2CU1A

Solution structure of the pb1 domain of human protein kinase mekk2b
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
103
structure length
103
Chain Sequence
GSSGSSGDVRVKFEHRGEKRILQFPRPVKLEDLRSKAKIAFGQSMDLHYTNNELVIPLTTQDDLDKAVELLDRSIHMKSLKILLVINGSTQATNLEPSGPSSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitogen-activated protein kinase kinase kinase 2
publication title Solution structure of the PB1 domain of human protein kinase MEKK2b
rcsb
source organism Homo sapiens
molecule tags Transferase
total genus 15
structure length 103
sequence length 103
ec nomenclature ec 2.7.11.25: Mitogen-activated protein kinase kinase kinase.
pdb deposition date 2005-05-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00564 PB1 PB1 domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 2cu1A01
3NZUA 5E6OA 4MH0E 1P1AA 2KJRA 1E8ZA 2MP2B 2A4ZA 4X57B 3DBRI 2IY1B 4LJPB 2FCNA 4I6PA 1H4RA 2KTRA 1KJTA 2KLCA 3N3KB 4K7UA 2LJ5A 2KQ7A 2KHWB 2GOWA 2HTHA 2JRIB 3JSVB 4RM8A 1RLFA 3P2BA 4N9F4 2MWSB 1AARA 4GSWA 3R7QA 2YLMA 1LFDA 4GDLB 2IO1B 3PLVA 1IP9A 4BBNC 2CHWA 2KQSA 1WRDB 2LZ6A 4MELA 4RMAA 3ZUNA 2ZCBA 3KUCB 3VHTC 4GIVA 3U7DA 1WGGA 1WJ4A 1XD3B 2M8SA 1F9JA 2BGFA 4FULA 2WX1A 3RZFA 3UF8A 3M95A 1OQYA 3QCAA 2V4LA 2BPSA 2JZZA 4I6NB 4MGIE 2KFKA 2G4SA 2JXXA 2OJRA 3DVNU 3R66C 1XQQA 2FUHB 4ANUA 3A9JB 2N1WA 4GGQA 5G2NA 2KJ6A 1OEYJ 2CR5A 1WE6A 2K8HA 2O6VA 2Y5BB 4W9IA 4BOZB 4NNJB 2RR9A 2CHZA 1WXVA 1WJNA 3PGEA 3U8ZA 4FJZA 2LVOA 3OLMD 4URKA 3MTNB 4B95A 3TIXA 2DENB 1XT9B 2R2QA 3QC8B 4HVBA 1HE8A 4XX5A 2KMAA 4GDKB 1V9JA 2EKEC 2NBUA 2BKFA 3DDCB 4ICVA 4JL9A 3TL5A 4DHJD 4E71A 3ONSA 2JZ3B 4G11A 5DPWA 2NBVB 4OVUA 3N30A 1WM2A 1R4MI 3VTWA 3DPDA 2DHZA 2AL3A 3ALBA 3VQIA 2MCNB 4PYZA 4BKSA 1SE9A 3T8MA 2DYMA 1RFAA 2BWFA 2XEWA 3DBHI 1YJ1A 3HK0A 4MSQB 4EOYA 3A1QA 4ANVA 2K6QA 2MP2A 1WE7A 1JRUA 3K9OB 2AEHA 2KANA 2J0MA 2KX3A 2I1JA 4HJKA 4GN1A 3R7RA 3JSVA 2KDBA 3DBSA 3PPAA 3QIJA 2J7QB 2IBIB 4HK2A 2G45B 5CHVC 1E8YA 4HCPB 3ZNGC 4HXDA 2ZZPB 2ZVNA 1OTRB 2FCSA 1UBQA 2ZNVC 1UZXB 3V60A 2N9EB 3TJPA 3ZRCA 5AZGA 3VUWA 4BBNF 4W9DA 2MA9B 1EF1A 3OJ4B 3PV1A 2CS4A 3APFA 4BOSC 4DK5A 3QHTA 3EHVA 2K6DB 3A4RA 4NQKE 2ZPYA 2N9PC 4G50A 3A9JA 4NAWB 4DDID 2KC1A 2NPTB 1EF5A 2HJ8A 1KLVA 2JRHA 3PRZA 3A4SC 1BT0A 4FJVB 4KZCA 5JH5C 2N7EA 4K1RB 3EC8A 2IO3B 2C60A 2CHXA 2KK8A 1LXDA 2DAJA 1WJ6A 2LXAA 2JVCA 1OEYA 1E90A 3UQBA 1I42A 2MBHA 4BKGA 1WX9A 3QX1A 3RULA 2VRRB 4FJYA 4FBJB 3PS6A 2KLGA 4AOFA 1UD7A 3SDLC 3ZKJC 4K81A 1ZKHA 4EFOA 2PJHA 1WR6E 1LQBA 2KNBA 4F1SA 5AZFA 3AU4A 3C0RB 2EMSA 4NJ6A 4BKTA 5L95C 4MEMA 1Q5WB 3L17A 5AZHA 1C3TA 3Q3FA 1QZEA 2DZIA 3KUZA 1E8WA 2L05A 4HDQA 1H8CA 3WA0A 3ZDMC 3NZSA 4CYEA 2K8BA 4TQ0A 4HPLB 3WAOA 2GBNA 3JYUA 3CSTA 5LXHA 4TQ1A 3KYCD 2JT4B 1Y8RC 2C7HA 3L16A 2GBKA 2N1VA 5IA7A 3RT3B 1Q0WB 5DPTA 1L7YA 5G55A 2KMCA 3UINB 3VH4B 3ZLZA 3ZTCA 4EZLA 1NBFC 4KDIC 4DWFA 1WI0A 3PVLA 1WGRA 2J0KA 4FLHA 1J0GA 5JHAA 3WAPA 1M94A 3PRMB 1U4AA 3AU5A 4AP4C 5IAAC 1YD8U 2BWES 4KIKB 1T0YA 1NDDA 1WXSA 3PZDA 1K8RB 1WZ0A 4M0WB 3VXWA 3V6EB 4IUMB 4HWIB 2DZJA 3WALA 3SD5A 3HM3A 2D10A 2WDTB 2DZMA 3H7PB 4W9FA 3N32A 1V86A 4WWPA 2MX2A 1YIWA 3U30A 4K7WA 1WMHB 2RPQA 4A3PA 5LLIA 3ZNID 3Q3JA 2LRUA 2L7RA 1EO6A 3VFKA 5TR5A 1WX7A 1KOTA 3CMMB 2C7NB 3A33B 1V6EA 1S3SG 2L0FA 5JZEB 3A9KB 2GBRA 3IHPC 4K7SA 4NJ7A 2MLBA 2V1YA 4PS7A 4CO7A 4IG7B 2PPHA 2D07B 2KDIA 2RGFA 3ZDTA 3ZRFA 1A5RA 1Q1OA 5CX3A 4MGYE 3QQ8B 3ZTDA 2UWQA 2MW5A 1EUVB 4WJOA 1WYWB 4XC2A 3PHXB 5DPRA 2LVPA 2PEAA 3UIOB 4ANWA 1WM3A 1C1YB 4KDLB 2MBOA 1TZ1A 2NS5A 4GMVA 4MGZE 1YX6B 3M62B 2LD9A 2N4FA 2NVUI 4RM9A 2XK5B 3WIMA 3RYTA 3IBEA 4WWNA 3QA8A 1P3QU 4ZRKA 3BINA 4GDLA 3APCA 3RZWC 4LDTD 2M1MA 1E7UA 4MJSB 4IW0A 3RUIB 2RSUA 2IZVB 1WJUA 2UYZB 1GUAB 2LWPA 3B08A 3CF6E 1ZW7A 2ZPNA 3KH0A 3LJ3A 5CHWA 5FR6A 4FHKA 1YQBA 3GZNI 4ASWC 2BYEA 4HDOA 4II2B 2OOBB 4I6LB 2FAZA 2LGYA 2M17A 2N7DA 2Z59B 2WWZA 2K25A 4KVGB 1P0RA 2LGXA 4W9LA 3L08A 1PQSA 4DHZE 2KX0A 3DVNV 3NOBA 2NBWB 3ZW3A 4ZDVA 2I1KA 3IFWB 2ZEQA 2MSED 5HKHA 3H7PA 3KUDB 3X0WA 3ECIA 4FHJA 2LUEA 2LVQA 2Z0EB 4JLCA 3RCZA 1UBIA 3R3MA 3VUYA 3KYDD 2IY0B 5C1ZA 4II3B 2ZNVB 4PS3A 3MJWA 4GDKA 1P9DU 3A9KA 3NS8A 1V5OA 3PHWB 2HE7A 2MBBB 4J6IA 4TUUA 5J18A 1Z5SB 5JHBA 1V81A 3K9PB 1WGDA 1E5WA 2XBBC 4W9GA 3EECA 4WWOA 3VH3B 2C5LC 2MQJA 2O6VB 3PT2B 4FA6A 2LI5A 1MG8A 2GMIC 4LDTB 2AL6A 3H9DA 3PLUA 4GOCA 4BFRA 2O2VB 4HPMB 4IWQA 4G3XB 4NPNA 2KKCA 2LXCA 4LCDE 3ZNZB 4DBGA 4MSMB 3OJ3A 4F7ZA 3QWZB 2M0XA 2R2OA 2DAFA 5D6JB 1LM8B 2ZVOA 2KOXA 1TBEA 2XK5A 4W9CA 5KHOA 2FCMA 2MBEA 1WH3A 2V3SA 3VAWA 4XZ4A 2D3GA 3H7SA 3GOEA 1UGMA 2KJHB 5J2RA 1SGHA 1GNUA 2L8JA 2DX5B 2FNJB 4IWOA 2K1FA 5C23A 1G6JA 2KN5A 4KSLC 3SU8X 1UELA 4JIOU 3HHMA 1R4NI 2Z0DB 2HD5B 1IPGA 2A5UA 3IG3A 2CKHB 3JVZX 4M8MA 4W9HA 1ISNA 5D2MB 3ZO5B 3H6NA 3UGBB 2D2QA 2DYBA 2L0TA 3A1QB 3UQAA 4IM2A 1GC6A 2GBJA 2IO0B 3KW5B 3L0WB 5BO4B 1D3ZA 3D32A 2G3QB 4IM3A 1GJZA 4A20A 1OGWA 2FIFA 5EDSA 2NCNA 4TKNA 4DXAB 2L00B 1V49A 2WX0A 3PRPB 3TCAA 4NAWA 3V6CB 2NPTA 3ML8A 1WZ3A 4EKUA 1E8XA 5L83A 4WJPA 4GB9A 3UIPB 4GU2A 5LXIB 2WYQA 2KDFB 4EUTA 3SHQA 3OAWA 2DZKA 2MRPA 1WIAA 2L76A 3QJZA 4OVVA 2PE9A 3M3JA 4NY0A 3L13A 5D94A 3JW0X 3PSEB 4WJNA 5DCNA 1WF9A 4F8CB 4WJQA 3AULA 2L3ZA 2FIDA 4GXBA 2ZCCA 3WANA 2GBMA 2ASQA 1WXMA 3DCGA 4W9KA 1WXAA 3ZVVA 1WY8A 3X23A 1UH6A 3VVWB 4M8NA 3NY5A 4MGKE 2KC2A 3DBLI 3L10B 2EMTA 3CSFA 1V2YA 1VD2A 4FN2A 2O2VA 4TV3A 4P7IA 1WFYA 3W1SA 4ZRIA 3NHEB 1V5TA 2KVRA 3IVFA 2KTFA 4AJYB 3ML9A 2BKRB 3ZNHB 1NI2A 2KWVB 4EZJA 4PYUA 1TTNA 2W9NA 4EEWA 3B1LX 3ENEA 3VTUA 4CHKA 4WAAA 4MM3A 2JF5A 4BVUC 2K39A 2BF8B 2KD0A 2LASA 2M4NA 3TBLD 2O6VD 1VCBA 2BYVE 2LRWA 2JY6A 2QHOA 2KFJA 3TMPB 5DPSA 5CTRC 4DHZB 4WQOB 2RD0A 2KWCA 5D7GA 2KO3A 3AXCA 3LDZE 3ZIMA 2J0JA 4AWJA 1WR1A 4FADA 2JUOA 4E74A 4W9EA 2KDEB 2KTRB 3QARA 3VDZA 3M63B 4KIKA 2IYDB 2MBQA 4IC7B 4E3CA 3DQVA 5GMVA 2LGDA 5J17A 4IM0A 3I3TB 4KV2A 4ZYNA 1E7VA 4HCNB 1RAXA 2YVCA 3O65B 3HIZA 4MDKE 4BKSD 1YX5B 2N9XA 2ZJDA 4DDGD 2NR2A 2DYOA 3AI5A 3MHSD 4HLEA 4JGHB 4G0NB 4LJOB 4ANXA 1ZGUB 3RD2A 2KZRA 1V80A 1WMHA 4JQWC 4NQLB 3KVFB 4IWPA 4B9KA 2D11A 4A3OA 2CU1A 1J8CA 3DVGY 3WAMA 2FCQA 4KSKC 5E6PA 2KFKB 1CMXB 2AWTA 3W1SC 3VTVA 2IO2B 2JPHA 2PE6B 4DHJB 2REXA 1FXTB 1GG3A 4B6WA 3EFUA 1I35A 3W1YA 2B3AA 1S1QB 3H1UA 3APDA 1P98A 2KXJA 1TGZB 1KM7A 4YL8A 1X1MA 1GC7A 3V62A 1WX8A 4ICUA 4PS8A 3HM6X 3PREA 5CHFA 2KWUB 2C9WB 5E6NA 3QK0A 1RRBA 3QAQA 4AJWA 4KZ0A 1L2NA 4AUQC 3L54A 5AEKB 3DVGX 3T9LA 2K8CA 3S2AA 1WGHA 4W9JA 3PTFC 1SIFA 2AYOB 3V61A 1IYFA 4ZRJA 1WGYA 1Z2MA 4MJSA 2BYFA 1J19A 5KHQA 3B0AA 3DOWA 2G4DB 3VUXA 2C7MB 2JWZA 3BY4B 4EZKA
chains in the Genus database with same CATH superfamily
