2CU1A

Solution structure of the pb1 domain of human protein kinase mekk2b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
103
Chain Sequence
GSSGSSGDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 2
publication title Solution structure of the PB1 domain of human protein kinase MEKK2b
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 103
sequence length 103
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cu1A01
1S3SG 3VH3B 1H4RA 4IWOA 2EMTA 2C7HA 2KTRA 5DPSA 3PRZA 2KMCA 1XQQA 5DPRA 4IG7B 4XC2A 1HE8A 4XZ4A 3UIOB 3N3KB 4LCDE 2KJ6A 1WIAA 2PEAA 4IWPA 1WE6A 2PE6B 2YLMA 1EO6A 3RD2A 2GOWA 1LQBA 2DYBA 3VUYA 1GUAB 1GG3A 3Q3FA 4E3CA 2ZPYA 1BT0A 2KTFA 1OGWA 2N1WA 4GDKB 4BBNF 4FA6A 2K25A 5D94A 4DK5A 4FHJA 2JF5A 5E6PA 3WAMA 3TBLD 2KC1A 1V5TA 3UGBB 3H6NA 4CYEA 3W1SA 3BINA 2DAFA 2WYQA 3DBRI 3L54A 1EUVB 3AULA 2DZJA 3ZNHB 2CS4A 4MM3A 1KLVA 5CX3A 4GOCA 4BOSC 2KQSA 4BKSA 4EKUA 3QA8A 1WMHB 1V6EA 2DZIA 3IFWB 2BWES 3KYDD 2MBQA 1ISNA 1Y8RC 2XEWA 2NPTA 4ICUA 2XK5B 4TQ0A 3H7SA 2KTRB 3WAOA 3A9KB 2KKCA 3QK0A 3VTVA 5G2NA 4BKSD 4ZRIA 1KM7A 5LXIB 2DENB 3NHEB 4W9GA 4CO7A 3GOEA 2PJHA 1WGDA 1J8CA 5G55A 3ZDTA 3QARA 1FXTB 2UYZB 1YX5B 1GC7A 4JGHB 4HXDA 2WX0A 3ML8A 3QC8B 3DCGA 3DBLI 2KK8A 2NBVB 3B0AA 2MBHA 3KUDB 3NZSA 2HJ8A 3VQIA 3SHQA 3ZNZB 3K9OB 1C3TA 1IYFA 2O6VA 2CHWA 4MELA 1I35A 4N9F4 4ANWA 1YIWA 1P0RA 2ZCCA 4RM9A 1WGHA 2I1JA 4PYUA 2AL3A 2LASA 4W9DA 2BKFA 1V9JA 1K8RB 4WQOB 5D6JB 3OLMD 3VH4B 4B95A 2BGFA 2EKEC 5DCNA 2BPSA 2B3AA 3DVGX 2JT4B 2KFJA 1WYWB 2O6VD 5C23A 2D10A 5C1ZA 1WJ6A 1P3QU 2FNJB 4NY0A 5J2RA 4GSWA 4LDTD 3MJWA 3T8MA 1E8YA 4W9FA 2IO1B 1C1YB 2REXA 3KUZA 3VXWA 2FCSA 1UH6A 1H8CA 2D2QA 4E71A 1WJ4A 2IY0B 3PHXB 2KXJA 4FHKA 4FBJB 3C0RB 3ZLZA 2D07B 2K39A 1WXMA 1SIFA 2BYEA 5E6NA 1VD2A 1P1AA 2LGYA 4K7WA 4TQ1A 3QHTA 4PYZA 3H7PA 5BO4B 3I3TB 4GDLA 3ML9A 4GMVA 4YL8A 3IG3A 3M95A 3O65B 3V6CB 4AJYB 2KWCA 5FR6A 2KNBA 3ZW3A 4LJOB 1OEYA 2LI5A 4DDID 2GBNA 2Z0DB 4G0NB 1V81A 2KWUB 3NY5A 2O6VB 2W9NA 3DBHI 1ZKHA 2AEHA 3JW0X 3R7QA 1CMXB 2AYOB 3QAQA 1WJNA 1TTNA 5KHOA 4WJOA 4BOZB 4DHZE 5DPWA 1GNUA 1E5WA 4ZRJA 4K7UA 4W9JA 4W9LA 1OQYA 3JVZX 3EC8A 5D2MB 2L3ZA 5JHAA 4MGYE 2YVCA 4JQWC 2LRUA 3ZTCA 3AU4A 2NBUA 2CR5A 3M62B 3RT3B 3OAWA 3L08A 3PT2B 3L10B 3HIZA 3ZNID 4BVUC 5AZHA 2ZNVB 2MLBA 2WX1A 1J0GA 2MP2A 1MG8A 3EHVA 1RLFA 3A9JB 1NBFC 1F9JA 2A4ZA 1R4MI 1KJTA 4M8MA 1A5RA 2FIDA 2KJHB 2KANA 2ZCBA 4IM3A 2MBEA 1P98A 2PE9A 3ZTDA 4W9CA 2D11A 3QJZA 1E7VA 1UGMA 2KC2A 4GDLB 1OTRB 3IVFA 5CHVC 3Q3JA 1X1MA 2IO3B 1WF9A 4NNJB 4FADA 4HJKA 4ANVA 2AL6A 4GIVA 4NQKE 3NS8A 3DQVA 2R2QA 3AXCA 4MSMB 2G4DB 3APDA 4NQLB 3U7DA 3PVLA 4K1RB 2V3SA 1OEYJ 4GXBA 2OJRA 3ZNGC 1WY8A 1P9DU 4WJQA 3ZUNA 3OJ3A 3L13A 3APCA 3IBEA 1WX8A 1LFDA 5KHQA 3RZFA 3PTFC 3PLVA 1R4NI 1EF1A 2FCNA 2KO3A 2LXCA 3NOBA 3W1YA 4FULA 4MDKE 2Z59B 2KX0A 4G3XB 4M8NA 2DAJA 4I6NB 1V2YA 4KDIC 1WGRA 3WANA 2LGDA 3X0WA 2KFKA 2WDTB 2KX3A 4DWFA 4WWOA 4KSLC 2CKHB 3QIJA 4GGQA 1JRUA 1VCBA 2L05A 3N32A 4FJVB 3VUWA 2M17A 1ZGUB 4EZLA 2KZRA 4WJPA 2D3GA 2KDBA 1RFAA 2M8SA 4WWPA 3R66C 2MQJA 1WFYA 2BWFA 4TKNA 4IM0A 4BKGA 2J0MA 2AWTA 3JSVA 4I6LB 3TCAA 4AOFA 3UQBA 2GBKA 5E6OA 2K8HA 2J7QB 2PPHA 3HK0A 2RSUA 4G11A 4ZRKA 4HVBA 3R3MA 3ZRCA 3KYCD 3H1UA 2R2OA 1G6JA 4II3B 1Z2MA 2MCNB 4ZDVA 1NDDA 3L17A 2N4FA 3NZUA 3AI5A 3QCAA 1V49A 2IYDB 2IBIB 1UD7A 3V6EB 1QZEA 3PREA 4JIOU 3ZRFA 4CHKA 4DHZB 2G45B 1WZ0A 3A1QA 2ZZPB 3R7RA 3U30A 2LWPA 3LJ3A 2RR9A 3IHPC 2ZVOA 3VFKA 2NPTB 1S1QB 2KFKB 1WZ3A 2L0TA 2O2VA 2Z0EB 3ENEA 3KW5B 4IWQA 3UQAA 1WJUA 3LDZE 4FJZA 2KD0A 1WR1A 2JPHA 5IA7A 1WM2A 2ASQA 2KWVB 1XT9B 1E8WA 5GMVA 2LVQA 2CU1A 4P7IA 4ANXA 4DDGD 2C5LC 2N7EA 4HDQA 1RAXA 2WWZA 3KVFB 4GN1A 3TJPA 4A3PA 4A3OA 2NVUI 4IUMB 4NJ6A 2IZVB 2KDEB 1AARA 2FUHB 3HHMA 4KZ0A 4NAWA 4W9HA 2KHWB 2JVCA 3W1SC 3WA0A 3BY4B 4HK2A 4EFOA 3H9DA 1WX7A 4WAAA 2C7MB 4EUTA 2MX2A 4WWNA 4B6WA 5J17A 3QWZB 4LDTB 2FIFA 1Q5WB 2LJ5A 3N30A 1GC6A 3APFA 2IO2B 2N9XA 3AU5A 3WIMA 2NR2A 5AZGA 5JHBA 4WJNA 4RM8A 4BFRA 1E8XA 1YJ1A 2NBWB 3DVGY 3KUCB 4EOYA 4NPNA 2JXXA 4HLEA 2L8JA 2GBRA 2LGXA 5CHFA 3P2BA 2M0XA 1IPGA 2DZMA 2KOXA 3S2AA 3SU8X 2I1KA 1YQBA 2KDIA 2L0FA 3VAWA 1NI2A 1PQSA 2IO0B 3VTUA 1IP9A 4ICVA 4MGIE 3PGEA 2C9WB 5IAAC 3V61A 3ZVVA 1L7YA 4JL9A 4MEMA 4K81A 3EECA 4X57B 3VTWA 1UBIA 1WR6E 3ZIMA 2FCQA 1WXSA 2LVPA 3PZDA 1WMHA 3TIXA 2K6DB 5DPTA 1WRDB 1KOTA 1UELA 2G3QB 4I6PA 3H7PB 4KDLB 4M0WB 2HD5B 3PS6A 2JZZA 2KN5A 2BYVE 1Q0WB 1WE7A 1U4AA 2C60A 2XK5A 3QX1A 2DYMA 4MJSA 3V62A 3JYUA 5LXHA 4MSQB 4IC7B 2FAZA 1Q1OA 4NAWB 3A9KA 2JZ3B 3ONSA 1E8ZA 4G50A 4MGKE 2J0KA 1E90A 4HWIB 1V86A 3ZKJC 2CHXA 4ZYNA 1ZW7A 3HM6X 2N9EB 2MBBB 2MA9B 1WGGA 2JWZA 4MGZE 4AP4C 2EMSA 3WALA 2ZNVC 4W9KA 4AJWA 2LUEA 2K8BA 1YX6B 3MHSD 2K8CA 4KIKA 5JH5C 4B9KA 1L2NA 3D32A 3DVNV 2K6QA 2KMAA 4FN2A 2MP2B 2DZKA 2LRWA 4W9IA 1SGHA 3VVWB 4OVVA 3SDLC 2KDFB 3TL5A 1WI0A 5HKHA 2M1MA 3ZDMC 3CSFA 1WXVA 1GJZA 3PSEB 4LJPB 2DHZA 1WM3A 3PRMB 4EZKA 2JRHA 4URKA 2V1YA 3RYTA 4BBNC 2V4LA 3TMPB 2L00B 2GBJA 3RZWC 4IM2A 3RUIB 3M63B 4MJSB 3UF8A 3U8ZA 4GB9A 1WXAA 2ZEQA 4FLHA 2DX5B 2KLCA 4HDOA 2KLGA 2VRRB 3L0WB 2HE7A 3PLUA 2HTHA 4KVGB 4A20A 1YD8U 2Y5BB 1D3ZA 2N1VA 4KV2A 1M94A 1TBEA 2XBBC 3DPDA 3K9PB 4F8CB 4KSKC 4MH0E 1T0YA 2UWQA 3UINB 3L16A 1J19A 3CF6E 2JUOA 4II2B 3A4SC 4NJ7A 3ECIA 3RULA 3VHTC 3SD5A 2L76A 3A4RA 4HCPB 4KIKB 4ANUA 5D7GA 5AEKB 3QQ8B 3OJ4B 4DBGA 2C7NB 4DHJD 5TR5A 5L83A 2QHOA 2MW5A 1E7UA 4RMAA 4HCNB 1WX9A 5CTRC 5JZEB 5CHWA 4TV3A 1EF5A 3PHWB 4IW0A 2GMIC 1WH3A 2NS5A 3M3JA 1SE9A 2M4NA 2RD0A 1LXDA 3ALBA 3CMMB 3JSVB 4HPLB 4PS8A 3KH0A 2FCMA 2LXAA 2BF8B 1V80A 2OOBB 2BKRB 2N7DA 2NCNA 4K7SA 2K1FA 2LVOA 2N9PC 3RCZA 4F1SA 3A9JA 2MBOA 4PS3A 4XX5A 2MSED 4AUQC 3HM3A 5J18A 3DVNU 2L7RA 5EDSA 3PV1A 1UBQA 3PPAA 4DHJB 2MWSB 3ZO5B 4DXAB 2DYOA 1LM8B 4E74A 2J0JA 3VDZA 1I42A 1TGZB 3A1QB 4HPMB 1WGYA 2BYFA 1Z5SB 4KZCA 1TZ1A 3WAPA 2MRPA 2LD9A 4GDKA 2KVRA 3B08A 3B1LX 3DDCB 2RPQA 3V60A 4ASWC 4JLCA 4AWJA 2GBMA 4OVUA 4EZJA 3DBSA 2O2VB 2A5UA 5L95C 3A33B 1XD3B 3MTNB 2G4SA 5LLIA 2ZPNA 2IY1B 3GZNI 3T9LA 4F7ZA 1RRBA 3EFUA 2KJRA 3VUXA 2JRIB 3PRPB 4GU2A 2KQ7A 1UZXB 2RGFA 2ZVNA 4PS7A 3CSTA 4TUUA 3UIPB 4W9EA 1V5OA 4FJYA 4EEWA 2LZ6A 3DOWA 4J6IA 2JY6A 2ZJDA 4BKTA 3X23A 2CHZA 5AZFA
chains in the Genus database with same CATH superfamily
