2CJGA 4A0GA 1XI9A 1D7VA 2OGEA 4H51A 1BJOA 4WXBA 3JWBA 2CJDA 1MDXA 3RBFA 1X2AA 2WK9A 3HMUA 3HLMA 1BJOB 2W8WA 4ZDPA 4ADCA 3F0HA 4A0RA 4LNJA 3H9XA 1JS6A 1EJIA 3E2ZA 2OKKA 3TATA 2C7TA 3E2ZB 4WXFA 1X29A 1WSTA 2PO3A 4JEXA 4MQPA 5E3KA 1VEFA 3ZZKA 3NDNA 4ADBA 3NU8A 4W8IA 4CXRA 1ARIA 2Z9VA 1GC2A 3PDXA 5BJ4A 4XJOA 4GRXA 3A9ZA 5EIGB 4MKKA 1C7NA 1LC8A 1AHEA 2HORA 4AH3A 1WYVA 3EI9A 4K2BA 2E7IA 3AENA 1ECXA 1UU2A 3TQXA 2G7JA 3AEJA 3BB8A 2Q7WA 4GE4A 1AIAA 2YKUA 4Y0DA 3W1IA 2BIAA 3FQ7A 5LH9A 1LS3A 1QISA 2BIGA 3QN6A 8AATA 1O69A 1GC0A 2QMAA 2AY7A 5BJ3A 2QBTA 2X3LA 4PVFA 4WBTA 4Q75A 3G0TA 1ARHA 2YRRA 3GZCA 4GDYA 2W8JA 2HP1A 3MC6A 3CAIA 3I5TA 1YIYA 4BQ0A 1YJYA 2CH2A 3UE8A 2W7KA 2AATA 5DX5A 3WCOA 4ZSYA 2AY6A 3ZRQA 2OQXA 3FVXA 1WYTA 3NUIA 2JJEA 4R8DA 1AKAA 3G8MA 2BWPA 4PIWA 1YAAA 4M2KA 2D64A 2ZY4A 3FKDA 1KKJA 2TPLA 4EFFA 1J04A 5KTBA 5M4DA 3NNKA 2G6WA 4F5GA 2JJFA 2C44A 4KXKA 2VMWA 3MKJA 1AJSB 2DKBA 2E7UA 3GR9A 4WXGA 4WYAA 2VMUA 5TF5A 1ASCA 4MQQA 3FD0A 2KFPA 1W23A 3MAFA 1N2TA 3FDDA 1BJ4A 3PIUA 4W1WA 2AY5A 1D7UA 1M0PA 4Y0HA 2YCPA 2GMSA 3LG0A 3RCHA 1QJ3A 3NYSA 5M46A 4UOYA 2D66A 3AELA 1QJ5A 3VOMA 3EZSA 2RFVA 4OBVA 3AATA 2AY8A 4F5KA 3FVUA 3QGUA 1M4NA 1UU1A 2VIAA 5G4JA 4EU1A 2DGLA 4WYCA 4XJMA 2YRIA 3HVYA 3WGBA 1JF9A 4ISYA 2W7DA 7AATA 1E5FA 4E3QA 1M32A 4EB7A 1AKBA 3N75A 2EGYA 1SZUA 1QIRA 1B9IA 2R0TA 3H7FA 3JTXA 3G7QA 4AZJA 4WYFA 3B1DA 3PPLA 1BJWA 1D7SA 1G4VA 3GJUA 1BKGA 1I48A 2W8VA 3PA9A 1H0CA 1TOGA 1VJOA 3BWNC 1ARTA 2D65A 2OATA 4O6ZA 3ECDA 2CJHA 3FRKA 4XJLA 1JS3A 3OP7A 4K2MA 2X5FA 4A6TA 1DJUA 2W7FA 1I41A 1CQ7A 4RIZA 4W1VA 1Z7DA 3II0A 3R9AA 1GDEA 4XJPA 3ELEA 4AO9A 3NYUA 3M5UA 1MLYA 2VMRA 3K40A 2BWOA 2HP2A 1BW0A 4OT8A 3T32A 9AATA 1G4XA 4A0FA 4P3MA 2ZY2A 2EH6A 4WD2A 1KKPA 5D95A 4A6RA 3DXVA 4WYEA 3CQ4A 2V0YA 4JF1A 4RLGA 1IAYA 2R5CB 1AMSA 2VYCA 4OYTA 4UHMA 5C6UA 1SZSA 2R5CA 3K28A 3WCNA 1QZ9A 3BC8A 4IXOA 2C81A 3B1CA 4A0HA 1X0MA 4KYOA 4OMAA 3N4SA 1W7NA 2YOBA 1O62A 4LW2A 4ZWMA 3WKSA 1AAWA 1IX6A 1DJ9A 2Z61A 4PFFA 3E77A 4ZM3A 2FKIA 5M4BA 3EI8A 4LNMA 1MLZA 1DJEA 3WY7A 4LW4A 2W8UA 3AOWA 1EQBA 2BI9A 2AY3A 2Z67A 2JISA 2Z9WA 1C7GA 5AX8A 1S06A 3N5MA 4M2JA 4MSOA 1IVRA 1MAQA 2VI9A 2HOXA 1AJRA 1AHYA 1ASBA 4Q31A 4WYDA 2HOYA 3ATHA 1TOIA 3I16A 2VGWA 4F5JA 2EPJA 1AHXA 4W5KA 2X5DA 2HZPA 3N0LA 1AMRA 1AY5A 3DU4A 3ELPA 4NOGA 4XQ2A 3FZ7A 1O61A 1W7MA 1I29A 2W7EA 4Y0IA 5F8VA 5M49A 3VK3A 1B8GA 1B5OA 3AEMA 4JE5D 4IXZA 1WKGA 1YJZA 1DFOA 3BV0A 2HUIA 2BI5A 3JW9A 3KE3A 3NYTA 5FT4A 1M0OA 3NUBA 2YCTA 4FL0A 1CQ6A 4J5UA 2CINA 4CBSA 2D61A 5LHAA 1YOOA 4ITGA 3W1HA 1RV3A 3RCHB 2BI2A 4FFCA 3E9KA 3PGYA 3MC6C 2PB0A 3CQ6A 4A72A 1AHFA 1CS1A 4A00A 1S0AA 3DR4A 2VLFA 3GWPA 4GSAA 3W1JA 1H1CA 3BCXA 2O0RA 1OHYA 2OKJA 1BS0A 4RJ0A 3LVJA 4K2IA 5EAVA 4ZASA 5K8BA 2R5EA 2XBNA 1CJ0A 1FG7A 2CTZA 1RV4A 1ASLA 3AV7A 1GCKA 1TOJA 1S09A 1LW5A 2Z1YA 5G09A 3RBLA 2WK8A 1JG8A 1BT4A 4PFNA 4RKCA 2FQ6A 5EQCA 4ZLVA 1PFFA 1TOEA 3A8UX 3HL2A 2VMQA 2WKAA 1BJNA 5G0AA 4CXQA 1DTYA 1DGDA 1SF2A 1GD9A 2EZ2A 4RAEA 4QGRA 4BHDA 5HHYA 2GSAA 2JJGA 2ZSMA 3H14A 3FZ6A 2VMTA 2HOZA 3ZRRA 4U2HA 4JE5A 3VP6A 4F5MA 1B5PA 1LC5A 1Z3ZA 2E54A 3FVSA 4F5LA 1QITA 3USFA 1WYVB 2VI8A 2QB2A 3AENB 3E2FA 1U08A 1M0QA 4HF8A 4TMRA 4ADEA 2O1BA 3BN1A 4E77A 3Q8NA 4RJYA 1KAFA 3MBBA 3B8XA 2JJHA 2ZY3A 2CSTA 1KMJA 4EMYA 3AEJC 1RVYA 3E6GA 3N4XA 2VMZA 1KL2A 2W7GA 3GSBA 5E5IA 1C0NA 3ASBA 2F8JA 3WKRA 1AICA 2ZC0A 1BQAA 1V2FA 5G4IA 3A9YA 5EFSA 1S07A 2VMXA 3FQAA 5DJ9A 2VMYA 4ZWVA 3LVLB 4IYOB 3GZDA 3COGA 1AMQA 1T3IA 4OCAA 5EAAA 4GEBA 1M7YA 4H63Q 1S08A 2VGZA 3KKIA 1KMKA 1CQ8A 3QPGA 1BQDA 4WYGA 3A2BA 4RM1A 3FZ8A 4ADDA 1GEYA 1KL1A 1WYUB 1GBNA 3B46A 4AOAA 2JGTA 3QBOA 2NMPA 3FSLA 4DGTA 3ZZJA 3I4JA 3LVMA 3HT4A 5FT5A 4XK1A 4N0BA 2VLHA 3KGXA 4F4EA 3PD6A 3IF2A 3LVKA 4GE9A 5D5SA 2R2NA 5G2PA 1ORDA 4MQRA 4I8AA 1GC3A 3EIAA 5FT8A 3TFUA 1AX4A 5IWQA 3JZLA 2AY1A 1CZCA 1IUGA 2YHKA
chains in the Genus database with same CATH topology
2DGKA 2O7CA 2W7LA 2W7MA 2Z1ZA 3VK2A 1TARA 1CZEA 1AKCA 1E5EA 3EI7A 4JEYA 2FM1A 3AEOA 1ASAA 3RQ1A 3GETA 3BCAA 5I92A 2VMSA 4MY5A 1IAXA 2VGSA 4OC9A 1MDZA 4GE7A 5E4ZA 3QM2A 3HBXA 2W8TA 3A9XA 5DJ1A 4MGRA 1D2FA 1ASFA 1GC4A 2FN6A 1O4SA 1LKCA 3RUYA 3MEBA 4LNLA 3FQ8A 2BWNA 3PDBA 1FG3A 1SFFA 3D6KA 2VIBA 3DR7A 1MDOA 4ZSWA 1AIBA 1N8PA 4WLHA 4MKJA 2BYJA 2V1PA 5J8QA 3OKSA 2QB3A 1ZC9A 2Z9XA 2QLRA 1ASEA 1CL2A 3DYDA 4B98A 4ZM4A 4TN4A 2GB3A 3AOVA 1C4KA 2VGVA 2ZYJA 4UHOA 4E3RA 3DODA 1B9HA 4N0WA 1IX7A 1M6SA 4UQVA 1I43A 4KAMA 4B9BA 4E1OA 4OBUA 3WZFA 1WKHA 4BMKA 1OHVA 2VMOA 1GEXA 2VGTA 4A6UA 2WB6A 4XEWA 4OTLA 4R5ZA 1J32A 4EB5A 2HUUA 2YKVA 4BA4A 2CY8A 2AEUA 4RKDA 2BIEA 4AO4A 3LY1A 3EZ1A 4Q76A 3JWAA 4ZAHA 3PJ0A 1N31A 3RI6A 1ASMA 1D7RA 1TATA 2YKXA 3BCBA 3TFTA 4ZDOA 2ZY5A 4IX8A 3EUCA 2AY9A 3JU7A 2FNUA 2ORDA 