3NZUA 5E6OA 1P1AA 1E8ZA 2MP2B 2A4ZA 2IY1B 2WXMA 4OVZA 1T0QC 3TEWA 2BQQA 3JSVB 2KT7A 4GDLB 2GLSA 4BBNC 1QT9A 1WRDB 4MELA 4RMAA 4YXDB 3U7DA 3AEFB 3ZGZA 2SEBD 1OQYA 3QCAA 4N6EB 3BK1A 2V4LA 2KN4A 4IDIA 2KFKA 4LNOA 3SR6A 2FUHB 3A9JB 1UUPA 1SSNA 4B0MA 1OEYJ 4BOZB 2PVGC 3PZ8A 1YN3A 3UI3A 1TS2A 2LVOA 4B95A 3P4QB 1YN5A 4HVBA 1HE8A 2KMAA 3T3NA 4GDKB 3DDCB 2BKFA 3AB5A 2WP9B 3N30A 1WM2A 1R4MI 3VTWA 1FM0D 4XWTA 2DYMA 3RFZB 3DBHI 2K6QA 4ZYSA 1JRUA 1UWXA 2KX3A 2MJDA 2KDBA 3ZJUA 2LGSA 3ZNGC 1E8YA 1D4BA 2ZZPB 4NZLB 2FCSA 2N9EB 2ACZB 5AZGA 1ET6A 3VUWA 4BBNF 2H89B 4BOSC 2HTME 3QHTA 4JWUC 4NQKE 2ZPYA 1XLOA 4M00A 1IBXB 3PRZA 4KZCA 1XCQL 4DQOC 4XDCA 3EGRA 4FBJB 2LUMA 4FJYA 4Q2JA 1ZKHA 1V1PB 4ITKA 3MHZA 5L95C 3AU4A 3BWUD 4MEMA 2MJEA 3W5UB 5AZHA 3Q3FA 1IGDA 1QZEA 2ZW1A 2DZIA 1E8WA 1RWSA 2WXNA 3CSTA 2G1EA 4TQ1A 3KYCD 3L16A 1Y8RC 3Q2AC 4PT5A 1PFDA 3AE3B 4YT0B 1A70A 3ZLZA 4KDIC 4C80A 3ETRA 3PVLA 3DBLB 1J0GA 4JPSA 3U7ZA 3CWIA 2D5GA 4AP4C 5GXGB 1NDDA 4M0WB 3MP9A 4HWIB 4OZAA 4LNNA 3LXFA 2D10A 2DZMA 2MX2A 2VZKD 1ZUD2 4RF0A 1N61A 1WMHB 3KLSX 3ZNID 3Q3JA 1EO6A 3VFKA 2WDRB 2INNE 1V6EA 1YJJA 5JZEB 4K7SA 4A90A 2RDBC 3FAHA 2PPHA 2D07B 2KDIA 1L4ZB 3ZDTA 1A5RA 1VR9A 1JROA 5CX3A 3R2TA 4C7ZA 4WJOA 1WYWB 2JXTA 2LVPA 2JU6X 4US9A 2BB6A 3RYTA 3NVVA 4O1NA 3BINA 3APCA 3AH7A 5D3DA 2GI9A 2WU5B 2IZVB 2UYZB 1ZW7A 3ZXRA 5FR6A 3GZNI 1C9FA 3Q69A 1J7CA 2WWZA 1JMLA 3DVNV 3IFWB 3N1ZC 1YQ4B 3KUDB 2LVQA 3LYYA 5EE0A 2ICIA 1EWCA 1NYRA 2KDMA 2IY0B 3MJWA 3A9KA 1V5OA 1HA5A 5JHBA 2INDC 3K9PB 1WGDA 4WWOA 3B2GA 2MQJA 2O6VB 2WNMA 3KWVA 2L1AA 2GMIC 2W3RA 2ONQA 2AL6A 4LDTB 5FK9C 4BFRA 4IOIE 1VZ6A 2KKCA 2LXCA 1SB3C 3OJ3A 4F7ZA 3QWZB 2M0XA 2YEPF 2DAFA 1FCCC 2KOXA 2V3SA 2D3GA 3H7SA 1SGHA 2L8JA 2DX5B 1R4NI 2Z0DB 2HD5B 1IPGA 4W9HA 2CKHB 4M8MA 3A1QB 4IM2A 2GBJA 2IO0B 3KW5B 3L0WB 4HJGE 1N60A 1DOYA 3Q8BA 2L00B 3PRPB 2NPTA 1WZ3A 4WJPA 2UU7A 4GU2A 1VZ8A 3QJZA 1I4GA 3M3JA 5D94A 3PSEB 1SJHD 2L3ZA 2FIDA 1C4AA 2GBMA 3DBHB 2W3SA 3ZVVA 1V2YA 1VD2A 3GE3C 4A8XC 3ML9A 1NI2A 4EEWA 3ENEA 4CHKA 3AE6B 4MM3A 2K5PA 2QEJC 1WSPA 2BBCA 2M4NA 3RNCC 3TBLD 1VLBA 2BYVE 4JWSC 3TMPB 3ZYYX 5CTRC 1KTKA 1YOVB 2RD0A 4WQOB 5D7GA 4AWJA 1WR1A 3SEBA 4E74A 2LHEA 3BYTB 2WXJA 2HDEA 1QKZA 1PDXA 3VDZA 2WDQB 3B9JA 2MBQA 1FFUA 4WURA 2YVCA 3HIZA 5BYRA 1QQRA 3WCQA 3HVZA 3AN1A 4K3CA 2D3CA 4NQLB 4WWMA 4B9KA 1L4DB 1STEA 2CU1A 3DVGY 4C00A 2FCQA 1C77A 2AWTA 3W1SC 2CJNA 3U4EG 4AQ7A 1GG3A 1DOXA 3H1UA 4GLSC 1LO5D 1TGZB 1GC7A 1WGKA 4PS8A 5E6NA 4KZ0A 3O13A 2WXGA 1RFKA 4YWGG 3Q8AA 3DVGX 1SBBB 5HI1A 1ACCA 1Z2MA 1J19A 1FXIA 5KHQA 2G4DB 2C7MB 1NENB 3AV8A 1L0VB 2JWZA 3BY4B 4MH0E 1XF5L 1H4RA 2KTRA 2KLCA 2KHWB 3V05A 4H2AA 3KQ4A 3P2BA 1AARA 4GSWA 2JX5A 2YLMA 1LFDA 2IO1B 2WXHA 1ZPSA 1JRPA 1C4CA 2WQYB 2LZ6A 4PK1A 3ZUNA 2BYTA 1WGGA 3OG5A 1MPEA 2BGFA 2K3UA 1TKEA 2V4IB 3RZFA 2OJRA 3DVNU 2R61A 1N5WA 2N1WA 4GGQA 2K8HA 1TS3A 3U8ZA 2BB5A 1DOIA 3MTNB 4RFBA 1UF0A 4MH8A 2D3AA 2R2QA 1KLGD 1I4RA 3TL5A 4DHJD 4ICVA 4E71A 3ONSA 2JZ3B 3NZ3A 3GZNB 5DPWA 2DHZA 2MCNB 1SE9A 4L2YA 4ZRQA 4RH6A 3HK0A 1T0SC 2MP2A 4C4VA 1SIJA 3K9OB 2KANA 2J0MA 4HJKA 2JYTA 3JSVA 2J7QB 4HXDA 3RNEC 3P4RB 2ZVNA 4XDDA 1UBQA 2ZNVC 3V60A 1NVID 1ESFA 2MA9B 1EF1A 3AE7B 3VRBB 4LK0M 3A4RA 2D3BA 3A9JA 3W5VB 4NAWB 3N9YC 2KC1A 4A6QA 2HJ8A 3A4SC 1UNSA 2XN9C 5JH5C 2N7EA 4K1RB 3EC8A 2KK8A 4KX6B 4BAXA 2WGSA 3AE2B 2JVCA 1E90A 1NI3A 1E0ZA 1R4NB 2MBHA 4BKGA 1I42A 1WX9A 2RDGA 2VRRB 4WIPA 3PS6A 1WYGA 3FILA 4AOFA 3SDLC 4K81A 4EFOA 2PJHA 1C4PA 4WH4A 3AEAB 5AZFA 3HRDD 3BZDB 1HTQA 3KUZA 1PUTA 3NZSA 4P16A 2K8BA 4TQ0A 3WAOA 3JYUA 3VRAB 1WWTA 2C7HA 2H88B 2AX5A 3RT3B 4MACA 3MFGA 3UINB 3VH4B 3AE1B 3ZTCA 4EZLA 2BW2A 1SXTA 4DWFA 1WGRA 4FLHA 3AEEB 3WAPA 2NMQA 5I4DA 5HFYA 2BWES 5EE9A 1T0YA 4B0EA 4WQMA 1WXSA 1K8RB 3V6EB 1IBXA 2EKIA 2DZJA 4KKIA 1MFWA 2VH2A 1MG4A 1KLUD 3H7PB 4WWPA 5E6JA 1YIWA 3U30A 2RPQA 5LLIA 2LRUA 2L7RA 3R8BA 1QF6A 5TR5A 1WX7A 1KOTA 3CMMB 1NYQA 2KMMA 2MLBA 5LNK1 1V1PA 3GB1A 5D3IB 3QQ8B 2QILA 3SFDB 4XC2A 1HQRD 2PEAA 2MBOA 4RF1A 4RM9A 2QSDA 3AE4B 3IBEA 3P1MA 4WWNA 1P3QU 3BVGA 3RZWC 4LDTD 2M1MA 4IW0A 3RUIB 3MC0B 1WJUA 4A9AA 4MT5A 5HHDG 2Q5WD 2QJLA 2WXFA 2LHDA 3B08A 3Q8EA 3KH0A 3LJ3A 1TT5B 1YQBA 2Y5CA 2BYEA 4HDOA 4HRSA 1L0XB 4II2B 4I6LB 2LMCA 1T6BX 3RNBC 1I4PA 2KX0A 3OWEB 3NOBA 3DWGC 2MSED 4S17A 3ECIA 2LUEA 1AW7A 4JLCA 4LNIA 2BS3B 3KYDD 2ZNVB 1P9DU 3NS8A 1JCKB 2HE7A 2KYWA 3AEBB 4TUUA 4XGAB 4W9GA 3EECA 1J7AA 1XXGA 1ZDXA 2LI5A 1MG8A 3H9DA 2O2VB 4G3XB 4NPNA 1C78A 4DBGA 4MSMB 1UWMA 5D6JB 1LM8B 1P7EA 4W9CA 3VAWA 2MBEA 5EE1A 4FXCA 5IO9A 2KJHB 1TY0A 2FNJB 2K1FA 2KN5A 4KSLC 3SU8X 3HHMA 3IG3A 2A5UA 3C8YA 2W55A 5BO4B 1GC6A 2Z8LA 1D3ZA 1YN4A 3D32A 1GJZA 1FXAA 1OGWA 2N0SB 1B9RA 3TEXA 2MH7A 3TCAA 2BTEA 3ML8A 2KVZA 3UIPB 5LXIB 2WYQA 2DWQA 4EUTA 4ARIA 2DZKA 2MEKA 1WIAA 2JSVX 4KKJA 3L13A 5G5GA 2LFIA 4F8CB 1WXMA 3DCGA 4AS1A 1WXAA 3VVWB 1LGRA 5IP4D 3NY5A 2PLPA 1L5PA 1WFYA 3RMKC 2KVRA 3IVFA 2KTFA 4AJYB 2BKRB 1TTNA 3VTUA 1E9MA 2W54A 4WAAA 3CIRB 2JF5A 2BF8B 1YNTE 1L0YB 4QAYA 3ZJVA 5DPSA 2JWUA 3GS2A 3ZIMA 1CZPA 2KDEB 3M63B 4KIKA 5GMVA 4IM0A 4KV2A 4P1BC 1RAXA 4HEA1 2B76B 3IAM1 1YX5B 4YSXB 3AI5A 1XLQA 4LJOB 4ANXA 1SE4A 1V80A 1FRRA 1N62A 2KQ4X 1XLPA 4IWPA 3H8HA 2D11A 1J8CA 3WAMA 4ARCA 1JWMD 2JPHA 4B6WA 3W1YA 2B3AA 2INCC 3APDA 1P98A 3I63C 1KM7A 3EFCA 3V62A 4DXGA 5CHFA 3HM6X 1N5XA 1V8CA 2C9WB 4JX1C 3QK0A 4C7YA 3SFEB 4USAA 2FE8A 2K8CA 3S2AA 4ACFA 1DYQA 2IDYA 3PTFC 1SIFA 3V61A 4ZRJA 3AECB 4MJSA 4KGRA 4L1BA 3HUIA 1FRDA 2ON8A 2KJRA 4X57B 2FCNA 4YSYB 1KJTA 2KQ7A 1TKGA 2HTHA 2JRIB 1RLFA 1IP9A 2TSSA 2CHWA 2KQSA 2WU2B 3AMZA 1TS5A 2EELA 1WJ4A 1XD3B 2RMMA 4IKGA 1GAQB 2WX1A 2W82A 2BPSA 2JZZA 1UGJA 4I6NB 1ZXIA 3KWLA 2G4SA 3R66C 3DHIC 1XQQA 1AN8A 5G2NA 3VR9B 2DNFA 2CR5A 1WE6A 2Y5BB 1WXVA 1WJNA 3PGEA 4FJZA 3OLMD 3NVZA 4HROA 2DENB 1XT9B 3QC8B 1WXQA 1N63A 4XX5A 1V9JA 2EKEC 2NBUA 4JL9A 1HTOA 4HKZE 4OVUA 3TUOA 3AE5B 1YMHE 1IGCA 4CQNA 3T8MA 5BMIA 1RFAA 2BWFA 2XEWA 4MSQB 3U2SC 4LTUA 4ANVA 3TSSA 1WE7A 2AEHA 1ZOYB 3QIJA 3DBSA 3PPAA 2G45B 5CHVC 4HCPB 3IT6B 1OTRB 3ZRCA 1KH0A 4W9DA 5MPOA 2VZKB 3PV1A 1BUIC 2BS4B 2CS4A 3APFA 4DK5A 3DHGC 1T5XD 4G50A 2N9PC 5H92C 5BYQA 1SEBD 4P6VF 5C2TB 4DDID 2NPTB 1EF5A 1KLVA 1BT0A 4FJVB 2LJIA 3Q3NC 2IO3B 3W2DA 2AQ2B 4XE0A 4TSSA 1WJ6A 2LXAA 2CU3A 1VJKA 1QOAA 1PYWD 2KLGA 2OEDA 4OZBA 2XNAC 1LQBA 4F1SA 4L23A 4BKTA 3ABVB 1EU3A 1OQRA 1Q5WB 3L17A 1RM6C 3R2IA 2WXKA 2V0GA 2L05A 4HDQA 3WA0A 1TJEA 4RGOS 3ZDMC 4CYEA 4HPLB 1DGJA 2JT4B 4HPPA 3NRZA 2WDVB 3RNGC 1V97A 2GBKA 2PTLA 2WLBA 1I4HA 1QLBB 4DXFA 1JWUD 1L7YA 5G55A 2KMCA 5JXVA 1FNUA 4OW0A 3Q8FA 5JHAA 4JE3B 1BXTA 1U4AA 3AU5A 5IAAC 3PZDA 1FIQA 2VH1A 1GOZA 2QC8A 3SD5A 3HM3A 3WALA 4US8A 1RYJA 2WDTB 2K22A 1I4XA 4ZOHC 4NJCA 3A33B 3IHPC 2GBRA 4NJ7A 2LGIA 3VR8B 5TSSA 1QOFA 2DLBA 2RGFA 2CJOA 2MJ3A 1XCTL 2K0PA 2UWQA 1EUVB 1ZDVA 3NVWA 5DPRA 3UIOB 4ANWA 1WM3A 1C1YB 1JWBD 4KDLB 4KGTA 1TZ1A 1J7BA 2NS5A 4GMVA 4MGZE 1YX6B 3M62B 2LD9A 2NVUI 2XK5B 3QA8A 4GDLA 1V1OA 3N20C 1E7UA 3N1YC 2GRIA 1E10A 1K53A 1WRIA 3CF6E 2AQ1B 5CHWA 4ASWC 5AUIA 2FAZA 1D5MC 2M17A 1TS4A 1BMLC 2Z59B 1P0RA 1CJEA 2LGXA 4W9LA 3L08A 1FD6A 4DHZE 3ZW3A 5HKHA 3H7PA 4FHJA 3DWMA 2Z0EB 3RCZA 3AM9A 3VUYA 1Y56A 1E7PB 4II3B 1MHXA 4GDKA 1XEEA 4J6IA 2MBBB 1V81A 1YQ3B 2BT6A 1E5WA 3AE8B 3PLUA 4GOCA 3ZXVA 2JZPA 3MC9A 1T0RC 3ZNZB 2R2OA 2G9HD 4N59A 1TBEA 5KHOA 1WH3A 3GOEA 2PMVA 1UGMA 2IPKD 5J2RA 1GNUA 1MJDA 1G6JA 1UELA 4JIOU 3GP7A 5D2MB 3H6NA 2D2QA 1MVKA 1OQQA 2DYBA 2L0TA 3UQAA 4C4VB 4IM3A 4S0RA 4A20A 2FIFA 5EDSA 2NCNA 4DXAB 2KWDA 2N9LA 3Q3OC 5L83A 1QILA 3URYA 3OAWA 2L76A 4OVVA 2PE9A 3MJ5A 4NY0A 4WJNA 5DCNA 1WF9A 3I5JC 2FBWB 2ZCCA 4GXBA 3WANA 1JWAD 2PIAA 2MHJA 1WY8A 1UH6A 4ZHOA 2KC2A 2EMTA 2OHFA 4FN2A 3PZ7A 2O2VA 1SE3A 2QCZA 3LB8C 1FNWA 1FPYA 1V5TA 3ZNHB 4EZJA 4PYUA 