2KTRA 2INCC 4IG7B 4XC2A 4XZ4A 3Q3OC 2EELA 1EO6A 4JPSA 2PW9A 2NMQA 1LQBA 2IGHA 1GUAB 3ABVB 3GP7A 1BT0A 4FA6A 2K25A 5D94A 4FHJA 2JF5A 1V5TA 1FNWA 3H6NA 3DBRI 3L54A 3ZNHB 2UU7A 2CS4A 4MM3A 3QA8A 2X38A 2DZIA 2JXTA 2J53A 2XEWA 3BVZA 3H7SA 3W2DA 1VZ8A 5G2NA 4ZRIA 1IBXB 5LXIB 2DENB 4HKZE 4CO7A 2PJHA 1WGDA 1J8CA 5G55A 3GB1A 3QARA 2D3CA 2WLBA 3ML8A 2KYWA 3B0AA 1I4XA 1C3TA 1IYFA 1UUPA 3SHQA 3ZNZB 3K9OB 4ANWA 1K50A 1YIWA 1GAQB 2ZCCA 2I1JA 3RNAC 2AL3A 2BKFA 2E6XA 4WQOB 5D6JB 2N0SB 4B95A 1T0RC 3DHGC 2MEKA 3DVGX 4K3BA 2KFJA 1WYWB 5C23A 3GE8C 2FNJB 4LDTD 3T8MA 1L0VB 4RCOA 1E8YA 2IO1B 2FCSA 2BTEA 1WJ4A 2KXJA 4FBJB 2D07B 1WXMA 3AEEB 2M0AA 5E6NA 3DWMA 4TQ1A 5BO4B 3IG3A 3AE8B 1OEYA 2O6VB 2ZW0A 4WIPA 3DBHI 4OW0A 2AEHA 1WXQA 1WJNA 2CJOA 4REZA 5KHOA 5DPWA 1E6EB 1GNUA 4O1NA 4C56C 2WDQB 3AEBB 3AMZA 2Y5CA 2L52A 3AE5B 4JQWC 1L0XB 2KQ4X 3OAWA 3L08A 3RNGC 2ZNVB 1V1PA 2INNE 2QEJC 1VZ7A 2OHFA 1A5RA 1L4DB 1KTKA 1CK1A 2KANA 1P98A 1ZOYB 4GDLB 1WF9A 2BS3B 4FADA 4HJKA 5GXGB 4YT0B 3NRZA 3APDA 4NQLB 4K1RB 1NEKB 2OJRA 3RMKC 1WY8A 2MJEA 3APCA 3IBEA 5KHQA 3RZFA 3E56A 3PLVA 2KO3A 1HA5A 2W3RA 1C76A 4G3XB 2VZKD 3P4PB 1T0SC 3MP9A 2LGDA 4KGTA 2WDTB 3SFDB 2KX3A 1JMLA 3QIJA 1QOAA 5G5GA 1IUEA 1VCBA 1ZGUB 4WWPA 3R66C 3SFEB 3UQBA 2AWTA 4I6LB 2PPHA 2RSUA 3R3MA 2LGIA 4R3DA 4RGTA 2BVCA 4ZDVA 1UNSA 1NDDA 1V49A 2RDGA 4DHZB 3A1QA 2ZZPB 3LJ3A 1MG4A 3IHPC 4P1CC 4IWQA 2KFKB 2O2VA 1WJUA 4LNOA 3DBLB 2JPHA 1FD6A 4S17A 4FXCA 5GMVA 1BXTA 4P7IA 2C5LC 1JWAD 3TJPA 4HDQA 2X8XX 3KVFB 1ACCA 1SE2A 3BYTB 4XDDA 1WRIA 4A9AA 1AARA 3H9DA 4WWNA 1TKYA 3AE4B 2WDVB 2R61A 4WWMA 3WIMA 2NR2A 5JHBA 4BFRA 3ZGZA 1YJ1A 3AE3B 4NPNA 2ICIA 2JYTA 1I7HA 3C8YA 2M0XA 4LLGM 2PIAA 1EWCA 1IP9A 3PGEA 2C9WB 3ZVVA 1JQ4A 1UBIA 1WR6E 2LVPA 3PZDA 1WMHA 4N59A 1N62A 3TIXA 4I6PA 2KAJA 2WP9B 1TZOA 2XK5A 3JYUA 3W9CB 2FAZA 2G9HD 1GOZA 2FE8A 3FC4A 2JZ3B 2V3NA 3ZQ4A 1RFKA 1QLBB 4ZYNA 4ACFA 1BUIC 2MA9B 5AUIA 3WALA 1DYQA 2LUEA 4XWWA 2IGDA 1DOYA 2TSSA 1IGDA 1QOGA 1V1PB 2DZKA 2BYTA 2VH1A 2MH7A 1GJZA 1YOVB 1JRPA 2PTLA 2D3BA 3EFCA 2QSDA 2JX5A 2GBJA 1ESFA 3RZWC 4IM2A 3RUIB 4MJSB 3U8ZA 4Q2JA 3HVZA 4HDOA 2KLGA 3Q8CA 2HTHA 1YD8U 1EU3A 1V8CA 4KV2A 1TBEA 5BMGA 4MH0E 2L32A 3P42A 1T0YA 2KDMA 3ZXVA 2FUG1 1UF0A 3CF6E 3E9SA 1WWTA 1XCQL 3A4RA 5D7GA 3QQ8B 3OJ4B 5TR5A 5L83A 2QHOA 4RMAA 1WX9A 5CHWA 4TV3A 1JWBD 3R2TA 4IW0A 2I38A 1FNUA 2M4NA 3RI7C 4WQMA 1LXDA 4PS8A 3KH0A 2FCMA 2WQYB 2N7DA 3ETRA 3IAS1 5G5HA 4AUQC 3I5JC 1KH0A 4RGNA 1ET6A 3DVNU 4LK0M 1SB3C 3PV1A 3IXSA 1LM8B 2J0JA 3A1QB 1ZDVA 3WAPA 1MJDA 3PZ7A 2KVRA 3B08A 1QOBA 3B1LX 4JLCA 4IOIE 4EZJA 2O2VB 5L95C 3A33B 2G4SA 5LLIA 2ZPNA 3H8HA 3VUXA 2KQ7A 2RGFA 1GB4A 1V5OA 4FJYA 3AE7B 2JY6A 1T3QA 2ZJDA 2MJDA 3FAHA 3I57A 1PFDA 1S3SG 1H4RA 2C7HA 3PRZA 3RNCC 5DPRA 1PDXA 2QDFA 3N20C 2OJWA 4LCDE 4JX1C 1WIAA 2MJ3A 2PEAA 1WE6A 2YLMA 1J7AA 4LNIA 3Q3FA 2N1WA 4GDKB 3AB5A 2CJNA 4MT5A 5E6PA 3WAMA 4AQ7A 3TBLD 2DBYA 3P1MA 3UGBB 4CYEA 3RPFC 3BINA 2DAFA 4P6VF 1EUVB 2DZJA 5IN7A 1KLVA 4EKUA 4BKSA 1WMHB 1V6EA 3IFWB 2NPTA 2XK5B 2BW2A 3UI3A 1YN4A 1HTOA 5E6JA 1P7EA 3QK0A 4B0EA 2WXIA 1KM7A 1WYGA 3GOEA 4US9A 4JGHB 4HXDA 2WX0A 1MFWA 4US8A 1N5WA 2GRIA 3DCGA 3DBLI 2KK8A 2MBHA 3KUDB 3I63C 2HJ8A 3NZSA 3VQIA 3GS2A 1C77A 4MACA 2O6VA 2CHWA 4RNAA 4RM9A 1YJJA 1V9JA 3OLMD 4J3OD 2BGFA 3N9YC 2B3AA 1YN3A 1C4CA 1ZDXA 4BAXA 1FIQA 4NY0A 3U7ZA 2WXQA 4W9FA 4ITKA 2D2QA 4E71A 2IY0B 3C0RB 2NTTA 1SIFA 3W5VB 3Q8AA 2LJIA 1FM0D 4GDLA 2H89B 3M95A 2QCZA 2KWCA 2KNBA 2LI5A 4DDID 2GBNA 2Z0DB 2LMCA 1JCKB 1RYJA 3JW0X 4JWSC 3R7QA 2AYOB 1TTNA 5FK9C 4BOZB 2HTME 1TS3A 3LB8C 2J42A 1OQYA 2E3TA 1JWMD 3EC8A 3AM9A 4A55A 2LRUA 3KLSX 3RT3B 1BMLC 1M4VA 3PT2B 2G1EA 3HIZA 3Q8EA 4YTPB 2MP2A 1MG8A 3EHVA 1RLFA 4M8MA 3C19A 2FIDA 2KJHB 4IM3A 2PE9A 4W9CA 4K3CA 3NS1A 1OTRB 2WXHA 1FMAD 3Q3JA 1OQRA 2IO3B 4DQOC 4OVZA 1FCLA 1K52A 3NS8A 3DQVA 5IOIA 3AE6B 2V3SA 2Z8LA 1OEYJ 4GXBA 3ZNGC 1P9DU 3BK1A 1TY2A 3OJ3A 1WX8A 1LFDA 1EF1A 2FCNA 2IPKD 3W1YA 4FULA 1PYWD 3X0WA 2KFKA 2WNMA 1JRUA 3N32A 3Q2AC 4FJVB 4HEA1 2KZRA 3NVYA 4WJPA 3L4PA 2MQJA 1WFYA 2BWFA 1DGJA 4TKNA 4BKGA 4KX6B 2J0MA 2GBKA 2JU6X 2K8HA 2J7QB 3HK0A 4ZRKA 4G11A 1XLPA 2NTSA 2R2OA 2XN9C 4DXFA 2L1AA 2V4IB 3L17A 1TT5B 2EKIA 3AI5A 3DHIC 1K53A 3PREA 4JIOU 1KLGD 2INDC 4BZAA 2RR9A 2NPTB 1EM7A 1S1QB 2Z0EB 3LDZE 5IKCM 2WXLA 4L23A 1WM2A 4LNKA 1E8WA 2LVQA 2WWZA 4GN1A 4LNFA 4IUMB 4ZOHC 2FUHB 4W9HA 2KHWB 4WAAA 5J17A 3QWZB 1ZXHA 1Q5WB 2N9XA 5AZGA 4WJNA 4HRSA 4RM8A 3DVGY 3FKYA 3HUIA 2JXXA 2LGXA 3P2BA 2RDBC 5HG2A 2DZMA 2KOXA 2WXNA 1YQBA 2KDIA 1EU4A 1R7SA 1PQSA 2IO0B 4JL9A 4MEMA 3EECA 4X57B 4KGSA 3ZIMA 2WHIA 1WRDB 1B9RA 2KACA 1FPYA 2KN5A 1WE7A 1U4AA 4MJSA 5LXHA 2DYMA 3VR8B 1Q1OA 4RH6A 4NAWB 1D5ZC 3A9KA 3MJ5A 2ACZB 1FRDA 2J0KA 1SJED 2JQRB 1E90A 4YSZB 3ZKJC 1QILA 1ZW7A 3HM6X 1R4MB 3CIRB 3T3NA 3P4SB 1YJIA 2ZNVC 5EE1A 1TS5A 1YX6B 1L6UA 3BVGA 3DVNV 2K6QA 4M00A 2MP2B 1SGHA 2QILA 3SDLC 4WURA 3PSEB 3VRAB 2JRHA 4KKJA 3AE1B 2W82A 4YWGG 2V4LA 3N1XC 3TMPB 1R4NB 2BT6A 1WXAA 2KLCA 3PLUA 3DHHC 2JSVX 2UWQA 2MHJA 4A90A 1J19A 2JUOA 3ECIA 3RULA 5C2TB 3VHTC 2W3SA 4ANUA 3N1ZC 2CU3A 4DHJD 4OZCA 3AV8A 1UWMA 4HCNB 5CTRC 3PHWB 2GMIC 1WH3A 3Q3NC 2WXKA 3M3JA 1SE9A 4OHJA 2YEPF 2RD0A 3P4RB 2LXAA 1V80A 4K7SA 3AEDB 2M56B 3BZDB 1C4AA 1Q10A 4NAMA 3A9JA 2MBOA 3HM3A 5EE9A 2GLSA 2PLPA 4IKGA 2MWSB 2GI9A 4HPMB 1Z5SB 4KZCA 1TZ1A 4GDKA 2MRPA 2LD9A 3ZJUA 3DDCB 5BYSA 4AWJA 4OVUA 1MHXA 3DBSA 1ZE3D 1XD3B 2K0PA 4P16A 3ZJTA 2KVZA 1D4BA 3T9LA 3EFUA 2KJRA 3PRPB 4GU2A 3W5UB 3CSTA 4W9EA 5BMHA 3DOWA 4D2KA 5AZFA 4ANXA 4IWOA 2KMCA 1XQQA 1HE8A 2KJ6A 3RD2A 3NZ3A 1P7FA 2DYBA 1VRAB 3IT4B 4E3CA 2ZPYA 4BBNF 4DK5A 1L4ZB 1TS4A 4TSSA 3RN9C 2KC1A 4ZRQA 1N63A 1ZPSA 4RFBA 2WYQA 1I4RA 1FFVA 4GLSC 2KQSA 2KWDA 2GB1A 1JWSD 4ICUA 4TQ0A 3A9KB 2PKOA 3VTVA 4BKSD 3NHEB 2DWQA 1FFUA 1FXTB 1GC7A 3I9V1 3Q8FA 2WS3B 1WSPA 2Y5PA 5HHDG 4MELA 1I35A 4N9F4 1WGHA 2LASA 4W9DA 3KWVA 5D3IB 3VH4B 3AECB 2EKEC 3CWIA 5T8IA 2JZPA 2O6VD 1Y56A 2D10A 5C1ZA 5J2RA 4GSWA 3AEGB 2BS2B 3MJWA 1I4GA 1L5PA 1C1YB 2REXA 3KUZA 1TYGB 3VXWA 1H8CA 4RGOS 3RNBC 4FHKA 1LGRA 3ZLZA 4C7ZA 1HZ5A 1I4HA 2BYEA 2LGYA 4QAYA 3RFZB 3I3TB 3ML9A 4AJYB 3V6CB 2QIEB 3ZW3A 1F1HA 4LJOB 4G0NB 2V0GA 3TEZA 3NY5A 5BMIA 1ZKHA 2D3AA 1CMXB 2LGSA 3QAQA 4KKIA 2SEBD 1QT9A 3PO0A 1E5WA 4W9JA 1ZUD2 3JVZX 2L3ZA 3MC9A 3ZTCA 2NBUA 2IDYA 3M62B 1VJKA 3ZNID 4BVUC 3IAM1 2MLBA 1SXTA 1J0GA 3A9JB 1NBFC 1F9JA 2A4ZA 1R4MI 1KJTA 4N58A 2ZCBA 1MHHE 2WU5B 3GE3C 4P1BC 3ZTDA 2D11A 2H88B 2AQ2B 3GZNB 1UGMA 2KC2A 2HJ1A 1X1MA 1ZXIA 1SJHD 4NNJB 4ANVA 4GIVA 3AXCA 3AN1A 2G4DB 1L0YB 2IJ0A 4MSMB 3PVLA 3LXFA 3FILB 4WJQA 1N6ZA 1R4NI 1HXYD 2LXCA 3P63A 3NOBA 2Z59B 4I6NB 2SAKA 4KDIC 1WGRA 3VRBB 1K51A 4DWFA 1PUTA 4WWOA 1I4QA 4KSLC 2CKHB 4GGQA 3VUWA 4EZLA 2KDBA 2M8SA 3V05A 3JSVA 2XNAC 5E6OA 1E10A 1TKGA 4HVBA 3KYCD 4CQNA 1G6JA 4II3B 1Z2MA 4WH4A 2LHDA 1AW7A 1E7PB 3NG0A 2N4FA 3QCAA 3V3XA 2ON8A 1UD7A 2IBIB 3ZXRA 1XEEA 1SSNA 3ZRFA 2G45B 4A8XC 4L1BA 1FXAA 1L6VA 2YEPB 4PT5A 3VFKA 3URYA 2L0TA 2BB5A 1JROA 4NZLB 1JALA 1T5XD 4YSYB 1N60A 2KD0A 3NJTA 4C4VB 2ASQA 2LHEA 2CU1A 4DDGD 2N7EA 4M02A 4A3PA 4A3OA 2NVUI 2KMMA 4JE3B 1D5XC 4LTUA 4NJ6A 2KDEB 2WXPA 1ET9A 4M01A 3HHMA 1XXGA 4NAWA 2Y3AA 3WA0A 1FO4A 4DXGA 4EUTA 2MX2A 2LJ5A 1GC6A 1HEZE 3APFA 2IO2B 3AU5A 3KUCB 4EOYA 4HLEA 5CHFA 2GBRA 1V97A 2J4XA 3EUB2 3S2AA 2I1KA 1UGJA 1XLQA 4TMAB 2L0FA 2VH2A 3VAWA 1QF6A 3SR6A 4ICVA 4MGIE 4UDUC 2V3PA 1F52A 3B2FA 4C7YA 1L7YA 4K81A 3NVWA 3VTWA 3T3OA 2AQ1B 2FCQA 2K6DB 1MVKA 1TS2A 5DPTA 1KOTA 4KDLB 1ZP0B 2BYVE 3QX1A 3V62A 4MSQB 2WXFA 4IC7B 2W55A 1E8ZA 1V86A 2CHXA 3Q6BA 2N9EB 2MBBB 1WGGA 2JWZA 2EMSA 2PMVA 3U4EG 4AJWA 1SF0A 2K8BA 5I4DA 2K8CA 5JH5C 1QKZA 2B76B 4B9KA 3D32A 3TEXA 4FN2A 4XGAB 3VR9B 3VVWB 2DNFA 3TL5A 2M1MA 3ZDMC 3CSFA 1SE4A 3PRMB 3RYTA 4BBNC 1T6BX 1TIFA 1RWSA 3M63B 4NJCA 3L0WB 3SEBA 2BBCA 1TY0A 2Y5BB 5TSSA 2N1VA 4ARIA 1M94A 4F8CB 4YTNB 3UINB 3LYYA 3L16A 4NJ7A 4YSXB 4HCPB 4KIKB 4RGMA 4ZRPA 1KLUD 2C7NB 4H2AA 1E7UA 5JZEB 4C80A 1NVID 2AQ3B 3B9JA 3MHZA 4N6EB 1C9FA 3CMMB 3JSVB 2WU2B 2N9KA 1CZPA 2OOBB 2BKRB 2NCNA 2N9PC 3TUOA 4PS3A 1NI3A 