4U1TA 3BWNA 2E7JA 2ZJGA 2EO5A 4TV7A 2FYFA 1V2DA 2D5YA 1ZOBA 3ASAA 1RVUA 4F5IA 3FTBA 1ZODA 1TASA 2BKWA 3K7YA 3HQTA 3QHXA 1OXPA 2GQNA 4RITA 4F5HA 1XEYA 1C9CA 1W7LA 1TOKA 3P6KA 4Q6RA 5FT6A 3FFRA 3PD6B 4ITXA 5EIGA 2Z20A 2A1VA 4K05A 2EZ1A 1CL1A 3NRAA 4IYOA 1YNUA 1Y4IA 2VMVA 4W91A 1ELQA 3N4RA 5G2QA 1ELUA 1ASGA 1LK9A 3BS8A 2QA3A 2AEVA 2QSRA 3L8AA 4W1XA 1GEWA 2D7YA 2CFBA 2JG2A 3NX3A 4J8LA 1MGVA 1PG8A 2GMUA 3EIBA 3WX9A 3BWOA 1V72A 1B4XA 3AEPA 2D7ZA 2D63A 1DKAA 3FDBA 2W7HA 3KGWA 4UHNA 4JEVA 4IXSA 4WB0A 2AY4A 4L0OA 1AAMA 2ZSLA 4LC3A 4P7YA 1P3WA 3ISLA 4JF0A 1ASNA 2DR1A 3NU7A 1UU0A 1VP4A 3F9TA 4WLJA 3NTJA 1YJSA 4XAUA 1WYTB 3MAUA 1AY8A 3WGCA 5HXXA 1AY4A 1IX8A 3GZDC 2EYQA 1OHWA 2ZUKA 5EUDA 1AMAA 1OXOA 3ZRPA 3EI6A 2Z9UA 3CQ5A 3F6TA 2PB2A 1WYUA 1X28A 2YKYA 3L44A 5EUNA 4ATQA 3IHJA 4AZKA 2X8UA 3E2YA 1ARSA 4JEWA 1DGEA 1G7XA 2CB1A 3LV2A 3MAFB 1SZKA 2ZP7A 2BYLA 2BI3A 3AEMC 3GBXA 3HDOA 4WB0B 4HVKA 1EG5A 2BHXA 5DB5A 3PDBB 1IBJA 1W3UA 2VGUA 4CBRA 1C7OA 2CANA 4ATPA 2WK7A 2W7JA 3UWCA 3MADA 5F9SA 1SPAA 3FCRA 1ASDA 3LWSA 1AHGA 1UKJA 2HUFA 1MAPA 3TCMA 2VMNA 4BA5A 1ARGA 3QI6A 3ACZA 4F5FA 2DOUA 2VMPA 3P1TA 1IJIA 1SVVA 3R4TA 1QGNA 4CVQA 1TPLA 1AJSA 3DRDA 3PAAA 5HDMA 3EI5A 2YCNA 2DGMA 3FFHA 4IW7A 5JAYA 1M0NA 1YIZA 2AY2A 3DC1A 3VK4A 2OGAA 2W7IA 1LC7A 4M2MA 2XH1A 4R5FA 4IY7A 3VAXA 4ZDLA 1G7WA 4JEZA 1PMMA 1FC4A 4WP0A 3N7NA 1LW4A 1PMOA 4DQ6A 2FNIA 1OATA 2DKJA 3DZZA 3B1EA 5EUEA 2CH1A 3UAKA 1V2EA 4DBCA 2C0RA 2BI1A 4R2NA 3DXWA 3CBFA 3WLXA 2CJGA 4A0GA 1XI9A 1D7VA 2OGEA 4H51A 1BJOA 4WXBA 3JWBA 2CJDA 1MDXA 3RBFA 1X2AA 2WK9A 3HMUA 3HLMA 1BJOB 2W8WA 4ZDPA 4ADCA 3F0HA 4A0RA 4LNJA 3H9XA 1JS6A 1EJIA 3E2ZA 2OKKA 3TATA 2C7TA 3E2ZB 4WXFA 1X29A 1WSTA 2PO3A 4JEXA 4MQPA 5E3KA 1VEFA 3ZZKA 3NDNA 4ADBA 3NU8A 4W8IA 4CXRA 1ARIA 2Z9VA 1GC2A 3PDXA 5BJ4A 4XJOA 4GRXA 3A9ZA 5EIGB 4MKKA 1C7NA 1LC8A 1AHEA 2HORA 4AH3A 1WYVA 3EI9A 4K2BA 2E7IA 3AENA 1ECXA 1UU2A 3TQXA 2G7JA 3AEJA 3BB8A 2Q7WA 4GE4A 1AIAA 2YKUA 4Y0DA 3W1IA 2BIAA 3FQ7A 5LH9A 1LS3A 1QISA 2BIGA 3QN6A 8AATA 1O69A 1GC0A 2QMAA 2AY7A 5BJ3A 2QBTA 2X3LA 4PVFA 4WBTA 4Q75A 3G0TA 1ARHA 2YRRA 3GZCA 4GDYA 2W8JA 2HP1A 3MC6A 3CAIA 3I5TA 1YIYA 4BQ0A 1YJYA 2CH2A 3UE8A 2W7KA 2AATA 5DX5A 3WCOA 4ZSYA 2AY6A 3ZRQA 2OQXA 3FVXA 1WYTA 3NUIA 2JJEA 4R8DA 1AKAA 3G8MA 2BWPA 4PIWA 1YAAA 4M2KA 2D64A 2ZY4A 3FKDA 1KKJA 2TPLA 4EFFA 1J04A 5KTBA 5M4DA 3NNKA 2G6WA 4F5GA 2JJFA 2C44A 4KXKA 2VMWA 3MKJA 1AJSB 2DKBA 2E7UA 3GR9A 4WXGA 4WYAA 2VMUA 5TF5A 1ASCA 4MQQA 3FD0A 2KFPA 1W23A 3MAFA 1N2TA 3FDDA 1BJ4A 3PIUA 4W1WA 2AY5A 1D7UA 1M0PA 4Y0HA 2YCPA 2GMSA 3LG0A 3RCHA 1QJ3A 3NYSA 5M46A 4UOYA 2D66A 3AELA 1QJ5A 3VOMA 3EZSA 2RFVA 4OBVA 3AATA 2AY8A 4F5KA 3FVUA 3QGUA 1M4NA 1UU1A 2VIAA 5G4JA 4EU1A 2DGLA 4WYCA 4XJMA 2YRIA 3HVYA 3WGBA 1JF9A 4ISYA 2W7DA 7AATA 1E5FA 4E3QA 1M32A 4EB7A 1AKBA 3N75A 2EGYA 1SZUA 1QIRA 1B9IA 2R0TA 3H7FA 3JTXA 3G7QA 4AZJA 4WYFA 3B1DA 3PPLA 1BJWA 1D7SA 1G4VA 3GJUA 1BKGA 1I48A 2W8VA 3PA9A 1H0CA 1TOGA 1VJOA 3BWNC 1ARTA 2D65A 2OATA 4O6ZA 3ECDA 2CJHA 3FRKA 4XJLA 1JS3A 3OP7A 4K2MA 2X5FA 4A6TA 1DJUA 2W7FA 1I41A 1CQ7A 4RIZA 4W1VA 1Z7DA 3II0A 3R9AA 1GDEA 4XJPA 3ELEA 4AO9A 3NYUA 3M5UA 1MLYA 2VMRA 3K40A 2BWOA 2HP2A 1BW0A 4OT8A 3T32A 9AATA 1G4XA 4A0FA 4P3MA 2ZY2A 2EH6A 4WD2A 1KKPA 5D95A 4A6RA 3DXVA 4WYEA 3CQ4A 2V0YA 4JF1A 4RLGA 1IAYA 2R5CB 1AMSA 2VYCA 4OYTA 4UHMA 5C6UA 1SZSA 2R5CA 3K28A 3WCNA 1QZ9A 3BC8A 4IXOA 2C81A 3B1CA 4A0HA 1X0MA 4KYOA 4OMAA 3N4SA 1W7NA 2YOBA 1O62A 4LW2A 4ZWMA 3WKSA 1AAWA 1IX6A 1DJ9A 2Z61A 4PFFA 3E77A 4ZM3A 2FKIA 5M4BA 3EI8A 4LNMA 1MLZA 1DJEA 3WY7A 4LW4A 2W8UA 3AOWA 1EQBA 2BI9A 2AY3A 2Z67A 2JISA 2Z9WA 1C7GA 5AX8A 1S06A 3N5MA 4M2JA 4MSOA 1IVRA 1MAQA 2VI9A 2HOXA 1AJRA 1AHYA 1ASBA 4Q31A 4WYDA 2HOYA 3ATHA 1TOIA 3I16A 2VGWA 4F5JA 2EPJA 1AHXA 4W5KA 2X5DA 2HZPA 3N0LA 1AMRA 1AY5A 3DU4A 3ELPA 4NOGA 4XQ2A 3FZ7A 1O61A 1W7MA 1I29A 2W7EA 4Y0IA 5F8VA 5M49A 3VK3A 1B8GA 1B5OA 3AEMA 4JE5D 4IXZA 1WKGA 1YJZA 1DFOA 3BV0A 2HUIA 2BI5A 3JW9A 3KE3A 3NYTA 5FT4A 1M0OA 3NUBA 2YCTA 4FL0A 1CQ6A 4J5UA 2CINA 4CBSA 2D61A 5LHAA 1YOOA 4ITGA 3W1HA 1RV3A 3RCHB 2BI2A 4FFCA 3E9KA 3PGYA 3MC6C 2PB0A 3CQ6A 4A72A 1AHFA 1CS1A 4A00A 1S0AA 3DR4A 2VLFA 3GWPA 4GSAA 3W1JA 1H1CA 3BCXA 2O0RA 1OHYA 2OKJA 1BS0A 4RJ0A 3LVJA 4K2IA 5EAVA 4ZASA 5K8BA 2R5EA 2XBNA 1CJ0A 1FG7A 2CTZA 1RV4A 1ASLA 3AV7A 1GCKA 1TOJA 1S09A 1LW5A 2Z1YA 5G09A 3RBLA 2WK8A 1JG8A 1BT4A 4PFNA 4RKCA 2FQ6A 5EQCA 4ZLVA 1PFFA 1TOEA 3A8UX 3HL2A 2VMQA 2WKAA 1BJNA 5G0AA 4CXQA 1DTYA 1DGDA 1SF2A 1GD9A 2EZ2A 4RAEA 4QGRA 4BHDA 5HHYA 2GSAA 2JJGA 2ZSMA 3H14A 3FZ6A 2VMTA 2HOZA 3ZRRA 4U2HA 4JE5A 3VP6A 4F5MA 1B5PA 1LC5A 1Z3ZA 2E54A 3FVSA 4F5LA 1QITA 3USFA 1WYVB 2VI8A 2QB2A 3AENB 3E2FA 1U08A 1M0QA 4HF8A 4TMRA 4ADEA 2O1BA 3BN1A 4E77A 3Q8NA 4RJYA 3MBBA 3B8XA 2JJHA 