2W9NA 4WAFA 3FILB 4BVUC 2GB1A 2ZW0A 2KD0A 2LASA 1VDVA 2O6VD 2WXPA 1VCBA 3Q6BA 4YTPB 2JY6A 2QHOA 1R7SA 4DHZB 3V3XA 2KWCA 2QIEB 3LDZE 1HZ6A 4W9EA 3J9CA 1JQ4A 2N7JA 3QARA 4M0WA 5C3JB 4IC7B 3DQVA 3P4PB 1PGXA 4ZYNA 5BYSA 1E7VA 3O65B 4LNFA 4BKSD 2N9XA 3MHSD 2DBYA 4JQWC 1WMHA 2BS2B 3RI7C 4HKQA 5E6PA 2KFKB 1CMXB 1HXYD 3NVYA 4DHJB 2PE6B 1FXTB 4YTNB 5BMHA 3EFUA 1S1QB 1SF0A 1F0ZA 2KXJA 1X1MA 4YSZB 4J3OD 1WX8A 4ICUA 3E9SA 1K50A 2KWUB 2RPVA 3DHHC 3QAQA 1I4QA 5EE3A 2NTTA 3L54A 1TIFA 3T9LA 3IAS1 2QDFA 4W9JA 3RPFC 2AYOB 1IYFA 2Y3AA 2M0AA 2BYFA 3B0AA 3VUXA 1MHHE 4EZKA 1E6EB 3DBRI 3MC8A 4LJPB 4I6PA 4ZHPA 3N3KB 4K7UA 2WXIA 2LJ5A 2GOWA 4RM8A 1TKYA 4N9F4 2MWSB 3R7QA 1JALA 5HG2A 3PLVA 2ZCBA 3KUCB 3VHTC 4GIVA 1YJIA 2V3PA 3BVMA 2M8SA 1F9JA 4FULA 3UF8A 3M95A 4MGIE 2JXXA 3FC4A 4ANUA 2KJ6A 2WS3B 2O6VA 4W9IA 2BVCA 4NNJB 2RR9A 2JQRB 2CHZA 1JW9D 4URKA 3TIXA 3GE8C 3AEGB 2QMTA 3I57A 4G11A 2NBVB 1NEKB 3DPDA 3IXSA 3N1XC 2AL3A 3ALBA 3VQIA 4PYZA 4BKSA 1KFYB 1YJ1A 4ZRPA 4EOYA 3A1QA 2OJWA 3T3OA 2I1JA 4GN1A 3R7RA 1ROEA 2IBIB 4HK2A 3ZQ4A 1TY2A 3L4PA 1F77A 4XYCA 1UZXB 3TJPA 1VRAB 2K9XA 1TYGB 3TEYA 1TZOA 5FR3A 3NUHB 4P1CC 1D5ZC 1L6UA 3OJ4B 1ET9A 2X38A 3EHVA 2K6DB 1M4VA 2JRHA 3ZJTA 4RCOA 4A55A 2C60A 2CHXA 2PKOA 1LXDA 2DAJA 4M02A 1F2RI 1OEYA 3UQBA 3QX1A 3RULA 1GB4A 1L6VA 2WXQA 1UD7A 3ZKJC 4TMAB 1WR6E 2KNBA 1D6EC 2E3TA 3C0RB 2EMSA 4NJ6A 1KRHA 1C3TA 3U52E 1H8CA 5FKAC 4YTMB 2RDHA 2M19A 2GBNA 2V3NA 5LXHA 2E6XA 5G5HA 2M56B 2N1VA 5IA7A 1EM7A 1Q0WB 5DPTA 1C79A 1NBFC 1WI0A 2J0KA 1M94A 3PRMB 1YD8U 4KIKB 3VXWA 2I2YA 1WZ0A 2PVOD 5IKCM 4IUMB 1CQVA 1K51A 3EA6A 3Q8CA 4W9FA 3N32A 1V86A 4K7WA 1R4MB 4A3PA 1EWYC 2IGGA 2INPE 2C7NB 4N58A 1B1ZA 2X8XX 1S3SG 2L0FA 3A9KB 4XWWA 2L83A 2V1YA 4PS7A 4CO7A 4IG7B 3ZRFA 2PW9A 1Q1OA 3NJTA 4MGYE 3ZTDA 1ZXHA 2LEKA 1FFVA 4OHJA 2MW5A 1IUEA 4RNAA 1PGBA 1F2RC 3I9V1 3PHXB 3Q14C 4R3DA 1Q10A 2N4FA 2WHIA 5H8YE 3W9CB 3WIMA 4ZRKA 3E56A 3C19A 4MJSB 1T3QA 3AE9B 2RSUA 3BIID 1GUAB 2LWPA 2ZPNA 4FHKA 4BZAA 3FKYA 2OOBB 2IJ0A 2LGYA 2N7DA 4D2KA 2K25A 4KVGB 5AUKA 2YEPB 3Q3MC 1PQSA 2NBWB 4ZDVA 2I1KA 1FNVA 2ZEQA 1XO3A 3X0WA 2J42A 4UDUC 1UBIA 3R3MA 5C1ZA 4PS3A 3PHWB 1AYFA 5J18A 1Z5SB 1F1HA 3P63A 3DBRB 2XBBC 3VH3B 2C5LC 2WXLA 2WXOA 3PT2B 4FA6A 1SJED 4HPMB 4IWQA 4M01A 3P42A 3HVDA 4LCDE 1KF6B 3RNFC 4LNKA 3NS1A 2ZVOA 2XK5A 4MM3B 3RNAC 2FCMA 4XZ4A 1FCLA 2KAJA 2KACA 5T8IA 4IWOA 2NTSA 5C23A 2IGDA 5IOIA 4K3BA 3JVZX 1ISNA 2J4XA 3P4SB 3AEDB 1OFFA 3ZO5B 3UGBB 1P7FA 2G3QB 3BYYB 1VZ7A 3EUB2 4RGMA 4TKNA 1V49A 2WX0A 4NAWA 3V6CB 4EKUA 1E8XA 4GB9A 4C56C 2V9HA 2KDFB 3SHQA 3BK2A 2J52A 2MRPA 1MI0A 3PO0A 3JW0X 3TEZA 2SAKA 4WJQA 3AULA 1CK1A 1GB1A 1SE2A 2L52A 2ASQA 2JYEA 4W9KA 3X23A 4M8NA 4MGKE 4NAMA 3DBLI 3NG0A 3L10B 3CSFA 4TV3A 4P7IA 3W1SA 4ZRIA 3NHEB 2KWVB 3B1LX 4OZCA 5BMGA 2AQ3B 2K39A 1QOBA 2LRWA 2KFJA 5IN7A 2HJ1A 2KO3A 3AXCA 2J0JA 4FADA 2L32A 2JUOA 1ZP0B 4REZA 1JWSD 1ZE3D 1XLNA 1FO4A 3IT4B 2KTRB 2IYDB 4E3CA 1C76A 2LGDA 2J53A 3I3TB 4HCNB 4MDKE 2ZJDA 4DDGD 2NR2A 2DYOA 4HLEA 4JGHB 1PGAA 4RGTA 3B2FA 2FUG1 4G0NB 1ZGUB 3RD2A 2KZRA 1I7HA 1D5XC 3KVFB 1GPXA 4A3OA 4KGSA 1EU4A 2I38A 4KSKC 3VTVA 2IO2B 2REXA 1HZ5A 1I35A 4RGNA 2Y5PA 1ENFA 1N6ZA 4LLGM 1AWDA 1FEHA 4YL8A 1HEZE 3PREA 1QOGA 1RRBA 4AJWA 1K52A 1L2NA 4AUQC 5AEKB 1WGHA 2WXRA 4EE2A 2IGHA 1WGYA 3BVZA 2N9KA 3RN9C 3DOWA 1FMAD 1F52A 5J17A
chains in the Genus database with same CATH topology
3NZUA 5E6OA 4MH0E 1P1AA 2KJRA 1E8ZA 2MP2B 2A4ZA 4X57B 3DBRI 2IY1B 4LJPB 2FCNA 4I6PA 1H4RA 2KTRA 1KJTA 2KLCA 3N3KB 4K7UA 2LJ5A 2KQ7A 2KHWB 2GOWA 2HTHA 2JRIB 3JSVB 4RM8A 1RLFA 3P2BA 4N9F4 2MWSB 1AARA 4GSWA 3R7QA 2YLMA 1LFDA 4GDLB 2IO1B 3PLVA 1IP9A 4BBNC 2CHWA 2KQSA 1WRDB 2LZ6A 4MELA 4RMAA 3ZUNA 2ZCBA 3KUCB 3VHTC 4GIVA 3U7DA 1WGGA 1WJ4A 1XD3B 2M8SA 1F9JA 2BGFA 4FULA 2WX1A 3RZFA 3UF8A 3M95A 1OQYA 3QCAA 2V4LA 2BPSA 2JZZA 4I6NB 4MGIE 2KFKA 2G4SA 2JXXA 2OJRA 3DVNU 3R66C 1XQQA 2FUHB 4ANUA 3A9JB 2N1WA 4GGQA 5G2NA 2KJ6A 1OEYJ 2CR5A 1WE6A 2K8HA 2O6VA 2Y5BB 4W9IA 4BOZB 4NNJB 2RR9A 2CHZA 1WXVA 1WJNA 3PGEA 3U8ZA 4FJZA 2LVOA 3OLMD 4URKA 3MTNB 4B95A 3TIXA 2DENB 1XT9B 2R2QA 3QC8B 4HVBA 1HE8A 4XX5A 2KMAA 4GDKB 1V9JA 2EKEC 2NBUA 2BKFA 3DDCB 4ICVA 4JL9A 3TL5A 4DHJD 4E71A 3ONSA 2JZ3B 4G11A 5DPWA 2NBVB 4OVUA 3N30A 1WM2A 1R4MI 3VTWA 3DPDA 2DHZA 2AL3A 3ALBA 3VQIA 2MCNB 4PYZA 4BKSA 1SE9A 3T8MA 2DYMA 1RFAA 2BWFA 2XEWA 3DBHI 1YJ1A 3HK0A 4MSQB 4EOYA 3A1QA 4ANVA 2K6QA 2MP2A 1WE7A 1JRUA 3K9OB 2AEHA 2KANA 2J0MA 2KX3A 2I1JA 4HJKA 4GN1A 3R7RA 3JSVA 2KDBA 3DBSA 3PPAA 3QIJA 2J7QB 2IBIB 4HK2A 2G45B 5CHVC 1E8YA 4HCPB 3ZNGC 4HXDA 2ZZPB 2ZVNA 1OTRB 2FCSA 1UBQA 2ZNVC 1UZXB 3V60A 2N9EB 3TJPA 3ZRCA 5AZGA 3VUWA 4BBNF 4W9DA 2MA9B 1EF1A 3OJ4B 3PV1A 2CS4A 3APFA 4BOSC 4DK5A 3QHTA 3EHVA 2K6DB 3A4RA 4NQKE 2ZPYA 2N9PC 4G50A 3A9JA 4NAWB 4DDID 2KC1A 2NPTB 1EF5A 2HJ8A 1KLVA 2JRHA 3PRZA 3A4SC 1BT0A 4FJVB 4KZCA 5JH5C 2N7EA 4K1RB 3EC8A 2IO3B 2C60A 2CHXA 2KK8A 1LXDA 2DAJA 1WJ6A 2LXAA 2JVCA 1OEYA 1E90A 3UQBA 1I42A 2MBHA 4BKGA 1WX9A 3QX1A 3RULA 2VRRB 4FJYA 4FBJB 3PS6A 2KLGA 4AOFA 1UD7A 3SDLC 3ZKJC 4K81A 1ZKHA 4EFOA 2PJHA 1WR6E 1LQBA 2KNBA 4F1SA 5AZFA 3AU4A 3C0RB 2EMSA 4NJ6A 4BKTA 5L95C 4MEMA 1Q5WB 3L17A 5AZHA 1C3TA 3Q3FA 1QZEA 2DZIA 3KUZA 1E8WA 2L05A 4HDQA 1H8CA 3WA0A 3ZDMC 3NZSA 4CYEA 2K8BA 4TQ0A 4HPLB 3WAOA 2GBNA 3JYUA 3CSTA 5LXHA 4TQ1A 3KYCD 2JT4B 1Y8RC 2C7HA 3L16A 2GBKA 2N1VA 5IA7A 3RT3B 1Q0WB 5DPTA 1L7YA 5G55A 2KMCA 3UINB 3VH4B 3ZLZA 3ZTCA 4EZLA 1NBFC 4KDIC 4DWFA 1WI0A 3PVLA 1WGRA 2J0KA 4FLHA 1J0GA 5JHAA 3WAPA 1M94A 3PRMB 1U4AA 3AU5A 4AP4C 5IAAC 1YD8U 2BWES 4KIKB 1T0YA 1NDDA 1WXSA 3PZDA 1K8RB 1WZ0A 4M0WB 3VXWA 3V6EB 4IUMB 4HWIB 2DZJA 3WALA 3SD5A 3HM3A 2D10A 2WDTB 2DZMA 3H7PB 4W9FA 3N32A 1V86A 4WWPA 2MX2A 1YIWA 3U30A 4K7WA 1WMHB 2RPQA 4A3PA 5LLIA 3ZNID 3Q3JA 2LRUA 2L7RA 1EO6A 3VFKA 5TR5A 1WX7A 1KOTA 3CMMB 2C7NB 3A33B 1V6EA 1S3SG 2L0FA 5JZEB 3A9KB 2GBRA 3IHPC 4K7SA 4NJ7A 2MLBA 2V1YA 4PS7A 4CO7A 4IG7B 2PPHA 2D07B 2KDIA 2RGFA 3ZDTA 3ZRFA 1A5RA 1Q1OA 5CX3A 4MGYE 3QQ8B 3ZTDA 2UWQA 2MW5A 1EUVB 4WJOA 1WYWB 4XC2A 3PHXB 5DPRA 2LVPA 2PEAA 3UIOB 4ANWA 1WM3A 1C1YB 4KDLB 2MBOA 1TZ1A 2NS5A 4GMVA 4MGZE 1YX6B 3M62B 2LD9A 2N4FA 2NVUI 4RM9A 2XK5B 3WIMA 3RYTA 3IBEA 4WWNA 3QA8A 1P3QU 4ZRKA 3BINA 4GDLA 3APCA 3RZWC 4LDTD 2M1MA 1E7UA 4MJSB 4IW0A 3RUIB 2RSUA 2IZVB 1WJUA 2UYZB 1GUAB 2LWPA 3B08A 3CF6E 1ZW7A 2ZPNA 3KH0A 3LJ3A 5CHWA 5FR6A 4FHKA 1YQBA 3GZNI 4ASWC 2BYEA 4HDOA 4II2B 2OOBB 4I6LB 2FAZA 2LGYA 2M17A 2N7DA 2Z59B 2WWZA 2K25A 4KVGB 1P0RA 2LGXA 4W9LA 3L08A 1PQSA 4DHZE 2KX0A 3DVNV 3NOBA 2NBWB 3ZW3A 4ZDVA 2I1KA 3IFWB 2ZEQA 2MSED 5HKHA 3H7PA 3KUDB 3X0WA 3ECIA 4FHJA 2LUEA 2LVQA 2Z0EB 4JLCA 3RCZA 1UBIA 3R3MA 3VUYA 3KYDD 2IY0B 5C1ZA 4II3B 2ZNVB 4PS3A 3MJWA 4GDKA 1P9DU 3A9KA 3NS8A 1V5OA 3PHWB 2HE7A 2MBBB 4J6IA 4TUUA 5J18A 1Z5SB 5JHBA 1V81A 3K9PB 1WGDA 1E5WA 2XBBC 4W9GA 3EECA 4WWOA 3VH3B 2C5LC 2MQJA 2O6VB 3PT2B 4FA6A 2LI5A 1MG8A 2GMIC 4LDTB 2AL6A 3H9DA 3PLUA 4GOCA 4BFRA 2O2VB 4HPMB 4IWQA 4G3XB 4NPNA 2KKCA 2LXCA 4LCDE 3ZNZB 4DBGA 4MSMB 3OJ3A 4F7ZA 3QWZB 2M0XA 2R2OA 2DAFA 5D6JB 1LM8B 2ZVOA 2KOXA 1TBEA 2XK5A 4W9CA 5KHOA 2FCMA 2MBEA 1WH3A 2V3SA 3VAWA 4XZ4A 2D3GA 3H7SA 3GOEA 1UGMA 2KJHB 5J2RA 1SGHA 1GNUA 2L8JA 2DX5B 2FNJB 4IWOA 2K1FA 5C23A 1G6JA 