2K9XA 2MSED 5J18A 5EDSA 1UBQA 4JWUC 1SIJA 3PPAA 1E9MA 3ZO5B 2QJLA 4DXAB 3VDZA 1I42A 1TGZB 1MI0A 3V60A 4ASWC 4ZHPA 2GBMA 4IDIA 4KGRA 2LEKA 2A5UA 1PGXA 1F2RI 3MTNB 3WCQA 5EE0A 2D5GA 3GZNI 4F7ZA 4PK1A 1J7BA 1J7CA 2ZVNA 4PS7A 1GPXA 4B0MA 3UIPB 4EEWA 2LZ6A 1CJEA 2JYEA 3VH3B 2EMTA 5DPSA 4YXDB 3UIOB 3N3KB 4IWPA 2PE6B 1N61A 1PGAA 2GOWA 3NUHB 1D6EC 2BB6A 3VUYA 1GG3A 5HFYA 1PGBA 2KTFA 1OGWA 1OQQA 1AN8A 1YNTE 4MH8A 4AS1A 1JW9D 4C00A 2LUMA 1C4PA 2KN4A 3W1SA 1ROEA 2J52A 3AULA 5CX3A 4GOCA 1WGKA 4BOSC 5EE3A 3KYDD 2BWES 1TKEA 1C78A 2MBQA 1ISNA 1Y8RC 1SBBB 2DLBA 1XO3A 2KTRB 3WAOA 2KKCA 1YMHE 1XLOA 4W9GA 3ZDTA 3BIID 5HI1A 2UYZB 1YX5B 3QC8B 1YN5A 2NBVB 1FEHA 1P0RA 4PYUA 1K8RB 1OFFA 2WXGA 4MM3B 5DCNA 1N5XA 2BPSA 2JT4B 3TSSA 3U2SC 1WJ6A 2JWUA 1P3QU 1KF6B 4XWTA 1ENFA 3R8BA 4HJGE 1UH6A 4LNNA 4XDCA 5MPOA 3PHXB 3AE9B 2K39A 5BYQA 1VD2A 1P1AA 3OG5A 4K7WA 2QC8A 3QHTA 1AWDA 3Q8BA 4M0WA 4PYZA 3H7PA 4GMVA 4YL8A 3O65B 2Q5WD 5FR6A 1NENB 1V81A 2KWUB 5JXVA 2W9NA 4RF1A 5LNK1 1KRHA 3FILA 1EWYC 4DHZE 4WJOA 2INPE 2K5PA 2N7JA 4ZRJA 4K7UA 4W9LA 4ZHOA 2M19A 5D2MB 2L83A 5JHAA 4MGYE 2YVCA 3B2GA 3AU4A 2CR5A 3KQ4A 3L10B 5AZHA 2WX1A 1SE3A 2RDHA 4ARCA 3MC8A 2WXJA 1I4PA 2MBEA 2WGSA 3P4QB 3QJZA 1E7VA 2V9HA 1QOFA 2I2YA 2ONQA 3U52E 3IVFA 5CHVC 2BS4B 4A6QA 2AL6A 3BYYB 4NQKE 3RNEC 2R2QA 1TJEA 3U7DA 5FKAC 3ZUNA 3L13A 3PTFC 2LFIA 4MDKE 2KX0A 4M8NA 2DAJA 1V2YA 3WANA 1STEA 4HROA 1UWXA 1AYFA 4XYCA 1FNVA 2ZW1A 3AEAB 4C4VA 1IGCA 2L05A 3MFGA 2M17A 1LO5D 2D3GA 2PVOD 1RFAA 2AX5A 3DBRB 2N9LA 4IM0A 1YQ3B 5C3JB 3TCAA 4AOFA 3ZRCA 3H1UA 4S0RA 5IP4D 2MCNB 3IT6B 2WDRB 3NZUA 1FCCC 2IYDB 3V6EB 1QZEA 4CHKA 1WZ0A 3R7RA 2WXMA 3U30A 2LWPA 1B1ZA 2ZVOA 3BWUD 5AUKA 2RPVA 3UQAA 1WZ3A 3ENEA 3KW5B 5H92C 1F0ZA 4FJZA 1GB1A 1WR1A 2KT7A 5IA7A 2KWVB 4HPPA 1XT9B 1RAXA 1RM6C 2PVGC 2IZVB 1NYQA 3DWGC 1C79A 4KZ0A 3W1SC 2JVCA 4EFOA 3BY4B 4HK2A 1WX7A 2C7MB 4B6WA 4LDTB 2FIFA 1XF5L 3N30A 1E8XA 2NBWB 4OZAA 2L8JA 3TEWA 1IPGA 3SU8X 1HTQA 5H8YE 2QMTA 1NI2A 1YQ4B 3VTUA 3EA6A 1VZ6A 3NVZA 3BK2A 1FRRA 2HDEA 5IAAC 3V61A 4EE2A 3EGRA 3N1YC 1V1OA 4ZYSA 3DBHB 1WXSA 1HZ6A 1UELA 2G3QB 4M0WB 3H7PB 2HD5B 3PS6A 2JZZA 1Q0WB 2C60A 3ZYYX 3TEYA 1HQRD 3AE2B 4YTMB 1VDVA 3HRDD 3ONSA 4G50A 4MGKE 1IBXA 4HWIB 3J9CA 1MPEA 4MGZE 1VLBA 4AP4C 4W9KA 3PZ8A 3MHSD 5FR3A 4KIKA 1L2NA 2OEDA 2KMAA 1F2RC 2LRWA 4W9IA 4OVVA 1XLNA 1E0ZA 2KDFB 5HKHA 1WI0A 1D5MC 1WXVA 4LJPB 2DHZA 1WM3A 4EZKA 4URKA 2V1YA 2IGGA 1KFYB 2L00B 3ZJVA 1T0QC 3UF8A 3OWEB 1A70A 2VZKB 4GB9A 4HKQA 2ZEQA 2K22A 4FLHA 2DX5B 4OZBA 2VRRB 2HE7A 3R2IA 4KVGB 1F77A 4XE0A 4A20A 1D3ZA 3K9PB 2XBBC 3DPDA 4KSKC 4WAFA 1CQVA 3O13A 4II2B 2K3UA 3A4SC 3SD5A 1NYRA 2L76A 5BYRA 2WXRA 1QQRA 5AEKB 4DBGA 3AH7A 2BQQA 2MW5A 5IO9A 4USAA 1EF5A 2NS5A 1JWUD 3MC0B 4L2YA 1SEBD 2W54A 3ALBA 4HPLB 2BF8B 2WXOA 3AEFB 2K1FA 2LVOA 3RCZA 4F1SA 4XX5A 2L7RA 3NVVA 3BVMA 3Q14C 4DHJB 2DYOA 4E74A 3HVDA 4RF0A 1WGYA 2BYFA 1DOIA 3Q69A 2RPQA 3Q3MC 1VR9A 1FXIA 3KWLA 2IY1B 5D3DA 1RRBA 1XCTL 2JRIB 1UZXB 2FBWB 4TUUA 2RMMA 1DOXA 3RNFC 4J6IA 4BKTA 3X23A 2CHZA
chains in the Genus database with same CATH topology
1S3SG 3VH3B 1H4RA 4IWOA 2EMTA 2C7HA 2KTRA 5DPSA 3PRZA 2KMCA 1XQQA 5DPRA 4IG7B 4XC2A 1HE8A 4XZ4A 3UIOB 3N3KB 4LCDE 2KJ6A 1WIAA 2PEAA 4IWPA 1WE6A 2PE6B 2YLMA 1EO6A 3RD2A 2GOWA 1LQBA 2DYBA 3VUYA 1GUAB 1GG3A 3Q3FA 4E3CA 2ZPYA 1BT0A 2KTFA 1OGWA 2N1WA 4GDKB 4BBNF 4FA6A 2K25A 5D94A 4DK5A 4FHJA 2JF5A 5E6PA 3WAMA 3TBLD 2KC1A 1V5TA 3UGBB 3H6NA 4CYEA 3W1SA 3BINA 2DAFA 2WYQA 3DBRI 3L54A 1EUVB 3AULA 2DZJA 3ZNHB 2CS4A 4MM3A 1KLVA 5CX3A 4GOCA 4BOSC 2KQSA 4BKSA 4EKUA 3QA8A 1WMHB 1V6EA 2DZIA 3IFWB 2BWES 3KYDD 2MBQA 1ISNA 1Y8RC 2XEWA 2NPTA 4ICUA 2XK5B 4TQ0A 3H7SA 2KTRB 3WAOA 3A9KB 2KKCA 3QK0A 3VTVA 5G2NA 4BKSD 4ZRIA 1KM7A 5LXIB 2DENB 3NHEB 4W9GA 4CO7A 3GOEA 2PJHA 1WGDA 1J8CA 5G55A 3ZDTA 3QARA 1FXTB 2UYZB 1YX5B 1GC7A 4JGHB 4HXDA 2WX0A 3ML8A 3QC8B 3DCGA 3DBLI 2KK8A 2NBVB 3B0AA 2MBHA 3KUDB 3NZSA 2HJ8A 3VQIA 3SHQA 3ZNZB 3K9OB 1C3TA 1IYFA 2O6VA 2CHWA 4MELA 1I35A 4N9F4 4ANWA 1YIWA 1P0RA 2ZCCA 4RM9A 1WGHA 2I1JA 4PYUA 2AL3A 2LASA 4W9DA 2BKFA 1V9JA 1K8RB 4WQOB 5D6JB 3OLMD 3VH4B 4B95A 2BGFA 2EKEC 5DCNA 2BPSA 2B3AA 3DVGX 2JT4B 2KFJA 1WYWB 2O6VD 5C23A 2D10A 5C1ZA 1WJ6A 1P3QU 2FNJB 4NY0A 5J2RA 4GSWA 4LDTD 3MJWA 3T8MA 1E8YA 4W9FA 2IO1B 1C1YB 2REXA 3KUZA 3VXWA 2FCSA 1UH6A 1H8CA 2D2QA 4E71A 1WJ4A 2IY0B 3PHXB 2KXJA 4FHKA 4FBJB 3C0RB 3ZLZA 2D07B 2K39A 1WXMA 1SIFA 2BYEA 5E6NA 1VD2A 1P1AA 2LGYA 4K7WA 4TQ1A 3QHTA 4PYZA 3H7PA 5BO4B 3I3TB 4GDLA 3ML9A 4GMVA 4YL8A 3IG3A 3M95A 3O65B 3V6CB 4AJYB 2KWCA 5FR6A 2KNBA 3ZW3A 4LJOB 1OEYA 2LI5A 4DDID 2GBNA 2Z0DB 4G0NB 1V81A 2KWUB 3NY5A 2O6VB 2W9NA 3DBHI 1ZKHA 2AEHA 3JW0X 3R7QA 1CMXB 2AYOB 3QAQA 1WJNA 1TTNA 5KHOA 4WJOA 4BOZB 4DHZE 5DPWA 1GNUA 1E5WA 4ZRJA 4K7UA 4W9JA 4W9LA 1OQYA 3JVZX 3EC8A 5D2MB 2L3ZA 5JHAA 4MGYE 2YVCA 4JQWC 2LRUA 3ZTCA 3AU4A 2NBUA 2CR5A 3M62B 3RT3B 3OAWA 3L08A 3PT2B 3L10B 3HIZA 3ZNID 4BVUC 5AZHA 2ZNVB 2MLBA 2WX1A 1J0GA 2MP2A 1MG8A 3EHVA 1RLFA 3A9JB 1NBFC 1F9JA 2A4ZA 1R4MI 1KJTA 4M8MA 1A5RA 2FIDA 2KJHB 2KANA 2ZCBA 4IM3A 2MBEA 1P98A 2PE9A 3ZTDA 4W9CA 2D11A 3QJZA 1E7VA 1UGMA 2KC2A 4GDLB 1OTRB 3IVFA 5CHVC 3Q3JA 1X1MA 2IO3B 1WF9A 4NNJB 4FADA 4HJKA 4ANVA 2AL6A 4GIVA 4NQKE 3NS8A 3DQVA 2R2QA 3AXCA 4MSMB 2G4DB 3APDA 4NQLB 3U7DA 3PVLA 4K1RB 2V3SA 1OEYJ 4GXBA 2OJRA 3ZNGC 1WY8A 1P9DU 4WJQA 3ZUNA 3OJ3A 3L13A 3APCA 3IBEA 1WX8A 1LFDA 5KHQA 3RZFA 3PTFC 3PLVA 1R4NI 1EF1A 2FCNA 2KO3A 2LXCA 3NOBA 3W1YA 4FULA 4MDKE 2Z59B 2KX0A 4G3XB 4M8NA 2DAJA 4I6NB 1V2YA 4KDIC 1WGRA 3WANA 2LGDA 3X0WA 2KFKA 2WDTB 2KX3A 4DWFA 4WWOA 4KSLC 2CKHB 3QIJA 4GGQA 1JRUA 1VCBA 2L05A 3N32A 4FJVB 3VUWA 2M17A 1ZGUB 4EZLA 2KZRA 4WJPA 2D3GA 2KDBA 1RFAA 2M8SA 4WWPA 3R66C 2MQJA 1WFYA 2BWFA 4TKNA 4IM0A 4BKGA 2J0MA 2AWTA 3JSVA 4I6LB 3TCAA 4AOFA 3UQBA 2GBKA 5E6OA 2K8HA 2J7QB 2PPHA 3HK0A 2RSUA 4G11A 4ZRKA 4HVBA 3R3MA 3ZRCA 3KYCD 3H1UA 2R2OA 1G6JA 4II3B 1Z2MA 2MCNB 4ZDVA 1NDDA 3L17A 2N4FA 3NZUA 3AI5A 3QCAA 1V49A 2IYDB 2IBIB 1UD7A 3V6EB 1QZEA 3PREA 4JIOU 3ZRFA 4CHKA 4DHZB 2G45B 1WZ0A 3A1QA 2ZZPB 3R7RA 3U30A 2LWPA 3LJ3A 2RR9A 3IHPC 2ZVOA 3VFKA 2NPTB 1S1QB 2KFKB 1WZ3A 2L0TA 2O2VA 2Z0EB 3ENEA 3KW5B 4IWQA 3UQAA 1WJUA 3LDZE 4FJZA 2KD0A 1WR1A 2JPHA 5IA7A 1WM2A 2ASQA 2KWVB 1XT9B 1E8WA 5GMVA 2LVQA 2CU1A 4P7IA 4ANXA 4DDGD 2C5LC 2N7EA 4HDQA 1RAXA 2WWZA 3KVFB 4GN1A 3TJPA 4A3PA 4A3OA 2NVUI 4IUMB 4NJ6A 2IZVB 2KDEB 1AARA 2FUHB 3HHMA 4KZ0A 4NAWA 4W9HA 2KHWB 2JVCA 3W1SC 3WA0A 3BY4B 4HK2A 4EFOA 3H9DA 1WX7A 4WAAA 2C7MB 4EUTA 2MX2A 4WWNA 4B6WA 5J17A 3QWZB 4LDTB 2FIFA 1Q5WB 2LJ5A 3N30A 1GC6A 3APFA 2IO2B 2N9XA 3AU5A 3WIMA 2NR2A 5AZGA 5JHBA 4WJNA 4RM8A 4BFRA 1E8XA 1YJ1A 2NBWB 3DVGY 3KUCB 4EOYA 4NPNA 2JXXA 4HLEA 2L8JA 2GBRA 2LGXA 5CHFA 3P2BA 2M0XA 1IPGA 2DZMA 2KOXA 3S2AA 3SU8X 2I1KA 1YQBA 2KDIA 2L0FA 3VAWA 1NI2A 1PQSA 2IO0B 3VTUA 1IP9A 4ICVA 4MGIE 3PGEA 2C9WB 5IAAC 3V61A 3ZVVA 1L7YA 4JL9A 4MEMA 4K81A 3EECA 4X57B 3VTWA 1UBIA 1WR6E 3ZIMA 2FCQA 1WXSA 2LVPA 3PZDA 1WMHA 3TIXA 2K6DB 5DPTA 1WRDB 1KOTA 1UELA 2G3QB 4I6PA 3H7PB 4KDLB 4M0WB 2HD5B 3PS6A 2JZZA 2KN5A 2BYVE 1Q0WB 1WE7A 1U4AA 2C60A 2XK5A 3QX1A 2DYMA 4MJSA 3V62A 3JYUA 5LXHA 4MSQB 4IC7B 2FAZA 1Q1OA 4NAWB 