2ZY3A 2CSTA 1KMJA 4EMYA 3AEJC 1RVYA 3E6GA 3N4XA 2VMZA 1KL2A 2W7GA 3GSBA 5E5IA 1C0NA 3ASBA 2F8JA 3WKRA 1AICA 2ZC0A 1BQAA 1V2FA 5G4IA 3A9YA 5EFSA 1S07A 2VMXA 3FQAA 5DJ9A 2VMYA 4ZWVA 3LVLB 4IYOB 3GZDA 3COGA 1AMQA 1T3IA 4OCAA 5EAAA 4GEBA 1M7YA 4H63Q 1S08A 2VGZA 3KKIA 1KMKA 1CQ8A 3QPGA 1BQDA 4WYGA 3A2BA 4RM1A 3FZ8A 4ADDA 1GEYA 1KL1A 1WYUB 1GBNA 3B46A 4AOAA 2JGTA 3QBOA 2NMPA 3FSLA 4DGTA 3ZZJA 3I4JA 3LVMA 3HT4A 5FT5A 4XK1A 4N0BA 2VLHA 3KGXA 4F4EA 3PD6A 3IF2A 3LVKA 4GE9A 5D5SA 2R2NA 5G2PA 1ORDA 4MQRA 4I8AA 1GC3A 3EIAA 5FT8A 3TFUA 1AX4A 5IWQA 3JZLA 2AY1A 1CZCA 1IUGA 2YHKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DGK A;  2O7C A;  2W7L A;  2W7M A;  2Z1Z A;  3VK2 A;  1TAR A;  1CZE A;  1AKC A;  1E5E A;  3EI7 A;  4JEY A;  2FM1 A;  3AEO A;  1ASA A;  3RQ1 A;  3GET A;  3BCA A;  5I92 A;  2VMS A;  4MY5 A;  1IAX A;  2VGS A;  4OC9 A;  1MDZ A;  4GE7 A;  5E4Z A;  3QM2 A;  3HBX A;  2W8T A;  3A9X A;  5DJ1 A;  4MGR A;  1D2F A;  1ASF A;  1GC4 A;  2FN6 A;  1O4S A;  1LKC A;  3RUY A;  3MEB A;  4LNL A;  3FQ8 A;  2BWN A;  3PDB A;  1FG3 A;  1SFF A;  3D6K A;  2VIB A;  3DR7 A;  1MDO A;  4ZSW A;  1AIB A;  1N8P A;  4WLH A;  4MKJ A;  2BYJ A;  2V1P A;  5J8Q A;  3OKS A;  2QB3 A;  1ZC9 A;  2Z9X A;  2QLR A;  1ASE A;  1CL2 A;  3DYD A;  4B98 A;  4ZM4 A;  4TN4 A;  2GB3 A;  3AOV A;  1C4K A;  2VGV A;  2ZYJ A;  4UHO A;  4E3R A;  3DOD A;  1B9H A;  4N0W A;  1IX7 A;  1M6S A;  4UQV A;  1I43 A;  4KAM A;  4B9B A;  4E1O A;  4OBU A;  3WZF A;  1WKH A;  4BMK A;  1OHV A;  2VMO A;  1GEX A;  2VGT A;  4A6U A;  4XEW A;  4OTL A;  4R5Z A;  1J32 A;  4EB5 A;  2HUU A;  2YKV A;  4BA4 A;  2CY8 A;  2AEU A;  4RKD A;  2BIE A;  4AO4 A;  3LY1 A;  3EZ1 A;  4Q76 A;  3JWA A;  4ZAH A;  3PJ0 A;  1N31 A;  3RI6 A;  1ASM A;  1D7R A;  1TAT A;  2YKX A;  3BCB A;  3TFT A;  4ZDO A;  2ZY5 A;  4IX8 A;  3EUC A;  2AY9 A;  3JU7 A;  2FNU A;  2ORD A;  4U1T A;  3BWN A;  2E7J A;  2ZJG A;  2EO5 A;  4TV7 A;  2FYF A;  1V2D A;  2D5Y A;  1ZOB A;  3ASA A;  1RVU A;  4F5I A;  3FTB A;  1ZOD A;  1TAS A;  2BKW A;  3K7Y A;  3HQT A;  3QHX A;  1OXP A;  2GQN A;  4RIT A;  4F5H A;  1XEY A;  1C9C A;  1W7L A;  1TOK A;  3P6K A;  4Q6R A;  5FT6 A;  3FFR A;  3PD6 B;  4ITX A;  5EIG A;  2Z20 A;  2EZ1 A;  1CL1 A;  3NRA A;  4IYO A;  1YNU A;  1Y4I A;  2VMV A;  4W91 A;  1ELQ A;  5G2Q A;  1ELU A;  1ASG A;  1LK9 A;  3BS8 A;  2QA3 A;  2AEV A;  3L8A A;  4W1X A;  1GEW A;  2D7Y A;  2CFB A;  2JG2 A;  3NX3 A;  4J8L A;  1MGV A;  1PG8 A;  2GMU A;  3EIB A;  3WX9 A;  3BWO A;  1V72 A;  1B4X A;  3AEP A;  2D7Z A;  2D63 A;  1DKA A;  3FDB A;  2W7H A;  3KGW A;  4UHN A;  4JEV A;  4IXS A;  4WB0 A;  2AY4 A;  4L0O A;  1AAM A;  2ZSL A;  4LC3 A;  4P7Y A;  1P3W A;  3ISL A;  4JF0 A;  1ASN A;  2DR1 A;  3NU7 A;  1UU0 A;  1VP4 A;  3F9T A;  4WLJ A;  3NTJ A;  1YJS A;  4XAU A;  1WYT B;  3MAU A;  1AY8 A;  3WGC A;  5HXX A;  1AY4 A;  1IX8 A;  3GZD C;  1OHW A;  2ZUK A;  5EUD A;  1AMA A;  1OXO A;  3ZRP A;  3EI6 A;  2Z9U A;  3CQ5 A;  3F6T A;  2PB2 A;  1WYU A;  1X28 A;  2YKY A;  3L44 A;  5EUN A;  4ATQ A;  3IHJ A;  4AZK A;  2X8U A;  3E2Y A;  1ARS A;  4JEW A;  1DGE A;  1G7X A;  2CB1 A;  3LV2 A;  3MAF B;  1SZK A;  2ZP7 A;  2BYL A;  2BI3 A;  3AEM C;  3GBX A;  3HDO A;  4WB0 B;  4HVK A;  1EG5 A;  2BHX A;  5DB5 A;  3PDB B;  1IBJ A;  1W3U A;  2VGU A;  4CBR A;  1C7O A;  2CAN A;  4ATP A;  2WK7 A;  2W7J A;  3UWC A;  3MAD A;  5F9S A;  1SPA A;  3FCR A;  1ASD A;  3LWS A;  1AHG A;  1UKJ A;  2HUF A;  1MAP A;  3TCM A;  2VMN A;  4BA5 A;  1ARG A;  3QI6 A;  3ACZ A;  4F5F A;  2DOU A;  2VMP A;  3P1T A;  1IJI A;  1SVV A;  3R4T A;  1QGN A;  4CVQ A;  1TPL A;  1AJS A;  3DRD A;  3PAA A;  5HDM A;  3EI5 A;  2YCN A;  2DGM A;  3FFH A;  4IW7 A;  5JAY A;  1M0N A;  1YIZ A;  2AY2 A;  3DC1 A;  3VK4 A;  2OGA A;  2W7I A;  1LC7 A;  4M2M A;  2XH1 A;  4R5F A;  4IY7 A;  3VAX A;  4ZDL A;  1G7W A;  4JEZ A;  1PMM A;  1FC4 A;  4WP0 A;  1LW4 A;  1PMO A;  4DQ6 A;  2FNI A;  1OAT A;  2DKJ A;  3DZZ A;  3B1E A;  5EUE A;  2CH1 A;  3UAK A;  1V2E A;  4DBC A;  2C0R A;  2BI1 A;  4R2N A;  3DXW A;  3CBF A;  3WLX A;  2CJG A;  4A0G A;  1XI9 A;  1D7V A;  2OGE A;  4H51 A;  1BJO A;  4WXB A;  3JWB A;  2CJD A;  1MDX A;  3RBF A;  1X2A A;  2WK9 A;  3HMU A;  3HLM A;  1BJO B;  2W8W A;  4ZDP A;  4ADC A;  3F0H A;  4A0R A;  4LNJ A;  1JS6 A;  1EJI A;  3E2Z A;  2OKK A;  3TAT A;  2C7T A;  3E2Z B;  4WXF A;  1X29 A;  1WST A;  2PO3 A;  4JEX A;  4MQP A;  5E3K A;  1VEF A;  3ZZK A;  3NDN A;  4ADB A;  3NU8 A;  4W8I A;  4CXR A;  1ARI A;  2Z9V A;  1GC2 A;  3PDX A;  5BJ4 A;  4XJO A;  4GRX A;  3A9Z A;  5EIG B;  4MKK A;  1C7N A;  1LC8 A;  1AHE A;  2HOR A;  4AH3 A;  1WYV A;  3EI9 A;  4K2B A;  2E7I A;  3AEN A;  1ECX A;  1UU2 A;  3TQX A;  3AEJ A;  3BB8 A;  2Q7W A;  4GE4 A;  1AIA