2KN5A 4KSLC 3SU8X 1UELA 4JIOU 3HHMA 1R4NI 2Z0DB 2HD5B 1IPGA 2A5UA 3IG3A 2CKHB 3JVZX 4M8MA 4W9HA 1ISNA 5D2MB 3ZO5B 3H6NA 3UGBB 2D2QA 2DYBA 2L0TA 3A1QB 3UQAA 4IM2A 1GC6A 2GBJA 2IO0B 3KW5B 3L0WB 5BO4B 1D3ZA 3D32A 2G3QB 4IM3A 1GJZA 4A20A 1OGWA 2FIFA 5EDSA 2NCNA 4TKNA 4DXAB 2L00B 1V49A 2WX0A 3PRPB 3TCAA 4NAWA 3V6CB 2NPTA 3ML8A 1WZ3A 4EKUA 1E8XA 5L83A 4WJPA 4GB9A 3UIPB 4GU2A 5LXIB 2WYQA 2KDFB 4EUTA 3SHQA 3OAWA 2DZKA 2MRPA 1WIAA 2L76A 3QJZA 4OVVA 2PE9A 3M3JA 4NY0A 3L13A 5D94A 3JW0X 3PSEB 4WJNA 5DCNA 1WF9A 4F8CB 4WJQA 3AULA 2L3ZA 2FIDA 4GXBA 2ZCCA 3WANA 2GBMA 2ASQA 1WXMA 3DCGA 4W9KA 1WXAA 3ZVVA 1WY8A 3X23A 1UH6A 3VVWB 4M8NA 3NY5A 4MGKE 2KC2A 3DBLI 3L10B 2EMTA 3CSFA 1V2YA 1VD2A 4FN2A 2O2VA 4TV3A 4P7IA 1WFYA 3W1SA 4ZRIA 3NHEB 1V5TA 2KVRA 3IVFA 2KTFA 4AJYB 3ML9A 2BKRB 3ZNHB 1NI2A 2KWVB 4EZJA 4PYUA 1TTNA 2W9NA 4EEWA 3B1LX 3ENEA 3VTUA 4CHKA 4WAAA 4MM3A 2JF5A 4BVUC 2K39A 2BF8B 2KD0A 2LASA 2M4NA 3TBLD 2O6VD 1VCBA 2BYVE 2LRWA 2JY6A 2QHOA 2KFJA 3TMPB 5DPSA 5CTRC 4DHZB 4WQOB 2RD0A 2KWCA 5D7GA 2KO3A 3AXCA 3LDZE 3ZIMA 2J0JA 4AWJA 1WR1A 4FADA 2JUOA 4E74A 4W9EA 2KDEB 2KTRB 3QARA 3VDZA 3M63B 4KIKA 2IYDB 2MBQA 4IC7B 4E3CA 3DQVA 5GMVA 2LGDA 5J17A 4IM0A 3I3TB 4KV2A 4ZYNA 1E7VA 4HCNB 1RAXA 2YVCA 3O65B 3HIZA 4MDKE 4BKSD 1YX5B 2N9XA 2ZJDA 4DDGD 2NR2A 2DYOA 3AI5A 3MHSD 4HLEA 4JGHB 4G0NB 4LJOB 4ANXA 1ZGUB 3RD2A 2KZRA 1V80A 1WMHA 4JQWC 4NQLB 3KVFB 4IWPA 4B9KA 2D11A 4A3OA 2CU1A 1J8CA 3DVGY 3WAMA 2FCQA 4KSKC 5E6PA 2KFKB 1CMXB 2AWTA 3W1SC 3VTVA 2IO2B 2JPHA 2PE6B 4DHJB 2REXA 1FXTB 1GG3A 4B6WA 3EFUA 1I35A 3W1YA 2B3AA 1S1QB 3H1UA 3APDA 1P98A 2KXJA 1TGZB 1KM7A 4YL8A 1X1MA 1GC7A 3V62A 1WX8A 4ICUA 4PS8A 3HM6X 3PREA 5CHFA 2KWUB 2C9WB 5E6NA 3QK0A 1RRBA 3QAQA 4AJWA 4KZ0A 1L2NA 4AUQC 3L54A 5AEKB 3DVGX 3T9LA 2K8CA 3S2AA 1WGHA 4W9JA 3PTFC 1SIFA 2AYOB 3V61A 1IYFA 4ZRJA 1WGYA 1Z2MA 4MJSA 2BYFA 1J19A 5KHQA 3B0AA 3DOWA 2G4DB 3VUXA 2C7MB 2JWZA 3BY4B 4EZKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NZU A;  5E6O A;  4MH0 E;  1P1A A;  2KJR A;  1E8Z A;  2MP2 B;  2A4Z A;  4X57 B;  3DBR I;  2IY1 B;  4LJP B;  2FCN A;  4I6P A;  1H4R A;  2KTR A;  1KJT A;  2KLC A;  3N3K B;  4K7U A;  2LJ5 A;  2KQ7 A;  2KHW B;  2GOW A;  2HTH A;  2JRI B;  3JSV B;  4RM8 A;  1RLF A;  3P2B A;  4N9F 4;  2MWS B;  1AAR A;  4GSW A;  3R7Q A;  2YLM A;  1LFD A;  4GDL B;  2IO1 B;  3PLV A;  1IP9 A;  4BBN C;  2CHW A;  2KQS A;  1WRD B;  2LZ6 A;  4MEL A;  4RMA A;  3ZUN A;  2ZCB A;  3KUC B;  3VHT C;  4GIV A;  3U7D A;  1WGG A;  1WJ4 A;  1XD3 B;  2M8S A;  1F9J A;  2BGF A;  4FUL A;  2WX1 A;  3RZF A;  3UF8 A;  3M95 A;  1OQY A;  3QCA A;  2V4L A;  2BPS A;  2JZZ A;  4I6N B;  4MGI E;  2KFK A;  2G4S A;  2JXX A;  2OJR A;  3DVN U;  3R66 C;  1XQQ A;  2FUH B;  4ANU A;  3A9J B;  2N1W A;  4GGQ A;  5G2N A;  2KJ6 A;  1OEY J;  2CR5 A;  1WE6 A;  2K8H A;  2O6V A;  2Y5B B;  4W9I A;  4BOZ B;  4NNJ B;  2RR9 A;  2CHZ A;  1WXV A;  1WJN A;  3PGE A;  3U8Z A;  4FJZ A;  2LVO A;  3OLM D;  4URK A;  3MTN B;  4B95 A;  3TIX A;  2DEN B;  1XT9 B;  2R2Q A;  3QC8 B;  4HVB A;  1HE8 A;  4XX5 A;  2KMA A;  4GDK B;  1V9J A;  2EKE C;  2NBU A;  2BKF A;  3DDC B;  4ICV A;  4JL9 A;  3TL5 A;  4DHJ D;  4E71 A;  3ONS A;  2JZ3 B;  4G11 A;  5DPW A;  2NBV B;  4OVU A;  3N30 A;  1WM2 A;  1R4M I;  3VTW A;  3DPD A;  2DHZ A;  2AL3 A;  3ALB A;  3VQI A;  2MCN B;  4PYZ A;  4BKS A;  1SE9 A;  3T8M A;  2DYM A;  1RFA A;  2BWF A;  2XEW A;  3DBH I;  1YJ1 A;  3HK0 A;  4MSQ B;  4EOY A;  3A1Q A;  4ANV A;  2K6Q A;  2MP2 A;  1WE7 A;  1JRU A;  3K9O B;  2AEH A;  2KAN A;  2J0M A;  2KX3 A;  2I1J A;  4HJK A;  4GN1 A;  3R7R A;  3JSV A;  2KDB A;  3DBS A;  3PPA A;  3QIJ A;  2J7Q B;  2IBI B;  4HK2 A;  2G45 B;  5CHV C;  1E8Y A;  4HCP B;  3ZNG C;  4HXD A;  2ZZP B;  2ZVN A;  1OTR B;  2FCS A;  1UBQ A;  2ZNV C;  1UZX B;  3V60 A;  2N9E B;  3TJP A;  3ZRC A;  5AZG A;  3VUW A;  4BBN F;  4W9D A;  2MA9 B;  1EF1 A;  3OJ4 B;  3PV1 A;  2CS4 A;  3APF A;  4BOS C;  4DK5 A;  3QHT A;  3EHV A;  2K6D B;  3A4R A;  4NQK E;  2ZPY A;  2N9P C;  4G50 A;  3A9J A;  4NAW B;  4DDI D;  2KC1 A;  2NPT B;  1EF5 A;  2HJ8 A;  1KLV A;  2JRH A;  3PRZ A;  3A4S C;  1BT0 A;  4FJV B;  4KZC A;  5JH5 C;  2N7E A;  4K1R B;  3EC8 A;  2IO3 B;  2C60 A;  2CHX A;  2KK8 A;  1LXD A;  2DAJ A;  1WJ6 A;  2LXA A;  2JVC A;  1OEY A;  1E90 A;  3UQB A;  1I42 A;  2MBH A;  4BKG A;  1WX9 A;  3QX1 A;  3RUL A;  2VRR B;  4FJY A;  4FBJ B;  3PS6 A;  2KLG A;  4AOF A;  1UD7 A;  3SDL C;  3ZKJ C;  4K81 A;  1ZKH A;  4EFO A;  2PJH A;  1WR6 E;  1LQB A;  2KNB A;  4F1S A;  5AZF A;  3AU4 A;  3C0R B;  2EMS A;  4NJ6 A;  4BKT A;  5L95 C;  4MEM A;  1Q5W B;  3L17 A;  5AZH A;  1C3T A;  3Q3F A;  1QZE A;  2DZI A;  3KUZ A;  1E8W A;  2L05 A;  4HDQ A;  1H8C A;  3WA0 A;  3ZDM C;  3NZS A;  4CYE A;  2K8B A;  4TQ0 A;  4HPL B;  3WAO A;  2GBN A;  3JYU A;  3CST A;  5LXH A;  4TQ1 A;  3KYC D;  2JT4 B;  1Y8R C;  2C7H A;  3L16 A;  2GBK A;  2N1V A;  5IA7 A;  3RT3 B;  1Q0W B;  5DPT A;  1L7Y A;  5G55 A;  2KMC A;  3UIN B;  3VH4 B;  3ZLZ A;  3ZTC A;  4EZL A;  1NBF C;  4KDI C;  4DWF A;  1WI0 A;  3PVL A;  1WGR A;  2J0K A;  4FLH A;  1J0G A;  5JHA A;  3WAP A;  1M94 A;  3PRM B;  1U4A A;  3AU5 A;  4AP4 C;  5IAA C;  1YD8 U;  2BWE S;  4KIK B;  1T0Y A;  1NDD A;  1WXS A;  3PZD A;  1K8R B;  1WZ0 A;  4M0W B;  3VXW A;  3V6E B;  4IUM B;  4HWI B;  2DZJ A;  3WAL A;  3SD5 A;  3HM3 A;  2D10 A;  2WDT B;  2DZM A;  3H7P B;  4W9F A;  3N32 A;  1V86 A;  4WWP A;  2MX2 A;  1YIW A;  3U30 A;  4K7W A;  1WMH B;  2RPQ A;  4A3P A;  5LLI A;  3ZNI D;  3Q3J A;  2LRU A;  2L7R A;  1EO6 A;  3VFK A;  5TR5 A;  1WX7 A;  1KOT A;  3CMM B;  2C7N B;  3A33 B;  1V6E A;  1S3S G;  2L0F A;  5JZE B;  3A9K B;  2GBR A;  3IHP C;  4K7S A;  4NJ7 A;  2MLB A;  2V1Y A;  4PS7 A;  4CO7 A;  4IG7 B;  2PPH A;  2D07 B;  2KDI A;  2RGF A;  3ZDT A;  3ZRF A;  1A5R A;  1Q1O A;  5CX3 A;  4MGY E;  3QQ8 B;  3ZTD A;  2UWQ A;  2MW5 A;  1EUV B;  4WJO A;  1WYW B;  4XC2 A;  3PHX B;  5DPR A;  2LVP A;  2PEA A;  3UIO B;  4ANW A;  1WM3 A;  1C1Y B;  4KDL B;  2MBO A;  1TZ1 A;  2NS5 A;  4GMV A;  4MGZ E;  1YX6 B;  3M62 B;  2LD9 A;  2N4F A;  2NVU I;  4RM9 A;  2XK5 B;  3WIM A;  3RYT A;  3IBE A;  4WWN A;  3QA8 A;  1P3Q U;  4ZRK A;  3BIN A;  4GDL A;  3APC A;  3RZW C;  4LDT D;  2M1M A;  1E7U A;  4MJS B;  4IW0 A;  3RUI B;  2RSU A;  2IZV B;  1WJU A;  2UYZ B;  1GUA B;  2LWP A;  3B08 A;  3CF6 E;  1ZW7 A;  2ZPN A;  3KH0 A;  3LJ3 A;  5CHW A;  5FR6 A;  4FHK A;  1YQB A;  3GZN I;  4ASW C;  2BYE A;  4HDO A;  4II2 B;  2OOB B;  4I6L B;  2FAZ A;  2LGY A;  2M17 A;  2N7D A;  2Z59 B;  2WWZ A;  2K25 A;  4KVG B;  1P0R A;  2LGX A;  4W9L A;  3L08 A;  1PQS A;  4DHZ E;  2KX0 A;  3DVN V;  3NOB A;  2NBW B;  3ZW3 A;  4ZDV A;  2I1K A;  3IFW B;  2ZEQ A;  2MSE D;  5HKH A;  3H7P A;  3KUD B;  3X0W A;  3ECI A;  4FHJ A;  2LUE A;  2LVQ A;  2Z0E B;  4JLC A;  3RCZ A;  1UBI A;  3R3M A;  3VUY A;  3KYD D;  2IY0 B;  5C1Z A;  4II3 B;  2ZNV B;  4PS3 A;  3MJW A;  4GDK A;  1P9D U;  3A9K A;  3NS8 A;  1V5O A;  3PHW B;  2HE7 A;  2MBB B;  4J6I A;  4TUU A;  5J18 A;  1Z5S B;  5JHB A;  1V81 A;  3K9P B;  1WGD A;  1E5W A;  2XBB C;  4W9G A;  3EEC A;  4WWO A;  3VH3 B;  2C5L C;  2MQJ A;  2O6V B;  3PT2 B;  4FA6 A;  2LI5 A;  1MG8 