3A9KA 2JZ3B 3ONSA 1E8ZA 4G50A 4MGKE 2J0KA 1E90A 4HWIB 1V86A 3ZKJC 2CHXA 4ZYNA 1ZW7A 3HM6X 2N9EB 2MBBB 2MA9B 1WGGA 2JWZA 4MGZE 4AP4C 2EMSA 3WALA 2ZNVC 4W9KA 4AJWA 2LUEA 2K8BA 1YX6B 3MHSD 2K8CA 4KIKA 5JH5C 4B9KA 1L2NA 3D32A 3DVNV 2K6QA 2KMAA 4FN2A 2MP2B 2DZKA 2LRWA 4W9IA 1SGHA 3VVWB 4OVVA 3SDLC 2KDFB 3TL5A 1WI0A 5HKHA 2M1MA 3ZDMC 3CSFA 1WXVA 1GJZA 3PSEB 4LJPB 2DHZA 1WM3A 3PRMB 4EZKA 2JRHA 4URKA 2V1YA 3RYTA 4BBNC 2V4LA 3TMPB 2L00B 2GBJA 3RZWC 4IM2A 3RUIB 3M63B 4MJSB 3UF8A 3U8ZA 4GB9A 1WXAA 2ZEQA 4FLHA 2DX5B 2KLCA 4HDOA 2KLGA 2VRRB 3L0WB 2HE7A 3PLUA 2HTHA 4KVGB 4A20A 1YD8U 2Y5BB 1D3ZA 2N1VA 4KV2A 1M94A 1TBEA 2XBBC 3DPDA 3K9PB 4F8CB 4KSKC 4MH0E 1T0YA 2UWQA 3UINB 3L16A 1J19A 3CF6E 2JUOA 4II2B 3A4SC 4NJ7A 3ECIA 3RULA 3VHTC 3SD5A 2L76A 3A4RA 4HCPB 4KIKB 4ANUA 5D7GA 5AEKB 3QQ8B 3OJ4B 4DBGA 2C7NB 4DHJD 5TR5A 5L83A 2QHOA 2MW5A 1E7UA 4RMAA 4HCNB 1WX9A 5CTRC 5JZEB 5CHWA 4TV3A 1EF5A 3PHWB 4IW0A 2GMIC 1WH3A 2NS5A 3M3JA 1SE9A 2M4NA 2RD0A 1LXDA 3ALBA 3CMMB 3JSVB 4HPLB 4PS8A 3KH0A 2FCMA 2LXAA 2BF8B 1V80A 2OOBB 2BKRB 2N7DA 2NCNA 4K7SA 2K1FA 2LVOA 2N9PC 3RCZA 4F1SA 3A9JA 2MBOA 4PS3A 4XX5A 2MSED 4AUQC 3HM3A 5J18A 3DVNU 2L7RA 5EDSA 3PV1A 1UBQA 3PPAA 4DHJB 2MWSB 3ZO5B 4DXAB 2DYOA 1LM8B 4E74A 2J0JA 3VDZA 1I42A 1TGZB 3A1QB 4HPMB 1WGYA 2BYFA 1Z5SB 4KZCA 1TZ1A 3WAPA 2MRPA 2LD9A 4GDKA 2KVRA 3B08A 3B1LX 3DDCB 2RPQA 3V60A 4ASWC 4JLCA 4AWJA 2GBMA 4OVUA 4EZJA 3DBSA 2O2VB 2A5UA 5L95C 3A33B 1XD3B 3MTNB 2G4SA 5LLIA 2ZPNA 2IY1B 3GZNI 3T9LA 4F7ZA 1RRBA 3EFUA 2KJRA 3VUXA 2JRIB 3PRPB 4GU2A 2KQ7A 1UZXB 2RGFA 2ZVNA 4PS7A 3CSTA 4TUUA 3UIPB 4W9EA 1V5OA 4FJYA 4EEWA 2LZ6A 3DOWA 4J6IA 2JY6A 2ZJDA 4BKTA 3X23A 2CHZA 5AZFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S3S G;  3VH3 B;  1H4R A;  4IWO A;  2EMT A;  2C7H A;  2KTR A;  5DPS A;  3PRZ A;  2KMC A;  1XQQ A;  5DPR A;  4IG7 B;  4XC2 A;  1HE8 A;  4XZ4 A;  3UIO B;  3N3K B;  4LCD E;  2KJ6 A;  1WIA A;  2PEA A;  4IWP A;  1WE6 A;  2PE6 B;  2YLM A;  1EO6 A;  3RD2 A;  2GOW A;  1LQB A;  2DYB A;  3VUY A;  1GUA B;  1GG3 A;  3Q3F A;  4E3C A;  2ZPY A;  1BT0 A;  2KTF A;  1OGW A;  2N1W A;  4GDK B;  4BBN F;  4FA6 A;  2K25 A;  5D94 A;  4DK5 A;  4FHJ A;  2JF5 A;  5E6P A;  3WAM A;  3TBL D;  2KC1 A;  1V5T A;  3UGB B;  3H6N A;  4CYE A;  3W1S A;  3BIN A;  2DAF A;  2WYQ A;  3DBR I;  3L54 A;  1EUV B;  3AUL A;  2DZJ A;  3ZNH B;  2CS4 A;  4MM3 A;  1KLV A;  5CX3 A;  4GOC A;  4BOS C;  2KQS A;  4BKS A;  4EKU A;  3QA8 A;  1WMH B;  1V6E A;  2DZI A;  3IFW B;  2BWE S;  3KYD D;  2MBQ A;  1ISN A;  1Y8R C;  2XEW A;  2NPT A;  4ICU A;  2XK5 B;  4TQ0 A;  3H7S A;  2KTR B;  3WAO A;  3A9K B;  2KKC A;  3QK0 A;  3VTV A;  5G2N A;  4BKS D;  4ZRI A;  1KM7 A;  5LXI B;  2DEN B;  3NHE B;  4W9G A;  4CO7 A;  3GOE A;  2PJH A;  1WGD A;  1J8C A;  5G55 A;  3ZDT A;  3QAR A;  1FXT B;  2UYZ B;  1YX5 B;  1GC7 A;  4JGH B;  4HXD A;  2WX0 A;  3ML8 A;  3QC8 B;  3DCG A;  3DBL I;  2KK8 A;  2NBV B;  3B0A A;  2MBH A;  3KUD B;  3NZS A;  2HJ8 A;  3VQI A;  3SHQ A;  3ZNZ B;  3K9O B;  1C3T A;  1IYF A;  2O6V A;  2CHW A;  4MEL A;  1I35 A;  4N9F 4;  4ANW A;  1YIW A;  1P0R A;  2ZCC A;  4RM9 A;  1WGH A;  2I1J A;  4PYU A;  2AL3 A;  2LAS A;  4W9D A;  2BKF A;  1V9J A;  1K8R B;  4WQO B;  5D6J B;  3OLM D;  3VH4 B;  4B95 A;  2BGF A;  2EKE C;  5DCN A;  2BPS A;  2B3A A;  3DVG X;  2JT4 B;  2KFJ A;  1WYW B;  2O6V D;  5C23 A;  2D10 A;  5C1Z A;  1WJ6 A;  1P3Q U;  2FNJ B;  4NY0 A;  5J2R A;  4GSW A;  4LDT D;  3MJW A;  3T8M A;  1E8Y A;  4W9F A;  2IO1 B;  1C1Y B;  2REX A;  3KUZ A;  3VXW A;  2FCS A;  1UH6 A;  1H8C A;  2D2Q A;  4E71 A;  1WJ4 A;  2IY0 B;  3PHX B;  2KXJ A;  4FHK A;  4FBJ B;  3C0R B;  3ZLZ A;  2D07 B;  2K39 A;  1WXM A;  1SIF A;  2BYE A;  5E6N A;  1VD2 A;  1P1A A;  2LGY A;  4K7W A;  4TQ1 A;  3QHT A;  4PYZ A;  3H7P A;  5BO4 B;  3I3T B;  4GDL A;  3ML9 A;  4GMV A;  4YL8 A;  3IG3 A;  3M95 A;  3O65 B;  3V6C B;  4AJY B;  2KWC A;  5FR6 A;  2KNB A;  3ZW3 A;  4LJO B;  1OEY A;  2LI5 A;  4DDI D;  2GBN A;  2Z0D B;  4G0N B;  1V81 A;  2KWU B;  3NY5 A;  2O6V B;  2W9N A;  3DBH I;  1ZKH A;  2AEH A;  3JW0 X;  3R7Q A;  1CMX B;  2AYO B;  3QAQ A;  1WJN A;  1TTN A;  5KHO A;  4WJO A;  4BOZ B;  4DHZ E;  5DPW A;  1GNU A;  1E5W A;  4ZRJ A;  4K7U A;  4W9J A;  4W9L A;  1OQY A;  3JVZ X;  3EC8 A;  5D2M B;  2L3Z A;  5JHA A;  4MGY E;  2YVC A;  4JQW C;  2LRU A;  3ZTC A;  3AU4 A;  2NBU A;  2CR5 A;  3M62 B;  3RT3 B;  3OAW A;  3L08 A;  3PT2 B;  3L10 B;  3HIZ A;  3ZNI D;  4BVU C;  5AZH A;  2ZNV B;  2MLB A;  2WX1 A;  1J0G A;  2MP2 A;  1MG8 A;  3EHV A;  1RLF A;  3A9J B;  1NBF C;  1F9J A;  2A4Z A;  1R4M I;  1KJT A;  4M8M A;  1A5R A;  2FID A;  2KJH B;  2KAN A;  2ZCB A;  4IM3 A;  2MBE A;  1P98 A;  2PE9 A;  3ZTD A;  4W9C A;  2D11 A;  3QJZ A;  1E7V A;  1UGM A;  2KC2 A;  4GDL B;  1OTR B;  3IVF A;  5CHV C;  3Q3J A;  1X1M A;  2IO3 B;  1WF9 A;  4NNJ B;  4FAD A;  4HJK A;  4ANV A;  2AL6 A;  4GIV A;  4NQK E;  3NS8 A;  3DQV A;  2R2Q A;  3AXC A;  4MSM B;  2G4D B;  3APD A;  4NQL B;  3U7D A;  3PVL A;  4K1R B;  2V3S A;  1OEY J;  4GXB A;  2OJR A;  3ZNG C;  1WY8 A;  1P9D U;  4WJQ A;  3ZUN A;  3OJ3 A;  3L13 A;  3APC A;  3IBE A;  1WX8 A;  1LFD A;  5KHQ A;  3RZF A;  3PTF C;  3PLV A;  1R4N I;  1EF1 A;  2FCN A;  2KO3 A;  2LXC A;  3NOB A;  3W1Y A;  4FUL A;  4MDK E;  2Z59 B;  2KX0 A;  4G3X B;  4M8N A;  2DAJ A;  4I6N B;  1V2Y A;  4KDI C;  1WGR A;  3WAN A;  2LGD A;  3X0W A;  2KFK A;  2WDT B;  2KX3 A;  4DWF A;  4WWO A;  4KSL C;  2CKH B;  3QIJ A;  4GGQ A;  1JRU A;  1VCB A;  2L05 A;  3N32 A;  4FJV B;  3VUW A;  2M17 A;  1ZGU B;  4EZL A;  2KZR A;  4WJP A;  2D3G A;  2KDB A;  1RFA A;  2M8S A;  4WWP A;  3R66 C;  2MQJ A;  1WFY A;  2BWF A;  4TKN A;  4IM0 A;  4BKG A;  2J0M A;  2AWT A;  3JSV A;  4I6L B;  3TCA A;  4AOF A;  3UQB A;  2GBK A;  5E6O A;  2K8H A;  2J7Q B;  2PPH A;  3HK0 A;  2RSU A;  4G11 A;  4ZRK A;  4HVB A;  3R3M A;  3ZRC A;  3KYC D;  3H1U A;  2R2O A;  1G6J A;  4II3 B;  1Z2M A;  2MCN B;  4ZDV A;  1NDD A;  3L17 A;  2N4F A;  3NZU A;  3AI5 A;  3QCA A;  1V49 A;  2IYD B;  2IBI B;  1UD7 A;  3V6E B;  1QZE A;  3PRE A;  4JIO U;  3ZRF A;  4CHK A;  4DHZ B;  2G45 B;  1WZ0 A;  3A1Q A;  2ZZP B;  3R7R A;  3U30 A;  2LWP A;  3LJ3 A;  2RR9 A;  3IHP C;  2ZVO A;  3VFK A;  2NPT B;  1S1Q B;  2KFK B;  1WZ3 A;  2L0T A;  2O2V A;  2Z0E B;  3ENE A;  3KW5 B;  4IWQ A;  3UQA A;  1WJU A;  3LDZ E;  4FJZ A;  2KD0 A;  1WR1 A;  2JPH A;  5IA7 A;  1WM2 A;  2ASQ A;  2KWV B;  1XT9 B;  1E8W A;  5GMV A;  2LVQ A;  2CU1 A;  4P7I A;  4ANX A;  4DDG D;  2C5L C;  2N7E A;  4HDQ A;  1RAX A;  2WWZ A;  3KVF B;  4GN1 A;  3TJP A;  4A3P A;  4A3O A;  2NVU I;  4IUM B;  4NJ6 A;  2IZV B;  2KDE B;  1AAR A;  2FUH B;  3HHM A;  4KZ0 A;  4NAW A;  4W9H A;  2KHW B;  2JVC A;  3W1S C;  3WA0 A;  3BY4 B;  4HK2 A;  4EFO A;  3H9D A;  1WX7 A;  4WAA A;  2C7M B;  4EUT A;  2MX2 A;  4WWN A;  4B6W A;  5J17 A;  3QWZ B;  4LDT B;  2FIF A;  1Q5W B;  2LJ5 A;  3N30 A;  1GC6 A;  3APF A;  2IO2 B;  2N9X A;  3AU5 A;  3WIM A;  2NR2 A;  5AZG A;  5JHB A;  4WJN A;  4RM8 A;  4BFR A;  1E8X A;  1YJ1 A;  2NBW B;  3DVG Y;  3KUC B;  4EOY A;  4NPN A;  2JXX A;  4HLE A;  2L8J A;  2GBR A;  2LGX A;  5CHF