A;  2YKU A;  4Y0D A;  3W1I A;  2BIA A;  3FQ7 A;  5LH9 A;  1LS3 A;  1QIS A;  2BIG A;  3QN6 A;  8AAT A;  1O69 A;  1GC0 A;  2QMA A;  2AY7 A;  5BJ3 A;  2QBT A;  2X3L A;  4PVF A;  4WBT A;  4Q75 A;  3G0T A;  1ARH A;  2YRR A;  3GZC A;  4GDY A;  2W8J A;  2HP1 A;  3MC6 A;  3CAI A;  3I5T A;  1YIY A;  4BQ0 A;  1YJY A;  2CH2 A;  3UE8 A;  2W7K A;  2AAT A;  5DX5 A;  3WCO A;  4ZSY A;  2AY6 A;  3ZRQ A;  2OQX A;  3FVX A;  1WYT A;  3NUI A;  2JJE A;  4R8D A;  1AKA A;  3G8M A;  2BWP A;  4PIW A;  1YAA A;  4M2K A;  2D64 A;  2ZY4 A;  3FKD A;  1KKJ A;  2TPL A;  4EFF A;  1J04 A;  5M4D A;  3NNK A;  2G6W A;  4F5G A;  2JJF A;  2C44 A;  4KXK A;  2VMW A;  3MKJ A;  1AJS B;  2DKB A;  2E7U A;  3GR9 A;  4WXG A;  4WYA A;  2VMU A;  5TF5 A;  1ASC A;  4MQQ A;  3FD0 A;  1W23 A;  3MAF A;  1N2T A;  3FDD A;  1BJ4 A;  3PIU A;  4W1W A;  2AY5 A;  1D7U A;  1M0P A;  4Y0H A;  2YCP A;  2GMS A;  3LG0 A;  3RCH A;  1QJ3 A;  3NYS A;  5M46 A;  4UOY A;  2D66 A;  3AEL A;  1QJ5 A;  3VOM A;  3EZS A;  2RFV A;  4OBV A;  3AAT A;  2AY8 A;  4F5K A;  3FVU A;  3QGU A;  1M4N A;  1UU1 A;  2VIA A;  5G4J A;  4EU1 A;  2DGL A;  4WYC A;  4XJM A;  2YRI A;  3HVY A;  3WGB A;  1JF9 A;  4ISY A;  2W7D A;  7AAT A;  1E5F A;  4E3Q A;  1M32 A;  4EB7 A;  1AKB A;  3N75 A;  2EGY A;  1SZU A;  1QIR A;  1B9I A;  2R0T A;  3H7F A;  3JTX A;  3G7Q A;  4AZJ A;  4WYF A;  3B1D A;  3PPL A;  1BJW A;  1D7S A;  1G4V A;  3GJU A;  1BKG A;  1I48 A;  2W8V A;  3PA9 A;  1H0C A;  1TOG A;  1VJO A;  3BWN C;  1ART A;  2D65 A;  2OAT A;  4O6Z A;  3ECD A;  2CJH A;  3FRK A;  4XJL A;  1JS3 A;  3OP7 A;  4K2M A;  2X5F A;  4A6T A;  1DJU A;  2W7F A;  1I41 A;  1CQ7 A;  4RIZ A;  4W1V A;  1Z7D A;  3II0 A;  3R9A A;  1GDE A;  4XJP A;  3ELE A;  4AO9 A;  3NYU A;  3M5U A;  1MLY A;  2VMR A;  3K40 A;  2BWO A;  2HP2 A;  1BW0 A;  4OT8 A;  3T32 A;  9AAT A;  1G4X A;  4A0F A;  4P3M A;  2ZY2 A;  2EH6 A;  4WD2 A;  1KKP A;  5D95 A;  4A6R A;  3DXV A;  4WYE A;  3CQ4 A;  2V0Y A;  4JF1 A;  4RLG A;  1IAY A;  2R5C B;  1AMS A;  2VYC A;  4OYT A;  4UHM A;  5C6U A;  1SZS A;  2R5C A;  3K28 A;  3WCN A;  1QZ9 A;  3BC8 A;  4IXO A;  2C81 A;  3B1C A;  4A0H A;  1X0M A;  4KYO A;  4OMA A;  1W7N A;  2YOB A;  1O62 A;  4LW2 A;  4ZWM A;  3WKS A;  1AAW A;  1IX6 A;  1DJ9 A;  2Z61 A;  4PFF A;  3E77 A;  4ZM3 A;  5M4B A;  3EI8 A;  4LNM A;  1MLZ A;  1DJE A;  3WY7 A;  4LW4 A;  2W8U A;  3AOW A;  1EQB A;  2BI9 A;  2AY3 A;  2Z67 A;  2JIS A;  2Z9W A;  1C7G A;  5AX8 A;  1S06 A;  3N5M A;  4M2J A;  4MSO A;  1IVR A;  1MAQ A;  2VI9 A;  2HOX A;  1AJR A;  1AHY A;  1ASB A;  4Q31 A;  4WYD A;  2HOY A;  3ATH A;  1TOI A;  3I16 A;  2VGW A;  4F5J A;  2EPJ A;  1AHX A;  4W5K A;  2X5D A;  2HZP A;  3N0L A;  1AMR A;  1AY5 A;  3DU4 A;  3ELP A;  4NOG A;  4XQ2 A;  3FZ7 A;  1O61 A;  1W7M A;  1I29 A;  2W7E A;  4Y0I A;  5F8V A;  5M49 A;  3VK3 A;  1B8G A;  1B5O A;  3AEM A;  4JE5 D;  4IXZ A;  1WKG A;  1YJZ A;  1DFO A;  3BV0 A;  2HUI A;  2BI5 A;  3JW9 A;  3KE3 A;  3NYT A;  5FT4 A;  1M0O A;  3NUB A;  2YCT A;  4FL0 A;  1CQ6 A;  4J5U A;  2CIN A;  4CBS A;  2D61 A;  5LHA A;  1YOO A;  4ITG A;  3W1H A;  1RV3 A;  3RCH B;  2BI2 A;  4FFC A;  3E9K A;  3PGY A;  3MC6 C;  2PB0 A;  3CQ6 A;  4A72 A;  1AHF A;  1CS1 A;  4A00 A;  1S0A A;  3DR4 A;  2VLF A;  3GWP A;  4GSA A;  3W1J A;  1H1C A;  3BCX A;  2O0R A;  1OHY A;  2OKJ A;  1BS0 A;  4RJ0 A;  3LVJ A;  4K2I A;  5EAV A;  4ZAS A;  5K8B A;  2R5E A;  2XBN A;  1CJ0 A;  1FG7 A;  2CTZ A;  1RV4 A;  1ASL A;  3AV7 A;  1GCK A;  1TOJ A;  1S09 A;  1LW5 A;  2Z1Y A;  5G09 A;  3RBL A;  2WK8 A;  1JG8 A;  1BT4 A;  4PFN A;  4RKC A;  2FQ6 A;  5EQC A;  4ZLV A;  1PFF A;  1TOE A;  3A8U X;  3HL2 A;  2VMQ A;  2WKA A;  1BJN A;  5G0A A;  4CXQ A;  1DTY A;  1DGD A;  1SF2 A;  1GD9 A;  2EZ2 A;  4RAE A;  4QGR A;  4BHD A;  5HHY A;  2GSA A;  2JJG A;  2ZSM A;  3H14 A;  3FZ6 A;  2VMT A;  2HOZ A;  3ZRR A;  4U2H A;  4JE5 A;  3VP6 A;  4F5M A;  1B5P A;  1LC5 A;  1Z3Z A;  2E54 A;  3FVS A;  4F5L A;  1QIT A;  3USF A;  1WYV B;  2VI8 A;  2QB2 A;  3AEN B;  3E2F A;  1U08 A;  1M0Q A;  4HF8 A;  4TMR A;  4ADE A;  2O1B A;  3BN1 A;  4E77 A;  3Q8N A;  4RJY A;  3MBB A;  3B8X A;  2JJH A;  2ZY3 A;  2CST A;  1KMJ A;  4EMY A;  3AEJ C;  1RVY A;  3E6G A;  2VMZ A;  1KL2 A;  2W7G A;  3GSB A;  5E5I A;  1C0N A;  3ASB A;  2F8J A;  3WKR A;  1AIC A;  2ZC0 A;  1BQA A;  1V2F A;  5G4I A;  3A9Y A;  5EFS A;  1S07 A;  2VMX A;  3FQA A;  5DJ9 A;  2VMY A;  4ZWV A;  3LVL B;  4IYO B;  3GZD A;  3COG A;  1AMQ A;  1T3I A;  4OCA A;  5EAA A;  4GEB A;  1M7Y A;  1S08 A;  2VGZ A;  3KKI A;  1KMK A;  1CQ8 A;  3QPG A;  1BQD A;  4WYG A;  3A2B A;  4RM1 A;  3FZ8 A;  4ADD A;  1GEY A;  1KL1 A;  1WYU B;  1GBN A;  3B46 A;  4AOA A;  2JGT A;  3QBO A;  2NMP A;  3FSL A;  4DGT A;  3ZZJ A;  3I4J A;  3LVM A;  3HT4 A;  5FT5 A;  4XK1 A;  4N0B A;  2VLH A;  3KGX A;  4F4E A;  3PD6 A;  3IF2 A;  3LVK A;  4GE9 A;  5D5S A;  2R2N A;  5G2P A;  1ORD A;  4MQR A;  4I8A A;  1GC3 A;  3EIA A;  5FT8 A;  3TFU A;  1AX4 A;  5IWQ A;  3JZL A;  2AY1 A;  1CZC A;  1IUG A;  2YHK A; 