A;  2GMI C;  4LDT B;  2AL6 A;  3H9D A;  3PLU A;  4GOC A;  4BFR A;  2O2V B;  4HPM B;  4IWQ A;  4G3X B;  4NPN A;  2KKC A;  2LXC A;  4LCD E;  3ZNZ B;  4DBG A;  4MSM B;  3OJ3 A;  4F7Z A;  3QWZ B;  2M0X A;  2R2O A;  2DAF A;  5D6J B;  1LM8 B;  2ZVO A;  2KOX A;  1TBE A;  2XK5 A;  4W9C A;  5KHO A;  2FCM A;  2MBE A;  1WH3 A;  2V3S A;  3VAW A;  4XZ4 A;  2D3G A;  3H7S A;  3GOE A;  1UGM A;  2KJH B;  5J2R A;  1SGH A;  1GNU A;  2L8J A;  2DX5 B;  2FNJ B;  4IWO A;  2K1F A;  5C23 A;  1G6J A;  2KN5 A;  4KSL C;  3SU8 X;  1UEL A;  4JIO U;  3HHM A;  1R4N I;  2Z0D B;  2HD5 B;  1IPG A;  2A5U A;  3IG3 A;  2CKH B;  3JVZ X;  4M8M A;  4W9H A;  1ISN A;  5D2M B;  3ZO5 B;  3H6N A;  3UGB B;  2D2Q A;  2DYB A;  2L0T A;  3A1Q B;  3UQA A;  4IM2 A;  1GC6 A;  2GBJ A;  2IO0 B;  3KW5 B;  3L0W B;  5BO4 B;  1D3Z A;  3D32 A;  2G3Q B;  4IM3 A;  1GJZ A;  4A20 A;  1OGW A;  2FIF A;  5EDS A;  2NCN A;  4TKN A;  4DXA B;  2L00 B;  1V49 A;  2WX0 A;  3PRP B;  3TCA A;  4NAW A;  3V6C B;  2NPT A;  3ML8 A;  1WZ3 A;  4EKU A;  1E8X A;  5L83 A;  4WJP A;  4GB9 A;  3UIP B;  4GU2 A;  5LXI B;  2WYQ A;  2KDF B;  4EUT A;  3SHQ A;  3OAW A;  2DZK A;  2MRP A;  1WIA A;  2L76 A;  3QJZ A;  4OVV A;  2PE9 A;  3M3J A;  4NY0 A;  3L13 A;  5D94 A;  3JW0 X;  3PSE B;  4WJN A;  5DCN A;  1WF9 A;  4F8C B;  4WJQ A;  3AUL A;  2L3Z A;  2FID A;  4GXB A;  2ZCC A;  3WAN A;  2GBM A;  2ASQ A;  1WXM A;  3DCG A;  4W9K A;  1WXA A;  3ZVV A;  1WY8 A;  3X23 A;  1UH6 A;  3VVW B;  4M8N A;  3NY5 A;  4MGK E;  2KC2 A;  3DBL I;  3L10 B;  2EMT A;  3CSF A;  1V2Y A;  1VD2 A;  4FN2 A;  2O2V A;  4TV3 A;  4P7I A;  1WFY A;  3W1S A;  4ZRI A;  3NHE B;  1V5T A;  2KVR A;  3IVF A;  2KTF A;  4AJY B;  3ML9 A;  2BKR B;  3ZNH B;  1NI2 A;  2KWV B;  4EZJ A;  4PYU A;  1TTN A;  2W9N A;  4EEW A;  3B1L X;  3ENE A;  3VTU A;  4CHK A;  4WAA A;  4MM3 A;  2JF5 A;  4BVU C;  2K39 A;  2BF8 B;  2KD0 A;  2LAS A;  2M4N A;  3TBL D;  2O6V D;  1VCB A;  2BYV E;  2LRW A;  2JY6 A;  2QHO A;  2KFJ A;  3TMP B;  5DPS A;  5CTR C;  4DHZ B;  4WQO B;  2RD0 A;  2KWC A;  5D7G A;  2KO3 A;  3AXC A;  3LDZ E;  3ZIM A;  2J0J A;  4AWJ A;  1WR1 A;  4FAD A;  2JUO A;  4E74 A;  4W9E A;  2KDE B;  2KTR B;  3QAR A;  3VDZ A;  3M63 B;  4KIK A;  2IYD B;  2MBQ A;  4IC7 B;  4E3C A;  3DQV A;  5GMV A;  2LGD A;  5J17 A;  4IM0 A;  3I3T B;  4KV2 A;  4ZYN A;  1E7V A;  4HCN B;  1RAX A;  2YVC A;  3O65 B;  3HIZ A;  4MDK E;  4BKS D;  1YX5 B;  2N9X A;  2ZJD A;  4DDG D;  2NR2 A;  2DYO A;  3AI5 A;  3MHS D;  4HLE A;  4JGH B;  4G0N B;  4LJO B;  4ANX A;  1ZGU B;  3RD2 A;  2KZR A;  1V80 A;  1WMH A;  4JQW C;  4NQL B;  3KVF B;  4IWP A;  4B9K A;  2D11 A;  4A3O A;  2CU1 A;  1J8C A;  3DVG Y;  3WAM A;  2FCQ A;  4KSK C;  5E6P A;  2KFK B;  1CMX B;  2AWT A;  3W1S C;  3VTV A;  2IO2 B;  2JPH A;  2PE6 B;  4DHJ B;  2REX A;  1FXT B;  1GG3 A;  4B6W A;  3EFU A;  1I35 A;  3W1Y A;  2B3A A;  1S1Q B;  3H1U A;  3APD A;  1P98 A;  2KXJ A;  1TGZ B;  1KM7 A;  4YL8 A;  1X1M A;  1GC7 A;  3V62 A;  1WX8 A;  4ICU A;  4PS8 A;  3HM6 X;  3PRE A;  5CHF A;  2KWU B;  2C9W B;  5E6N A;  3QK0 A;  1RRB A;  3QAQ A;  4AJW A;  4KZ0 A;  1L2N A;  4AUQ C;  3L54 A;  5AEK B;  3DVG X;  3T9L A;  2K8C A;  3S2A A;  1WGH A;  4W9J A;  3PTF C;  1SIF A;  2AYO B;  3V61 A;  1IYF A;  4ZRJ A;  1WGY A;  1Z2M A;  4MJS A;  2BYF A;  1J19 A;  5KHQ A;  3B0A A;  3DOW A;  2G4D B;  3VUX A;  2C7M B;  2JWZ A;  3BY4 B;  4EZK A; 
#chains in the Genus database with same CATH topology
 3NZU A;  5E6O A;  1P1A A;  1E8Z A;  2MP2 B;  2A4Z A;  2IY1 B;  2WXM A;  4OVZ A;  1T0Q C;  3TEW A;  2BQQ A;  3JSV B;  2KT7 A;  4GDL B;  2GLS A;  4BBN C;  1QT9 A;  1WRD B;  4MEL A;  4RMA A;  4YXD B;  3U7D A;  3AEF B;  3ZGZ A;  2SEB D;  1OQY A;  3QCA A;  4N6E B;  3BK1 A;  2V4L A;  2KN4 A;  4IDI A;  2KFK A;  4LNO A;  3SR6 A;  2FUH B;  3A9J B;  1UUP A;  1SSN A;  4B0M A;  1OEY J;  4BOZ B;  2PVG C;  3PZ8 A;  1YN3 A;  3UI3 A;  1TS2 A;  2LVO A;  4B95 A;  3P4Q B;  1YN5 A;  4HVB A;  1HE8 A;  2KMA A;  3T3N A;  4GDK B;  3DDC B;  2BKF A;  3AB5 A;  2WP9 B;  3N30 A;  1WM2 A;  1R4M I;  3VTW A;  1FM0 D;  4XWT A;  2DYM A;  3RFZ B;  3DBH I;  2K6Q A;  4ZYS A;  1JRU A;  1UWX A;  2KX3 A;  2MJD A;  2KDB A;  3ZJU A;  2LGS A;  3ZNG C;  1E8Y A;  1D4B A;  2ZZP B;  4NZL B;  2FCS A;  2N9E B;  2ACZ B;  5AZG A;  1ET6 A;  3VUW A;  4BBN F;  2H89 B;  4BOS C;  2HTM E;  3QHT A;  4JWU C;  4NQK E;  2ZPY A;  1XLO A;  4M00 A;  1IBX B;  3PRZ A;  4KZC A;  1XCQ L;  4DQO C;  4XDC A;  3EGR A;  4FBJ B;  2LUM A;  4FJY A;  4Q2J A;  1ZKH A;  1V1P B;  4ITK A;  3MHZ A;  5L95 C;  3AU4 A;  3BWU D;  4MEM A;  2MJE A;  3W5U B;  5AZH A;  3Q3F A;  1IGD A;  1QZE A;  2ZW1 A;  2DZI A;  1E8W A;  1RWS A;  2WXN A;  3CST A;  2G1E A;  4TQ1 A;  3KYC D;  3L16 A;  1Y8R C;  3Q2A C;  4PT5 A;  1PFD A;  3AE3 B;  4YT0 B;  1A70 A;  3ZLZ A;  4KDI C;  4C80 A;  3ETR A;  3PVL A;  3DBL B;  1J0G A;  4JPS A;  3U7Z A;  3CWI A;  2D5G A;  4AP4 C;  5GXG B;  1NDD A;  4M0W B;  3MP9 A;  4HWI B;  4OZA A;  4LNN A;  3LXF A;  2D10 A;  2DZM A;  2MX2 A;  2VZK D;  1ZUD 2;  4RF0 A;  1N61 A;  1WMH B;  3KLS X;  3ZNI D;  3Q3J A;  1EO6 A;  3VFK A;  2WDR B;  2INN E;  1V6E A;  1YJJ A;  5JZE B;  4K7S A;  4A90 A;  2RDB C;  3FAH A;  2PPH A;  2D07 B;  2KDI A;  1L4Z B;  3ZDT A;  1A5R A;  1VR9 A;  1JRO A;  5CX3 A;  3R2T A;  4C7Z A;  4WJO A;  1WYW B;  2JXT A;  2LVP A;  2JU6 X;  4US9 A;  2BB6 A;  3RYT A;  3NVV A;  4O1N A;  3BIN A;  3APC A;  3AH7 A;  5D3D A;  2GI9 A;  2WU5 B;  2IZV B;  2UYZ B;  1ZW7 A;  3ZXR A;  5FR6 A;  3GZN I;  1C9F A;  3Q69 A;  1J7C A;  2WWZ A;  1JML A;  3DVN V;  3IFW B;  3N1Z C;  1YQ4 B;  3KUD B;  2LVQ A;  3LYY A;  5EE0 A;  2ICI A;  1EWC A;  1NYR A;  2KDM A;  2IY0 B;  3MJW A;  3A9K A;  1V5O A;  1HA5 A;  5JHB A;  2IND C;  3K9P B;  1WGD A;  4WWO A;  3B2G A;  2MQJ A;  2O6V B;  2WNM A;  3KWV A;  2L1A A;  2GMI C;  2W3R A;  2ONQ A;  2AL6 A;  4LDT B;  5FK9 C;  4BFR A;  4IOI E;  1VZ6 A;  2KKC A;  2LXC A;  1SB3 C;  3OJ3 A;  4F7Z A;  3QWZ B;  2M0X A;  2YEP F;  2DAF A;  1FCC C;  2KOX A;  2V3S A;  2D3G A;  3H7S A;  1SGH A;  2L8J A;  2DX5 B;  1R4N I;  2Z0D B;  2HD5 B;  1IPG A;  4W9H A;  2CKH B;  4M8M A;  3A1Q B;  4IM2 A;  2GBJ A;  2IO0 B;  3KW5 B;  3L0W B;  4HJG E;  1N60 A;  1DOY A;  3Q8B A;  2L00 B;  3PRP B;  2NPT A;  1WZ3 A;  4WJP A;  2UU7 A;  4GU2 A;  1VZ8 A;  3QJZ A;  1I4G A;  3M3J A;  5D94 A;  3PSE B;  1SJH D;  2L3Z A;  2FID A;  1C4A A;  2GBM A;  3DBH B;  2W3S A;  3ZVV A;  1V2Y A;  1VD2 A;  3GE3 C;  4A8X C;  3ML9 A;  1NI2 A;  4EEW A;  3ENE A;  4CHK A;  3AE6 B;  4MM3 A;  2K5P A;  2QEJ C;  1WSP A;  2BBC A;  2M4N A;  3RNC C;  3TBL D;  1VLB A;  2BYV E;  4JWS C;  3TMP B;  3ZYY X;  5CTR C;  1KTK A;  1YOV B;  2RD0 A;  4WQO B;  5D7G A;  4AWJ A;  1WR1 A;  3SEB A;  4E74 A;  2LHE A;  3BYT B;  2WXJ A;  2HDE A;  1QKZ A;  1PDX A;  3VDZ A;  2WDQ B;  3B9J A;  2MBQ A;  1FFU A;  4WUR A;  2YVC A;  3HIZ A;  5BYR A;  1QQR A;  3WCQ A;  3HVZ A;  3AN1 A;  4K3C A;  2D3C A;  4NQL B;  4WWM A;  4B9K A;  1L4D B;  1STE A;  2CU1 A;  3DVG Y;  4C00 A;  2FCQ A;  1C77 A;  2AWT A;  3W1S C;  2CJN A;  3U4E G;  4AQ7 A;  1GG3 A;  1DOX A;  3H1U A;  4GLS C;  1LO5 D;  1TGZ B;  1GC7 A;  1WGK A;  4PS8 A;  5E6N A;  4KZ0 A;  3O13 A;  