A;  3P2B A;  2M0X A;  1IPG A;  2DZM A;  2KOX A;  3S2A A;  3SU8 X;  2I1K A;  1YQB A;  2KDI A;  2L0F A;  3VAW A;  1NI2 A;  1PQS A;  2IO0 B;  3VTU A;  1IP9 A;  4ICV A;  4MGI E;  3PGE A;  2C9W B;  5IAA C;  3V61 A;  3ZVV A;  1L7Y A;  4JL9 A;  4MEM A;  4K81 A;  3EEC A;  4X57 B;  3VTW A;  1UBI A;  1WR6 E;  3ZIM A;  2FCQ A;  1WXS A;  2LVP A;  3PZD A;  1WMH A;  3TIX A;  2K6D B;  5DPT A;  1WRD B;  1KOT A;  1UEL A;  2G3Q B;  4I6P A;  3H7P B;  4KDL B;  4M0W B;  2HD5 B;  3PS6 A;  2JZZ A;  2KN5 A;  2BYV E;  1Q0W B;  1WE7 A;  1U4A A;  2C60 A;  2XK5 A;  3QX1 A;  2DYM A;  4MJS A;  3V62 A;  3JYU A;  5LXH A;  4MSQ B;  4IC7 B;  2FAZ A;  1Q1O A;  4NAW B;  3A9K A;  2JZ3 B;  3ONS A;  1E8Z A;  4G50 A;  4MGK E;  2J0K A;  1E90 A;  4HWI B;  1V86 A;  3ZKJ C;  2CHX A;  4ZYN A;  1ZW7 A;  3HM6 X;  2N9E B;  2MBB B;  2MA9 B;  1WGG A;  2JWZ A;  4MGZ E;  4AP4 C;  2EMS A;  3WAL A;  2ZNV C;  4W9K A;  4AJW A;  2LUE A;  2K8B A;  1YX6 B;  3MHS D;  2K8C A;  4KIK A;  5JH5 C;  4B9K A;  1L2N A;  3D32 A;  3DVN V;  2K6Q A;  2KMA A;  4FN2 A;  2MP2 B;  2DZK A;  2LRW A;  4W9I A;  1SGH A;  3VVW B;  4OVV A;  3SDL C;  2KDF B;  3TL5 A;  1WI0 A;  5HKH A;  2M1M A;  3ZDM C;  3CSF A;  1WXV A;  1GJZ A;  3PSE B;  4LJP B;  2DHZ A;  1WM3 A;  3PRM B;  4EZK A;  2JRH A;  4URK A;  2V1Y A;  3RYT A;  4BBN C;  2V4L A;  3TMP B;  2L00 B;  2GBJ A;  3RZW C;  4IM2 A;  3RUI B;  3M63 B;  4MJS B;  3UF8 A;  3U8Z A;  4GB9 A;  1WXA A;  2ZEQ A;  4FLH A;  2DX5 B;  2KLC A;  4HDO A;  2KLG A;  2VRR B;  3L0W B;  2HE7 A;  3PLU A;  2HTH A;  4KVG B;  4A20 A;  1YD8 U;  2Y5B B;  1D3Z A;  2N1V A;  4KV2 A;  1M94 A;  1TBE A;  2XBB C;  3DPD A;  3K9P B;  4F8C B;  4KSK C;  4MH0 E;  1T0Y A;  2UWQ A;  3UIN B;  3L16 A;  1J19 A;  3CF6 E;  2JUO A;  4II2 B;  3A4S C;  4NJ7 A;  3ECI A;  3RUL A;  3VHT C;  3SD5 A;  2L76 A;  3A4R A;  4HCP B;  4KIK B;  4ANU A;  5D7G A;  5AEK B;  3QQ8 B;  3OJ4 B;  4DBG A;  2C7N B;  4DHJ D;  5TR5 A;  5L83 A;  2QHO A;  2MW5 A;  1E7U A;  4RMA A;  4HCN B;  1WX9 A;  5CTR C;  5JZE B;  5CHW A;  4TV3 A;  1EF5 A;  3PHW B;  4IW0 A;  2GMI C;  1WH3 A;  2NS5 A;  3M3J A;  1SE9 A;  2M4N A;  2RD0 A;  1LXD A;  3ALB A;  3CMM B;  3JSV B;  4HPL B;  4PS8 A;  3KH0 A;  2FCM A;  2LXA A;  2BF8 B;  1V80 A;  2OOB B;  2BKR B;  2N7D A;  2NCN A;  4K7S A;  2K1F A;  2LVO A;  2N9P C;  3RCZ A;  4F1S A;  3A9J A;  2MBO A;  4PS3 A;  4XX5 A;  2MSE D;  4AUQ C;  3HM3 A;  5J18 A;  3DVN U;  2L7R A;  5EDS A;  3PV1 A;  1UBQ A;  3PPA A;  4DHJ B;  2MWS B;  3ZO5 B;  4DXA B;  2DYO A;  1LM8 B;  4E74 A;  2J0J A;  3VDZ A;  1I42 A;  1TGZ B;  3A1Q B;  4HPM B;  1WGY A;  2BYF A;  1Z5S B;  4KZC A;  1TZ1 A;  3WAP A;  2MRP A;  2LD9 A;  4GDK A;  2KVR A;  3B08 A;  3B1L X;  3DDC B;  2RPQ A;  3V60 A;  4ASW C;  4JLC A;  4AWJ A;  2GBM A;  4OVU A;  4EZJ A;  3DBS A;  2O2V B;  2A5U A;  5L95 C;  3A33 B;  1XD3 B;  3MTN B;  2G4S A;  5LLI A;  2ZPN A;  2IY1 B;  3GZN I;  3T9L A;  4F7Z A;  1RRB A;  3EFU A;  2KJR A;  3VUX A;  2JRI B;  3PRP B;  4GU2 A;  2KQ7 A;  1UZX B;  2RGF A;  2ZVN A;  4PS7 A;  3CST A;  4TUU A;  3UIP B;  4W9E A;  1V5O A;  4FJY A;  4EEW A;  2LZ6 A;  3DOW A;  4J6I A;  2JY6 A;  2ZJD A;  4BKT A;  3X23 A;  2CHZ A;  5AZF A; 
#chains in the Genus database with same CATH topology
 2KTR A;  2INC C;  4IG7 B;  4XC2 A;  4XZ4 A;  3Q3O C;  2EEL A;  1EO6 A;  4JPS A;  2PW9 A;  2NMQ A;  1LQB A;  2IGH A;  1GUA B;  3ABV B;  3GP7 A;  1BT0 A;  4FA6 A;  2K25 A;  5D94 A;  4FHJ A;  2JF5 A;  1V5T A;  1FNW A;  3H6N A;  3DBR I;  3L54 A;  3ZNH B;  2UU7 A;  2CS4 A;  4MM3 A;  3QA8 A;  2X38 A;  2DZI A;  2JXT A;  2J53 A;  2XEW A;  3BVZ A;  3H7S A;  3W2D A;  1VZ8 A;  5G2N A;  4ZRI A;  1IBX B;  5LXI B;  2DEN B;  4HKZ E;  4CO7 A;  2PJH A;  1WGD A;  1J8C A;  5G55 A;  3GB1 A;  3QAR A;  2D3C A;  2WLB A;  3ML8 A;  2KYW A;  3B0A A;  1I4X A;  1C3T A;  1IYF A;  1UUP A;  3SHQ A;  3ZNZ B;  3K9O B;  4ANW A;  1K50 A;  1YIW A;  1GAQ B;  2ZCC A;  2I1J A;  3RNA C;  2AL3 A;  2BKF A;  2E6X A;  4WQO B;  5D6J B;  2N0S B;  4B95 A;  1T0R C;  3DHG C;  2MEK A;  3DVG X;  4K3B A;  2KFJ A;  1WYW B;  5C23 A;  3GE8 C;  2FNJ B;  4LDT D;  3T8M A;  1L0V B;  4RCO A;  1E8Y A;  2IO1 B;  2FCS A;  2BTE A;  1WJ4 A;  2KXJ A;  4FBJ B;  2D07 B;  1WXM A;  3AEE B;  2M0A A;  5E6N A;  3DWM A;  4TQ1 A;  5BO4 B;  3IG3 A;  3AE8 B;  1OEY A;  2O6V B;  2ZW0 A;  4WIP A;  3DBH I;  4OW0 A;  2AEH A;  1WXQ A;  1WJN A;  2CJO A;  4REZ A;  5KHO A;  5DPW A;  1E6E B;  1GNU A;  4O1N A;  4C56 C;  2WDQ B;  3AEB B;  3AMZ A;  2Y5C A;  2L52 A;  3AE5 B;  4JQW C;  1L0X B;  2KQ4 X;  3OAW A;  3L08 A;  3RNG C;  2ZNV B;  1V1P A;  2INN E;  2QEJ C;  1VZ7 A;  2OHF A;  1A5R A;  1L4D B;  1KTK A;  1CK1 A;  2KAN A;  1P98 A;  1ZOY B;  4GDL B;  1WF9 A;  2BS3 B;  4FAD A;  4HJK A;  5GXG B;  4YT0 B;  3NRZ A;  3APD A;  4NQL B;  4K1R B;  1NEK B;  2OJR A;  3RMK C;  1WY8 A;  2MJE A;  3APC A;  3IBE A;  5KHQ A;  3RZF A;  3E56 A;  3PLV A;  2KO3 A;  1HA5 A;  2W3R A;  1C76 A;  4G3X B;  2VZK D;  3P4P B;  1T0S C;  3MP9 A;  2LGD A;  4KGT A;  2WDT B;  3SFD B;  2KX3 A;  1JML A;  3QIJ A;  1QOA A;  5G5G A;  1IUE A;  1VCB A;  1ZGU B;  4WWP A;  3R66 C;  3SFE B;  3UQB A;  2AWT A;  4I6L B;  2PPH A;  2RSU A;  3R3M A;  2LGI A;  4R3D A;  4RGT A;  2BVC A;  4ZDV A;  1UNS A;  1NDD A;  1V49 A;  2RDG A;  4DHZ B;  3A1Q A;  2ZZP B;  3LJ3 A;  1MG4 A;  3IHP C;  4P1C C;  4IWQ A;  2KFK B;  2O2V A;  1WJU A;  4LNO A;  3DBL B;  2JPH A;  1FD6 A;  4S17 A;  4FXC A;  5GMV A;  1BXT A;  4P7I A;  2C5L C;  1JWA D;  3TJP A;  4HDQ A;  2X8X X;  3KVF B;  1ACC A;  1SE2 A;  3BYT B;  4XDD A;  1WRI A;  4A9A A;  1AAR A;  3H9D A;  4WWN A;  1TKY A;  3AE4 B;  2WDV B;  2R61 A;  4WWM A;  3WIM A;  2NR2 A;  5JHB A;  4BFR A;  3ZGZ A;  1YJ1 A;  3AE3 B;  4NPN A;  2ICI A;  2JYT A;  1I7H A;  3C8Y A;  2M0X A;  4LLG M;  2PIA A;  1EWC A;  1IP9 A;  3PGE A;  2C9W B;  3ZVV A;  1JQ4 A;  1UBI A;  1WR6 E;  2LVP A;  3PZD A;  1WMH A;  4N59 A;  1N62 A;  3TIX A;  4I6P A;  2KAJ A;  2WP9 B;  1TZO A;  2XK5 A;  3JYU A;  3W9C B;  2FAZ A;  2G9H D;  1GOZ A;  2FE8 A;  3FC4 A;  2JZ3 B;  2V3N A;  3ZQ4 A;  1RFK A;  1QLB B;  4ZYN A;  4ACF A;  1BUI C;  2MA9 B;  5AUI A;  3WAL A;  1DYQ A;  2LUE A;  4XWW A;  2IGD A;  1DOY A;  2TSS A;  1IGD A;  1QOG A;  1V1P B;  2DZK A;  2BYT A;  2VH1 A;  2MH7 A;  1GJZ A;  1YOV B;  1JRP A;  2PTL A;  2D3B A;  3EFC A;  2QSD A;  2JX5 A;  2GBJ A;  1ESF A;  3RZW C;  4IM2 A;  3RUI B;  4MJS B;  3U8Z A;  4Q2J A;  3HVZ A;  4HDO A;  2KLG A;  3Q8C A;  2HTH A;  1YD8 U;  1EU3 A;  1V8C A;  4KV2 A;  1TBE A;  5BMG A;  4MH0 E;  2L32 A;  3P42 A;  1T0Y A;  2KDM A;  3ZXV A;  2FUG 1;  1UF0 A;  3CF6 E;  3E9S A;  1WWT A;  1XCQ L;  3A4R A;  5D7G A;  3QQ8 B;  3OJ4 B;  5TR5 A;  5L83 A;  2QHO A;  4RMA A;  1WX9 A;  5CHW A;  4TV3 A;  1JWB D;  3R2T A;  4IW0 A;  2I38 A;  1FNU A;  2M4N A;  3RI7 C;  4WQM A;  1LXD A;  4PS8 A;  3KH0 A;  2FCM A;  2WQY B;  2N7D A;  3ETR A;  3IAS 1;  5G5H A;  4AUQ C;  3I5J C;  1KH0 A;  4RGN A;  1ET6 A;  3DVN U;  4LK0 M;  1SB3 C;  3PV1 A;  3IXS A;  1LM8 B;  2J0J A;  3A1Q B;  1ZDV A;  3WAP A;  1MJD A;  3PZ7 A;  2KVR A;  3B08 A;  1QOB A;  3B1L X;  4JLC A;  4IOI E;  4EZJ A;  2O2V