#chains in the Genus database with same CATH topology
 2DGK A;  2O7C A;  2W7L A;  2W7M A;  2Z1Z A;  3VK2 A;  1TAR A;  1CZE A;  1AKC A;  1E5E A;  3EI7 A;  4JEY A;  2FM1 A;  3AEO A;  1ASA A;  3RQ1 A;  3GET A;  3BCA A;  5I92 A;  2VMS A;  4MY5 A;  1IAX A;  2VGS A;  4OC9 A;  1MDZ A;  4GE7 A;  5E4Z A;  3QM2 A;  3HBX A;  2W8T A;  3A9X A;  5DJ1 A;  4MGR A;  1D2F A;  1ASF A;  1GC4 A;  2FN6 A;  1O4S A;  1LKC A;  3RUY A;  3MEB A;  4LNL A;  3FQ8 A;  2BWN A;  3PDB A;  1FG3 A;  1SFF A;  3D6K A;  2VIB A;  3DR7 A;  1MDO A;  4ZSW A;  1AIB A;  1N8P A;  4WLH A;  4MKJ A;  2BYJ A;  2V1P A;  5J8Q A;  3OKS A;  2QB3 A;  1ZC9 A;  2Z9X A;  2QLR A;  1ASE A;  1CL2 A;  3DYD A;  4B98 A;  4ZM4 A;  4TN4 A;  2GB3 A;  3AOV A;  1C4K A;  2VGV A;  2ZYJ A;  4UHO A;  4E3R A;  3DOD A;  1B9H A;  4N0W A;  1IX7 A;  1M6S A;  4UQV A;  1I43 A;  4KAM A;  4B9B A;  4E1O A;  4OBU A;  3WZF A;  1WKH A;  4BMK A;  1OHV A;  2VMO A;  1GEX A;  2VGT A;  4A6U A;  2WB6 A;  4XEW A;  4OTL A;  4R5Z A;  1J32 A;  4EB5 A;  2HUU A;  2YKV A;  4BA4 A;  2CY8 A;  2AEU A;  4RKD A;  2BIE A;  4AO4 A;  3LY1 A;  3EZ1 A;  4Q76 A;  3JWA A;  4ZAH A;  3PJ0 A;  1N31 A;  3RI6 A;  1ASM A;  1D7R A;  1TAT A;  2YKX A;  3BCB A;  3TFT A;  4ZDO A;  2ZY5 A;  4IX8 A;  3EUC A;  2AY9 A;  3JU7 A;  2FNU A;  2ORD A;  4U1T A;  3BWN A;  2E7J A;  2ZJG A;  2EO5 A;  4TV7 A;  2FYF A;  1V2D A;  2D5Y A;  1ZOB A;  3ASA A;  1RVU A;  4F5I A;  3FTB A;  1ZOD A;  1TAS A;  2BKW A;  3K7Y A;  3HQT A;  3QHX A;  1OXP A;  2GQN A;  4RIT A;  4F5H A;  1XEY A;  1C9C A;  1W7L A;  1TOK A;  3P6K A;  4Q6R A;  5FT6 A;  3FFR A;  3PD6 B;  4ITX A;  5EIG A;  2Z20 A;  2A1V A;  4K05 A;  2EZ1 A;  1CL1 A;  3NRA A;  4IYO A;  1YNU A;  1Y4I A;  2VMV A;  4W91 A;  1ELQ A;  3N4R A;  5G2Q A;  1ELU A;  1ASG A;  1LK9 A;  3BS8 A;  2QA3 A;  2AEV A;  2QSR A;  3L8A A;  4W1X A;  1GEW A;  2D7Y A;  2CFB A;  2JG2 A;  3NX3 A;  4J8L A;  1MGV A;  1PG8 A;  2GMU A;  3EIB A;  3WX9 A;  3BWO A;  1V72 A;  1B4X A;  3AEP A;  2D7Z A;  2D63 A;  1DKA A;  3FDB A;  2W7H A;  3KGW A;  4UHN A;  4JEV A;  4IXS A;  4WB0 A;  2AY4 A;  4L0O A;  1AAM A;  2ZSL A;  4LC3 A;  4P7Y A;  1P3W A;  3ISL A;  4JF0 A;  1ASN A;  2DR1 A;  3NU7 A;  1UU0 A;  1VP4 A;  3F9T A;  4WLJ A;  3NTJ A;  1YJS A;  4XAU A;  1WYT B;  3MAU A;  1AY8 A;  3WGC A;  5HXX A;  1AY4 A;  1IX8 A;  3GZD C;  2EYQ A;  1OHW A;  2ZUK A;  5EUD A;  1AMA A;  1OXO A;  3ZRP A;  3EI6 A;  2Z9U A;  3CQ5 A;  3F6T A;  2PB2 A;  1WYU A;  1X28 A;  2YKY A;  3L44 A;  5EUN A;  4ATQ A;  3IHJ A;  4AZK A;  2X8U A;  3E2Y A;  1ARS A;  4JEW A;  1DGE A;  1G7X A;  2CB1 A;  3LV2 A;  3MAF B;  1SZK A;  2ZP7 A;  2BYL A;  2BI3 A;  3AEM C;  3GBX A;  3HDO A;  4WB0 B;  4HVK A;  1EG5 A;  2BHX A;  5DB5 A;  3PDB B;  1IBJ A;  1W3U A;  2VGU A;  4CBR A;  1C7O A;  2CAN A;  4ATP A;  2WK7 A;  2W7J A;  3UWC A;  3MAD A;  5F9S A;  1SPA A;  3FCR A;  1ASD A;  3LWS A;  1AHG A;  1UKJ A;  2HUF A;  1MAP A;  3TCM A;  2VMN A;  4BA5 A;  1ARG A;  3QI6 A;  3ACZ A;  4F5F A;  2DOU A;  2VMP A;  3P1T A;  1IJI A;  1SVV A;  3R4T A;  1QGN A;  4CVQ A;  1TPL A;  1AJS A;  3DRD A;  3PAA A;  5HDM A;  3EI5 A;  2YCN A;  2DGM A;  3FFH A;  4IW7 A;  5JAY A;  1M0N A;  1YIZ A;  2AY2 A;  3DC1 A;  3VK4 A;  2OGA A;  2W7I A;  1LC7 A;  4M2M A;  2XH1 A;  4R5F A;  4IY7 A;  3VAX A;  4ZDL A;  1G7W A;  4JEZ A;  1PMM A;  1FC4 A;  4WP0 A;  3N7N A;  1LW4 A;  1PMO A;  4DQ6 A;  2FNI A;  1OAT A;  2DKJ A;  3DZZ A;  3B1E A;  5EUE A;  2CH1 A;  3UAK A;  1V2E A;  4DBC A;  2C0R A;  2BI1 A;  4R2N A;  3DXW A;  3CBF A;  3WLX A;  2CJG A;  4A0G A;  1XI9 A;  1D7V A;  2OGE A;  4H51 A;  1BJO A;  4WXB A;  3JWB A;  2CJD A;  1MDX A;  3RBF A;  1X2A A;  2WK9 A;  3HMU A;  3HLM A;  1BJO B;  2W8W A;  4ZDP A;  4ADC A;  3F0H A;  4A0R A;  4LNJ A;  3H9X A;  1JS6 A;  1EJI A;  3E2Z A;  2OKK A;  3TAT A;  2C7T A;  3E2Z B;  4WXF A;  1X29 A;  1WST A;  2PO3 A;  4JEX A;  4MQP A;  5E3K A;  1VEF A;  3ZZK A;  3NDN A;  4ADB A;  3NU8 A;  4W8I A;  4CXR A;  1ARI A;  2Z9V A;  1GC2 A;  3PDX A;  5BJ4 A;  4XJO A;  4GRX A;  3A9Z A;  5EIG B;  4MKK A;  1C7N A;  1LC8 A;  1AHE A;  2HOR A;  4AH3 A;  1WYV A;  3EI9 A;  4K2B A;  2E7I A;  3AEN A;  1ECX A;  1UU2 A;  3TQX A;  2G7J A;  3AEJ A;  3BB8 A;  2Q7W A;  4GE4 A;  1AIA A;  2YKU A;  4Y0D A;  3W1I A;  2BIA A;  3FQ7 A;  5LH9 A;  1LS3 A;  1QIS A;  2BIG A;  3QN6 A;  8AAT A;  1O69 A;  1GC0 A;  2QMA A;  2AY7 A;  5BJ3 A;  2QBT A;  2X3L A;  4PVF A;  4WBT A;  4Q75 A;  3G0T A;  1ARH A;  2YRR