2WXG A;  1RFK A;  4YWG G;  3Q8A A;  3DVG X;  1SBB B;  5HI1 A;  1ACC A;  1Z2M A;  1J19 A;  1FXI A;  5KHQ A;  2G4D B;  2C7M B;  1NEN B;  3AV8 A;  1L0V B;  2JWZ A;  3BY4 B;  4MH0 E;  1XF5 L;  1H4R A;  2KTR A;  2KLC A;  2KHW B;  3V05 A;  4H2A A;  3KQ4 A;  3P2B A;  1AAR A;  4GSW A;  2JX5 A;  2YLM A;  1LFD A;  2IO1 B;  2WXH A;  1ZPS A;  1JRP A;  1C4C A;  2WQY B;  2LZ6 A;  4PK1 A;  3ZUN A;  2BYT A;  1WGG A;  3OG5 A;  1MPE A;  2BGF A;  2K3U A;  1TKE A;  2V4I B;  3RZF A;  2OJR A;  3DVN U;  2R61 A;  1N5W A;  2N1W A;  4GGQ A;  2K8H A;  1TS3 A;  3U8Z A;  2BB5 A;  1DOI A;  3MTN B;  4RFB A;  1UF0 A;  4MH8 A;  2D3A A;  2R2Q A;  1KLG D;  1I4R A;  3TL5 A;  4DHJ D;  4ICV A;  4E71 A;  3ONS A;  2JZ3 B;  3NZ3 A;  3GZN B;  5DPW A;  2DHZ A;  2MCN B;  1SE9 A;  4L2Y A;  4ZRQ A;  4RH6 A;  3HK0 A;  1T0S C;  2MP2 A;  4C4V A;  1SIJ A;  3K9O B;  2KAN A;  2J0M A;  4HJK A;  2JYT A;  3JSV A;  2J7Q B;  4HXD A;  3RNE C;  3P4R B;  2ZVN A;  4XDD A;  1UBQ A;  2ZNV C;  3V60 A;  1NVI D;  1ESF A;  2MA9 B;  1EF1 A;  3AE7 B;  3VRB B;  4LK0 M;  3A4R A;  2D3B A;  3A9J A;  3W5V B;  4NAW B;  3N9Y C;  2KC1 A;  4A6Q A;  2HJ8 A;  3A4S C;  1UNS A;  2XN9 C;  5JH5 C;  2N7E A;  4K1R B;  3EC8 A;  2KK8 A;  4KX6 B;  4BAX A;  2WGS A;  3AE2 B;  2JVC A;  1E90 A;  1NI3 A;  1E0Z A;  1R4N B;  2MBH A;  4BKG A;  1I42 A;  1WX9 A;  2RDG A;  2VRR B;  4WIP A;  3PS6 A;  1WYG A;  3FIL A;  4AOF A;  3SDL C;  4K81 A;  4EFO A;  2PJH A;  1C4P A;  4WH4 A;  3AEA B;  5AZF A;  3HRD D;  3BZD B;  1HTQ A;  3KUZ A;  1PUT A;  3NZS A;  4P16 A;  2K8B A;  4TQ0 A;  3WAO A;  3JYU A;  3VRA B;  1WWT A;  2C7H A;  2H88 B;  2AX5 A;  3RT3 B;  4MAC A;  3MFG A;  3UIN B;  3VH4 B;  3AE1 B;  3ZTC A;  4EZL A;  2BW2 A;  1SXT A;  4DWF A;  1WGR A;  4FLH A;  3AEE B;  3WAP A;  2NMQ A;  5I4D A;  5HFY A;  2BWE S;  5EE9 A;  1T0Y A;  4B0E A;  4WQM A;  1WXS A;  1K8R B;  3V6E B;  1IBX A;  2EKI A;  2DZJ A;  4KKI A;  1MFW A;  2VH2 A;  1MG4 A;  1KLU D;  3H7P B;  4WWP A;  5E6J A;  1YIW A;  3U30 A;  2RPQ A;  5LLI A;  2LRU A;  2L7R A;  3R8B A;  1QF6 A;  5TR5 A;  1WX7 A;  1KOT A;  3CMM B;  1NYQ A;  2KMM A;  2MLB A;  5LNK 1;  1V1P A;  3GB1 A;  5D3I B;  3QQ8 B;  2QIL A;  3SFD B;  4XC2 A;  1HQR D;  2PEA A;  2MBO A;  4RF1 A;  4RM9 A;  2QSD A;  3AE4 B;  3IBE A;  3P1M A;  4WWN A;  1P3Q U;  3BVG A;  3RZW C;  4LDT D;  2M1M A;  4IW0 A;  3RUI B;  3MC0 B;  1WJU A;  4A9A A;  4MT5 A;  5HHD G;  2Q5W D;  2QJL A;  2WXF A;  2LHD A;  3B08 A;  3Q8E A;  3KH0 A;  3LJ3 A;  1TT5 B;  1YQB A;  2Y5C A;  2BYE A;  4HDO A;  4HRS A;  1L0X B;  4II2 B;  4I6L B;  2LMC A;  1T6B X;  3RNB C;  1I4P A;  2KX0 A;  3OWE B;  3NOB A;  3DWG C;  2MSE D;  4S17 A;  3ECI A;  2LUE A;  1AW7 A;  4JLC A;  4LNI A;  2BS3 B;  3KYD D;  2ZNV B;  1P9D U;  3NS8 A;  1JCK B;  2HE7 A;  2KYW A;  3AEB B;  4TUU A;  4XGA B;  4W9G A;  3EEC A;  1J7A A;  1XXG A;  1ZDX A;  2LI5 A;  1MG8 A;  3H9D A;  2O2V B;  4G3X B;  4NPN A;  1C78 A;  4DBG A;  4MSM B;  1UWM A;  5D6J B;  1LM8 B;  1P7E A;  4W9C A;  3VAW A;  2MBE A;  5EE1 A;  4FXC A;  5IO9 A;  2KJH B;  1TY0 A;  2FNJ B;  2K1F A;  2KN5 A;  4KSL C;  3SU8 X;  3HHM A;  3IG3 A;  2A5U A;  3C8Y A;  2W55 A;  5BO4 B;  1GC6 A;  2Z8L A;  1D3Z A;  1YN4 A;  3D32 A;  1GJZ A;  1FXA A;  1OGW A;  2N0S B;  1B9R A;  3TEX A;  2MH7 A;  3TCA A;  2BTE A;  3ML8 A;  2KVZ A;  3UIP B;  5LXI B;  2WYQ A;  2DWQ A;  4EUT A;  4ARI A;  2DZK A;  2MEK A;  1WIA A;  2JSV X;  4KKJ A;  3L13 A;  5G5G A;  2LFI A;  4F8C B;  1WXM A;  3DCG A;  4AS1 A;  1WXA A;  3VVW B;  1LGR A;  5IP4 D;  3NY5 A;  2PLP A;  1L5P A;  1WFY A;  3RMK C;  2KVR A;  3IVF A;  2KTF A;  4AJY B;  2BKR B;  1TTN A;  3VTU A;  1E9M A;  2W54 A;  4WAA A;  3CIR B;  2JF5 A;  2BF8 B;  1YNT E;  1L0Y B;  4QAY A;  3ZJV A;  5DPS A;  2JWU A;  3GS2 A;  3ZIM A;  1CZP A;  2KDE B;  3M63 B;  4KIK A;  5GMV A;  4IM0 A;  4KV2 A;  4P1B C;  1RAX A;  4HEA 1;  2B76 B;  3IAM 1;  1YX5 B;  4YSX B;  3AI5 A;  1XLQ A;  4LJO B;  4ANX A;  1SE4 A;  1V80 A;  1FRR A;  1N62 A;  2KQ4 X;  1XLP A;  4IWP A;  3H8H A;  2D11 A;  1J8C A;  3WAM A;  4ARC A;  1JWM D;  2JPH A;  4B6W A;  3W1Y A;  2B3A A;  2INC C;  3APD A;  1P98 A;  3I63 C;  1KM7 A;  3EFC A;  3V62 A;  4DXG A;  5CHF A;  3HM6 X;  1N5X A;  1V8C A;  2C9W B;  4JX1 C;  3QK0 A;  4C7Y A;  3SFE B;  4USA A;  2FE8 A;  2K8C A;  3S2A A;  4ACF A;  1DYQ A;  2IDY A;  3PTF C;  1SIF A;  3V61 A;  4ZRJ A;  3AEC B;  4MJS A;  4KGR A;  4L1B A;  3HUI A;  1FRD A;  2ON8 A;  2KJR A;  4X57 B;  2FCN A;  4YSY B;  1KJT A;  2KQ7 A;  1TKG A;  2HTH A;  2JRI B;  1RLF A;  1IP9 A;  2TSS A;  2CHW A;  2KQS A;  2WU2 B;  3AMZ A;  1TS5 A;  2EEL A;  1WJ4 A;  1XD3 B;  2RMM A;  4IKG A;  1GAQ B;  2WX1 A;  2W82 A;  2BPS A;  2JZZ A;  1UGJ A;  4I6N B;  1ZXI A;  3KWL A;  2G4S A;  3R66 C;  3DHI C;  1XQQ A;  1AN8 A;  5G2N A;  3VR9 B;  2DNF A;  2CR5 A;  1WE6 A;  2Y5B B;  1WXV A;  1WJN A;  3PGE A;  4FJZ A;  3OLM D;  3NVZ A;  4HRO A;  2DEN B;  1XT9 B;  3QC8 B;  1WXQ A;  1N63 A;  4XX5 A;  1V9J A;  2EKE C;  2NBU A;  4JL9 A;  1HTO A;  4HKZ E;  4OVU A;  3TUO A;  3AE5 B;  1YMH E;  1IGC A;  4CQN A;  3T8M A;  5BMI A;  1RFA A;  2BWF A;  2XEW A;  4MSQ B;  3U2S C;  4LTU A;  4ANV A;  3TSS A;  1WE7 A;  2AEH A;  1ZOY B;  3QIJ A;  3DBS A;  3PPA A;  2G45 B;  5CHV C;  4HCP B;  3IT6 B;  1OTR B;  3ZRC A;  1KH0 A;  4W9D A;  5MPO A;  2VZK B;  3PV1 A;  1BUI C;  2BS4 B;  2CS4 A;  3APF A;  4DK5 A;  3DHG C;  1T5X D;  4G50 A;  2N9P C;  5H92 C;  5BYQ A;  1SEB D;  4P6V F;  5C2T B;  4DDI D;  2NPT B;  1EF5 A;  1KLV A;  1BT0 A;  4FJV B;  2LJI A;  3Q3N C;  2IO3 B;  3W2D A;  2AQ2 B;  4XE0 A;  4TSS A;  1WJ6 A;  2LXA A;  2CU3 A;  1VJK A;  1QOA A;  1PYW D;  2KLG A;  2OED A;  4OZB A;  2XNA C;  1LQB A;  4F1S A;  4L23 A;  4BKT A;  3ABV B;  1EU3 A;  1OQR A;  1Q5W B;  3L17 A;  1RM6 C;  3R2I A;  2WXK A;  2V0G A;  2L05 A;  4HDQ A;  3WA0 A;  1TJE A;  4RGO S;  3ZDM C;  4CYE A;  4HPL B;  1DGJ A;  2JT4 B;  4HPP A;  3NRZ A;  2WDV B;  3RNG C;  1V97 A;  2GBK A;  2PTL A;  2WLB A;  1I4H A;  1QLB B;  4DXF A;  1JWU D;  1L7Y A;  5G55 A;  2KMC A;  5JXV A;  1FNU A;  4OW0 A;  3Q8F A;  5JHA A;  4JE3 B;  1BXT A;  1U4A A;  3AU5 A;  5IAA C;  3PZD A;  1FIQ A;  2VH1 A;  1GOZ A;  2QC8 A;  3SD5 A;  3HM3 A;  3WAL A;  4US8 A;  1RYJ A;  2WDT B;  2K22 A;  1I4X A;  4ZOH C;  4NJC A;  3A33 B;  3IHP C;  2GBR A;  4NJ7 A;  2LGI A;  3VR8 B;  5TSS A;  1QOF A;  2DLB A;  2RGF A;  2CJO A;  2MJ3 A;  1XCT L;  2K0P A;  2UWQ A;  1EUV B;  1ZDV A;  3NVW A;  5DPR A;  3UIO B;  4ANW A;  1WM3 A;  1C1Y B;  1JWB D;  4KDL B;  4KGT A;  1TZ1 A;  1J7B A;  2NS5 A;  4GMV A;  4MGZ E;  1YX6 B;  3M62 B;  2LD9 A;  2NVU I;  2XK5 B;  3QA8 A;  4GDL A;  1V1O A;  3N20 C;  1E7U A;  3N1Y C;  2GRI A;  1E10 A;  1K53 A;  1WRI A;  3CF6 E;  2AQ1 B;  5CHW A;  4ASW C;  5AUI A;  2FAZ A;  1D5M C;  2M17 A;  1TS4 A;  1BML C;  2Z59 B;  1P0R A;  1CJE A;  2LGX A;  4W9L A;  3L08 A;  1FD6 A;  4DHZ E;  3ZW3 A;  5HKH A;  3H7P A;  4FHJ A;  3DWM A;  2Z0E B;  3RCZ A;  3AM9 A;  3VUY A;  1Y56 A;  1E7P B;  4II3 B;  1MHX A;  4GDK A;  1XEE A;  4J6I A;  2MBB B;  1V81 A;  1YQ3 B;  2BT6 A;  1E5W A;  3AE8 B;  3PLU A;  4GOC A;  3ZXV A;  2JZP A;  3MC9 A;  1T0R C;  3ZNZ B;  2R2O A;  2G9H D;  4N59 A;  