B;  5L95 C;  3A33 B;  2G4S A;  5LLI A;  2ZPN A;  3H8H A;  3VUX A;  2KQ7 A;  2RGF A;  1GB4 A;  1V5O A;  4FJY A;  3AE7 B;  2JY6 A;  1T3Q A;  2ZJD A;  2MJD A;  3FAH A;  3I57 A;  1PFD A;  1S3S G;  1H4R A;  2C7H A;  3PRZ A;  3RNC C;  5DPR A;  1PDX A;  2QDF A;  3N20 C;  2OJW A;  4LCD E;  4JX1 C;  1WIA A;  2MJ3 A;  2PEA A;  1WE6 A;  2YLM A;  1J7A A;  4LNI A;  3Q3F A;  2N1W A;  4GDK B;  3AB5 A;  2CJN A;  4MT5 A;  5E6P A;  3WAM A;  4AQ7 A;  3TBL D;  2DBY A;  3P1M A;  3UGB B;  4CYE A;  3RPF C;  3BIN A;  2DAF A;  4P6V F;  1EUV B;  2DZJ A;  5IN7 A;  1KLV A;  4EKU A;  4BKS A;  1WMH B;  1V6E A;  3IFW B;  2NPT A;  2XK5 B;  2BW2 A;  3UI3 A;  1YN4 A;  1HTO A;  5E6J A;  1P7E A;  3QK0 A;  4B0E A;  2WXI A;  1KM7 A;  1WYG A;  3GOE A;  4US9 A;  4JGH B;  4HXD A;  2WX0 A;  1MFW A;  4US8 A;  1N5W A;  2GRI A;  3DCG A;  3DBL I;  2KK8 A;  2MBH A;  3KUD B;  3I63 C;  2HJ8 A;  3NZS A;  3VQI A;  3GS2 A;  1C77 A;  4MAC A;  2O6V A;  2CHW A;  4RNA A;  4RM9 A;  1YJJ A;  1V9J A;  3OLM D;  4J3O D;  2BGF A;  3N9Y C;  2B3A A;  1YN3 A;  1C4C A;  1ZDX A;  4BAX A;  1FIQ A;  4NY0 A;  3U7Z A;  2WXQ A;  4W9F A;  4ITK A;  2D2Q A;  4E71 A;  2IY0 B;  3C0R B;  2NTT A;  1SIF A;  3W5V B;  3Q8A A;  2LJI A;  1FM0 D;  4GDL A;  2H89 B;  3M95 A;  2QCZ A;  2KWC A;  2KNB A;  2LI5 A;  4DDI D;  2GBN A;  2Z0D B;  2LMC A;  1JCK B;  1RYJ A;  3JW0 X;  4JWS C;  3R7Q A;  2AYO B;  1TTN A;  5FK9 C;  4BOZ B;  2HTM E;  1TS3 A;  3LB8 C;  2J42 A;  1OQY A;  2E3T A;  1JWM D;  3EC8 A;  3AM9 A;  4A55 A;  2LRU A;  3KLS X;  3RT3 B;  1BML C;  1M4V A;  3PT2 B;  2G1E A;  3HIZ A;  3Q8E A;  4YTP B;  2MP2 A;  1MG8 A;  3EHV A;  1RLF A;  4M8M A;  3C19 A;  2FID A;  2KJH B;  4IM3 A;  2PE9 A;  4W9C A;  4K3C A;  3NS1 A;  1OTR B;  2WXH A;  1FMA D;  3Q3J A;  1OQR A;  2IO3 B;  4DQO C;  4OVZ A;  1FCL A;  1K52 A;  3NS8 A;  3DQV A;  5IOI A;  3AE6 B;  2V3S A;  2Z8L A;  1OEY J;  4GXB A;  3ZNG C;  1P9D U;  3BK1 A;  1TY2 A;  3OJ3 A;  1WX8 A;  1LFD A;  1EF1 A;  2FCN A;  2IPK D;  3W1Y A;  4FUL A;  1PYW D;  3X0W A;  2KFK A;  2WNM A;  1JRU A;  3N32 A;  3Q2A C;  4FJV B;  4HEA 1;  2KZR A;  3NVY A;  4WJP A;  3L4P A;  2MQJ A;  1WFY A;  2BWF A;  1DGJ A;  4TKN A;  4BKG A;  4KX6 B;  2J0M A;  2GBK A;  2JU6 X;  2K8H A;  2J7Q B;  3HK0 A;  4ZRK A;  4G11 A;  1XLP A;  2NTS A;  2R2O A;  2XN9 C;  4DXF A;  2L1A A;  2V4I B;  3L17 A;  1TT5 B;  2EKI A;  3AI5 A;  3DHI C;  1K53 A;  3PRE A;  4JIO U;  1KLG D;  2IND C;  4BZA A;  2RR9 A;  2NPT B;  1EM7 A;  1S1Q B;  2Z0E B;  3LDZ E;  5IKC M;  2WXL A;  4L23 A;  1WM2 A;  4LNK A;  1E8W A;  2LVQ A;  2WWZ A;  4GN1 A;  4LNF A;  4IUM B;  4ZOH C;  2FUH B;  4W9H A;  2KHW B;  4WAA A;  5J17 A;  3QWZ B;  1ZXH A;  1Q5W B;  2N9X A;  5AZG A;  4WJN A;  4HRS A;  4RM8 A;  3DVG Y;  3FKY A;  3HUI A;  2JXX A;  2LGX A;  3P2B A;  2RDB C;  5HG2 A;  2DZM A;  2KOX A;  2WXN A;  1YQB A;  2KDI A;  1EU4 A;  1R7S A;  1PQS A;  2IO0 B;  4JL9 A;  4MEM A;  3EEC A;  4X57 B;  4KGS A;  3ZIM A;  2WHI A;  1WRD B;  1B9R A;  2KAC A;  1FPY A;  2KN5 A;  1WE7 A;  1U4A A;  4MJS A;  5LXH A;  2DYM A;  3VR8 B;  1Q1O A;  4RH6 A;  4NAW B;  1D5Z C;  3A9K A;  3MJ5 A;  2ACZ B;  1FRD A;  2J0K A;  1SJE D;  2JQR B;  1E90 A;  4YSZ B;  3ZKJ C;  1QIL A;  1ZW7 A;  3HM6 X;  1R4M B;  3CIR B;  3T3N A;  3P4S B;  1YJI A;  2ZNV C;  5EE1 A;  1TS5 A;  1YX6 B;  1L6U A;  3BVG A;  3DVN V;  2K6Q A;  4M00 A;  2MP2 B;  1SGH A;  2QIL A;  3SDL C;  4WUR A;  3PSE B;  3VRA B;  2JRH A;  4KKJ A;  3AE1 B;  2W82 A;  4YWG G;  2V4L A;  3N1X C;  3TMP B;  1R4N B;  2BT6 A;  1WXA A;  2KLC A;  3PLU A;  3DHH C;  2JSV X;  2UWQ A;  2MHJ A;  4A90 A;  1J19 A;  2JUO A;  3ECI A;  3RUL A;  5C2T B;  3VHT C;  2W3S A;  4ANU A;  3N1Z C;  2CU3 A;  4DHJ D;  4OZC A;  3AV8 A;  1UWM A;  4HCN B;  5CTR C;  3PHW B;  2GMI C;  1WH3 A;  3Q3N C;  2WXK A;  3M3J A;  1SE9 A;  4OHJ A;  2YEP F;  2RD0 A;  3P4R B;  2LXA A;  1V80 A;  4K7S A;  3AED B;  2M56 B;  3BZD B;  1C4A A;  1Q10 A;  4NAM A;  3A9J A;  2MBO A;  3HM3 A;  5EE9 A;  2GLS A;  2PLP A;  4IKG A;  2MWS B;  2GI9 A;  4HPM B;  1Z5S B;  4KZC A;  1TZ1 A;  4GDK A;  2MRP A;  2LD9 A;  3ZJU A;  3DDC B;  5BYS A;  4AWJ A;  4OVU A;  1MHX A;  3DBS A;  1ZE3 D;  1XD3 B;  2K0P A;  4P16 A;  3ZJT A;  2KVZ A;  1D4B A;  3T9L A;  3EFU A;  2KJR A;  3PRP B;  4GU2 A;  3W5U B;  3CST A;  4W9E A;  5BMH A;  3DOW A;  4D2K A;  5AZF A;  4ANX A;  4IWO A;  2KMC A;  1XQQ A;  1HE8 A;  2KJ6 A;  3RD2 A;  3NZ3 A;  1P7F A;  2DYB A;  1VRA B;  3IT4 B;  4E3C A;  2ZPY A;  4BBN F;  4DK5 A;  1L4Z B;  1TS4 A;  4TSS A;  3RN9 C;  2KC1 A;  4ZRQ A;  1N63 A;  1ZPS A;  4RFB A;  2WYQ A;  1I4R A;  1FFV A;  4GLS C;  2KQS A;  2KWD A;  2GB1 A;  1JWS D;  4ICU A;  4TQ0 A;  3A9K B;  2PKO A;  3VTV A;  4BKS D;  3NHE B;  2DWQ A;  1FFU A;  1FXT B;  1GC7 A;  3I9V 1;  3Q8F A;  2WS3 B;  1WSP A;  2Y5P A;  5HHD G;  4MEL A;  1I35 A;  4N9F 4;  1WGH A;  2LAS A;  4W9D A;  3KWV A;  5D3I B;  3VH4 B;  3AEC B;  2EKE C;  3CWI A;  5T8I A;  2JZP A;  2O6V D;  1Y56 A;  2D10 A;  5C1Z A;  5J2R A;  4GSW A;  3AEG B;  2BS2 B;  3MJW A;  1I4G A;  1L5P A;  1C1Y B;  2REX A;  3KUZ A;  1TYG B;  3VXW A;  1H8C A;  4RGO S;  3RNB C;  4FHK A;  1LGR A;  3ZLZ A;  4C7Z A;  1HZ5 A;  1I4H A;  2BYE A;  2LGY A;  4QAY A;  3RFZ B;  3I3T B;  3ML9 A;  4AJY B;  3V6C B;  2QIE B;  3ZW3 A;  1F1H A;  4LJO B;  4G0N B;  2V0G A;  3TEZ A;  3NY5 A;  5BMI A;  1ZKH A;  2D3A A;  1CMX B;  2LGS A;  3QAQ A;  4KKI A;  2SEB D;  1QT9 A;  3PO0 A;  1E5W A;  4W9J A;  1ZUD 2;  3JVZ X;  2L3Z A;  3MC9 A;  3ZTC A;  2NBU A;  2IDY A;  3M62 B;  1VJK A;  3ZNI D;  4BVU C;  3IAM 1;  2MLB A;  1SXT A;  1J0G A;  3A9J B;  1NBF C;  1F9J A;  2A4Z A;  1R4M I;  1KJT A;  4N58 A;  2ZCB A;  1MHH E;  2WU5 B;  3GE3 C;  4P1B C;  3ZTD A;  2D11 A;  2H88 B;  2AQ2 B;  3GZN B;  1UGM A;  2KC2 A;  2HJ1 A;  1X1M A;  1ZXI A;  1SJH D;  4NNJ B;  4ANV A;  4GIV A;  3AXC A;  3AN1 A;  2G4D B;  1L0Y B;  2IJ0 A;  4MSM B;  3PVL A;  3LXF A;  3FIL B;  4WJQ A;  1N6Z A;  1R4N I;  1HXY D;  2LXC A;  3P63 A;  3NOB A;  2Z59 B;  4I6N B;  2SAK A;  4KDI C;  1WGR A;  3VRB B;  1K51 A;  4DWF A;  1PUT A;  4WWO A;  1I4Q A;  4KSL C;  2CKH B;  4GGQ A;  3VUW A;  4EZL A;  2KDB A;  2M8S A;  3V05 A;  3JSV A;  2XNA C;  5E6O A;  1E10 A;  1TKG A;  4HVB A;  3KYC D;  4CQN A;  1G6J A;  4II3 B;  1Z2M A;  4WH4 A;  2LHD A;  1AW7 A;  1E7P B;  3NG0 A;  2N4F A;  3QCA A;  3V3X A;  2ON8 A;  1UD7 A;  2IBI B;  3ZXR A;  1XEE A;  1SSN A;  3ZRF A;  2G45 B;  4A8X C;  4L1B A;  1FXA A;  1L6V A;  2YEP B;  4PT5 A;  3VFK A;  3URY A;  2L0T A;  2BB5 A;  1JRO A;  4NZL B;  1JAL A;  1T5X D;  4YSY B;  1N60 A;  2KD0 A;  3NJT A;  4C4V B;  2ASQ A;  2LHE A;  2CU1 A;  4DDG D;  2N7E A;  4M02 A;  4A3P A;  4A3O A;  2NVU I;  2KMM A;  4JE3 B;  1D5X C;  4LTU A;  4NJ6 A;  2KDE B;  2WXP A;  1ET9 A;  4M01 A;  3HHM A;  1XXG A;  4NAW A;  2Y3A A;  3WA0 A;  1FO4 A;  4DXG A;  4EUT A;  2MX2 A;  2LJ5 A;  1GC6 A;  1HEZ E;  3APF A;  2IO2 B;  3AU5 A;  3KUC B;  4EOY A;  4HLE A;  5CHF A;  2GBR A;  1V97 A;  2J4X A;  3EUB 2;  3S2A A;  2I1K A;  1UGJ A;  1XLQ A;  4TMA B;  2L0F A;  2VH2 A;  3VAW A;  1QF6 A;  3SR6 A;  4ICV A;  4MGI E;  4UDU C;  2V3P A;  1F52 