A;  3GZC A;  4GDY A;  2W8J A;  2HP1 A;  3MC6 A;  3CAI A;  3I5T A;  1YIY A;  4BQ0 A;  1YJY A;  2CH2 A;  3UE8 A;  2W7K A;  2AAT A;  5DX5 A;  3WCO A;  4ZSY A;  2AY6 A;  3ZRQ A;  2OQX A;  3FVX A;  1WYT A;  3NUI A;  2JJE A;  4R8D A;  1AKA A;  3G8M A;  2BWP A;  4PIW A;  1YAA A;  4M2K A;  2D64 A;  2ZY4 A;  3FKD A;  1KKJ A;  2TPL A;  4EFF A;  1J04 A;  5KTB A;  5M4D A;  3NNK A;  2G6W A;  4F5G A;  2JJF A;  2C44 A;  4KXK A;  2VMW A;  3MKJ A;  1AJS B;  2DKB A;  2E7U A;  3GR9 A;  4WXG A;  4WYA A;  2VMU A;  5TF5 A;  1ASC A;  4MQQ A;  3FD0 A;  2KFP A;  1W23 A;  3MAF A;  1N2T A;  3FDD A;  1BJ4 A;  3PIU A;  4W1W A;  2AY5 A;  1D7U A;  1M0P A;  4Y0H A;  2YCP A;  2GMS A;  3LG0 A;  3RCH A;  1QJ3 A;  3NYS A;  5M46 A;  4UOY A;  2D66 A;  3AEL A;  1QJ5 A;  3VOM A;  3EZS A;  2RFV A;  4OBV A;  3AAT A;  2AY8 A;  4F5K A;  3FVU A;  3QGU A;  1M4N A;  1UU1 A;  2VIA A;  5G4J A;  4EU1 A;  2DGL A;  4WYC A;  4XJM A;  2YRI A;  3HVY A;  3WGB A;  1JF9 A;  4ISY A;  2W7D A;  7AAT A;  1E5F A;  4E3Q A;  1M32 A;  4EB7 A;  1AKB A;  3N75 A;  2EGY A;  1SZU A;  1QIR A;  1B9I A;  2R0T A;  3H7F A;  3JTX A;  3G7Q A;  4AZJ A;  4WYF A;  3B1D A;  3PPL A;  1BJW A;  1D7S A;  1G4V A;  3GJU A;  1BKG A;  1I48 A;  2W8V A;  3PA9 A;  1H0C A;  1TOG A;  1VJO A;  3BWN C;  1ART A;  2D65 A;  2OAT A;  4O6Z A;  3ECD A;  2CJH A;  3FRK A;  4XJL A;  1JS3 A;  3OP7 A;  4K2M A;  2X5F A;  4A6T A;  1DJU A;  2W7F A;  1I41 A;  1CQ7 A;  4RIZ A;  4W1V A;  1Z7D A;  3II0 A;  3R9A A;  1GDE A;  4XJP A;  3ELE A;  4AO9 A;  3NYU A;  3M5U A;  1MLY A;  2VMR A;  3K40 A;  2BWO A;  2HP2 A;  1BW0 A;  4OT8 A;  3T32 A;  9AAT A;  1G4X A;  4A0F A;  4P3M A;  2ZY2 A;  2EH6 A;  4WD2 A;  1KKP A;  5D95 A;  4A6R A;  3DXV A;  4WYE A;  3CQ4 A;  2V0Y A;  4JF1 A;  4RLG A;  1IAY A;  2R5C B;  1AMS A;  2VYC A;  4OYT A;  4UHM A;  5C6U A;  1SZS A;  2R5C A;  3K28 A;  3WCN A;  1QZ9 A;  3BC8 A;  4IXO A;  2C81 A;  3B1C A;  4A0H A;  1X0M A;  4KYO A;  4OMA A;  3N4S A;  1W7N A;  2YOB A;  1O62 A;  4LW2 A;  4ZWM A;  3WKS A;  1AAW A;  1IX6 A;  1DJ9 A;  2Z61 A;  4PFF A;  3E77 A;  4ZM3 A;  2FKI A;  5M4B A;  3EI8 A;  4LNM A;  1MLZ A;  1DJE A;  3WY7 A;  4LW4 A;  2W8U A;  3AOW A;  1EQB A;  2BI9 A;  2AY3 A;  2Z67 A;  2JIS A;  2Z9W A;  1C7G A;  5AX8 A;  1S06 A;  3N5M A;  4M2J A;  4MSO A;  1IVR A;  1MAQ A;  2VI9 A;  2HOX A;  1AJR A;  1AHY A;  1ASB A;  4Q31 A;  4WYD A;  2HOY A;  3ATH A;  1TOI A;  3I16 A;  2VGW A;  4F5J A;  2EPJ A;  1AHX A;  4W5K A;  2X5D A;  2HZP A;  3N0L A;  1AMR A;  1AY5 A;  3DU4 A;  3ELP A;  4NOG A;  4XQ2 A;  3FZ7 A;  1O61 A;  1W7M A;  1I29 A;  2W7E A;  4Y0I A;  5F8V A;  5M49 A;  3VK3 A;  1B8G A;  1B5O A;  3AEM A;  4JE5 D;  4IXZ A;  1WKG A;  1YJZ A;  1DFO A;  3BV0 A;  2HUI A;  2BI5 A;  3JW9 A;  3KE3 A;  3NYT A;  5FT4 A;  1M0O A;  3NUB A;  2YCT A;  4FL0 A;  1CQ6 A;  4J5U A;  2CIN A;  4CBS A;  2D61 A;  5LHA A;  1YOO A;  4ITG A;  3W1H A;  1RV3 A;  3RCH B;  2BI2 A;  4FFC A;  3E9K A;  3PGY A;  3MC6 C;  2PB0 A;  3CQ6 A;  4A72 A;  1AHF A;  1CS1 A;  4A00 A;  1S0A A;  3DR4 A;  2VLF A;  3GWP A;  4GSA A;  3W1J A;  1H1C A;  3BCX A;  2O0R A;  1OHY A;  2OKJ A;  1BS0 A;  4RJ0 A;  3LVJ A;  4K2I A;  5EAV A;  4ZAS A;  5K8B A;  2R5E A;  2XBN A;  1CJ0 A;  1FG7 A;  2CTZ A;  1RV4 A;  1ASL A;  3AV7 A;  1GCK A;  1TOJ A;  1S09 A;  1LW5 A;  2Z1Y A;  5G09 A;  3RBL A;  2WK8 A;  1JG8 A;  1BT4 A;  4PFN A;  4RKC A;  2FQ6 A;  5EQC A;  4ZLV A;  1PFF A;  1TOE A;  3A8U X;  3HL2 A;  2VMQ A;  2WKA A;  1BJN A;  5G0A A;  4CXQ A;  1DTY A;  1DGD A;  1SF2 A;  1GD9 A;  2EZ2 A;  4RAE A;  4QGR A;  4BHD A;  5HHY A;  2GSA A;  2JJG A;  2ZSM A;  3H14 A;  3FZ6 A;  2VMT A;  2HOZ A;  3ZRR A;  4U2H A;  4JE5 A;  3VP6 A;  4F5M A;  1B5P A;  1LC5 A;  1Z3Z A;  2E54 A;  3FVS A;  4F5L A;  1QIT A;  3USF A;  1WYV B;  2VI8 A;  2QB2 A;  3AEN B;  3E2F A;  1U08 A;  1M0Q A;  4HF8 A;  4TMR A;  4ADE A;  2O1B A;  3BN1 A;  4E77 A;  3Q8N A;  4RJY A;  1KAF A;  3MBB A;  3B8X A;  2JJH A;  2ZY3 A;  2CST A;  1KMJ A;  4EMY A;  3AEJ C;  1RVY A;  3E6G A;  3N4X A;  2VMZ A;  1KL2 A;  2W7G A;  3GSB A;  5E5I A;  1C0N A;  3ASB A;  2F8J A;  3WKR A;  1AIC A;  2ZC0 A;  1BQA A;  1V2F A;  5G4I A;  3A9Y A;  5EFS A;  1S07 A;  2VMX A;  3FQA A;  5DJ9 A;  2VMY A;  4ZWV A;  3LVL B;  4IYO B;  3GZD A;  3COG A;  1AMQ A;  1T3I A;  4OCA A;  5EAA A;  4GEB A;  1M7Y A;  4H63 Q;  1S08 A;  2VGZ A;  3KKI A;  1KMK A;  1CQ8 A;  3QPG A;  1BQD A;  4WYG A;  3A2B A;  4RM1 A;  3FZ8 A;  4ADD A;  1GEY A;  1KL1 A;  1WYU B;  1GBN A;  3B46 A;  4AOA A;  2JGT A;  3QBO A;  2NMP A;  3FSL A;  4DGT A;  3ZZJ A;  3I4J A;  3LVM A;  3HT4 A;  5FT5 A;  4XK1 A;  4N0B A;  2VLH A;  3KGX A;  4F4E A;  3PD6 A;  3IF2 A;  3LVK A;  4GE9 A;  5D5S A;  2R2N A;  5G2P A;  1ORD A;  4MQR A;  4I8A A;  1GC3 A;  3EIA A;  5FT8 A;  3TFU A;  1AX4 A;  5IWQ A;  3JZL A;  2AY1 A;  1CZC A;  1IUG A;  2YHK A; 