1TBE A;  5KHO A;  1WH3 A;  3GOE A;  2PMV A;  1UGM A;  2IPK D;  5J2R A;  1GNU A;  1MJD A;  1G6J A;  1UEL A;  4JIO U;  3GP7 A;  5D2M B;  3H6N A;  2D2Q A;  1MVK A;  1OQQ A;  2DYB A;  2L0T A;  3UQA A;  4C4V B;  4IM3 A;  4S0R A;  4A20 A;  2FIF A;  5EDS A;  2NCN A;  4DXA B;  2KWD A;  2N9L A;  3Q3O C;  5L83 A;  1QIL A;  3URY A;  3OAW A;  2L76 A;  4OVV A;  2PE9 A;  3MJ5 A;  4NY0 A;  4WJN A;  5DCN A;  1WF9 A;  3I5J C;  2FBW B;  2ZCC A;  4GXB A;  3WAN A;  1JWA D;  2PIA A;  2MHJ A;  1WY8 A;  1UH6 A;  4ZHO A;  2KC2 A;  2EMT A;  2OHF A;  4FN2 A;  3PZ7 A;  2O2V A;  1SE3 A;  2QCZ A;  3LB8 C;  1FNW A;  1FPY A;  1V5T A;  3ZNH B;  4EZJ A;  4PYU A;  2W9N A;  4WAF A;  3FIL B;  4BVU C;  2GB1 A;  2ZW0 A;  2KD0 A;  2LAS A;  1VDV A;  2O6V D;  2WXP A;  1VCB A;  3Q6B A;  4YTP B;  2JY6 A;  2QHO A;  1R7S A;  4DHZ B;  3V3X A;  2KWC A;  2QIE B;  3LDZ E;  1HZ6 A;  4W9E A;  3J9C A;  1JQ4 A;  2N7J A;  3QAR A;  4M0W A;  5C3J B;  4IC7 B;  3DQV A;  3P4P B;  1PGX A;  4ZYN A;  5BYS A;  1E7V A;  3O65 B;  4LNF A;  4BKS D;  2N9X A;  3MHS D;  2DBY A;  4JQW C;  1WMH A;  2BS2 B;  3RI7 C;  4HKQ A;  5E6P A;  2KFK B;  1CMX B;  1HXY D;  3NVY A;  4DHJ B;  2PE6 B;  1FXT B;  4YTN B;  5BMH A;  3EFU A;  1S1Q B;  1SF0 A;  1F0Z A;  2KXJ A;  1X1M A;  4YSZ B;  4J3O D;  1WX8 A;  4ICU A;  3E9S A;  1K50 A;  2KWU B;  2RPV A;  3DHH C;  3QAQ A;  1I4Q A;  5EE3 A;  2NTT A;  3L54 A;  1TIF A;  3T9L A;  3IAS 1;  2QDF A;  4W9J A;  3RPF C;  2AYO B;  1IYF A;  2Y3A A;  2M0A A;  2BYF A;  3B0A A;  3VUX A;  1MHH E;  4EZK A;  1E6E B;  3DBR I;  3MC8 A;  4LJP B;  4I6P A;  4ZHP A;  3N3K B;  4K7U A;  2WXI A;  2LJ5 A;  2GOW A;  4RM8 A;  1TKY A;  4N9F 4;  2MWS B;  3R7Q A;  1JAL A;  5HG2 A;  3PLV A;  2ZCB A;  3KUC B;  3VHT C;  4GIV A;  1YJI A;  2V3P A;  3BVM A;  2M8S A;  1F9J A;  4FUL A;  3UF8 A;  3M95 A;  4MGI E;  2JXX A;  3FC4 A;  4ANU A;  2KJ6 A;  2WS3 B;  2O6V A;  4W9I A;  2BVC A;  4NNJ B;  2RR9 A;  2JQR B;  2CHZ A;  1JW9 D;  4URK A;  3TIX A;  3GE8 C;  3AEG B;  2QMT A;  3I57 A;  4G11 A;  2NBV B;  1NEK B;  3DPD A;  3IXS A;  3N1X C;  2AL3 A;  3ALB A;  3VQI A;  4PYZ A;  4BKS A;  1KFY B;  1YJ1 A;  4ZRP A;  4EOY A;  3A1Q A;  2OJW A;  3T3O A;  2I1J A;  4GN1 A;  3R7R A;  1ROE A;  2IBI B;  4HK2 A;  3ZQ4 A;  1TY2 A;  3L4P A;  1F77 A;  4XYC A;  1UZX B;  3TJP A;  1VRA B;  2K9X A;  1TYG B;  3TEY A;  1TZO A;  5FR3 A;  3NUH B;  4P1C C;  1D5Z C;  1L6U A;  3OJ4 B;  1ET9 A;  2X38 A;  3EHV A;  2K6D B;  1M4V A;  2JRH A;  3ZJT A;  4RCO A;  4A55 A;  2C60 A;  2CHX A;  2PKO A;  1LXD A;  2DAJ A;  4M02 A;  1F2R I;  1OEY A;  3UQB A;  3QX1 A;  3RUL A;  1GB4 A;  1L6V A;  2WXQ A;  1UD7 A;  3ZKJ C;  4TMA B;  1WR6 E;  2KNB A;  1D6E C;  2E3T A;  3C0R B;  2EMS A;  4NJ6 A;  1KRH A;  1C3T A;  3U52 E;  1H8C A;  5FKA C;  4YTM B;  2RDH A;  2M19 A;  2GBN A;  2V3N A;  5LXH A;  2E6X A;  5G5H A;  2M56 B;  2N1V A;  5IA7 A;  1EM7 A;  1Q0W B;  5DPT A;  1C79 A;  1NBF C;  1WI0 A;  2J0K A;  1M94 A;  3PRM B;  1YD8 U;  4KIK B;  3VXW A;  2I2Y A;  1WZ0 A;  2PVO D;  5IKC M;  4IUM B;  1CQV A;  1K51 A;  3EA6 A;  3Q8C A;  4W9F A;  3N32 A;  1V86 A;  4K7W A;  1R4M B;  4A3P A;  1EWY C;  2IGG A;  2INP E;  2C7N B;  4N58 A;  1B1Z A;  2X8X X;  1S3S G;  2L0F A;  3A9K B;  4XWW A;  2L83 A;  2V1Y A;  4PS7 A;  4CO7 A;  4IG7 B;  3ZRF A;  2PW9 A;  1Q1O A;  3NJT A;  4MGY E;  3ZTD A;  1ZXH A;  2LEK A;  1FFV A;  4OHJ A;  2MW5 A;  1IUE A;  4RNA A;  1PGB A;  1F2R C;  3I9V 1;  3PHX B;  3Q14 C;  4R3D A;  1Q10 A;  2N4F A;  2WHI A;  5H8Y E;  3W9C B;  3WIM A;  4ZRK A;  3E56 A;  3C19 A;  4MJS B;  1T3Q A;  3AE9 B;  2RSU A;  3BII D;  1GUA B;  2LWP A;  2ZPN A;  4FHK A;  4BZA A;  3FKY A;  2OOB B;  2IJ0 A;  2LGY A;  2N7D A;  4D2K A;  2K25 A;  4KVG B;  5AUK A;  2YEP B;  3Q3M C;  1PQS A;  2NBW B;  4ZDV A;  2I1K A;  1FNV A;  2ZEQ A;  1XO3 A;  3X0W A;  2J42 A;  4UDU C;  1UBI A;  3R3M A;  5C1Z A;  4PS3 A;  3PHW B;  1AYF A;  5J18 A;  1Z5S B;  1F1H A;  3P63 A;  3DBR B;  2XBB C;  3VH3 B;  2C5L C;  2WXL A;  2WXO A;  3PT2 B;  4FA6 A;  1SJE D;  4HPM B;  4IWQ A;  4M01 A;  3P42 A;  3HVD A;  4LCD E;  1KF6 B;  3RNF C;  4LNK A;  3NS1 A;  2ZVO A;  2XK5 A;  4MM3 B;  3RNA C;  2FCM A;  4XZ4 A;  1FCL A;  2KAJ A;  2KAC A;  5T8I A;  4IWO A;  2NTS A;  5C23 A;  2IGD A;  5IOI A;  4K3B A;  3JVZ X;  1ISN A;  2J4X A;  3P4S B;  3AED B;  1OFF A;  3ZO5 B;  3UGB B;  1P7F A;  2G3Q B;  3BYY B;  1VZ7 A;  3EUB 2;  4RGM A;  4TKN A;  1V49 A;  2WX0 A;  4NAW A;  3V6C B;  4EKU A;  1E8X A;  4GB9 A;  4C56 C;  2V9H A;  2KDF B;  3SHQ A;  3BK2 A;  2J52 A;  2MRP A;  1MI0 A;  3PO0 A;  3JW0 X;  3TEZ A;  2SAK A;  4WJQ A;  3AUL A;  1CK1 A;  1GB1 A;  1SE2 A;  2L52 A;  2ASQ A;  2JYE A;  4W9K A;  3X23 A;  4M8N A;  4MGK E;  4NAM A;  3DBL I;  3NG0 A;  3L10 B;  3CSF A;  4TV3 A;  4P7I A;  3W1S A;  4ZRI A;  3NHE B;  2KWV B;  3B1L X;  4OZC A;  5BMG A;  2AQ3 B;  2K39 A;  1QOB A;  2LRW A;  2KFJ A;  5IN7 A;  2HJ1 A;  2KO3 A;  3AXC A;  2J0J A;  4FAD A;  2L32 A;  2JUO A;  1ZP0 B;  4REZ A;  1JWS D;  1ZE3 D;  1XLN A;  1FO4 A;  3IT4 B;  2KTR B;  2IYD B;  4E3C A;  1C76 A;  2LGD A;  2J53 A;  3I3T B;  4HCN B;  4MDK E;  2ZJD A;  4DDG D;  2NR2 A;  2DYO A;  4HLE A;  4JGH B;  1PGA A;  4RGT A;  3B2F A;  2FUG 1;  4G0N B;  1ZGU B;  3RD2 A;  2KZR A;  1I7H A;  1D5X C;  3KVF B;  1GPX A;  4A3O A;  4KGS A;  1EU4 A;  2I38 A;  4KSK C;  3VTV A;  2IO2 B;  2REX A;  1HZ5 A;  1I35 A;  4RGN A;  2Y5P A;  1ENF A;  1N6Z A;  4LLG M;  1AWD A;  1FEH A;  4YL8 A;  1HEZ E;  3PRE A;  1QOG A;  1RRB A;  4AJW A;  1K52 A;  1L2N A;  4AUQ C;  5AEK B;  1WGH A;  2WXR A;  4EE2 A;  2IGH A;  1WGY A;  3BVZ A;  2N9K A;  3RN9 C;  3DOW A;  1FMA D;  1F52 A;  5J17 A; 
#chains in the Genus database with same CATH homology
 3NZU A;  5E6O A;  4MH0 E;  1P1A A;  2KJR A;  1E8Z A;  2MP2 B;  2A4Z A;  4X57 B;  3DBR I;  2IY1 B;  4LJP B;  2FCN A;  4I6P A;  1H4R A;  2KTR A;  1KJT A;  2KLC A;  3N3K B;  4K7U A;  2LJ5 A;  2KQ7 A;  2KHW B;  2GOW A;  2HTH A;  2JRI B;  3JSV B;  4RM8 A;  1RLF A;  3P2B A;  4N9F 4;  2MWS B;  1AAR A;  4GSW A;  3R7Q A;  2YLM A;  1LFD A;  4GDL B;  2IO1 B;  3PLV A;  1IP9 A;  4BBN C;  2CHW A;  2KQS A;  1WRD B;  2LZ6 A;  4MEL A;  4RMA A;  3ZUN A;  2ZCB A;  3KUC B;  3VHT C;  4GIV A;  3U7D A;  1WGG A;  1WJ4 A;  1XD3 B;  2M8S A;  1F9J A;  2BGF A;  4FUL A;  2WX1 A;  3RZF A;  3UF8 A;  3M95 A;  1OQY A;  3QCA A;  2V4L A;  2BPS A;  2JZZ A;  4I6N B;  4MGI E;  2KFK A;  2G4S A;  2JXX A;  2OJR A;  3DVN U;  3R66 C;  1XQQ A;  2FUH B;  4ANU A;  3A9J B;  2N1W A;  4GGQ A;  5G2N A;  2KJ6 A;  1OEY J;  2CR5 A;  1WE6 A;  2K8H A;  2O6V A;  2Y5B B;  4W9I A;  4BOZ B;  4NNJ B;  2RR9 A;  2CHZ A;  1WXV A;  1WJN A;  3PGE A;  3U8Z A;  4FJZ A;  2LVO A;  3OLM D;  4URK A;  3MTN B;  4B95 A;  3TIX A;  2DEN B;  1XT9 B;  2R2Q A;  3QC8 B;  4HVB A;  1HE8 A;  4XX5 A;  2KMA A;  4GDK B;  1V9J A;  2EKE C;  2NBU A;  2BKF A;  3DDC B;  4ICV A;  4JL9 A;  3TL5 A;  4DHJ D;  4E71 A;  3ONS A;  2JZ3 B;  4G11 A;  5DPW A;  2NBV B;  4OVU A;  3N30 A;  1WM2 A;  1R4M I;  3VTW A;  3DPD A;  2DHZ A;  2AL3 A;  3ALB A;  3VQI A;  2MCN B;  4PYZ A;  4BKS A;  1SE9 A;  3T8M A;  2DYM A;  1RFA A;  2BWF A;  2XEW A;  3DBH I;  1YJ1 A;  3HK0 A;  4MSQ B;  4EOY