A;  3B2F A;  4C7Y A;  1L7Y A;  4K81 A;  3NVW A;  3VTW A;  3T3O A;  2AQ1 B;  2FCQ A;  2K6D B;  1MVK A;  1TS2 A;  5DPT A;  1KOT A;  4KDL B;  1ZP0 B;  2BYV E;  3QX1 A;  3V62 A;  4MSQ B;  2WXF A;  4IC7 B;  2W55 A;  1E8Z A;  1V86 A;  2CHX A;  3Q6B A;  2N9E B;  2MBB B;  1WGG A;  2JWZ A;  2EMS A;  2PMV A;  3U4E G;  4AJW A;  1SF0 A;  2K8B A;  5I4D A;  2K8C A;  5JH5 C;  1QKZ A;  2B76 B;  4B9K A;  3D32 A;  3TEX A;  4FN2 A;  4XGA B;  3VR9 B;  3VVW B;  2DNF A;  3TL5 A;  2M1M A;  3ZDM C;  3CSF A;  1SE4 A;  3PRM B;  3RYT A;  4BBN C;  1T6B X;  1TIF A;  1RWS A;  3M63 B;  4NJC A;  3L0W B;  3SEB A;  2BBC A;  1TY0 A;  2Y5B B;  5TSS A;  2N1V A;  4ARI A;  1M94 A;  4F8C B;  4YTN B;  3UIN B;  3LYY A;  3L16 A;  4NJ7 A;  4YSX B;  4HCP B;  4KIK B;  4RGM A;  4ZRP A;  1KLU D;  2C7N B;  4H2A A;  1E7U A;  5JZE B;  4C80 A;  1NVI D;  2AQ3 B;  3B9J A;  3MHZ A;  4N6E B;  1C9F A;  3CMM B;  3JSV B;  2WU2 B;  2N9K A;  1CZP A;  2OOB B;  2BKR B;  2NCN A;  2N9P C;  3TUO A;  4PS3 A;  1NI3 A;  2K9X A;  2MSE D;  5J18 A;  5EDS A;  1UBQ A;  4JWU C;  1SIJ A;  3PPA A;  1E9M A;  3ZO5 B;  2QJL A;  4DXA B;  3VDZ A;  1I42 A;  1TGZ B;  1MI0 A;  3V60 A;  4ASW C;  4ZHP A;  2GBM A;  4IDI A;  4KGR A;  2LEK A;  2A5U A;  1PGX A;  1F2R I;  3MTN B;  3WCQ A;  5EE0 A;  2D5G A;  3GZN I;  4F7Z A;  4PK1 A;  1J7B A;  1J7C A;  2ZVN A;  4PS7 A;  1GPX A;  4B0M A;  3UIP B;  4EEW A;  2LZ6 A;  1CJE A;  2JYE A;  3VH3 B;  2EMT A;  5DPS A;  4YXD B;  3UIO B;  3N3K B;  4IWP A;  2PE6 B;  1N61 A;  1PGA A;  2GOW A;  3NUH B;  1D6E C;  2BB6 A;  3VUY A;  1GG3 A;  5HFY A;  1PGB A;  2KTF A;  1OGW A;  1OQQ A;  1AN8 A;  1YNT E;  4MH8 A;  4AS1 A;  1JW9 D;  4C00 A;  2LUM A;  1C4P A;  2KN4 A;  3W1S A;  1ROE A;  2J52 A;  3AUL A;  5CX3 A;  4GOC A;  1WGK A;  4BOS C;  5EE3 A;  3KYD D;  2BWE S;  1TKE A;  1C78 A;  2MBQ A;  1ISN A;  1Y8R C;  1SBB B;  2DLB A;  1XO3 A;  2KTR B;  3WAO A;  2KKC A;  1YMH E;  1XLO A;  4W9G A;  3ZDT A;  3BII D;  5HI1 A;  2UYZ B;  1YX5 B;  3QC8 B;  1YN5 A;  2NBV B;  1FEH A;  1P0R A;  4PYU A;  1K8R B;  1OFF A;  2WXG A;  4MM3 B;  5DCN A;  1N5X A;  2BPS A;  2JT4 B;  3TSS A;  3U2S C;  1WJ6 A;  2JWU A;  1P3Q U;  1KF6 B;  4XWT A;  1ENF A;  3R8B A;  4HJG E;  1UH6 A;  4LNN A;  4XDC A;  5MPO A;  3PHX B;  3AE9 B;  2K39 A;  5BYQ A;  1VD2 A;  1P1A A;  3OG5 A;  4K7W A;  2QC8 A;  3QHT A;  1AWD A;  3Q8B A;  4M0W A;  4PYZ A;  3H7P A;  4GMV A;  4YL8 A;  3O65 B;  2Q5W D;  5FR6 A;  1NEN B;  1V81 A;  2KWU B;  5JXV A;  2W9N A;  4RF1 A;  5LNK 1;  1KRH A;  3FIL A;  1EWY C;  4DHZ E;  4WJO A;  2INP E;  2K5P A;  2N7J A;  4ZRJ A;  4K7U A;  4W9L A;  4ZHO A;  2M19 A;  5D2M B;  2L83 A;  5JHA A;  4MGY E;  2YVC A;  3B2G A;  3AU4 A;  2CR5 A;  3KQ4 A;  3L10 B;  5AZH A;  2WX1 A;  1SE3 A;  2RDH A;  4ARC A;  3MC8 A;  2WXJ A;  1I4P A;  2MBE A;  2WGS A;  3P4Q B;  3QJZ A;  1E7V A;  2V9H A;  1QOF A;  2I2Y A;  2ONQ A;  3U52 E;  3IVF A;  5CHV C;  2BS4 B;  4A6Q A;  2AL6 A;  3BYY B;  4NQK E;  3RNE C;  2R2Q A;  1TJE A;  3U7D A;  5FKA C;  3ZUN A;  3L13 A;  3PTF C;  2LFI A;  4MDK E;  2KX0 A;  4M8N A;  2DAJ A;  1V2Y A;  3WAN A;  1STE A;  4HRO A;  1UWX A;  1AYF A;  4XYC A;  1FNV A;  2ZW1 A;  3AEA B;  4C4V A;  1IGC A;  2L05 A;  3MFG A;  2M17 A;  1LO5 D;  2D3G A;  2PVO D;  1RFA A;  2AX5 A;  3DBR B;  2N9L A;  4IM0 A;  1YQ3 B;  5C3J B;  3TCA A;  4AOF A;  3ZRC A;  3H1U A;  4S0R A;  5IP4 D;  2MCN B;  3IT6 B;  2WDR B;  3NZU A;  1FCC C;  2IYD B;  3V6E B;  1QZE A;  4CHK A;  1WZ0 A;  3R7R A;  2WXM A;  3U30 A;  2LWP A;  1B1Z A;  2ZVO A;  3BWU D;  5AUK A;  2RPV A;  3UQA A;  1WZ3 A;  3ENE A;  3KW5 B;  5H92 C;  1F0Z A;  4FJZ A;  1GB1 A;  1WR1 A;  2KT7 A;  5IA7 A;  2KWV B;  4HPP A;  1XT9 B;  1RAX A;  1RM6 C;  2PVG C;  2IZV B;  1NYQ A;  3DWG C;  1C79 A;  4KZ0 A;  3W1S C;  2JVC A;  4EFO A;  3BY4 B;  4HK2 A;  1WX7 A;  2C7M B;  4B6W A;  4LDT B;  2FIF A;  1XF5 L;  3N30 A;  1E8X A;  2NBW B;  4OZA A;  2L8J A;  3TEW A;  1IPG A;  3SU8 X;  1HTQ A;  5H8Y E;  2QMT A;  1NI2 A;  1YQ4 B;  3VTU A;  3EA6 A;  1VZ6 A;  3NVZ A;  3BK2 A;  1FRR A;  2HDE A;  5IAA C;  3V61 A;  4EE2 A;  3EGR A;  3N1Y C;  1V1O A;  4ZYS A;  3DBH B;  1WXS A;  1HZ6 A;  1UEL A;  2G3Q B;  4M0W B;  3H7P B;  2HD5 B;  3PS6 A;  2JZZ A;  1Q0W B;  2C60 A;  3ZYY X;  3TEY A;  1HQR D;  3AE2 B;  4YTM B;  1VDV A;  3HRD D;  3ONS A;  4G50 A;  4MGK E;  1IBX A;  4HWI B;  3J9C A;  1MPE A;  4MGZ E;  1VLB A;  4AP4 C;  4W9K A;  3PZ8 A;  3MHS D;  5FR3 A;  4KIK A;  1L2N A;  2OED A;  2KMA A;  1F2R C;  2LRW A;  4W9I A;  4OVV A;  1XLN A;  1E0Z A;  2KDF B;  5HKH A;  1WI0 A;  1D5M C;  1WXV A;  4LJP B;  2DHZ A;  1WM3 A;  4EZK A;  4URK A;  2V1Y A;  2IGG A;  1KFY B;  2L00 B;  3ZJV A;  1T0Q C;  3UF8 A;  3OWE B;  1A70 A;  2VZK B;  4GB9 A;  4HKQ A;  2ZEQ A;  2K22 A;  4FLH A;  2DX5 B;  4OZB A;  2VRR B;  2HE7 A;  3R2I A;  4KVG B;  1F77 A;  4XE0 A;  4A20 A;  1D3Z A;  3K9P B;  2XBB C;  3DPD A;  4KSK C;  4WAF A;  1CQV A;  3O13 A;  4II2 B;  2K3U A;  3A4S C;  3SD5 A;  1NYR A;  2L76 A;  5BYR A;  2WXR A;  1QQR A;  5AEK B;  4DBG A;  3AH7 A;  2BQQ A;  2MW5 A;  5IO9 A;  4USA A;  1EF5 A;  2NS5 A;  1JWU D;  3MC0 B;  4L2Y A;  1SEB D;  2W54 A;  3ALB A;  4HPL B;  2BF8 B;  2WXO A;  3AEF B;  2K1F A;  2LVO A;  3RCZ A;  4F1S A;  4XX5 A;  2L7R A;  3NVV A;  3BVM A;  3Q14 C;  4DHJ B;  2DYO A;  4E74 A;  3HVD A;  4RF0 A;  1WGY A;  2BYF A;  1DOI A;  3Q69 A;  2RPQ A;  3Q3M C;  1VR9 A;  1FXI A;  3KWL A;  2IY1 B;  5D3D A;  1RRB A;  1XCT L;  2JRI B;  1UZX B;  2FBW B;  4TUU A;  2RMM A;  1DOX A;  3RNF C;  4J6I A;  4BKT A;  3X23 A;  2CHZ A; 
#chains in the Genus database with same CATH homology
 1S3S G;  3VH3 B;  1H4R A;  4IWO A;  2EMT A;  2C7H A;  2KTR A;  5DPS A;  3PRZ A;  2KMC A;  1XQQ A;  5DPR A;  4IG7 B;  4XC2 A;  1HE8 A;  4XZ4 A;  3UIO B;  3N3K B;  4LCD E;  2KJ6 A;  1WIA A;  2PEA A;  4IWP A;  1WE6 A;  2PE6 B;  2YLM A;  1EO6 A;  3RD2 A;  2GOW A;  1LQB A;  2DYB A;  3VUY A;  1GUA B;  1GG3 A;  3Q3F A;  4E3C A;  2ZPY A;  1BT0 A;  2KTF A;  1OGW A;  2N1W A;  4GDK B;  4BBN F;  4FA6 A;  2K25 A;  5D94 A;  4DK5 A;  4FHJ A;  2JF5 A;  5E6P A;  3WAM A;  3TBL D;  2KC1 A;  1V5T A;  3UGB B;  3H6N A;  4CYE A;  3W1S A;  3BIN A;  2DAF A;  2WYQ A;  3DBR I;  3L54 A;  1EUV B;  3AUL A;  2DZJ A;  3ZNH B;  2CS4 A;  4MM3 A;  1KLV A;  5CX3 A;  4GOC A;  4BOS C;  2KQS A;  4BKS A;  4EKU A;  3QA8 A;  1WMH B;  1V6E A;  2DZI A;  3IFW B;  2BWE S;  3KYD D;  2MBQ A;  1ISN A;  1Y8R C;  2XEW A;  2NPT A;  4ICU A;  2XK5 B;  4TQ0 A;  3H7S A;  2KTR B;  3WAO A;  3A9K B;  2KKC A;  3QK0 A;  3VTV A;  5G2N A;  4BKS D;  4ZRI A;  1KM7 A;  5LXI B;  2DEN B;  3NHE B;  4W9G A;  4CO7 A;  3GOE A;  2PJH A;  1WGD A;  1J8C A;  5G55 A;  3ZDT A;  3QAR A;  1FXT B;  2UYZ B;  1YX5 B;  1GC7 A;  4JGH B;  4HXD A;  2WX0 A;  3ML8 A;  3QC8 B;  3DCG A;  3DBL I;  2KK8 A;  2NBV B;  3B0A A;  2MBH A;  3KUD B;  3NZS A;  2HJ8 A;  3VQI A;  3SHQ A;  3ZNZ B;  3K9O B;  1C3T A;  1IYF A;  2O6V A;  2CHW A;  4MEL A;  1I35 A;  4N9F 4;  4ANW A;  1YIW A;  1P0R A;  2ZCC A;  4RM9 A;  1WGH A;  2I1J A;  4PYU A;  2AL3 A;  2LAS A;  4W9D A;  2BKF A;  1V9J A;  1K8R B;  4WQO B;  5D6J B;  3OLM D;  3VH4 