#chains in the Genus database with same CATH homology
 2DGK A;  2O7C A;  2W7L A;  2W7M A;  2Z1Z A;  3VK2 A;  1TAR A;  1CZE A;  1AKC A;  1E5E A;  3EI7 A;  4JEY A;  2FM1 A;  3AEO A;  1ASA A;  3RQ1 A;  3GET A;  3BCA A;  5I92 A;  2VMS A;  4MY5 A;  1IAX A;  2VGS A;  4OC9 A;  1MDZ A;  4GE7 A;  5E4Z A;  3QM2 A;  3HBX A;  2W8T A;  3A9X A;  5DJ1 A;  4MGR A;  1D2F A;  1ASF A;  1GC4 A;  2FN6 A;  1O4S A;  1LKC A;  3RUY A;  3MEB A;  4LNL A;  3FQ8 A;  2BWN A;  3PDB A;  1FG3 A;  1SFF A;  3D6K A;  2VIB A;  3DR7 A;  1MDO A;  4ZSW A;  1AIB A;  1N8P A;  4WLH A;  4MKJ A;  2BYJ A;  2V1P A;  5J8Q A;  3OKS A;  2QB3 A;  1ZC9 A;  2Z9X A;  2QLR A;  1ASE A;  1CL2 A;  3DYD A;  4B98 A;  4ZM4 A;  4TN4 A;  2GB3 A;  3AOV A;  1C4K A;  2VGV A;  2ZYJ A;  4UHO A;  4E3R A;  3DOD A;  1B9H A;  4N0W A;  1IX7 A;  1M6S A;  4UQV A;  1I43 A;  4KAM A;  4B9B A;  4E1O A;  4OBU A;  3WZF A;  1WKH A;  4BMK A;  1OHV A;  2VMO A;  1GEX A;  2VGT A;  4A6U A;  2WB6 A;  4XEW A;  4OTL A;  4R5Z A;  1J32 A;  4EB5 A;  2HUU A;  2YKV A;  4BA4 A;  2CY8 A;  2AEU A;  4RKD A;  2BIE A;  4AO4 A;  3LY1 A;  3EZ1 A;  4Q76 A;  3JWA A;  4ZAH A;  3PJ0 A;  1N31 A;  3RI6 A;  1ASM A;  1D7R A;  1TAT A;  2YKX A;  3BCB A;  3TFT A;  4ZDO A;  2ZY5 A;  4IX8 A;  3EUC A;  2AY9 A;  3JU7 A;  2FNU A;  2ORD A;  4U1T A;  3BWN A;  2E7J A;  2ZJG A;  2EO5 A;  4TV7 A;  2FYF A;  1V2D A;  2D5Y A;  1ZOB A;  3ASA A;  1RVU A;  4F5I A;  3FTB A;  1ZOD A;  1TAS A;  2BKW A;  3K7Y A;  3HQT A;  3QHX A;  1OXP A;  2GQN A;  4RIT A;  4F5H A;  1XEY A;  1C9C A;  1W7L A;  1TOK A;  3P6K A;  4Q6R A;  5FT6 A;  3FFR A;  3PD6 B;  4ITX A;  5EIG A;  2Z20 A;  2A1V A;  4K05 A;  2EZ1 A;  1CL1 A;  3NRA A;  4IYO A;  1YNU A;  1Y4I A;  2VMV A;  4W91 A;  1ELQ A;  3N4R A;  5G2Q A;  1ELU A;  1ASG A;  1LK9 A;  3BS8 A;  2QA3 A;  2AEV A;  2QSR A;  3L8A A;  4W1X A;  1GEW A;  2D7Y A;  2CFB A;  2JG2 A;  3NX3 A;  4J8L A;  1MGV A;  1PG8 A;  2GMU A;  3EIB A;  3WX9 A;  3BWO A;  1V72 A;  1B4X A;  3AEP A;  2D7Z A;  2D63 A;  1DKA A;  3FDB A;  2W7H A;  3KGW A;  4UHN A;  4JEV A;  4IXS A;  4WB0 A;  2AY4 A;  4L0O A;  1AAM A;  2ZSL A;  4LC3 A;  4P7Y A;  1P3W A;  3ISL A;  4JF0 A;  1ASN A;  2DR1 A;  3NU7 A;  1UU0 A;  1VP4 A;  3F9T A;  4WLJ A;  3NTJ A;  1YJS A;  4XAU A;  1WYT B;  3MAU A;  1AY8 A;  3WGC A;  5HXX A;  1AY4 A;  1IX8 A;  3GZD C;  2EYQ A;  1OHW A;  2ZUK A;  5EUD A;  1AMA A;  1OXO A;  3ZRP A;  3EI6 A;  2Z9U A;  3CQ5 A;  3F6T A;  2PB2 A;  1WYU A;  1X28 A;  2YKY A;  3L44 A;  5EUN A;  4ATQ A;  3IHJ A;  4AZK A;  2X8U A;  3E2Y A;  1ARS A;  4JEW A;  1DGE A;  1G7X A;  2CB1 A;  3LV2 A;  3MAF B;  1SZK A;  2ZP7 A;  2BYL A;  2BI3 A;  3AEM C;  3GBX A;  3HDO A;  4WB0 B;  4HVK A;  1EG5 A;  2BHX A;  5DB5 A;  3PDB B;  1IBJ A;  1W3U A;  2VGU A;  4CBR A;  1C7O A;  2CAN A;  4ATP A;  2WK7 A;  2W7J A;  3UWC A;  3MAD A;  5F9S A;  1SPA A;  3FCR A;  1ASD A;  3LWS A;  1AHG A;  1UKJ A;  2HUF A;  1MAP A;  3TCM A;  2VMN A;  4BA5 A;  1ARG A;  3QI6 A;  3ACZ A;  4F5F A;  2DOU A;  2VMP A;  3P1T A;  1IJI A;  1SVV A;  3R4T A;  1QGN A;  4CVQ A;  1TPL A;  1AJS A;  3DRD A;  3PAA A;  5HDM A;  3EI5 A;  2YCN A;  2DGM A;  3FFH A;  4IW7 A;  5JAY A;  1M0N A;  1YIZ A;  2AY2 A;  3DC1 A;  3VK4 A;  2OGA A;  2W7I A;  1LC7 A;  4M2M A;  2XH1 A;  4R5F A;  4IY7 A;  3VAX A;  4ZDL A;  1G7W A;  4JEZ A;  1PMM A;  1FC4 A;  4WP0 A;  3N7N A;  1LW4 A;  1PMO A;  4DQ6 A;  2FNI A;  1OAT A;  2DKJ A;  3DZZ A;  3B1E A;  5EUE A;  2CH1 A;  3UAK A;  1V2E A;  4DBC A;  2C0R A;  2BI1 A;  4R2N A;  3DXW A;  3CBF A;  3WLX A;  2CJG A;  4A0G A;  1XI9 A;  1D7V A;  2OGE A;  4H51 A;  1BJO A;  4WXB A;  3JWB A;  2CJD A;  1MDX A;  3RBF A;  1X2A A;  2WK9 A;  3HMU A;  3HLM A;  1BJO B;  2W8W A;  4ZDP A;  4ADC A;  3F0H A;  4A0R A;  4LNJ A;  3H9X A;  1JS6 A;  1EJI A;  3E2Z A;  2OKK A;  3TAT A;  2C7T A;  3E2Z B;  4WXF A;  1X29 A;  1WST A;  2PO3 A;  4JEX A;  4MQP A;  5E3K A;  1VEF A;  3ZZK A;  3NDN A;  4ADB A;  3NU8 A;  4W8I A;  4CXR A;  1ARI A;  2Z9V A;  1GC2 A;  3PDX A;  5BJ4 A;  4XJO A;  4GRX A;  3A9Z A;  5EIG B;  4MKK A;  1C7N A;  1LC8 A;  1AHE A;  2HOR A;  4AH3 A;  1WYV A;  3EI9 A;  4K2B A;  2E7I A;  3AEN A;  1ECX A;  1UU2 A;  3TQX A;  2G7J A;  3AEJ A;  3BB8 A;  2Q7W A;  4GE4 A;  1AIA A;  2YKU A;  4Y0D A;  3W1I A;  2BIA A;  3FQ7 A;  5LH9 A;  1LS3 A;  1QIS A;  2BIG A;  3QN6 A;  8AAT A;  1O69 A;  1GC0 A;  2QMA A;  2AY7 A;  5BJ3 A;  2QBT A;  2X3L A;  4PVF A;  4WBT A;  4Q75 A;  3G0T A;  1ARH A;  2YRR A;  3GZC A;  4GDY A;  2W8J A;  2HP1 A;  3MC6 A;  3CAI A;  3I5T A;  1YIY A;  4BQ0 A;  1YJY A;  2CH2 A;  3UE8 A;  2W7K A;  2AAT A;  5DX5 A;  3WCO A;  4ZSY