A;  3A1Q A;  4ANV A;  2K6Q A;  2MP2 A;  1WE7 A;  1JRU A;  3K9O B;  2AEH A;  2KAN A;  2J0M A;  2KX3 A;  2I1J A;  4HJK A;  4GN1 A;  3R7R A;  3JSV A;  2KDB A;  3DBS A;  3PPA A;  3QIJ A;  2J7Q B;  2IBI B;  4HK2 A;  2G45 B;  5CHV C;  1E8Y A;  4HCP B;  3ZNG C;  4HXD A;  2ZZP B;  2ZVN A;  1OTR B;  2FCS A;  1UBQ A;  2ZNV C;  1UZX B;  3V60 A;  2N9E B;  3TJP A;  3ZRC A;  5AZG A;  3VUW A;  4BBN F;  4W9D A;  2MA9 B;  1EF1 A;  3OJ4 B;  3PV1 A;  2CS4 A;  3APF A;  4BOS C;  4DK5 A;  3QHT A;  3EHV A;  2K6D B;  3A4R A;  4NQK E;  2ZPY A;  2N9P C;  4G50 A;  3A9J A;  4NAW B;  4DDI D;  2KC1 A;  2NPT B;  1EF5 A;  2HJ8 A;  1KLV A;  2JRH A;  3PRZ A;  3A4S C;  1BT0 A;  4FJV B;  4KZC A;  5JH5 C;  2N7E A;  4K1R B;  3EC8 A;  2IO3 B;  2C60 A;  2CHX A;  2KK8 A;  1LXD A;  2DAJ A;  1WJ6 A;  2LXA A;  2JVC A;  1OEY A;  1E90 A;  3UQB A;  1I42 A;  2MBH A;  4BKG A;  1WX9 A;  3QX1 A;  3RUL A;  2VRR B;  4FJY A;  4FBJ B;  3PS6 A;  2KLG A;  4AOF A;  1UD7 A;  3SDL C;  3ZKJ C;  4K81 A;  1ZKH A;  4EFO A;  2PJH A;  1WR6 E;  1LQB A;  2KNB A;  4F1S A;  5AZF A;  3AU4 A;  3C0R B;  2EMS A;  4NJ6 A;  4BKT A;  5L95 C;  4MEM A;  1Q5W B;  3L17 A;  5AZH A;  1C3T A;  3Q3F A;  1QZE A;  2DZI A;  3KUZ A;  1E8W A;  2L05 A;  4HDQ A;  1H8C A;  3WA0 A;  3ZDM C;  3NZS A;  4CYE A;  2K8B A;  4TQ0 A;  4HPL B;  3WAO A;  2GBN A;  3JYU A;  3CST A;  5LXH A;  4TQ1 A;  3KYC D;  2JT4 B;  1Y8R C;  2C7H A;  3L16 A;  2GBK A;  2N1V A;  5IA7 A;  3RT3 B;  1Q0W B;  5DPT A;  1L7Y A;  5G55 A;  2KMC A;  3UIN B;  3VH4 B;  3ZLZ A;  3ZTC A;  4EZL A;  1NBF C;  4KDI C;  4DWF A;  1WI0 A;  3PVL A;  1WGR A;  2J0K A;  4FLH A;  1J0G A;  5JHA A;  3WAP A;  1M94 A;  3PRM B;  1U4A A;  3AU5 A;  4AP4 C;  5IAA C;  1YD8 U;  2BWE S;  4KIK B;  1T0Y A;  1NDD A;  1WXS A;  3PZD A;  1K8R B;  1WZ0 A;  4M0W B;  3VXW A;  3V6E B;  4IUM B;  4HWI B;  2DZJ A;  3WAL A;  3SD5 A;  3HM3 A;  2D10 A;  2WDT B;  2DZM A;  3H7P B;  4W9F A;  3N32 A;  1V86 A;  4WWP A;  2MX2 A;  1YIW A;  3U30 A;  4K7W A;  1WMH B;  2RPQ A;  4A3P A;  5LLI A;  3ZNI D;  3Q3J A;  2LRU A;  2L7R A;  1EO6 A;  3VFK A;  5TR5 A;  1WX7 A;  1KOT A;  3CMM B;  2C7N B;  3A33 B;  1V6E A;  1S3S G;  2L0F A;  5JZE B;  3A9K B;  2GBR A;  3IHP C;  4K7S A;  4NJ7 A;  2MLB A;  2V1Y A;  4PS7 A;  4CO7 A;  4IG7 B;  2PPH A;  2D07 B;  2KDI A;  2RGF A;  3ZDT A;  3ZRF A;  1A5R A;  1Q1O A;  5CX3 A;  4MGY E;  3QQ8 B;  3ZTD A;  2UWQ A;  2MW5 A;  1EUV B;  4WJO A;  1WYW B;  4XC2 A;  3PHX B;  5DPR A;  2LVP A;  2PEA A;  3UIO B;  4ANW A;  1WM3 A;  1C1Y B;  4KDL B;  2MBO A;  1TZ1 A;  2NS5 A;  4GMV A;  4MGZ E;  1YX6 B;  3M62 B;  2LD9 A;  2N4F A;  2NVU I;  4RM9 A;  2XK5 B;  3WIM A;  3RYT A;  3IBE A;  4WWN A;  3QA8 A;  1P3Q U;  4ZRK A;  3BIN A;  4GDL A;  3APC A;  3RZW C;  4LDT D;  2M1M A;  1E7U A;  4MJS B;  4IW0 A;  3RUI B;  2RSU A;  2IZV B;  1WJU A;  2UYZ B;  1GUA B;  2LWP A;  3B08 A;  3CF6 E;  1ZW7 A;  2ZPN A;  3KH0 A;  3LJ3 A;  5CHW A;  5FR6 A;  4FHK A;  1YQB A;  3GZN I;  4ASW C;  2BYE A;  4HDO A;  4II2 B;  2OOB B;  4I6L B;  2FAZ A;  2LGY A;  2M17 A;  2N7D A;  2Z59 B;  2WWZ A;  2K25 A;  4KVG B;  1P0R A;  2LGX A;  4W9L A;  3L08 A;  1PQS A;  4DHZ E;  2KX0 A;  3DVN V;  3NOB A;  2NBW B;  3ZW3 A;  4ZDV A;  2I1K A;  3IFW B;  2ZEQ A;  2MSE D;  5HKH A;  3H7P A;  3KUD B;  3X0W A;  3ECI A;  4FHJ A;  2LUE A;  2LVQ A;  2Z0E B;  4JLC A;  3RCZ A;  1UBI A;  3R3M A;  3VUY A;  3KYD D;  2IY0 B;  5C1Z A;  4II3 B;  2ZNV B;  4PS3 A;  3MJW A;  4GDK A;  1P9D U;  3A9K A;  3NS8 A;  1V5O A;  3PHW B;  2HE7 A;  2MBB B;  4J6I A;  4TUU A;  5J18 A;  1Z5S B;  5JHB A;  1V81 A;  3K9P B;  1WGD A;  1E5W A;  2XBB C;  4W9G A;  3EEC A;  4WWO A;  3VH3 B;  2C5L C;  2MQJ A;  2O6V B;  3PT2 B;  4FA6 A;  2LI5 A;  1MG8 A;  2GMI C;  4LDT B;  2AL6 A;  3H9D A;  3PLU A;  4GOC A;  4BFR A;  2O2V B;  4HPM B;  4IWQ A;  4G3X B;  4NPN A;  2KKC A;  2LXC A;  4LCD E;  3ZNZ B;  4DBG A;  4MSM B;  3OJ3 A;  4F7Z A;  3QWZ B;  2M0X A;  2R2O A;  2DAF A;  5D6J B;  1LM8 B;  2ZVO A;  2KOX A;  1TBE A;  2XK5 A;  4W9C A;  5KHO A;  2FCM A;  2MBE A;  1WH3 A;  2V3S A;  3VAW A;  4XZ4 A;  2D3G A;  3H7S A;  3GOE A;  1UGM A;  2KJH B;  5J2R A;  1SGH A;  1GNU A;  2L8J A;  2DX5 B;  2FNJ B;  4IWO A;  2K1F A;  5C23 A;  1G6J A;  2KN5 A;  4KSL C;  3SU8 X;  1UEL A;  4JIO U;  3HHM A;  1R4N I;  2Z0D B;  2HD5 B;  1IPG A;  2A5U A;  3IG3 A;  2CKH B;  3JVZ X;  4M8M A;  4W9H A;  1ISN A;  5D2M B;  3ZO5 B;  3H6N A;  3UGB B;  2D2Q A;  2DYB A;  2L0T A;  3A1Q B;  3UQA A;  4IM2 A;  1GC6 A;  2GBJ A;  2IO0 B;  3KW5 B;  3L0W B;  5BO4 B;  1D3Z A;  3D32 A;  2G3Q B;  4IM3 A;  1GJZ A;  4A20 A;  1OGW A;  2FIF A;  5EDS A;  2NCN A;  4TKN A;  4DXA B;  2L00 B;  1V49 A;  2WX0 A;  3PRP B;  3TCA A;  4NAW A;  3V6C B;  2NPT A;  3ML8 A;  1WZ3 A;  4EKU A;  1E8X A;  5L83 A;  4WJP A;  4GB9 A;  3UIP B;  4GU2 A;  5LXI B;  2WYQ A;  2KDF B;  4EUT A;  3SHQ A;  3OAW A;  2DZK A;  2MRP A;  1WIA A;  2L76 A;  3QJZ A;  4OVV A;  2PE9 A;  3M3J A;  4NY0 A;  3L13 A;  5D94 A;  3JW0 X;  3PSE B;  4WJN A;  5DCN A;  1WF9 A;  4F8C B;  4WJQ A;  3AUL A;  2L3Z A;  2FID A;  4GXB A;  2ZCC A;  3WAN A;  2GBM A;  2ASQ A;  1WXM A;  3DCG A;  4W9K A;  1WXA A;  3ZVV A;  1WY8 A;  3X23 A;  1UH6 A;  3VVW B;  4M8N A;  3NY5 A;  4MGK E;  2KC2 A;  3DBL I;  3L10 B;  2EMT A;  3CSF A;  1V2Y A;  1VD2 A;  4FN2 A;  2O2V A;  4TV3 A;  4P7I A;  1WFY A;  3W1S A;  4ZRI A;  3NHE B;  1V5T A;  2KVR A;  3IVF A;  2KTF A;  4AJY B;  3ML9 A;  2BKR B;  3ZNH B;  1NI2 A;  2KWV B;  4EZJ A;  4PYU A;  1TTN A;  2W9N A;  4EEW A;  3B1L X;  3ENE A;  3VTU A;  4CHK A;  4WAA A;  4MM3 A;  2JF5 A;  4BVU C;  2K39 A;  2BF8 B;  2KD0 A;  2LAS A;  2M4N A;  3TBL D;  2O6V D;  1VCB A;  2BYV E;  2LRW A;  2JY6 A;  2QHO A;  2KFJ A;  3TMP B;  5DPS A;  5CTR C;  4DHZ B;  4WQO B;  2RD0 A;  2KWC A;  5D7G A;  2KO3 A;  3AXC A;  3LDZ E;  3ZIM A;  2J0J A;  4AWJ A;  1WR1 A;  4FAD A;  2JUO A;  4E74 A;  4W9E A;  2KDE B;  2KTR B;  3QAR A;  3VDZ A;  3M63 B;  4KIK A;  2IYD B;  2MBQ A;  4IC7 B;  4E3C A;  3DQV A;  5GMV A;  2LGD A;  5J17 A;  4IM0 A;  3I3T B;  4KV2 A;  4ZYN A;  1E7V A;  4HCN B;  1RAX A;  2YVC A;  3O65 B;  3HIZ A;  4MDK E;  4BKS D;  1YX5 B;  2N9X A;  2ZJD A;  4DDG D;  2NR2 A;  2DYO A;  3AI5 A;  3MHS D;  4HLE A;  4JGH B;  4G0N B;  4LJO B;  4ANX A;  1ZGU B;  3RD2 A;  2KZR A;  1V80 A;  1WMH A;  4JQW C;  4NQL B;  3KVF B;  4IWP A;  4B9K A;  2D11 A;  4A3O A;  2CU1 A;  1J8C A;  3DVG Y;  3WAM A;  2FCQ A;  4KSK C;  5E6P A;  2KFK B;  1CMX B;  2AWT A;  3W1S C;  3VTV A;  2IO2 B;  2JPH A;  2PE6 B;  4DHJ B;  2REX A;  1FXT B;  1GG3 A;  4B6W A;  3EFU A;  1I35 A;  3W1Y A;  2B3A A;  1S1Q B;  3H1U A;  3APD A;  1P98 A;  2KXJ A;  1TGZ B;  1KM7 A;  4YL8 A;  1X1M A;  1GC7 A;  3V62 A;  1WX8 A;  4ICU A;  4PS8 A;  3HM6 X;  3PRE A;  5CHF A;  2KWU B;  2C9W B;  5E6N A;  3QK0 A;  1RRB A;  3QAQ A;  4AJW A;  4KZ0 A;  1L2N A;  4AUQ C;  3L54 A;  5AEK B;  3DVG X;  3T9L A;  2K8C A;  3S2A A;  1WGH A;  4W9J A;  3PTF C;  1SIF A;  2AYO B;  3V61 A;  1IYF A;  4ZRJ A;  1WGY A;  1Z2M A;  4MJS A;  2BYF A;  1J19 A;  5KHQ A;  3B0A A;  3DOW A;  2G4D B;  3VUX A;  2C7M B;  2JWZ A;  3BY4 B;  4EZK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...