B;  4B95 A;  2BGF A;  2EKE C;  5DCN A;  2BPS A;  2B3A A;  3DVG X;  2JT4 B;  2KFJ A;  1WYW B;  2O6V D;  5C23 A;  2D10 A;  5C1Z A;  1WJ6 A;  1P3Q U;  2FNJ B;  4NY0 A;  5J2R A;  4GSW A;  4LDT D;  3MJW A;  3T8M A;  1E8Y A;  4W9F A;  2IO1 B;  1C1Y B;  2REX A;  3KUZ A;  3VXW A;  2FCS A;  1UH6 A;  1H8C A;  2D2Q A;  4E71 A;  1WJ4 A;  2IY0 B;  3PHX B;  2KXJ A;  4FHK A;  4FBJ B;  3C0R B;  3ZLZ A;  2D07 B;  2K39 A;  1WXM A;  1SIF A;  2BYE A;  5E6N A;  1VD2 A;  1P1A A;  2LGY A;  4K7W A;  4TQ1 A;  3QHT A;  4PYZ A;  3H7P A;  5BO4 B;  3I3T B;  4GDL A;  3ML9 A;  4GMV A;  4YL8 A;  3IG3 A;  3M95 A;  3O65 B;  3V6C B;  4AJY B;  2KWC A;  5FR6 A;  2KNB A;  3ZW3 A;  4LJO B;  1OEY A;  2LI5 A;  4DDI D;  2GBN A;  2Z0D B;  4G0N B;  1V81 A;  2KWU B;  3NY5 A;  2O6V B;  2W9N A;  3DBH I;  1ZKH A;  2AEH A;  3JW0 X;  3R7Q A;  1CMX B;  2AYO B;  3QAQ A;  1WJN A;  1TTN A;  5KHO A;  4WJO A;  4BOZ B;  4DHZ E;  5DPW A;  1GNU A;  1E5W A;  4ZRJ A;  4K7U A;  4W9J A;  4W9L A;  1OQY A;  3JVZ X;  3EC8 A;  5D2M B;  2L3Z A;  5JHA A;  4MGY E;  2YVC A;  4JQW C;  2LRU A;  3ZTC A;  3AU4 A;  2NBU A;  2CR5 A;  3M62 B;  3RT3 B;  3OAW A;  3L08 A;  3PT2 B;  3L10 B;  3HIZ A;  3ZNI D;  4BVU C;  5AZH A;  2ZNV B;  2MLB A;  2WX1 A;  1J0G A;  2MP2 A;  1MG8 A;  3EHV A;  1RLF A;  3A9J B;  1NBF C;  1F9J A;  2A4Z A;  1R4M I;  1KJT A;  4M8M A;  1A5R A;  2FID A;  2KJH B;  2KAN A;  2ZCB A;  4IM3 A;  2MBE A;  1P98 A;  2PE9 A;  3ZTD A;  4W9C A;  2D11 A;  3QJZ A;  1E7V A;  1UGM A;  2KC2 A;  4GDL B;  1OTR B;  3IVF A;  5CHV C;  3Q3J A;  1X1M A;  2IO3 B;  1WF9 A;  4NNJ B;  4FAD A;  4HJK A;  4ANV A;  2AL6 A;  4GIV A;  4NQK E;  3NS8 A;  3DQV A;  2R2Q A;  3AXC A;  4MSM B;  2G4D B;  3APD A;  4NQL B;  3U7D A;  3PVL A;  4K1R B;  2V3S A;  1OEY J;  4GXB A;  2OJR A;  3ZNG C;  1WY8 A;  1P9D U;  4WJQ A;  3ZUN A;  3OJ3 A;  3L13 A;  3APC A;  3IBE A;  1WX8 A;  1LFD A;  5KHQ A;  3RZF A;  3PTF C;  3PLV A;  1R4N I;  1EF1 A;  2FCN A;  2KO3 A;  2LXC A;  3NOB A;  3W1Y A;  4FUL A;  4MDK E;  2Z59 B;  2KX0 A;  4G3X B;  4M8N A;  2DAJ A;  4I6N B;  1V2Y A;  4KDI C;  1WGR A;  3WAN A;  2LGD A;  3X0W A;  2KFK A;  2WDT B;  2KX3 A;  4DWF A;  4WWO A;  4KSL C;  2CKH B;  3QIJ A;  4GGQ A;  1JRU A;  1VCB A;  2L05 A;  3N32 A;  4FJV B;  3VUW A;  2M17 A;  1ZGU B;  4EZL A;  2KZR A;  4WJP A;  2D3G A;  2KDB A;  1RFA A;  2M8S A;  4WWP A;  3R66 C;  2MQJ A;  1WFY A;  2BWF A;  4TKN A;  4IM0 A;  4BKG A;  2J0M A;  2AWT A;  3JSV A;  4I6L B;  3TCA A;  4AOF A;  3UQB A;  2GBK A;  5E6O A;  2K8H A;  2J7Q B;  2PPH A;  3HK0 A;  2RSU A;  4G11 A;  4ZRK A;  4HVB A;  3R3M A;  3ZRC A;  3KYC D;  3H1U A;  2R2O A;  1G6J A;  4II3 B;  1Z2M A;  2MCN B;  4ZDV A;  1NDD A;  3L17 A;  2N4F A;  3NZU A;  3AI5 A;  3QCA A;  1V49 A;  2IYD B;  2IBI B;  1UD7 A;  3V6E B;  1QZE A;  3PRE A;  4JIO U;  3ZRF A;  4CHK A;  4DHZ B;  2G45 B;  1WZ0 A;  3A1Q A;  2ZZP B;  3R7R A;  3U30 A;  2LWP A;  3LJ3 A;  2RR9 A;  3IHP C;  2ZVO A;  3VFK A;  2NPT B;  1S1Q B;  2KFK B;  1WZ3 A;  2L0T A;  2O2V A;  2Z0E B;  3ENE A;  3KW5 B;  4IWQ A;  3UQA A;  1WJU A;  3LDZ E;  4FJZ A;  2KD0 A;  1WR1 A;  2JPH A;  5IA7 A;  1WM2 A;  2ASQ A;  2KWV B;  1XT9 B;  1E8W A;  5GMV A;  2LVQ A;  2CU1 A;  4P7I A;  4ANX A;  4DDG D;  2C5L C;  2N7E A;  4HDQ A;  1RAX A;  2WWZ A;  3KVF B;  4GN1 A;  3TJP A;  4A3P A;  4A3O A;  2NVU I;  4IUM B;  4NJ6 A;  2IZV B;  2KDE B;  1AAR A;  2FUH B;  3HHM A;  4KZ0 A;  4NAW A;  4W9H A;  2KHW B;  2JVC A;  3W1S C;  3WA0 A;  3BY4 B;  4HK2 A;  4EFO A;  3H9D A;  1WX7 A;  4WAA A;  2C7M B;  4EUT A;  2MX2 A;  4WWN A;  4B6W A;  5J17 A;  3QWZ B;  4LDT B;  2FIF A;  1Q5W B;  2LJ5 A;  3N30 A;  1GC6 A;  3APF A;  2IO2 B;  2N9X A;  3AU5 A;  3WIM A;  2NR2 A;  5AZG A;  5JHB A;  4WJN A;  4RM8 A;  4BFR A;  1E8X A;  1YJ1 A;  2NBW B;  3DVG Y;  3KUC B;  4EOY A;  4NPN A;  2JXX A;  4HLE A;  2L8J A;  2GBR A;  2LGX A;  5CHF A;  3P2B A;  2M0X A;  1IPG A;  2DZM A;  2KOX A;  3S2A A;  3SU8 X;  2I1K A;  1YQB A;  2KDI A;  2L0F A;  3VAW A;  1NI2 A;  1PQS A;  2IO0 B;  3VTU A;  1IP9 A;  4ICV A;  4MGI E;  3PGE A;  2C9W B;  5IAA C;  3V61 A;  3ZVV A;  1L7Y A;  4JL9 A;  4MEM A;  4K81 A;  3EEC A;  4X57 B;  3VTW A;  1UBI A;  1WR6 E;  3ZIM A;  2FCQ A;  1WXS A;  2LVP A;  3PZD A;  1WMH A;  3TIX A;  2K6D B;  5DPT A;  1WRD B;  1KOT A;  1UEL A;  2G3Q B;  4I6P A;  3H7P B;  4KDL B;  4M0W B;  2HD5 B;  3PS6 A;  2JZZ A;  2KN5 A;  2BYV E;  1Q0W B;  1WE7 A;  1U4A A;  2C60 A;  2XK5 A;  3QX1 A;  2DYM A;  4MJS A;  3V62 A;  3JYU A;  5LXH A;  4MSQ B;  4IC7 B;  2FAZ A;  1Q1O A;  4NAW B;  3A9K A;  2JZ3 B;  3ONS A;  1E8Z A;  4G50 A;  4MGK E;  2J0K A;  1E90 A;  4HWI B;  1V86 A;  3ZKJ C;  2CHX A;  4ZYN A;  1ZW7 A;  3HM6 X;  2N9E B;  2MBB B;  2MA9 B;  1WGG A;  2JWZ A;  4MGZ E;  4AP4 C;  2EMS A;  3WAL A;  2ZNV C;  4W9K A;  4AJW A;  2LUE A;  2K8B A;  1YX6 B;  3MHS D;  2K8C A;  4KIK A;  5JH5 C;  4B9K A;  1L2N A;  3D32 A;  3DVN V;  2K6Q A;  2KMA A;  4FN2 A;  2MP2 B;  2DZK A;  2LRW A;  4W9I A;  1SGH A;  3VVW B;  4OVV A;  3SDL C;  2KDF B;  3TL5 A;  1WI0 A;  5HKH A;  2M1M A;  3ZDM C;  3CSF A;  1WXV A;  1GJZ A;  3PSE B;  4LJP B;  2DHZ A;  1WM3 A;  3PRM B;  4EZK A;  2JRH A;  4URK A;  2V1Y A;  3RYT A;  4BBN C;  2V4L A;  3TMP B;  2L00 B;  2GBJ A;  3RZW C;  4IM2 A;  3RUI B;  3M63 B;  4MJS B;  3UF8 A;  3U8Z A;  4GB9 A;  1WXA A;  2ZEQ A;  4FLH A;  2DX5 B;  2KLC A;  4HDO A;  2KLG A;  2VRR B;  3L0W B;  2HE7 A;  3PLU A;  2HTH A;  4KVG B;  4A20 A;  1YD8 U;  2Y5B B;  1D3Z A;  2N1V A;  4KV2 A;  1M94 A;  1TBE A;  2XBB C;  3DPD A;  3K9P B;  4F8C B;  4KSK C;  4MH0 E;  1T0Y A;  2UWQ A;  3UIN B;  3L16 A;  1J19 A;  3CF6 E;  2JUO A;  4II2 B;  3A4S C;  4NJ7 A;  3ECI A;  3RUL A;  3VHT C;  3SD5 A;  2L76 A;  3A4R A;  4HCP B;  4KIK B;  4ANU A;  5D7G A;  5AEK B;  3QQ8 B;  3OJ4 B;  4DBG A;  2C7N B;  4DHJ D;  5TR5 A;  5L83 A;  2QHO A;  2MW5 A;  1E7U A;  4RMA A;  4HCN B;  1WX9 A;  5CTR C;  5JZE B;  5CHW A;  4TV3 A;  1EF5 A;  3PHW B;  4IW0 A;  2GMI C;  1WH3 A;  2NS5 A;  3M3J A;  1SE9 A;  2M4N A;  2RD0 A;  1LXD A;  3ALB A;  3CMM B;  3JSV B;  4HPL B;  4PS8 A;  3KH0 A;  2FCM A;  2LXA A;  2BF8 B;  1V80 A;  2OOB B;  2BKR B;  2N7D A;  2NCN A;  4K7S A;  2K1F A;  2LVO A;  2N9P C;  3RCZ A;  4F1S A;  3A9J A;  2MBO A;  4PS3 A;  4XX5 A;  2MSE D;  4AUQ C;  3HM3 A;  5J18 A;  3DVN U;  2L7R A;  5EDS A;  3PV1 A;  1UBQ A;  3PPA A;  4DHJ B;  2MWS B;  3ZO5 B;  4DXA B;  2DYO A;  1LM8 B;  4E74 A;  2J0J A;  3VDZ A;  1I42 A;  1TGZ B;  3A1Q B;  4HPM B;  1WGY A;  2BYF A;  1Z5S B;  4KZC A;  1TZ1 A;  3WAP A;  2MRP A;  2LD9 A;  4GDK A;  2KVR A;  3B08 A;  3B1L X;  3DDC B;  2RPQ A;  3V60 A;  4ASW C;  4JLC A;  4AWJ A;  2GBM A;  4OVU A;  4EZJ A;  3DBS A;  2O2V B;  2A5U A;  5L95 C;  3A33 B;  1XD3 B;  3MTN B;  2G4S A;  5LLI A;  2ZPN A;  2IY1 B;  3GZN I;  3T9L A;  4F7Z A;  1RRB A;  3EFU A;  2KJR A;  3VUX A;  2JRI B;  3PRP B;  4GU2 A;  2KQ7 A;  1UZX B;  2RGF A;  2ZVN A;  4PS7 A;  3CST A;  4TUU A;  3UIP B;  4W9E A;  1V5O A;  4FJY A;  4EEW A;  2LZ6 A;  3DOW A;  4J6I A;  2JY6 A;  2ZJD A;  4BKT A;  3X23 A;  2CHZ A;  5AZF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...