A;  2AY6 A;  3ZRQ A;  2OQX A;  3FVX A;  1WYT A;  3NUI A;  2JJE A;  4R8D A;  1AKA A;  3G8M A;  2BWP A;  4PIW A;  1YAA A;  4M2K A;  2D64 A;  2ZY4 A;  3FKD A;  1KKJ A;  2TPL A;  4EFF A;  1J04 A;  5KTB A;  5M4D A;  3NNK A;  2G6W A;  4F5G A;  2JJF A;  2C44 A;  4KXK A;  2VMW A;  3MKJ A;  1AJS B;  2DKB A;  2E7U A;  3GR9 A;  4WXG A;  4WYA A;  2VMU A;  5TF5 A;  1ASC A;  4MQQ A;  3FD0 A;  2KFP A;  1W23 A;  3MAF A;  1N2T A;  3FDD A;  1BJ4 A;  3PIU A;  4W1W A;  2AY5 A;  1D7U A;  1M0P A;  4Y0H A;  2YCP A;  2GMS A;  3LG0 A;  3RCH A;  1QJ3 A;  3NYS A;  5M46 A;  4UOY A;  2D66 A;  3AEL A;  1QJ5 A;  3VOM A;  3EZS A;  2RFV A;  4OBV A;  3AAT A;  2AY8 A;  4F5K A;  3FVU A;  3QGU A;  1M4N A;  1UU1 A;  2VIA A;  5G4J A;  4EU1 A;  2DGL A;  4WYC A;  4XJM A;  2YRI A;  3HVY A;  3WGB A;  1JF9 A;  4ISY A;  2W7D A;  7AAT A;  1E5F A;  4E3Q A;  1M32 A;  4EB7 A;  1AKB A;  3N75 A;  2EGY A;  1SZU A;  1QIR A;  1B9I A;  2R0T A;  3H7F A;  3JTX A;  3G7Q A;  4AZJ A;  4WYF A;  3B1D A;  3PPL A;  1BJW A;  1D7S A;  1G4V A;  3GJU A;  1BKG A;  1I48 A;  2W8V A;  3PA9 A;  1H0C A;  1TOG A;  1VJO A;  3BWN C;  1ART A;  2D65 A;  2OAT A;  4O6Z A;  3ECD A;  2CJH A;  3FRK A;  4XJL A;  1JS3 A;  3OP7 A;  4K2M A;  2X5F A;  4A6T A;  1DJU A;  2W7F A;  1I41 A;  1CQ7 A;  4RIZ A;  4W1V A;  1Z7D A;  3II0 A;  3R9A A;  1GDE A;  4XJP A;  3ELE A;  4AO9 A;  3NYU A;  3M5U A;  1MLY A;  2VMR A;  3K40 A;  2BWO A;  2HP2 A;  1BW0 A;  4OT8 A;  3T32 A;  9AAT A;  1G4X A;  4A0F A;  4P3M A;  2ZY2 A;  2EH6 A;  4WD2 A;  1KKP A;  5D95 A;  4A6R A;  3DXV A;  4WYE A;  3CQ4 A;  2V0Y A;  4JF1 A;  4RLG A;  1IAY A;  2R5C B;  1AMS A;  2VYC A;  4OYT A;  4UHM A;  5C6U A;  1SZS A;  2R5C A;  3K28 A;  3WCN A;  1QZ9 A;  3BC8 A;  4IXO A;  2C81 A;  3B1C A;  4A0H A;  1X0M A;  4KYO A;  4OMA A;  3N4S A;  1W7N A;  2YOB A;  1O62 A;  4LW2 A;  4ZWM A;  3WKS A;  1AAW A;  1IX6 A;  1DJ9 A;  2Z61 A;  4PFF A;  3E77 A;  4ZM3 A;  2FKI A;  5M4B A;  3EI8 A;  4LNM A;  1MLZ A;  1DJE A;  3WY7 A;  4LW4 A;  2W8U A;  3AOW A;  1EQB A;  2BI9 A;  2AY3 A;  2Z67 A;  2JIS A;  2Z9W A;  1C7G A;  5AX8 A;  1S06 A;  3N5M A;  4M2J A;  4MSO A;  1IVR A;  1MAQ A;  2VI9 A;  2HOX A;  1AJR A;  1AHY A;  1ASB A;  4Q31 A;  4WYD A;  2HOY A;  3ATH A;  1TOI A;  3I16 A;  2VGW A;  4F5J A;  2EPJ A;  1AHX A;  4W5K A;  2X5D A;  2HZP A;  3N0L A;  1AMR A;  1AY5 A;  3DU4 A;  3ELP A;  4NOG A;  4XQ2 A;  3FZ7 A;  1O61 A;  1W7M A;  1I29 A;  2W7E A;  4Y0I A;  5F8V A;  5M49 A;  3VK3 A;  1B8G A;  1B5O A;  3AEM A;  4JE5 D;  4IXZ A;  1WKG A;  1YJZ A;  1DFO A;  3BV0 A;  2HUI A;  2BI5 A;  3JW9 A;  3KE3 A;  3NYT A;  5FT4 A;  1M0O A;  3NUB A;  2YCT A;  4FL0 A;  1CQ6 A;  4J5U A;  2CIN A;  4CBS A;  2D61 A;  5LHA A;  1YOO A;  4ITG A;  3W1H A;  1RV3 A;  3RCH B;  2BI2 A;  4FFC A;  3E9K A;  3PGY A;  3MC6 C;  2PB0 A;  3CQ6 A;  4A72 A;  1AHF A;  1CS1 A;  4A00 A;  1S0A A;  3DR4 A;  2VLF A;  3GWP A;  4GSA A;  3W1J A;  1H1C A;  3BCX A;  2O0R A;  1OHY A;  2OKJ A;  1BS0 A;  4RJ0 A;  3LVJ A;  4K2I A;  5EAV A;  4ZAS A;  5K8B A;  2R5E A;  2XBN A;  1CJ0 A;  1FG7 A;  2CTZ A;  1RV4 A;  1ASL A;  3AV7 A;  1GCK A;  1TOJ A;  1S09 A;  1LW5 A;  2Z1Y A;  5G09 A;  3RBL A;  2WK8 A;  1JG8 A;  1BT4 A;  4PFN A;  4RKC A;  2FQ6 A;  5EQC A;  4ZLV A;  1PFF A;  1TOE A;  3A8U X;  3HL2 A;  2VMQ A;  2WKA A;  1BJN A;  5G0A A;  4CXQ A;  1DTY A;  1DGD A;  1SF2 A;  1GD9 A;  2EZ2 A;  4RAE A;  4QGR A;  4BHD A;  5HHY A;  2GSA A;  2JJG A;  2ZSM A;  3H14 A;  3FZ6 A;  2VMT A;  2HOZ A;  3ZRR A;  4U2H A;  4JE5 A;  3VP6 A;  4F5M A;  1B5P A;  1LC5 A;  1Z3Z A;  2E54 A;  3FVS A;  4F5L A;  1QIT A;  3USF A;  1WYV B;  2VI8 A;  2QB2 A;  3AEN B;  3E2F A;  1U08 A;  1M0Q A;  4HF8 A;  4TMR A;  4ADE A;  2O1B A;  3BN1 A;  4E77 A;  3Q8N A;  4RJY A;  3MBB A;  3B8X A;  2JJH A;  2ZY3 A;  2CST A;  1KMJ A;  4EMY A;  3AEJ C;  1RVY A;  3E6G A;  3N4X A;  2VMZ A;  1KL2 A;  2W7G A;  3GSB A;  5E5I A;  1C0N A;  3ASB A;  2F8J A;  3WKR A;  1AIC A;  2ZC0 A;  1BQA A;  1V2F A;  5G4I A;  3A9Y A;  5EFS A;  1S07 A;  2VMX A;  3FQA A;  5DJ9 A;  2VMY A;  4ZWV A;  3LVL B;  4IYO B;  3GZD A;  3COG A;  1AMQ A;  1T3I A;  4OCA A;  5EAA A;  4GEB A;  1M7Y A;  4H63 Q;  1S08 A;  2VGZ A;  3KKI A;  1KMK A;  1CQ8 A;  3QPG A;  1BQD A;  4WYG A;  3A2B A;  4RM1 A;  3FZ8 A;  4ADD A;  1GEY A;  1KL1 A;  1WYU B;  1GBN A;  3B46 A;  4AOA A;  2JGT A;  3QBO A;  2NMP A;  3FSL A;  4DGT A;  3ZZJ A;  3I4J A;  3LVM A;  3HT4 A;  5FT5 A;  4XK1 A;  4N0B A;  2VLH A;  3KGX A;  4F4E A;  3PD6 A;  3IF2 A;  3LVK A;  4GE9 A;  5D5S A;  2R2N A;  5G2P A;  1ORD A;  4MQR A;  4I8A A;  1GC3 A;  3EIA A;  5FT8 A;  3TFU A;  1AX4 A;  5IWQ A;  3JZL A;  2AY1 A;  1CZC A;  1IUG A;  2YHK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...